1JT0A

Crystal structure of a cooperative qacr-dna complex
Total Genus 69
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
69
sequence length
188
structure length
188
Chain Sequence
NLKDKILGVAKELFIKNGYNATTTGEIVKLSESSKGNLYYHFKTKENLFLEILNIEESKWQEQWKKEQIKAKTNREKFYLYNELSLTTEYYYPLQNAIIEFYTEYYKTNSINEKMNKLENKYIDAYHVIFKEGNLNGEWSINDVNAVSKIAANAVNGIVTFTHEQNINERIKLMNKFSQIFLNGLSKH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords QACA operator
publication title Structural basis for cooperative DNA binding by two dimers of the multidrug-binding protein QacR.
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Transcription/dna
total genus 69
structure length 188
sequence length 188
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2001-08-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00440 TetR_N Bacterial regulatory proteins, tetR family
A PF08360 TetR_C_5 QacR-like protein, C-terminal region
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 1jt0A01
1.10.357.10 Mainly Alpha Orthogonal Bundle Tetracycline Repressor; domain 2 Tetracycline Repressor, domain 2 1jt0A02
4ABZA 1ZTRA 3G56A 1T33A 3HOZJ 2HXOA 1B72A 2LK2A 1BW5A 3JSJA 5IPAA 3W6VA 1Y1WJ 1BA5A 3VVXA 5M3MJ 3L1PA 3GTKJ 2CJJA 1H8AC 3GEUA 2K9SA 5C4YA 1IDZA 3AQSA 1I3QJ 5M5YJ 2XSDC 1AHDP 3RD3A 3S15J 3BT9A 1FTZA 4QSHA 1POGA 2DTZA 3S2HJ 3NARA 2GENA 3OSFA 1RETA 2CUFA 2Y31A 2LR8A 1WH7A 3K7AJ 4L5EA 3LSPA 2R92J 2M0CA 3BR0A 5EYRA 5EGOB 3BR3A 4XIDA 2IU5A 3CDLA 2ZB9A 4JKZA 3ANPA 2DA5A 1MH3A 3S14J 3PPBA 4V2FA 5EFYA 3H3VK 2R7ZJ 4DZPA 2D6YA 1A6IA 1WPKA 4W97A 2IBDA 3OSGA 1B8IA 3Q0VA 4IHWA 2JA7J 4FTHA 1Q1VA 3ON4A 2LTPA 3VW0A 2JK3A 2FJ1A 2YUSA 4QTRA 1ORKA 2ZCXA 2WB1N 5IYCJ 3COLA 5E3NA 1IG7A 3S5RA 4PXIA 1HCRA 3CMYA 1U9NA 2N8GA 5IYBJ 1GT0C 3SFIA 3BRUA 3MNLA 2ID6A 3RZDJ 5E3OA 4MLOA 3ZQIA 2XGCA 4X6AJ 3ZQCA 2QIBA 3EGQA 1AU7A 2JA8J 2HQ5A 2YU9J 3VPRA 3BNIA 5HBUA 2Y0SN 5EG0B 1QRYA 2NVXJ 2H8RA 9ANTA 3GTQJ 1JTYA 3BJBA 5CW8A 3M3YJ 4XRSG 4MFDA 2W53A 2GUHA 5FGLA 5FLVA 4G12A 4GCTA 2JWTA 5IP7J 2GFNA 1ETXA 1SFOJ 4UUSA 2E2JJ 5J1YA 3BCGA 3IH3A 1F43A 5IP6A 2NOGA 4XRSA 1YRNA 4IHXA 2YVEA 3CRJA 1WI3A 1T56A 3FK7A 1GV2A 3MKLA 2B63J 2HOTA 4NDLA 1ETKA 1Y1VJ 4FISA 1FTTA 1JT6A 1BJZA 1QVTA 1RKTA 2EZLA 3WHBA 4B1RA 4D7NA 3LSRA 3HOVJ 2LY9A 5GPAA 3PASA 4D5FA 3QKXA 3FISA 5F0HA 5FLMJ 2JMWA 4Y7NJ 2XPUA 2HYTA 1RKWA 3IH2A 3S1RJ 4BBRJ 5J3LA 3G1OA 1MBGA 3TP0A 3ZOBA 2NX4A 2DA2A 2ECBA 4UDSA 1WGXA 1TWAJ 2NP5A 5CXGA 3DEWA 3VUQA 2R5ZB 5DTDA 3BHQA 1JKRC 2RASA 3NXCA 3Q0UA 5EF6A 4I76A 1GV5A 1JJ8C 2L7MP 3QPSA 1ETVA 3GBGA 5EEAA 4D5CA 3KKDA 4YZEA 3HOXJ 4A3FJ 2HDDA 1WH5A 3LJLA 3A02A 4GFBA 3HBLA 2XDNA 3KZ9A 3BR1A 3TW6A 1U9OA 3GTJJ 3Q3SA 2XPVA 2CQQA 3G1LA 5F08A 2M8GX 4HKUA 2RAEA 3A01B 4M6VA 1R9TJ 2LP0A 2EQRA 1UMQA 1HOMA 3CWRA 2L7ZA 1P7IA 2E1OA 4NN1A 1JUPA 5K7FA 1HDDC 2XB0X 1IV6A 2WV1A 3DPJA 2DMTA 3GTOJ 2HI3A 4NELA 2K40A 4D7MA 2OI8A 5CXIA 1U8BA 3H0GJ 2NVQJ 2QWTA 4AYBN 4C3JJ 5EGOA 2E2IJ 5GPCA 2XGEA 1W0UA 5C44J 3TP3A 1OJLA 4A93J 3NPIA 4C3HJ 3HE0A 3LWJA 1HDPA 1PUFB 3HGGA 1Z77A 2ME6A 3GTLJ 1D5YA 1MSFC 3HDDA 3S2DJ 2D5VA 3I4NJ 3V78A 2EZKA 1UG2A 1ZK8A 2WAQN 2LD5A 2R0QC 5JLXA 3G1MA 4BXXJ 4BY1J 1RPWA 2G0EA 1FIPA 2DN0A 4MIMA 1JT0A 2E2HJ 3S17J 1E3OC 4JX6A 2AHQA 1X2NA 3O8GA 5IOYA 1AKHB 3NI7A 4ICHA 3JRCA 3S16J 5E3MA 2G3BA 3ZQLA 1NK2P 4V2GA 5EG0A 1UHSA 4GFKA 3VOKA 3HKZN 3K2AA 4S0HB 3B81A 3DCFA 3TW7A 4W1UA 2FD5A 2E19A 2HXIA 5FKLA 3ZQFA 3VW2A 3HOYJ 5EDNA 2OPTA 3F0CA 3B6AA 1TWHJ 4A3KJ 5IOZA 1MNMC 2V57A 1TWGJ 5D18A 2K9NA 4C3IJ 2ZOYA 3FIWA 3HEFA 1ZQ3P 4M3DA 2X48A 2FBQA 2COBA 2NVTJ 3B6CA 1FJLA 5F0FA 2M2EA 4AF5A 2NP3A 2CRGA 2DJNA 4CYCB 4ME9A 3BTJA 2M34A 2WGBA 2O7OA 3NRGA 2UXHA 2DMNA 3O60A 5H9TA 1IC8A 1FEXA 4GFLA 4JX5A 1ZGWA 1NK3P 5DS9A 3GTGJ 2LLKA 1UI5A 2DMPA 2DA1A 4DZJA 2OF7A 1UI6A 2G7SA 2R5YB 1VI0A 2NS8A 3C2BA 1ZKGA 4Y52J 1WCMJ 4JYKA 2R5ZA 3E7QA 5FKOA 5HSZA 2DG7A 2MGQA 3ON2A 3RKQA 1JKQC 2JN6A 1HF0A 3Q0WA 4A3EJ 1G2HA 5DAJA 2Y2ZA 1MSEC 4JX4A 1IJWC 2Y9YA 2AO9A 3JRAA 1ITYA 1VFCA 5IYDJ 1LFBA 3BR5A 1JKOC 1SGMA 2QOPA 1IUFA 5K7ZA 3RH2A 5K58A 4A3MJ 2ECCA 1GDTA 1MH4A 3RZOJ 5C4XJ 2F07A 4XK4A 2ZCMA 3MVPA 2MSYA 4UUTA 4DYCA 1JGGA 3A01A 3JRDA 2QCOA 3PO2J 2CU7A 2ELKA 4DYRA 3NAUA 3CCYA 3TEDA 2P81A 2Q24A 4MXMA 3GZIA 5M3FJ 2OERA 2HOAA 2HOSA 4MFEA 2XGDA 3VIBA 4XRMA 4GCKA 3HGYA 3GTMJ 2QF7A 5HAWA 3JRFA 2UXUA 3HTIA 1LE8B 5J1RA 3KKCA 1IDYA 3HOUJ 2X6OA 1SANA 2HYJA 3BG3A 3PM1A 2KDZA 5AQCA 5FJ8J 2UXPA 4RDUA 3AQTA 2L0KA 2NS7A 2EZIA 4A3IJ 4A3CJ 3JR9A 2UXIA 3UKGA 4J19A 5FHPA 3JRBA 1PUFA 3BG9A 2DA4A 1TWFJ 1NTCA 3RQIA 1XG1A 1DU6A 1BL0A 2EH3A 1CQTA 2ME0A 3KNWA 5J1UA 2PMZN 3G7RA 2X9DA 1RESA 1ENHA 3HM5A 2CUEA 5JLWA 1AKHA 1GVDA 2HKUA 1U78A 2YS9A 4A3DJ 4FCYA 3LNQA 1LFUP 3S1QJ 1F36A 3BTLA 5FKNA 4I6ZA 3LSGA 3HOWJ 4A3BJ 3JRIA 3VVZA 3CQZJ 5E3LA 3ZQGA 4C2MJ 1XC5A 1ETQA 5BNGA 1IGNA 4BKXA 4DYQA 4CGRA 4M3FA 4IHVA 2DA6A 3I4MJ 3T6NA 3PO3J 2ZCNA 1DU0A 5IP9J 4MO7A 2Y30A 4QIWN 1X58A 4LOCA 1B72B 1IRZA 3IUVA 2UXOA 3A03A 4CYCA 2IAIA 3JRHA 4JL3A 1MBEA 2O9LA 2XPWA 2DA3A 3LSJA 5F0CA 2PZ9A 2CQXA 2VUMJ 1TWCJ 1JTXA 5FKMA 2YVHA 4A69C 1ETYA 3BG5A 4XICA 2GM4A 3FKIJ 5EZGA 3S1MJ 1MBHA 1OCTC 2L9RA 3HTJA 2QKOA 2W48A 3BTIA 4RBOA 1MBFA 5FMPA 2G7LA 2R5YA 3OOUA 1GUUA 3CJDA 2IEKA 1HLVA 3C07A 5C4JJ 2LKXA 3BTCA 2H1KA 2JA6J 1P7JA 3V6GA 4HNVA 3D1NI 3GTPJ 4M3BA 1K61A 2REKA 4FE4A 4X1EA 2PBXA 1B8IB 3HTAA 2GBYA 3WHCA 2NVYJ 1H89C 3FRQA 1APLC 2VPRA 3HB9A 3QPLA 2FX0A 3BR6A 5FKKA 3JREA 2EZHA 2LVSA 4JP0A 2FQ4A 2MW8A 2VKEA 3VP5A 4AUXA 3BQYA 4IHYA 5EZHA 3QQAA 3VOXA 2EBIA 3IH4A 4GCLA 3BR2A 3SJMA 2TCTA 5C3EJ 4A3JJ 4MK6A 1H88C 1JUMA 1ETWA 1ETOA 1X2MA 2L7FP 3LOCA 3NNRA 1I50J 4EEFG 3S1NJ 3FK6A 1JJ6C 2G7GA 1VF9A 2LFBA 3F1BA 3OIOA 1JKPC 2VKVA 3M4OJ 5M5WJ 4A3LJ 1MBJA 1MBKA 1LE8A 1ZR2A 1Z0XA 2GLOA 4FE7A 3JRGA 2ID3A 4BY7J 2KT0A 1XS9A 2MG4A 1BW6A 4B4CA 2DG8A 4UUSB 1O4XA 4M3EA 1QPIA 3HTHA 1I6HJ 1FIAA 2K9QA 5M5XJ 1TC3C 1YRNB 2JA5J 3LHQA 5D19A 5F04A 4AC6A 1S7EA 3BQZA 5K7HA 2VI6A 3HIMA 2JJ7A 4BBSJ 2DMUA 4ACIA 5HODA 2O7TA 3ZQHA 1OCPA 3EUPA 2XRLA 4DW6A 2QTQA 3QBMA 3VW1A 1ZR4A 2R93J 5D1RA 3SDGA 4B3AA 2M9HA 2O8KA 1A5JA 4L62A 2DMQA 3ANGA 5GP9A 5F1JA 1QVUA 1RR7A 2I10A 2RHAA 4M3GA 2XB5A 1K83J 1OFCX 2DA7A 3O8HA 1W0TA 4JNNA 1EF4A 4A3GJ 5F27A 3P9TA 4AC0A 4KWAA 2TRTA 3MN2A 1JUSA 1VNDA 2ZOZA 3E7LA 3VVYA 3IV5A 2WUIA 2Y9ZA 4IEJA
chains in the Genus database with same CATH superfamily
4G7ZF 1T33A 3AL0C 3OS0A 3JAMK 4FT8A 3JSJA 1MNDA 5IPAA 1BA5A 5HDKA 3VVXA 2CJJA 3HYIA 1H8AC 3AFHA 3I58A 3MZ8A 1B59A 2K3PA 1X4PA 4IRHA 2XF6A 2Y69H 5M5YJ 4XOTA 1WJFA 1AHDP 1X3WB 3UNGC 4XLFA 3AL0B 1KYWA 3S15J 2BEOA 1F9NA 4QSHA 1FTZA 1CF7A 3C7JA 5LRSA 3IWFA 1TW2A 3OYDA 3RYRA 3QPHA 3GUDA 1XCVA 4BDZA 3HRMA 2R92J 2LH9A 1KU9A 1WJAA 3CJRB 4U0VA 2LNBA 2W82A 1X19A 2QVOA 2VIXA 3K4CA 1MH3A 1R1VA 2OTLI 3WTZA 3CCLI 2L02A 3H3VK 5EFYA 3VOKA 4W97A 2IBDA 1B8IA 4IHWA 3OIPA 4E4HA 1EH6A 2RV8A 1H9TA 1ORKA 1RUNA 1IG7A 1MJAA 3OS1A 2DFEA 2PN6A 2OA4A 4HX7A 5CVVA 3MNLA 5E3OA 1IXRC 4V19K 4F92B 3EYIA 3H5AA 2ELHA 5K5OA 2DI3A 3VPRA 3VYUB 4F3QA 3F8FA 2A6HF 2P7VB 4Y4RA 5EG0B 1YITI 2OAZA 2M45A 2H8RA 2GIVA 2ISYA 4GXOA 3GTQJ 2HPMA 3FDYA 1E3HA 1JTYA 1MJBA 1PDNC 3MKZA 2Y0MA 3O2PE 2K02A 5FLVA 2GUHA 2JWTA 2XVCA 2BW3B 1MMDA 1Z7LA 3OYHA 1ZRDA 3BCGA 3IH3A 4YG2F 2VLAA 3GYHX 2E71A 5IP6A 2ZCWA 3SEZA 2EPFA 4XRSA 1FMWA 2V1XA 1T56A 1GV2A 3LSMA 3MKLA 4OAYA 1LNWA 2HOTA 1ETKA 1I1GA 1Y1VJ 3K1NA 3PQKA 3LFUA 4FISA 3ZQQA 1BJZA 2VT2A 4EM1A 5FLXK 4B1RA 2B9SA 3KZZA 3HOVJ 2D1VA 4G6TB 3G2BA 4A5MA 4D0PA 2L54A 5F0HA 2QENA 2RNJA 2JMWA 3K0LA 5L3BA 2XPUA 5L3FA 2ACJA 3TL4X 2V79A 2DXIA 3GMEA 3S1RJ 4BBRJ 3SWHA 5J3LA 3OS2A 3V4GA 2ECBA 3MD2A 1WGXA 2R5ZB 2F4OB 5DTDA 4FETA 4DOZA 2L7MP 3WG9A 2W84A 4RA2A 1LFPA 4ENNA 3LJLA 3ZR8X 3A02A 2EA4A 3BR1A 1KYZA 3L2VA 3WTSC 3F8MA 3DEUA 3Q3SA 5HS9A 2DOAA 4BAYA 5DM7F 2M8GX 3QP6A 4MEYF 4CICA 5HLIA 4HSRA 3GXOA 1B4AA 4OINF 3RIRA 3ZMUA 1P7IA 2EFQA 1HOMA 1WRJA 4BU2A 3ECHA 4G6QA 2B3WA 1ZN2A 2BV6A 2DBBA 3P9IA 2EFWA 2OI8A 2PJRB 1K4SA 1IN7A 2XRNA 2NNNA 3H0GJ 2Y48A 1MMAA 2ZSHB 1ZG3A 1XMAA 2ZBKA 4RB2C 5GPCA 1U0JA 3K69A 4U9NA 3D5RC 1U5TA 3CUOA 1KZHA 2HOEA 3FZVA 3ERMA 4HQEA 2M3AA 1XMKA 2W1OA 2XGXA 1ZG5A 1S72I 1D5YA 3S2DJ 4O6JA 3R4KA 5HLHA 2LF7A 2LBFA 5EJCA 1R5HA 4J01A 2EV6A 4G6DA 1U6GA 4PJJA 3NS4A 3HHGA 2O8XA 4L9VA 2G0EA 3NRVA 1LVAA 4HDUA 1FIPA 2DN0A 1JT0A 4DBQA 5LBQA 1E3OC 4IO9F 2FUG2 2KISA 4JX6A 5DEQA 2P7CB 5IOYA 2FU4A 1AKHB 3NI7A 4IF4A 1T8IA 4ICHA 2ESHA 5E3MA 2NYXA 1KGSA 1J9IA 3DWLE 2K86A 3DP7A 4ZYHA 2IS4A 3HKZN 1YX3A 3K4KA 4S0HB 2I5UA 3B81A 2EFNA 2HS5A 5CPRB 4IRVA 2OPTA 3F0CA 3JSPA 1TWHJ 3RPUD 5IOZA 2PG4A 1TWGJ 4XLPF 2CV2A 2K9NA 4KT6A 2ZOYA 5KCMA 4CZZA 3WTUC 1Z3XA 3VSLA 2RVCA 2RN7A 1QO0D 2L7KA 3UR3C 4AF5A 1I39A 2NP3A 2DJNA 4CYCB 4ME9A 2A6TA 4Y3OA 2HDWA 2M4KA 3BTJA 4KIBA 2P5LC 2E1MC 2UXHA 3NRGA 5H9TA 5D8KB 2NRAC 4KYWA 1YW8A 5E8GA 1LPQA 3E6MA 2DFFA 4JX5A 4PFOA 3GX4X 2DT7B 1UI5A 2VQHA 2DMPA 2DA1A 2JTVA 2X6YA 1OCZH 5E1WA 3FXOA 1XMXA 4BQOA 3D5SC 5GADJ 3KYCB 3E0JB 4JQFA 4HF1A 3Q9SA 2BZTA 4Y52J 4RAFA 2NNYA 2J5PA 2EFPA 5FKOA 3QOPA 1BI0A 2HQNA 4XSXF 3DU5A 5FROA 2XKPA 3VB2A 1TQMA 4A3EJ 1TW3A 4I09A 3FBNB 2HZDA 3K2ZA 2DDBA 4BXUA 4E6KG 1LQ1A 2Y2ZA 1G2HA 3TBIA 1I6XA 2KIMA 3WTVC 3P7NA 1ITYA 1JXSA 2EIMH 1VFCA 4C2UA 3BR5A 4L9NA 2K9MA 1R7JA 3MCZA 1JKOC 5K7ZA 2QOPA 5J47A 3RZOJ 1ZELA 2LOOA 5DDGA 5C4XJ 2F07A 4XK4A 2MSYA 1UJ8A 3GFJA 4DYCA 5FB2A 2QSHX 3C2HA 3NAUA 3TEDA 2CSOA 2DPUA 2FQ3A 1UCRA 4ZYAA 1YG2A 3JTHA 2OERA 5CYVA 1VQLI 1DQUA 3VIBA 1QGPA 3PQJA 2QF7A 2EA2A 3W2AA 5HAWA 2TDXA 5KNLA 1J0RA 1LE8B 4RB1A 1UELB 4BUPA 2Y75A 3HOUJ 3KPHA 3DKWA 4FQGA 4U87A 1N75A 2HGCA 4LFUA 3Q5FA 1VQ5I 3AQTA 4NC8A 2BYVE 4XLNF 1OCRH 1T6SA 3S3OA 4J19A 2EV5A 2YX4A 3GO5A 3DQVC 1NTCA 2WB1A 4GYGA 4ANJA 4QWQA 3HKZA 4YIIA 4XLHA 1XG1A 3I71A 5B1BH 2EH3A 1BL0A 5TJJA 3E5UA 4I01A 4FASD 2DO7A 1BI1A 2CUEA 2IS6A 1ZYRF 2HKUA 3HOSA 3FXQA 2IRFG 5DCFA 4FCYA 4XL9A 3CO7C 2EILH 1LFUP 3NEUA 4M73A 1VQ6I 2XUBA 1G59A 4ESJA 1JE8A 2CFXA 3VVZA 2QKLB 3S8PA 3LQRA 1OYIA 4RGUA 2LREA 1Z05A 2RQPA 4Y15A 3RQ4A 1DU0A 3FXKA 1FOKA 2JSCA 4LLGF 2X6WA 3ZRGA 2KL4A 4I7HA 4HV6A 3SQNA 4CSWA 1WKMA 2DCEA 3SZGA 5JR3A 1Z67A 4C2TA 4LG3A 5FKMA 2VQLA 1MBHA 3F9KA 3E5XA 3QYBA 2WV0A 4K2EA 1OCTC 2BY0A 2L9RA 3IHUA 3SHFA 3HTJA 3BTIA 1MBFA 2G7LA 2V1UA 4BQAA 3OOUA 2XF7A 3K1PA 3CCEI 1OR7A 1GUUA 3IUOA 1T2KA 2P6SA 2IA2A 3V6GA 1P7JA 1JHHA 4HNVA 1ZG1A 5K5QA 2FF4A 4YIRX 1UFMA 3HPHA 4LGWA 5LD2C 5HDNA 5LEJA 2GBYA 4HLXA 3LA3A 3KYLA 1MJ9A 4BJTA 1J09A 2FX0A 2LVSA 2M4GA 3CJNA 3VP5A 4XOPA 5KAIC 3CUQC 4GCLA 3BR2A 3SJMA 4EJWA 4MK6A 3H9QA 1H88C 3GLXA 1ETWA 4EMSA 1SAXA 1I50J 3E6CC 4EEFG 3S1NJ 2A5YB 1JJ6C 4CCOA 1VF9A 3PIPF 2LFBA 2VKVA 2QBYA 3ZMDA 3CUQB 1X1AA 4MEXF 1V3FA 4PUSA 5M5WJ 4LG0B 1MBKA 2V9PA 4AYBA 3WGGA 2ZXWH 3LAPA 4BY7J 3BCBA 3KP5A 2PMUA 2CQNA 4B4CA 2BY3A 1WWXA 1XD7A 5F6FA 5E20A 4CUGA 3F8CA 1QPIA 3HHHA 3LSTA 4M9XA 1MMGA 1YRNB 1XSDA 4AC6A 1S7EA 3W2WA 2PX9A 3M1CA 3ZMVA 4P9UA 3J81K 2JJ7A 1YOVB 3DKYA 3AAFA 4BBSJ 1S29A 5J40A 2V6EA 1OCPA 1I5ZA 3CCRI 3EUPA 4DW6A 2R93J 3CP2A 3SDGA 5GTHC 3DLAA 1KQ0A 4L62A 3JAMZ 1D1AA 3RKWA 3O3KA 1BR4A 5F1RA 3LL7A 1FBQA 4XN3A 2KKOA 3U9GA 1QVUA 3DTEA 3PSIA 1O3TA 4U9LA 5CQEA 2KPMA 4RB0A 2RHAA 2DA7A 3O8HA 1TLHB 2BE5F 2QQAA 3IP4B 4KN4X 4TV7A 4XM3A 1MDMA 4XKBA 4A3GJ 3P9TA 2ZMEB 2HWVA 4NNJA 2KLOA 2DT5A 2TRTA 4J00A 2YX7A 1VNDA 4G8XA 3VVYA 3IV5A 3CD6I 2WUIA 2YVXA 5J6XA 1LB2A 1VQ8I 3PJRA 1F1ZA 1ZTRA 3G56A 2LK2A 4RGSA 1QNTA 3S2WA 1KQ9A 4L5JA 1FT9A 4UB8C 3L1PA 4WXCA 5C4YA 4KUMA 3ZN0A 3WTTC 1O3SA 3CF2A 1OLTA 6PAXA 1KQ8A 2D45A 5AIPA 3BG7A 2FRHA 3GF2A 2DTZA 1MIJA 2CUFA 4BEHB 2LR8A 2VBYA 4Y13A 1S5LC 2M0CA 4HBLA 2RGVA 3HXLA 3BR0A 5EYRA 2XKOA 2CW0F 5A2QK 3CDLA 4F52A 2ZB9A 3M8EA 4RM3A 2DA5A 3OYNA 1PP7U 1T38A 5LFAA 4V2FA 3BZKA 4DZPA 1IO2A 4B47A 1F4KA 1A6IA 4E7JA 4IQ4A 3Q0VA 2MLKA 2JA7J 2K3FA 1Q1VA 3VW0A 1K78A 2H6CA 2JK3A 4QTRA 5D5VB 3COLA 5E3NA 2KDOA 4OAZA 1U9NA 2WC2A 2OTJI 2NXNB 1SC7A 1FPQA 3GCMA 5D6EA 3SFIA 1GT0C 3BRUA 3CLQA 2ID6A 3RZDJ 5E17F 2E1NA 3ZP5A 3I4PA 4I99C 4BDYA 3ZQIA 2HYGD 2A68F 2OZ6A 3P9CA 4U7BA 2L4AA 3OYKA 2HQ5A 2JA8J 3DBRB 3BNIA 5LGNA 2LY1A 1QRYA 5E8IA 2BBYA 2M7BA 2W00A 4BS9A 1OYWA 4ASNA 3ZXSA 3M3YJ 4XBFA 4RAZA 2XSJC 2Q0OA 3CJTB 3OYGA 5CQGA 2GFNA 5IP7J 4MNUA 4EATA 3I0TA 2PFVA 1SFOJ 2WAFA 4UUSA 2NOJB 5CVJA 4CXFA 4BGDA 2CGPA 2L2OA 5J1YA 3DLLF 3MWMA 3BP8A 1F43A 3KLNA 3CRJA 1Z7UA 1G6NA 2NAZA 2RQQA 3OYBA 2B63J 2COMA 2RC4A 4NDLA 5L3GA 1ZGJA 3HSFA 4N9IA 1YJWI 1JT6A 3I59A 3IRRA 2EZLA 3KETA 3LSRA 4BACA 5L3CA 2PMZA 2W85A 3QODA 5GPAA 4DVYP 1QU3A 1FSEA 3FISA 5FLMJ 3P5JA 3KLOA 3X2QH 2VBXA 4HAMA 5HNHA 2HYTA 3IH2A 2DFHA 1MNEA 1RIOH 2QZ8A 1AWCA 2XDVA 3J7AY 4AVZA 1KA8A 3H36A 2EK5A 3CZ6A 4UDSA 3DEWA 3QP5A 1DPRA 2KRHA 2QWWA 2W57A 1JJ8C 2JUGA 3GBGA 1VQOI 3BZCA 3R61A 4P55A 2F6CA 1FNNA 1Y8QB 4G9YA 3K8PC 5B1AH 3FMSA 3KKDA 4KNYA 1T98A 2ZJ2A 3F8BA 4YZEA 2HDDA 1EA3A 3ABTA 4UVBA 3CC4I 4PK4A 5FD5A 1I27A 3EETA 3WTWC 1Z1DA 2V9VA 2H8WA 1J5YA 1W5CC 2XPVA 3ISPA 3CF5F 2CQQA 5BMZA 5IT9K 2HR3A 4UY8I 2RAEA 3CMMA 5F64A 3A01B 2LP0A 2FMLA 3K10A 2L7ZA 3KX2A 5GAEJ 2GQQA 3PUFA 1JUPA 4EM2A 4KIFA 2XB0X 2WV1A 1Y6IA 4KN7X 5HS7A 3GTOJ 4BE1A 2K40A 5LGTA 2PBIA 3EUHC 4IPAA 4D7MA 5CXIA 3GZNB 2UZKA 2QWTA 3LFKA 5D5WB 2P6TA 5EGOA 2ZJPF 3E3VA 5HOOA 5B3SH 1IN8A 1OJLA 2L9VA 2MD5A 3HE0A 3BZ6A 3LWJA 2BVMA 2GA1A 2Q2EB 3HGGA 1Z77A 2STWA 3W2VA 3HDDA 2D5VA 2XASA 1Z3YA 4HF2A 3I4NJ 1KU7A 1ZK8A 3P9KA 3ABKH 1A31A 4Y17A 4GCVA 2R0QC 5JLXA 4BXXJ 1SD4A 5HVQC 3FBIB 4MIMA 2E2HJ 3S17J 2AHQA 5J4YA 3O8GA 1B9NA 3ZQ7A 3HIFA 3H9JA 3KP2A 4X0GA 4H0EA 2BXYA 4ENMA 5FFZA 4XLCA 1IN6A 3L2QA 2G3BA 1NK2P 1XGOA 5FFXA 2E5NA 4GFKA 1YIJI 3VOEA 2DU9A 3KP6A 1FMVA 2FD5A 2E19A 3VW2A 3QRFF 1FBSA 3T8TA 3V8KA 2F48A 3H0DA 5D18A 2P5KA 3VYTB 2V1DA 2ICWG 1FSHA 3CMAI 2W25A 4M3DA 3FMQA 2FBQA 2CW7A 4CHUA 2CQKA 3B6CA 1FJLA 2ZNZA 2M2EA 2ZFUA 5F0FA 1FYMA 2CRGA 4IOCF 2M87A 2KQRA 1SD7A 4B48A 2M34A 3I3LA 3M9AA 1IC8A 1FEXA 2GOXB 2G9WA 4CCLA 4M9ZA 3TDZC 1ZGWA 1NK3P 3GTGJ 1WHUA 2G7HA 2VODA 1RNLA 2LLKA 2MFZA 3HZJA 4DZJA 2ETHA 5JFRA 2PQ8A 1T08B 1R71A 4E7IA 4IX7A 1L3LA 2GIZA 1ZKGA 3CC7I 3PFIA 5DCMB 3CCQI 3H5NA 5E18F 3RKQA 2OU2A 4PSXA 2JN6A 3N97A 1HF0A 1D3YA 2Q8KA 4CZCA 4RGXA 4NB5A 1IJWC 2Y9YA 2AO9A 2K4JA 3T1BA 2LYCA 2ADUA 3IL2A 1FY7A 3OL4A 3RH2A 4A3MJ 2KRCA 1MH4A 3PUBA 3BROA 1UG0A 4XORA 3IWZA 4BNCA 5HLTA 1W7PA 3QWLA 4UUTA 5HS8A 1BM9A 1S7OA 3GLLA 2HNHA 2FEZA 1ZARA 2CU7A 2ELKA 3H35A 1BN5A 4DGWB 2F4IA 2Q24A 3GZIA 5M3FJ 1SFKA 2H09A 3F22A 4GCKA 3HSEA 4P1WA 1N25A 3KE2A 3M07A 3QYFA 2F5DA 1IW7F 4WX9A 3KKCA 1IDYA 3E5QA 4XKCA 4I0BA 4NC7A 4L5IA 3CCMI 1ZH5A 2X6OA 5AQCA 5H2FC 2D2WA 3ZMSA 2L0KA 4A3IJ 3WU1B 3JR9A 2UXIA 1Y39A 1SEUA 1HXDA 4EM0B 4NBQA 1PUFA 1FLIA 2YPRA 2VASA 1VQKI 2A61A 2DK8A 3RQIA 1V5GA 1U8RA 2O6GE 4PFPA 2HYFA 1CQTA 3KNWA 2GAUA 2QYOA 2Z1DA 5J1UA 3HTSB 2IGMA 2EJRA 4PJLA 3HM5A 5BOXA 3CCVI 4M6YA 2YS9A 4RM2A 5B5EC 1J2XA 1Y0UA 2HVQA 3S1QJ 2YU3A 3FXMA 5FKNA 1FZPB 4A3BJ 4A2UA 2EB7A 1RUOA 3S93A 3CQZJ 3FKJA 3T8RA 2DOEA 5E3LA 3ZQGA 1XC5A 4DYQA 4M72A 4CGRA 1NG6A 5CVRA 5D4RA 4IHVA 2DA6A 3PO3J 2W7NA 2CFOA 2HFHA 1EH8A 4MO7A 4NQWA 4EJVA 2ZXHA 1IRZA 2JA2A 1R1UA 1DUXC 2UXOA 1YTYA 3A03A 1O3QA 2VC1A 2IAIA 1ZAOA 5ICGA 1JGSA 2VXDA 4BH9A 4EJOA 3G6EI 2O9LA 4YFKF 1WSUA 5F0CA 2VUMJ 3A2KA 1JTXA 2YSRA 1R49A 2HVSA 4LJZF 5DM6F 4I02A 2R3SA 1NHAA 1GHCA 2WWYA 5BPDA 1CF7B 3BJAA 2X85A 4M6XA 2R5YA 2HVRA 1QHGA 1FC3A 2KHMA 2ZXJA 1D5VA 2KFDA 1WJDA 2CV0A 3LWFA 4LIUA 3BTCA 2H1KA 3IC7A 1K61A 3I54A 4I0AA 4HPQA 3LAJA 5LGUA 3A0BC 3J80K 4C9YA 1B8IB 3L9FA 5D5XB 4HX4A 5H20A 2E35A 3WHCA 2NVYJ 3QPLA 1F5TA 1NG7A 2EZHA 4JP0A 4IZZA 5IY5H 1X3ZB 4AUXA 2WADA 2XAJA 3HPGA 4XONA 5EZHA 4N4NB 1B1BA 4HQMA 4A3JJ 5LRRA 3R6SA 1ETOA 2L7FP 3N4MA 1ZLJA 2R7SA 1K6YA 3RKYA 3LOCA 2ZFWA 4ENJA 2ZY9A 3FK6A 2KIFA 5J8CA 3F1BA 3J81Z 3LSKA 2CW8A 1D0XA 1P4AA 2VJ4A 3TQNA 2KP6A 3AG3H 4FE7A 2ZNYA 1XS9A 3FX3A 3ABUA 1BW6A 3V8JA 2DK5A 3K4NA 2JVGA 2A2FX 4M3EA 4EGZA 3J7ZI 1WFXA 2IPQX 1FIAA 1Y56A 4PGHA 2JA5J 4ZDOA 1VQ9I 1LDDA 2JRMA 5KHDA 2VXZA 1YS6A 1XSVA 5K7HA 4CCMA 3HIMA 2O0YA 3DPTA 2WA0A 1IRFA 2DMUA 1RRJA 1T0FC 1SD6A 3FHNA 3RJPA 2IVMA 4PGGA 3VFZA 3VW1A 2AQEA 1TQPA 1OQYA 1YFHA 1VQ7I 5JHUA 2X0LA 3RCOA 5GP9A 5F1JA 1RR7A 2VQCA 2XAGA 4IXAA 4I2OA 1TNSA 1G3WA 1YX5A 2XB5A 2ELJA 4A0XA 4JNNA 1BJAA 1PVEA 1R36A 2X6XA 3HUGA 2FNPA 4AC0A 5CVIA 3TOBA 1JUSA 3TMOA 3COAC 2A6EF 2Y9ZA 2EIJH 2DT6A 2VBWA 4UV9A 3DF8A 2P5VA 1B72A 1BW5A 5M3MJ 2R7UA 4WWCA 1IXCA 4OD5A 2K9SA 3OY9A 3DTKA 4MHGA 4ZDPA 4PJ0C 2XSDC 3EYYA 3RD3A 3BC8A 1U5TC 1BOBA 1POGA 2KZGA 1FBUA 3OYCA 3CESA 3H92A 3S2HJ 3NARA 5H6QA 2GENA 4YELA 1RETA 1XGNA 2MC3A 3W3CA 4E7LA 3J7YJ 4WF2A 1MW7A 1WH7A 3K7AJ 4L5EA 3U1KA 5HLGA 2L3DA 3LSPA 4KJZA 2OUMA 2VONA 3TDUC 3CO6C 3DPLC 4XIDA 3I56I 4JKZA 5BPIA 1FOXA 1U5TB 3S14J 4YIFA 2O03A 3OSGA 4P96A 3ON4A 1R00A 2CUZA 4FTHA 2MBFA 2P8TA 1N77A 2LBFB 1Z9CA 1MD0A 2X1CA 3V7SA 5IYCJ 2ZCXA 3S5RA 1G4DA 3CMYA 3ZGKA 4F7ZA 2N8GA 1SFEA 3DV8A 5IYBJ 3L2WA 4X6AJ 3ZQCA 3GEZA 3EGQA 1AU7A 1EV7A 3DU6A 2HQRA 4MQVA 1USSA 4CCKA 1LJ9A 5HBUA 2Y0SN 1IXSB 1X1CA 3D5LA 3L2UA 1YW9A 2NVXJ 3E6BA 2CQ7A 4U0WA 5TRDA 3BJBA 1LEBA 2W53A 1UB9A 2D1HA 4G12A 3VODA 4GCTA 2EV0A 4CDGA 1WJBA 1PJRA 2M30A 3TO9A 4EGYA 3WGIA 1HQCA 2E2JJ 2EFOA 2WY8Q 2QGUA 3V7RA 3ERED 2ISZA 3RDIA 1GXPA 1XX5A 4IHXA 2YVEA 1WI3A 5LHGA 1EKEA 2OCEA 4HF0A 4KDPA 2F5FA 4AIHA 2R7DA 2XHKA 1RKTA 2BOLA 4WK8F 3KZYA 5L3DA 2VKDA 2M0MA 5KVRA 3PASA 1RR8C 3QKXA 2CUJA 4FX0A 4DNCA 4RMNA 4HNTA 4Z6YA 2DOFA 3IRQA 1R22A 1U3EM 3MQ0A 3G1OA 1MBGA 4LITA 2DDAA 3TP0A 3PNVA 3ZOBA 4UB6C 5D4SA 4ZYGA 2NX4A 2DA2A 5IT9Z 2LY2A 5CXGA 2NP5A 3VUQA 2IA0A 3MAJA 4D1QA 3VTIA 2RASA 2GXBA 3NXCA 3Q0UA 3E1SA 4I76A 1GV5A 4GDFA 2M8EA 1ETVA 2ESNA 2ZMEC 3HOXJ 4A3FJ 1WH5A 4GFBA 3HBLA 3KZ9A 3GVAA 4XR6A 1E0EA 1J59A 1U9OA 1OMIA 4UVCA 3L00A 4ZC3A 3OYEA 4XMYA 2DTRA 4AWXB 1Q1HA 4HKUA 1V55H 4M6VA 1D0ZA 4AM3A 4KICA 2MLGA 3CWRA 1BI2A 2E1OA 1P92A 3GWZA 3PIOF 2YR2A 4LIVA 4PJMA 1WVRA 3EUHA 2QEXI 1UHWA 2DMTA 2KZVA 3V42A 4NELA 2LKPA 4P9FA 1R23A 1U8BA 3HSRA 1S8NA 2NVQJ 2KJCA 2FXAA 1B6AA 4C3JJ 2E2IJ 2V9KA 3CJQB 4EVIA 2XGEA 1W0UA 4XKWA 5C44J 3TP3A 4KIGA 3NPIA 2R7WA 3MKYB 3PL8A 2QA4I 3BLYA 2WBMA 5ED4A 1DP3A 2K85A 2CYYA 2DYRH 2CV1A 3WE3A 2Y0SA 1P9QC 4I98B 1K7AA 5J4VA 3K6GA 5JI6A 3V78A 1P4XA 2ZXIA 2LD5A 3G1MA 2K4BA 3M8FA 5CJ9A 1X1DA 3F72A 3QAHA 4OWRB 1RPWA 4WXHA 3SZTA 2B1EA 2IJLA 1YI2I 5FRMA 1X2NA 2J5OA 3ONQA 4CGZA 4L0YB 4ZZLA 4V2GA 4IOAF 5EG0A 1MMSA 2GXGA 2HU9A 4W1UA 3RSNA 3TW7A 2HXIA 3U2RA 2QLZA 3ZQFA 2BXZA 4R79A 2JVHA 3HOYJ 5EDNA 2FOWA 2Q1ZB 3WTXC 1XDUA 1MZBA 2BW3A 1MNMC 3KEYA 3OYJA 1K6OA 3EUAA 4C3IJ 1ERDA 3FIWA 3HEFA 2ZKZA 5LHHA 2X48A 2QUFA 3R0AA 1IRGA 3QYEA 2E1CA 2BHZA 5FLXZ 3CCJI 3F6VA 3CCSI 1TP4A 2O7OA 3O60A 2OZUA 1O7LA 4ZYDA 1SVMA 4GFLA 1TQIA 3JCUC 4ITVA 1ACIA 2W4SA 2H94A 4CCJA 5L3EA 3KP7A 4BJ5C 1X3UA 2VBZA 1BOAA 5AONA 2LG4A 3FXRA 3LSHA 4R8HA 3W6JB 2G7SA 2O61A 1D0YA 1VQ4I 4XQFA 1YJNI 3WE2A 3F3XA 3KP3A 3C2BA 2GOMA 2KJBA 2CG4A 4JOMA 3MZHA 1WCMJ 2OQGA 2R5ZA 3S3NA 4A6DA 2R7XA 3H9GA 4EJTA 3ON2A 2M7AA 4QLCU 2RKHA 1JKQC 5DUIA 1FP1D 4B09A 1DGWY 3DPUA 3GFMA 2DJIA 2K7LA 1QHHD 3QU3A 4HZFA 5HDGA 5DAJA 1MSEC 4N4OB 2FA5A 4JX4A 3JRAA 3HG9A 4GGGA 3HRTA 1OCCH 5IYDJ 3L2RA 1LFBA 4LK0F 2LRDA 1R58A 2H1LA 1E3PA 2DQLA 2ECCA 1T39A 1SAUA 2ZCMA 3MVPA 1ZLKA 1JGGA 3JRDA 5DV5A 2PLYA 2DFIA 2X1EA 4DYRA 1N78A 4MXMA 1VZ0A 1Z6TA 4L0ZB 2FBIA 3BCAA 3OYAA 4BQNA 2HOAA 3H3ZA 2DW4A 2XGDA 1TL8A 4BL0B 4XRMA 3HGYA 4KA4A 2HZTA 1FYKA 2PI0A 2QBYB 3FMRA 4IL6C 3DBLB 3HTIA 3U1DA 5J1RA 4BHCA 3OYMA 2PJRA 3CTAA 4LD5A 2VOPA 1OPCA 1HKTA 3CP8A 4U7DA 1SANA 3BG3A 3PM1A 1GVJA 2KDZA 1ZRFA 1Z91A 1Y8RB 2HQAA 2EZIA 3GZ6A 1BR1A 2FBHA 3FXUA 4FX4A 3PSFA 5FHPA 4PJNA 3BG9A 1TWFJ 1S3JA 4PDKA 4PCQA 3PFYA 3RPUA 3L09A 1DU6A 3A0HC 3K9TA 3ASNH 1DGRM 4S05A 4L9TA 3PNTA 3NWSA 3G7RA 2X9DA 5DD8A 2WTEA 1ENHA 1SD5A 3JW4A 1AKHA 3CCUI 1YO5C 1U78A 4A3DJ 3SYTA 3BTLA 3BJ6A 4M71A 4I6ZA 3LA7A 3BJOA 4Q48A 1HA8A 2L9NA 4II2A 3KEOA 1OISA 1MDMB 5LHIA 2HTJA 5BNGA 1IGNA 4DJAA 3S3MA 4ENKA 1B9MA 2L01A 2KIQA 3BY6A 4LB6B 1XB4A 2FOKA 3DXJF 4HA8A 2Y30A 2Z3YA 1HW5A 3G3ZA 4NUBA 4LOCA 4RS8A 2IXSA 3J7AO 1ULYA 4Q5SF 3IUVA 1XGSA 2HTSA 4CYCA 4QPOA 4JL3A 1EJ9A 2XPWA 2DA3A 3N05A 4OIQF 3J80Z 1OYYA 3MZYA 4A5NA 2PZ9A 2CQXA 2AS5F 3ROUA 2YVHA 5EEGA 2F5VA 2O5RA 2GM4A 5ILSA 3L7WA 3VWBA 4B3XA 2IS1A 3V8LA 2QKOA 5ILVA 5FMPA 2M1BA 3BG6A 3R60A 1IRXA 2LKSA 2X1DA 2FBKA 2R4GA 4KITB 2IGKA 4XLAA 2LKXA 1W36C 4UHTA 1WZ2A 2I8DA 2BY2A 2JA6J 1R5ID 3GTPJ 4M3BA 3REOA 2FE3A 4FE4A 2OC6A 4L18B 1W5SA 1ZGAA 4CYDA 1IZ1A 5ICCA 3FRQA 1A6QA 5KK1A 1K78B 4OMYA 4ZH4F 1IN5A 3JREA 5GAHJ 2DYSH 4R1HA 4A6EA 4F55A 2JPCA 3E6DA 4YFNF 4IHYA 3QQAA 4ON0A 2EBIA 1GXQA 1QBJA 4G7OF 2R7RA 2OV7A 2FNAA 3WG7H 1JUMA 1XPXA 4KT5C 5GTIC 2MC4A 3L2CA 1R1TA 2L4MA 4OMZA 3RKXA 4LLNA 2G7GA 2FJI1 4JK1X 4D9JA 4YFXF 3DKXA 4ZTFA 2FSWA 4A3LJ 1WI9A 2R7QA 1RI7A 1LE8A 3K70C 5KAFC 1ZR2A 1Z0XA 1MKMA 1QQIA 1BC8C 1I3AA 3JRGA 2KT0A 1W36D 2MG4A 1TT0A 2DG8A 4UUSB 1O4XA 3KCCA 2CMPA 1M1EB 4IRGA 1I6HJ 1HC8A 3AG4H 2K9QA 5M5XJ 1TC3C 1PYVA 1R6RA 2HKXA 1YIOA 2O3FA 1TT5B 4BJ6C 1P2FA 3BQZA 2VI6A 1JI8A 1UZCA 3QPTA 1T0FA 1WJCA 2E36A 5ICFA 3I59B 4ACIA 4HLYA 2O7TA 3I64A 3VDXA 3ZQHA 3G4SI 3HOTA 3KP4A 3OR2C 2QTQA 2MABA 1ZR4A 5D1RA 2KMUA 2ZSIB 2GXAA 4B3AA 2M9HA 2O8KA 1WJEA 1A5JA 3ESWB 3S32A 2P4WA 1TTYA 1G8XA 2UUZA 3ANGA 3ML6A 3OV8A 3VEPA 3DTIA 3SXYA 1ONVA 1PP8F 2IA1A 4L9JA 1KU3A 4S04A 1HW1A 3V7CA 1W0TA 3K70D 4M74A 3MN2A 1LKXA 4JBAA 3FXJA 3E7LA 3M7GA 2XC7A 2I10A 4IEJA 4IVNA 4ABZA 3HOZJ 2RNGA 2HXOA 2VQGA 1A35A 3W6VA 1Y1WJ 3EDPA 2HKOA 3K4BA 3GTKJ 3GEUA 2H27A 1MGTA 4NC6A 2G7UA 1YS7A 1IDZA 3K4MA 2PJPA 3AQSA 3KYDB 1R4NB 1I3QJ 4E7KA 2XAHA 5AIQA 1O3RA 3CC2I 4UUVA 4OU0A 2R7OA 3BT9A 4RB3C 1BBYA 1J7KA 2CWEA 2Z99A 2MYSA 5EEHA 3OSFA 2Y31A 3KIOA 4OD4A 3VYRB 4BXFA 1P4WA 1YJ9I 4O3MA 3HRSA 2K9LA 5EGOB 3SEQA 1YE9A 3H3UA 3BR3A 2IU5A 4LB5A 1X1PA 3KEQA 3ANPA 2VPLA 3PPBA 2R7ZJ 3T5XA 2D6YA 3FHZA 1LVKA 1WPKA 2VKHA 2R7TA 4IHTA 2LTPA 2QSGX 2FJ1A 2YUSA 3FWEA 2WB1N 4YRVA 1I1SA 4PXIA 1V54H 2VJJA 1HCRA 3RTRA 3K4LA 4IQJA 1TZLA 4G94A 2JT1A 1U2WA 3DEEA 1OCOH 2ZO4A 4MLOA 2XGCA 2E34A 2QIBA 2GZWA 1ZRCA 1XSXA 2EWNA 3E97A 2YU9J 1E17A 3B02A 3AG1H 1Y0NA 3MEXA 3CUQA 3MKWB 9ANTA 4LG0A 5HNFA 3IKTA 4HYEA 1H0MA 5B66C 5CW8A 4XRSG 4MFDA 1XGMA 5FGLA 2K5CA 3MMYB 1XTAA 3SDBA 1KONA 3U21A 4BYYA 1FYLA 1ETXA 1TNTA 1IUYA 4O5VA 1D8JA 4RGRA 4RLQA 4B44A 2WAEA 3IAS2 4BQQA 4OOIA 4AVPA 3FF5A 3VSKA 4UVAA 3Q9VA 1T95A 2NOGA 5LEKA 4CH7A 1YRNA 2PMHA 3FK7A 1HBXG 2V26A 3D0SA 3WU0A 1S6LA 3G73A 1FTTA 1TBXA 2E1MB 4ETSA 1FOYA 1S9HA 2QQ8A 1QVTA 1BC7C 5D8LB 3WHBA 4D7NA 3OMYA 2P0WA 4QPQA 1Z21A 1CGPA 1XN7A 2BHYA 2LY9A 1PUEE 4D5FA 1L0OC 4GYIA 3HL2A 4Y7NJ 4ZZDA 1RKWA 1YLFA 3BPXA 1IN4A 3R0JA 2VJIA 1FWZA 3LA2A 1FOWA 1TWAJ 2V1NA 4AD9A 4ZJZA 3AG2H 4AIDA 2ZJQF 3BHQA 3ASOH 1JKRC 4XSZF 5EF6A 2JPBA 3QPSA 3HC7A 1AA7A 2ZMEA 5EEAA 1SFUA 4D5CA 3JSOA 3C1DA 4KMUX 2DPDA 2VT3A 3W6KB 2Z9OA 4UV8A 2XDNA 2OD5A 3HTUA 4RAGA 4GRIA 3TW6A 3GTJJ 1RC9A 3AKZA 4HRIA 3ZPLA 2XAUA 3G1LA 1ODDA 1W7PB 5F08A 3GFLA 1R9TJ 4ESBA 2EQRA 1UMQA 4OIOF 3F21A 2UXXA 4NN1A 4U0YA 1SVLA 1VQMI 3C3WA 5K7FA 1HDDC 4C2MA 3OIQA 1IV6A 1MMNA 3DPJA 2HI3A 5JHFA 4BEHA 2E7WA 2LMDA 3DFGA 5A2QZ 3IKVA 3CMEI 3NQOA 2A69F 4AYBN 5DYMA 1R4MB 2OCCH 4YEJA 3WODF 4N0BA 3OL3A 3HRUA 4HSTA 1SVOA 3JTGA 4A93J 4C3HJ 1W7PD 3F8NA 4IHSA 1G3TA 1HDPA 1W1WE 4IKFA 3A4CA 4Q47A 1PUFB 2ME6A 3GTLJ 1IV8A 1MSFC 2DODA 1QZZA 5FO5A 3MFKA 2EZKA 1UG2A 2PEXA 5J8FA 2WAQN 2V4JC 5IT3A 4M9SA 3NWTA 4DIQA 4BY1J 3ZCOA 2LSOA 4B43A 1E2XA 2ZJRF 2WY7Q 4HDVA 3B73A 3JRCA 3S16J 4NHJA 2Z5UA 3G71I 3ZQLA 3F23A 4A0YA 1HSJA 2PFBA 4U88A 1UHSA 3BPVA 4KMFA 1WJ5A 2KRFA 2QSFX 3K2AA 1QZYA 3DCFA 2MH9A 2IS2A 4KFCA 3GFIA 5FKLA 1X1BA 3OOPA 3C2GA 3M1EA 5CKTA 3B6AA 4A3KJ 2V57A 1AOYA 3K4JA 5TISC 3TO6A 2DQRA 1D1BA 4B8XA 1ZQ3P 1G3YA 2C6YA 1QPMA 3K1MA 2DLLA 4NQWB 4HOBA 2VL8A 3ULQB 2A05A 2COBA 3ABLH 4F93B 2Z33A 3LMMA 2IGOA 2NVTJ 2X4HA 1IF1A 1UHMA 4MTDA 3KFWX 2KIUA 2X51A 1BR2A 5ILUA 2WGBA 2DMNA 1GLNA 1DPUA 2CH0A 2F5CA 2GWRA 5JVTA 5DS9A 4KISA 2VOOA 1H9GA 3BWGA 3EUKL 2XROA 2OF7A 1UI6A 1FP2A 4BE0A 4N9HA 5FGMA 3SZPA 2R5YB 2MA3A 4E7SA 3RYPA 1VI0A 2NS8A 1OKRA 1BIAA 1ZHFA 2LC2A 4JYKA 3E7QA 5FD6A 2XAQA 2IP2A 1HSTA 5TGTA 3EPZA 4RAYA 4HW0A 5HSZA 2QM3A 2DG7A 2MGQA 1V5EA 2JRTA 3OYIA 3Q0WA 2STTA 2A3SA 3WU2C 4RLFA 3WTYC 4OIRF 4P5OA 4AIJA 1V4RA 4OIPF 4ZDLA 2HDCA 1SGMA 2E5ZA 1IUFA 1YQAA 2OJED 1ON1A 2VB6A 3QU6A 5K58A 1GDTA 4MGRA 1LDKB 3PO2J 3A01A 2QCOA 1LDJA 4BE2A 3CCYA 2P81A 2OQRA 3O6BB 5CVUA 4UNOA 2HOSA 4MFEA 5E79C 3WGHA 3CLOA 3GTMJ 3OWTA 2EINH 2L5QA 2F2EA 2RREA 4BHBA 4ZYEA 1J75A 3JRFA 2UXUA 1DDNA 2WAQA 1STZA 4Y33A 2JQ7A 4EQQA 2JSPA 1BI3A 2HYJA 3DBHB 5FJ8J 2UXPA 4RDUA 1HW2A 2NS7A 4A3CJ 1K79A 2JZYA 3UKGA 3TKYA 1D8KA 2F4MB 4LLLA 3I55I 1BIBA 2Q2EA 3VYSB 2DA4A 4A0ZA 3JRBA 3ZMZA 1VQNI 3IAM2 2VJ5A 4LK1F 2MD0A 3GZ5A 2UWMA 2R7VA 4A12A 1S7AA 1DP7P 3SFZA 1VQPI 1ON2A 2ME0A 5BS6A 4MQ9F 2H6BA 2PMZN 4E70A 3TOAA 1RESA 2XV4S 4ESFA 1C0WA 3ECOA 4HNUA 5JLWA 5D5UB 1GVDA 1W5TA 2HEOA 2A07F 3ZN1A 4HX8A 3I9V2 2B7EA 3LNQA 1SFXA 4LMYA 1F36A 2CS3A 4CO8A 3LSGA 3HOWJ 5K1YA 3JRIA 2EIKH 3TO7A 2IW5A 3CDIA 1V5FA 2K27A 4C2MJ 1FX7A 3HUGB 1ETQA 2IT0A 2BY1A 4BKXA 4M3FA 4EV0A 3I4MJ 3T6NA 2ZCNA 1O57A 4XNFA 5IP9J 2F5EA 2XAFA 5D6FA 2Z16A 3FXLA 2NS0A 1X4OA 3BDDA 4QIWN 1X58A 1B72B 3LSIA 4Z2YA 1SMTA 2VC0A 2VN2A 3JRHA 4CCNA 2M5WA 4HG2A 1MBEA 2VE8A 3I5UA 3LSJA 1TWCJ 4A69C 1ETYA 2RDPA 3BG5A 4XICA 1SMYF 1JHFA 2XF5A 3FKIJ 5EZGA 3S1MJ 3F6OA 2DAOA 5DUKA 1P6RA 4XKVA 4Q4ZF 2W48A 4RBOA 4E7HA 2ZC2A 1A36A 4CA0A 1D1CA 1RZ4A 3CJDA 2IEKA 2V6CA 3A1YA 1HLVA 3C07A 5DCMA 4IJAA 5C4JJ 4G7HF 1OR7C 1ZREA 2QQBA 3I53A 3D1NI 1YYVA 2OBPA 4E7ZA 2REKA 4H4KC 5ERIA 3BOQA 1K4TA 1G3SA 2UXNA 4X1EA 2PBXA 3HJEA 2V7FA 3HTAA 3H1CA 1H89C 1APLC 2AXLA 2VPRA 3QOEA 2E7XA 3HB9A 3BR6A 5FKKA 5CLSA 3C18A 3ELKA 2FQ4A 2MW8A 2VKEA 4IRIA 5E1XA 3BQYA 2AQFA 3VOXA 3FM5A 3IH4A 1HKQA 2TCTA 1XDSA 4DQ2A 5C3EJ 4HEA2 4ZTJA 2CO5A 3TGNA 1QZEA 3LQQA 1X2MA 2FMYA 4UXNA 4XLEA 4GO1A 3NNRA 5BQTA 4PZJA 2NVUB 1YW7A 3OIOA 2B0LA 3OYLA 1JKPC 5ICEA 2GA2A 3M4OJ 1LUJB 2R7FA 1MBJA 1WQ2A 4BHPA 4DBRA 4II3A 2GLOA 5JVGF 2ID3A 2MH2A 1USTA 3PNYA 2QQ9A 4HV5A 2A5WA 4WXDA 3ZMTA 3HTHA 1W4MA 2L9SA 4XRFA 3LHQA 1HKSA 1QA6A 5D19A 2BVLA 3OR1C 5E1ZB 2E60A 5F04A 1YHQI 2Z2SB 4XN0A 1VTNC 2IGNA 3M8JA 2W24A 4FHTA 1O7FA 1REPC 5HODA 3RPQA 1LEAA 4WCGA 5H6RA 2XRLA 1KU2A 3QBMA 2JUCA 5K5RA 1EH7A 5FRNA 4F91B 4EJUA 1IAWA 2DMQA 2LF8A 3T0YA 1A04A 2XIGA 1NH3A 2UV1A 4PSWA 3FM3A 2HPIA 1Z6RA 2QKMB 5DD4A 4M3GA 5LLQA 2VE9A 1K83J 1OFCX 3KZIC 1UAAA 1EF4A 5F27A 3ABMH 3OYFA 2BGCA 1XCBA 3H5RA 1R5GA 3RI4A 4MTEA 5GAGJ 4KWAA 2AXTC 2ZOZA 4AIKA 3CDHA 3EQLF 4C30A 4WIBA 2LDUA 3GW2A 4AU7A
chains in the Genus database with same CATH topology
4ABZA 1ZTRA 3G56A 1T33A 3HOZJ 2HXOA 1B72A 2LK2A 1BW5A 3JSJA 5IPAA 3W6VA 1Y1WJ 1BA5A 3VVXA 5M3MJ 3L1PA 3GTKJ 2CJJA 1H8AC 3GEUA 2K9SA 5C4YA 1IDZA 3AQSA 1I3QJ 5M5YJ 2XSDC 1AHDP 3RD3A 3S15J 3BT9A 1FTZA 4QSHA 1POGA 2DTZA 3S2HJ 3NARA 2GENA 3OSFA 1RETA 2CUFA 2Y31A 2LR8A 1WH7A 3K7AJ 4L5EA 3LSPA 2R92J 2M0CA 3BR0A 5EYRA 5EGOB 3BR3A 4XIDA 2IU5A 3CDLA 2ZB9A 4JKZA 3ANPA 2DA5A 1MH3A 3S14J 3PPBA 4V2FA 5EFYA 3H3VK 2R7ZJ 4DZPA 2D6YA 1A6IA 1WPKA 4W97A 2IBDA 3OSGA 1B8IA 3Q0VA 4IHWA 2JA7J 4FTHA 1Q1VA 3ON4A 2LTPA 3VW0A 2JK3A 2FJ1A 2YUSA 4QTRA 1ORKA 2ZCXA 2WB1N 5IYCJ 3COLA 5E3NA 1IG7A 3S5RA 4PXIA 1HCRA 3CMYA 1U9NA 2N8GA 5IYBJ 1GT0C 3SFIA 3BRUA 3MNLA 2ID6A 3RZDJ 5E3OA 4MLOA 3ZQIA 2XGCA 4X6AJ 3ZQCA 2QIBA 3EGQA 1AU7A 2JA8J 2HQ5A 2YU9J 3VPRA 3BNIA 5HBUA 2Y0SN 5EG0B 1QRYA 2NVXJ 2H8RA 9ANTA 3GTQJ 1JTYA 3BJBA 5CW8A 3M3YJ 4XRSG 4MFDA 2W53A 2GUHA 5FGLA 5FLVA 4G12A 4GCTA 2JWTA 5IP7J 2GFNA 1ETXA 1SFOJ 4UUSA 2E2JJ 5J1YA 3BCGA 3IH3A 1F43A 5IP6A 2NOGA 4XRSA 1YRNA 4IHXA 2YVEA 3CRJA 1WI3A 1T56A 3FK7A 1GV2A 3MKLA 2B63J 2HOTA 4NDLA 1ETKA 1Y1VJ 4FISA 1FTTA 1JT6A 1BJZA 1QVTA 1RKTA 2EZLA 3WHBA 4B1RA 4D7NA 3LSRA 3HOVJ 2LY9A 5GPAA 3PASA 4D5FA 3QKXA 3FISA 5F0HA 5FLMJ 2JMWA 4Y7NJ 2XPUA 2HYTA 1RKWA 3IH2A 3S1RJ 4BBRJ 5J3LA 3G1OA 1MBGA 3TP0A 3ZOBA 2NX4A 2DA2A 2ECBA 4UDSA 1WGXA 1TWAJ 2NP5A 5CXGA 3DEWA 3VUQA 2R5ZB 5DTDA 3BHQA 1JKRC 2RASA 3NXCA 3Q0UA 5EF6A 4I76A 1GV5A 1JJ8C 2L7MP 3QPSA 1ETVA 3GBGA 5EEAA 4D5CA 3KKDA 4YZEA 3HOXJ 4A3FJ 2HDDA 1WH5A 3LJLA 3A02A 4GFBA 3HBLA 2XDNA 3KZ9A 3BR1A 3TW6A 1U9OA 3GTJJ 3Q3SA 2XPVA 2CQQA 3G1LA 5F08A 2M8GX 4HKUA 2RAEA 3A01B 4M6VA 1R9TJ 2LP0A 2EQRA 1UMQA 1HOMA 3CWRA 2L7ZA 1P7IA 2E1OA 4NN1A 1JUPA 5K7FA 1HDDC 2XB0X 1IV6A 2WV1A 3DPJA 2DMTA 3GTOJ 2HI3A 4NELA 2K40A 4D7MA 2OI8A 5CXIA 1U8BA 3H0GJ 2NVQJ 2QWTA 4AYBN 4C3JJ 5EGOA 2E2IJ 5GPCA 2XGEA 1W0UA 5C44J 3TP3A 1OJLA 4A93J 3NPIA 4C3HJ 3HE0A 3LWJA 1HDPA 1PUFB 3HGGA 1Z77A 2ME6A 3GTLJ 1D5YA 1MSFC 3HDDA 3S2DJ 2D5VA 3I4NJ 3V78A 2EZKA 1UG2A 1ZK8A 2WAQN 2LD5A 2R0QC 5JLXA 3G1MA 4BXXJ 4BY1J 1RPWA 2G0EA 1FIPA 2DN0A 4MIMA 1JT0A 2E2HJ 3S17J 1E3OC 4JX6A 2AHQA 1X2NA 3O8GA 5IOYA 1AKHB 3NI7A 4ICHA 3JRCA 3S16J 5E3MA 2G3BA 3ZQLA 1NK2P 4V2GA 5EG0A 1UHSA 4GFKA 3VOKA 3HKZN 3K2AA 4S0HB 3B81A 3DCFA 3TW7A 4W1UA 2FD5A 2E19A 2HXIA 5FKLA 3ZQFA 3VW2A 3HOYJ 5EDNA 2OPTA 3F0CA 3B6AA 1TWHJ 4A3KJ 5IOZA 1MNMC 2V57A 1TWGJ 5D18A 2K9NA 4C3IJ 2ZOYA 3FIWA 3HEFA 1ZQ3P 4M3DA 2X48A 2FBQA 2COBA 2NVTJ 3B6CA 1FJLA 5F0FA 2M2EA 4AF5A 2NP3A 2CRGA 2DJNA 4CYCB 4ME9A 3BTJA 2M34A 2WGBA 2O7OA 3NRGA 2UXHA 2DMNA 3O60A 5H9TA 1IC8A 1FEXA 4GFLA 4JX5A 1ZGWA 1NK3P 5DS9A 3GTGJ 2LLKA 1UI5A 2DMPA 2DA1A 4DZJA 2OF7A 1UI6A 2G7SA 2R5YB 1VI0A 2NS8A 3C2BA 1ZKGA 4Y52J 1WCMJ 4JYKA 2R5ZA 3E7QA 5FKOA 5HSZA 2DG7A 2MGQA 3ON2A 3RKQA 1JKQC 2JN6A 1HF0A 3Q0WA 4A3EJ 1G2HA 5DAJA 2Y2ZA 1MSEC 4JX4A 1IJWC 2Y9YA 2AO9A 3JRAA 1ITYA 1VFCA 5IYDJ 1LFBA 3BR5A 1JKOC 1SGMA 2QOPA 1IUFA 5K7ZA 3RH2A 5K58A 4A3MJ 2ECCA 1GDTA 1MH4A 3RZOJ 5C4XJ 2F07A 4XK4A 2ZCMA 3MVPA 2MSYA 4UUTA 4DYCA 1JGGA 3A01A 3JRDA 2QCOA 3PO2J 2CU7A 2ELKA 4DYRA 3NAUA 3CCYA 3TEDA 2P81A 2Q24A 4MXMA 3GZIA 5M3FJ 2OERA 2HOAA 2HOSA 4MFEA 2XGDA 3VIBA 4XRMA 4GCKA 3HGYA 3GTMJ 2QF7A 5HAWA 3JRFA 2UXUA 3HTIA 1LE8B 5J1RA 3KKCA 1IDYA 3HOUJ 2X6OA 1SANA 2HYJA 3BG3A 3PM1A 2KDZA 5AQCA 5FJ8J 2UXPA 4RDUA 3AQTA 2L0KA 2NS7A 2EZIA 4A3IJ 4A3CJ 3JR9A 2UXIA 3UKGA 4J19A 5FHPA 3JRBA 1PUFA 3BG9A 2DA4A 1TWFJ 1NTCA 3RQIA 1XG1A 1DU6A 1BL0A 2EH3A 1CQTA 2ME0A 3KNWA 5J1UA 2PMZN 3G7RA 2X9DA 1RESA 1ENHA 3HM5A 2CUEA 5JLWA 1AKHA 1GVDA 2HKUA 1U78A 2YS9A 4A3DJ 4FCYA 3LNQA 1LFUP 3S1QJ 1F36A 3BTLA 5FKNA 4I6ZA 3LSGA 3HOWJ 4A3BJ 3JRIA 3VVZA 3CQZJ 5E3LA 3ZQGA 4C2MJ 1XC5A 1ETQA 5BNGA 1IGNA 4BKXA 4DYQA 4CGRA 4M3FA 4IHVA 2DA6A 3I4MJ 3T6NA 3PO3J 2ZCNA 1DU0A 5IP9J 4MO7A 2Y30A 4QIWN 1X58A 4LOCA 1B72B 1IRZA 3IUVA 2UXOA 3A03A 4CYCA 2IAIA 3JRHA 4JL3A 1MBEA 2O9LA 2XPWA 2DA3A 3LSJA 5F0CA 2PZ9A 2CQXA 2VUMJ 1TWCJ 1JTXA 5FKMA 2YVHA 4A69C 1ETYA 3BG5A 4XICA 2GM4A 3FKIJ 5EZGA 3S1MJ 1MBHA 1OCTC 2L9RA 3HTJA 2QKOA 2W48A 3BTIA 4RBOA 1MBFA 5FMPA 2G7LA 2R5YA 3OOUA 1GUUA 3CJDA 2IEKA 1HLVA 3C07A 5C4JJ 2LKXA 3BTCA 2H1KA 2JA6J 1P7JA 3V6GA 4HNVA 3D1NI 3GTPJ 4M3BA 1K61A 2REKA 4FE4A 4X1EA 2PBXA 1B8IB 3HTAA 2GBYA 3WHCA 2NVYJ 1H89C 3FRQA 1APLC 2VPRA 3HB9A 3QPLA 2FX0A 3BR6A 5FKKA 3JREA 2EZHA 2LVSA 4JP0A 2FQ4A 2MW8A 2VKEA 3VP5A 4AUXA 3BQYA 4IHYA 5EZHA 3QQAA 3VOXA 2EBIA 3IH4A 4GCLA 3BR2A 3SJMA 2TCTA 5C3EJ 4A3JJ 4MK6A 1H88C 1JUMA 1ETWA 1ETOA 1X2MA 2L7FP 3LOCA 3NNRA 1I50J 4EEFG 3S1NJ 3FK6A 1JJ6C 2G7GA 1VF9A 2LFBA 3F1BA 3OIOA 1JKPC 2VKVA 3M4OJ 5M5WJ 4A3LJ 1MBJA 1MBKA 1LE8A 1ZR2A 1Z0XA 2GLOA 4FE7A 3JRGA 2ID3A 4BY7J 2KT0A 1XS9A 2MG4A 1BW6A 4B4CA 2DG8A 4UUSB 1O4XA 4M3EA 1QPIA 3HTHA 1I6HJ 1FIAA 2K9QA 5M5XJ 1TC3C 1YRNB 2JA5J 3LHQA 5D19A 5F04A 4AC6A 1S7EA 3BQZA 5K7HA 2VI6A 3HIMA 2JJ7A 4BBSJ 2DMUA 4ACIA 5HODA 2O7TA 3ZQHA 1OCPA 3EUPA 2XRLA 4DW6A 2QTQA 3QBMA 3VW1A 1ZR4A 2R93J 5D1RA 3SDGA 4B3AA 2M9HA 2O8KA 1A5JA 4L62A 2DMQA 3ANGA 5GP9A 5F1JA 1QVUA 1RR7A 2I10A 2RHAA 4M3GA 2XB5A 1K83J 1OFCX 2DA7A 3O8HA 1W0TA 4JNNA 1EF4A 4A3GJ 5F27A 3P9TA 4AC0A 4KWAA 2TRTA 3MN2A 1JUSA 1VNDA 2ZOZA 3E7LA 3VVYA 3IV5A 2WUIA 2Y9ZA 4IEJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4ABZ A;  1ZTR A;  3G56 A;  1T33 A;  3HOZ J;  2HXO A;  1B72 A;  2LK2 A;  1BW5 A;  3JSJ A;  5IPA A;  3W6V A;  1Y1W J;  1BA5 A;  3VVX A;  5M3M J;  3L1P A;  3GTK J;  2CJJ A;  1H8A C;  3GEU A;  2K9S A;  5C4Y A;  1IDZ A;  3AQS A;  1I3Q J;  5M5Y J;  2XSD C;  1AHD P;  3RD3 A;  3S15 J;  3BT9 A;  1FTZ A;  4QSH A;  1POG A;  2DTZ A;  3S2H J;  3NAR A;  2GEN A;  3OSF A;  1RET A;  2CUF A;  2Y31 A;  2LR8 A;  1WH7 A;  3K7A J;  4L5E A;  3LSP A;  2R92 J;  2M0C A;  3BR0 A;  5EYR A;  5EGO B;  3BR3 A;  4XID A;  2IU5 A;  3CDL A;  2ZB9 A;  4JKZ A;  3ANP A;  2DA5 A;  1MH3 A;  3S14 J;  3PPB A;  4V2F A;  5EFY A;  3H3V K;  2R7Z J;  4DZP A;  2D6Y A;  1A6I A;  1WPK A;  4W97 A;  2IBD A;  3OSG A;  1B8I A;  3Q0V A;  4IHW A;  2JA7 J;  4FTH A;  1Q1V A;  3ON4 A;  2LTP A;  3VW0 A;  2JK3 A;  2FJ1 A;  2YUS A;  4QTR A;  1ORK A;  2ZCX A;  2WB1 N;  5IYC J;  3COL A;  5E3N A;  1IG7 A;  3S5R A;  4PXI A;  1HCR A;  3CMY A;  1U9N A;  2N8G A;  5IYB J;  1GT0 C;  3SFI A;  3BRU A;  3MNL A;  2ID6 A;  3RZD J;  5E3O A;  4MLO A;  3ZQI A;  2XGC A;  4X6A J;  3ZQC A;  2QIB A;  3EGQ A;  1AU7 A;  2JA8 J;  2HQ5 A;  2YU9 J;  3VPR A;  3BNI A;  5HBU A;  2Y0S N;  5EG0 B;  1QRY A;  2NVX J;  2H8R A;  9ANT A;  3GTQ J;  1JTY A;  3BJB A;  5CW8 A;  3M3Y J;  4XRS G;  4MFD A;  2W53 A;  2GUH A;  5FGL A;  5FLV A;  4G12 A;  4GCT A;  2JWT A;  5IP7 J;  2GFN A;  1ETX A;  1SFO J;  4UUS A;  2E2J J;  5J1Y A;  3BCG A;  3IH3 A;  1F43 A;  5IP6 A;  2NOG A;  4XRS A;  1YRN A;  4IHX A;  2YVE A;  3CRJ A;  1WI3 A;  1T56 A;  3FK7 A;  1GV2 A;  3MKL A;  2B63 J;  2HOT A;  4NDL A;  1ETK A;  1Y1V J;  4FIS A;  1FTT A;  1JT6 A;  1BJZ A;  1QVT A;  1RKT A;  2EZL A;  3WHB A;  4B1R A;  4D7N A;  3LSR A;  3HOV J;  2LY9 A;  5GPA A;  3PAS A;  4D5F A;  3QKX A;  3FIS A;  5F0H A;  5FLM J;  2JMW A;  4Y7N J;  2XPU A;  2HYT A;  1RKW A;  3IH2 A;  3S1R J;  4BBR J;  5J3L A;  3G1O A;  1MBG A;  3TP0 A;  3ZOB A;  2NX4 A;  2DA2 A;  2ECB A;  4UDS A;  1WGX A;  1TWA J;  2NP5 A;  5CXG A;  3DEW A;  3VUQ A;  2R5Z B;  5DTD A;  3BHQ A;  1JKR C;  2RAS A;  3NXC A;  3Q0U A;  5EF6 A;  4I76 A;  1GV5 A;  1JJ8 C;  2L7M P;  3QPS A;  1ETV A;  3GBG A;  5EEA A;  4D5C A;  3KKD A;  4YZE A;  3HOX J;  4A3F J;  2HDD A;  1WH5 A;  3LJL A;  3A02 A;  4GFB A;  3HBL A;  2XDN A;  3KZ9 A;  3BR1 A;  3TW6 A;  1U9O A;  3GTJ J;  3Q3S A;  2XPV A;  2CQQ A;  3G1L A;  5F08 A;  2M8G X;  4HKU A;  2RAE A;  3A01 B;  4M6V A;  1R9T J;  2LP0 A;  2EQR A;  1UMQ A;  1HOM A;  3CWR A;  2L7Z A;  1P7I A;  2E1O A;  4NN1 A;  1JUP A;  5K7F A;  1HDD C;  2XB0 X;  1IV6 A;  2WV1 A;  3DPJ A;  2DMT A;  3GTO J;  2HI3 A;  4NEL A;  2K40 A;  4D7M A;  2OI8 A;  5CXI A;  1U8B A;  3H0G J;  2NVQ J;  2QWT A;  4AYB N;  4C3J J;  5EGO A;  2E2I J;  5GPC A;  2XGE A;  1W0U A;  5C44 J;  3TP3 A;  1OJL A;  4A93 J;  3NPI A;  4C3H J;  3HE0 A;  3LWJ A;  1HDP A;  1PUF B;  3HGG A;  1Z77 A;  2ME6 A;  3GTL J;  1D5Y A;  1MSF C;  3HDD A;  3S2D J;  2D5V A;  3I4N J;  3V78 A;  2EZK A;  1UG2 A;  1ZK8 A;  2WAQ N;  2LD5 A;  2R0Q C;  5JLX A;  3G1M A;  4BXX J;  4BY1 J;  1RPW A;  2G0E A;  1FIP A;  2DN0 A;  4MIM A;  1JT0 A;  2E2H J;  3S17 J;  1E3O C;  4JX6 A;  2AHQ A;  1X2N A;  3O8G A;  5IOY A;  1AKH B;  3NI7 A;  4ICH A;  3JRC A;  3S16 J;  5E3M A;  2G3B A;  3ZQL A;  1NK2 P;  4V2G A;  5EG0 A;  1UHS A;  4GFK A;  3VOK A;  3HKZ N;  3K2A A;  4S0H B;  3B81 A;  3DCF A;  3TW7 A;  4W1U A;  2FD5 A;  2E19 A;  2HXI A;  5FKL A;  3ZQF A;  3VW2 A;  3HOY J;  5EDN A;  2OPT A;  3F0C A;  3B6A A;  1TWH J;  4A3K J;  5IOZ A;  1MNM C;  2V57 A;  1TWG J;  5D18 A;  2K9N A;  4C3I J;  2ZOY A;  3FIW A;  3HEF A;  1ZQ3 P;  4M3D A;  2X48 A;  2FBQ A;  2COB A;  2NVT J;  3B6C A;  1FJL A;  5F0F A;  2M2E A;  4AF5 A;  2NP3 A;  2CRG A;  2DJN A;  4CYC B;  4ME9 A;  3BTJ A;  2M34 A;  2WGB A;  2O7O A;  3NRG A;  2UXH A;  2DMN A;  3O60 A;  5H9T A;  1IC8 A;  1FEX A;  4GFL A;  4JX5 A;  1ZGW A;  1NK3 P;  5DS9 A;  3GTG J;  2LLK A;  1UI5 A;  2DMP A;  2DA1 A;  4DZJ A;  2OF7 A;  1UI6 A;  2G7S A;  2R5Y B;  1VI0 A;  2NS8 A;  3C2B A;  1ZKG A;  4Y52 J;  1WCM J;  4JYK A;  2R5Z A;  3E7Q A;  5FKO A;  5HSZ A;  2DG7 A;  2MGQ A;  3ON2 A;  3RKQ A;  1JKQ C;  2JN6 A;  1HF0 A;  3Q0W A;  4A3E J;  1G2H A;  5DAJ A;  2Y2Z A;  1MSE C;  4JX4 A;  1IJW C;  2Y9Y A;  2AO9 A;  3JRA A;  1ITY A;  1VFC A;  5IYD J;  1LFB A;  3BR5 A;  1JKO C;  1SGM A;  2QOP A;  1IUF A;  5K7Z A;  3RH2 A;  5K58 A;  4A3M J;  2ECC A;  1GDT A;  1MH4 A;  3RZO J;  5C4X J;  2F07 A;  4XK4 A;  2ZCM A;  3MVP A;  2MSY A;  4UUT A;  4DYC A;  1JGG A;  3A01 A;  3JRD A;  2QCO A;  3PO2 J;  2CU7 A;  2ELK A;  4DYR A;  3NAU A;  3CCY A;  3TED A;  2P81 A;  2Q24 A;  4MXM A;  3GZI A;  5M3F J;  2OER A;  2HOA A;  2HOS A;  4MFE A;  2XGD A;  3VIB A;  4XRM A;  4GCK A;  3HGY A;  3GTM J;  2QF7 A;  5HAW A;  3JRF A;  2UXU A;  3HTI A;  1LE8 B;  5J1R A;  3KKC A;  1IDY A;  3HOU J;  2X6O A;  1SAN A;  2HYJ A;  3BG3 A;  3PM1 A;  2KDZ A;  5AQC A;  5FJ8 J;  2UXP A;  4RDU A;  3AQT A;  2L0K A;  2NS7 A;  2EZI A;  4A3I J;  4A3C J;  3JR9 A;  2UXI A;  3UKG A;  4J19 A;  5FHP A;  3JRB A;  1PUF A;  3BG9 A;  2DA4 A;  1TWF J;  1NTC A;  3RQI A;  1XG1 A;  1DU6 A;  1BL0 A;  2EH3 A;  1CQT A;  2ME0 A;  3KNW A;  5J1U A;  2PMZ N;  3G7R A;  2X9D A;  1RES A;  1ENH A;  3HM5 A;  2CUE A;  5JLW A;  1AKH A;  1GVD A;  2HKU A;  1U78 A;  2YS9 A;  4A3D J;  4FCY A;  3LNQ A;  1LFU P;  3S1Q J;  1F36 A;  3BTL A;  5FKN A;  4I6Z A;  3LSG A;  3HOW J;  4A3B J;  3JRI A;  3VVZ A;  3CQZ J;  5E3L A;  3ZQG A;  4C2M J;  1XC5 A;  1ETQ A;  5BNG A;  1IGN A;  4BKX A;  4DYQ A;  4CGR A;  4M3F A;  4IHV A;  2DA6 A;  3I4M J;  3T6N A;  3PO3 J;  2ZCN A;  1DU0 A;  5IP9 J;  4MO7 A;  2Y30 A;  4QIW N;  1X58 A;  4LOC A;  1B72 B;  1IRZ A;  3IUV A;  2UXO A;  3A03 A;  4CYC A;  2IAI A;  3JRH A;  4JL3 A;  1MBE A;  2O9L A;  2XPW A;  2DA3 A;  3LSJ A;  5F0C A;  2PZ9 A;  2CQX A;  2VUM J;  1TWC J;  1JTX A;  5FKM A;  2YVH A;  4A69 C;  1ETY A;  3BG5 A;  4XIC A;  2GM4 A;  3FKI J;  5EZG A;  3S1M J;  1MBH A;  1OCT C;  2L9R A;  3HTJ A;  2QKO A;  2W48 A;  3BTI A;  4RBO A;  1MBF A;  5FMP A;  2G7L A;  2R5Y A;  3OOU A;  1GUU A;  3CJD A;  2IEK A;  1HLV A;  3C07 A;  5C4J J;  2LKX A;  3BTC A;  2H1K A;  2JA6 J;  1P7J A;  3V6G A;  4HNV A;  3D1N I;  3GTP J;  4M3B A;  1K61 A;  2REK A;  4FE4 A;  4X1E A;  2PBX A;  1B8I B;  3HTA A;  2GBY A;  3WHC A;  2NVY J;  1H89 C;  3FRQ A;  1APL C;  2VPR A;  3HB9 A;  3QPL A;  2FX0 A;  3BR6 A;  5FKK A;  3JRE A;  2EZH A;  2LVS A;  4JP0 A;  2FQ4 A;  2MW8 A;  2VKE A;  3VP5 A;  4AUX A;  3BQY A;  4IHY A;  5EZH A;  3QQA A;  3VOX A;  2EBI A;  3IH4 A;  4GCL A;  3BR2 A;  3SJM A;  2TCT A;  5C3E J;  4A3J J;  4MK6 A;  1H88 C;  1JUM A;  1ETW A;  1ETO A;  1X2M A;  2L7F P;  3LOC A;  3NNR A;  1I50 J;  4EEF G;  3S1N J;  3FK6 A;  1JJ6 C;  2G7G A;  1VF9 A;  2LFB A;  3F1B A;  3OIO A;  1JKP C;  2VKV A;  3M4O J;  5M5W J;  4A3L J;  1MBJ A;  1MBK A;  1LE8 A;  1ZR2 A;  1Z0X A;  2GLO A;  4FE7 A;  3JRG A;  2ID3 A;  4BY7 J;  2KT0 A;  1XS9 A;  2MG4 A;  1BW6 A;  4B4C A;  2DG8 A;  4UUS B;  1O4X A;  4M3E A;  1QPI A;  3HTH A;  1I6H J;  1FIA A;  2K9Q A;  5M5X J;  1TC3 C;  1YRN B;  2JA5 J;  3LHQ A;  5D19 A;  5F04 A;  4AC6 A;  1S7E A;  3BQZ A;  5K7H A;  2VI6 A;  3HIM A;  2JJ7 A;  4BBS J;  2DMU A;  4ACI A;  5HOD A;  2O7T A;  3ZQH A;  1OCP A;  3EUP A;  2XRL A;  4DW6 A;  2QTQ A;  3QBM A;  3VW1 A;  1ZR4 A;  2R93 J;  5D1R A;  3SDG A;  4B3A A;  2M9H A;  2O8K A;  1A5J A;  4L62 A;  2DMQ A;  3ANG A;  5GP9 A;  5F1J A;  1QVU A;  1RR7 A;  2I10 A;  2RHA A;  4M3G A;  2XB5 A;  1K83 J;  1OFC X;  2DA7 A;  3O8H A;  1W0T A;  4JNN A;  1EF4 A;  4A3G J;  5F27 A;  3P9T A;  4AC0 A;  4KWA A;  2TRT A;  3MN2 A;  1JUS A;  1VND A;  2ZOZ A;  3E7L A;  3VVY A;  3IV5 A;  2WUI A;  2Y9Z A;  4IEJ A; 
#chains in the Genus database with same CATH topology
 4G7Z F;  1T33 A;  3AL0 C;  3OS0 A;  3JAM K;  4FT8 A;  3JSJ A;  1MND A;  5IPA A;  1BA5 A;  5HDK A;  3VVX A;  2CJJ A;  3HYI A;  1H8A C;  3AFH A;  3I58 A;  3MZ8 A;  1B59 A;  2K3P A;  1X4P A;  4IRH A;  2XF6 A;  2Y69 H;  5M5Y J;  4XOT A;  1WJF A;  1AHD P;  1X3W B;  3UNG C;  4XLF A;  3AL0 B;  1KYW A;  3S15 J;  2BEO A;  1F9N A;  4QSH A;  1FTZ A;  1CF7 A;  3C7J A;  5LRS A;  3IWF A;  1TW2 A;  3OYD A;  3RYR A;  3QPH A;  3GUD A;  1XCV A;  4BDZ A;  3HRM A;  2R92 J;  2LH9 A;  1KU9 A;  1WJA A;  3CJR B;  4U0V A;  2LNB A;  2W82 A;  1X19 A;  2QVO A;  2VIX A;  3K4C A;  1MH3 A;  1R1V A;  2OTL I;  3WTZ A;  3CCL I;  2L02 A;  3H3V K;  5EFY A;  3VOK A;  4W97 A;  2IBD A;  1B8I A;  4IHW A;  3OIP A;  4E4H A;  1EH6 A;  2RV8 A;  1H9T A;  1ORK A;  1RUN A;  1IG7 A;  1MJA A;  3OS1 A;  2DFE A;  2PN6 A;  2OA4 A;  4HX7 A;  5CVV A;  3MNL A;  5E3O A;  1IXR C;  4V19 K;  4F92 B;  3EYI A;  3H5A A;  2ELH A;  5K5O A;  2DI3 A;  3VPR A;  3VYU B;  4F3Q A;  3F8F A;  2A6H F;  2P7V B;  4Y4R A;  5EG0 B;  1YIT I;  2OAZ A;  2M45 A;  2H8R A;  2GIV A;  2ISY A;  4GXO A;  3GTQ J;  2HPM A;  3FDY A;  1E3H A;  1JTY A;  1MJB A;  1PDN C;  3MKZ A;  2Y0M A;  3O2P E;  2K02 A;  5FLV A;  2GUH A;  2JWT A;  2XVC A;  2BW3 B;  1MMD A;  1Z7L A;  3OYH A;  1ZRD A;  3BCG A;  3IH3 A;  4YG2 F;  2VLA A;  3GYH X;  2E71 A;  5IP6 A;  2ZCW A;  3SEZ A;  2EPF A;  4XRS A;  1FMW A;  2V1X A;  1T56 A;  1GV2 A;  3LSM A;  3MKL A;  4OAY A;  1LNW A;  2HOT A;  1ETK A;  1I1G A;  1Y1V J;  3K1N A;  3PQK A;  3LFU A;  4FIS A;  3ZQQ A;  1BJZ A;  2VT2 A;  4EM1 A;  5FLX K;  4B1R A;  2B9S A;  3KZZ A;  3HOV J;  2D1V A;  4G6T B;  3G2B A;  4A5M A;  4D0P A;  2L54 A;  5F0H A;  2QEN A;  2RNJ A;  2JMW A;  3K0L A;  5L3B A;  2XPU A;  5L3F A;  2ACJ A;  3TL4 X;  2V79 A;  2DXI A;  3GME A;  3S1R J;  4BBR J;  3SWH A;  5J3L A;  3OS2 A;  3V4G A;  2ECB A;  3MD2 A;  1WGX A;  2R5Z B;  2F4O B;  5DTD A;  4FET A;  4DOZ A;  2L7M P;  3WG9 A;  2W84 A;  4RA2 A;  1LFP A;  4ENN A;  3LJL A;  3ZR8 X;  3A02 A;  2EA4 A;  3BR1 A;  1KYZ A;  3L2V A;  3WTS C;  3F8M A;  3DEU A;  3Q3S A;  5HS9 A;  2DOA A;  4BAY A;  5DM7 F;  2M8G X;  3QP6 A;  4MEY F;  4CIC A;  5HLI A;  4HSR A;  3GXO A;  1B4A A;  4OIN F;  3RIR A;  3ZMU A;  1P7I A;  2EFQ A;  1HOM A;  1WRJ A;  4BU2 A;  3ECH A;  4G6Q A;  2B3W A;  1ZN2 A;  2BV6 A;  2DBB A;  3P9I A;  2EFW A;  2OI8 A;  2PJR B;  1K4S A;  1IN7 A;  2XRN A;  2NNN A;  3H0G J;  2Y48 A;  1MMA A;  2ZSH B;  1ZG3 A;  1XMA A;  2ZBK A;  4RB2 C;  5GPC A;  1U0J A;  3K69 A;  4U9N A;  3D5R C;  1U5T A;  3CUO A;  1KZH A;  2HOE A;  3FZV A;  3ERM A;  4HQE A;  2M3A A;  1XMK A;  2W1O A;  2XGX A;  1ZG5 A;  1S72 I;  1D5Y A;  3S2D J;  4O6J A;  3R4K A;  5HLH A;  2LF7 A;  2LBF A;  5EJC A;  1R5H A;  4J01 A;  2EV6 A;  4G6D A;  1U6G A;  4PJJ A;  3NS4 A;  3HHG A;  2O8X A;  4L9V A;  2G0E A;  3NRV A;  1LVA A;  4HDU A;  1FIP A;  2DN0 A;  1JT0 A;  4DBQ A;  5LBQ A;  1E3O C;  4IO9 F;  2FUG 2;  2KIS A;  4JX6 A;  5DEQ A;  2P7C B;  5IOY A;  2FU4 A;  1AKH B;  3NI7 A;  4IF4 A;  1T8I A;  4ICH A;  2ESH A;  5E3M A;  2NYX A;  1KGS A;  1J9I A;  3DWL E;  2K86 A;  3DP7 A;  4ZYH A;  2IS4 A;  3HKZ N;  1YX3 A;  3K4K A;  4S0H B;  2I5U A;  3B81 A;  2EFN A;  2HS5 A;  5CPR B;  4IRV A;  2OPT A;  3F0C A;  3JSP A;  1TWH J;  3RPU D;  5IOZ A;  2PG4 A;  1TWG J;  4XLP F;  2CV2 A;  2K9N A;  4KT6 A;  2ZOY A;  5KCM A;  4CZZ A;  3WTU C;  1Z3X A;  3VSL A;  2RVC A;  2RN7 A;  1QO0 D;  2L7K A;  3UR3 C;  4AF5 A;  1I39 A;  2NP3 A;  2DJN A;  4CYC B;  4ME9 A;  2A6T A;  4Y3O A;  2HDW A;  2M4K A;  3BTJ A;  4KIB A;  2P5L C;  2E1M C;  2UXH A;  3NRG A;  5H9T A;  5D8K B;  2NRA C;  4KYW A;  1YW8 A;  5E8G A;  1LPQ A;  3E6M A;  2DFF A;  4JX5 A;  4PFO A;  3GX4 X;  2DT7 B;  1UI5 A;  2VQH A;  2DMP A;  2DA1 A;  2JTV A;  2X6Y A;  1OCZ H;  5E1W A;  3FXO A;  1XMX A;  4BQO A;  3D5S C;  5GAD J;  3KYC B;  3E0J B;  4JQF A;  4HF1 A;  3Q9S A;  2BZT A;  4Y52 J;  4RAF A;  2NNY A;  2J5P A;  2EFP A;  5FKO A;  3QOP A;  1BI0 A;  2HQN A;  4XSX F;  3DU5 A;  5FRO A;  2XKP A;  3VB2 A;  1TQM A;  4A3E J;  1TW3 A;  4I09 A;  3FBN B;  2HZD A;  3K2Z A;  2DDB A;  4BXU A;  4E6K G;  1LQ1 A;  2Y2Z A;  1G2H A;  3TBI A;  1I6X A;  2KIM A;  3WTV C;  3P7N A;  1ITY A;  1JXS A;  2EIM H;  1VFC A;  4C2U A;  3BR5 A;  4L9N A;  2K9M A;  1R7J A;  3MCZ A;  1JKO C;  5K7Z A;  2QOP A;  5J47 A;  3RZO J;  1ZEL A;  2LOO A;  5DDG A;  5C4X J;  2F07 A;  4XK4 A;  2MSY A;  1UJ8 A;  3GFJ A;  4DYC A;  5FB2 A;  2QSH X;  3C2H A;  3NAU A;  3TED A;  2CSO A;  2DPU A;  2FQ3 A;  1UCR A;  4ZYA A;  1YG2 A;  3JTH A;  2OER A;  5CYV A;  1VQL I;  1DQU A;  3VIB A;  1QGP A;  3PQJ A;  2QF7 A;  2EA2 A;  3W2A A;  5HAW A;  2TDX A;  5KNL A;  1J0R A;  1LE8 B;  4RB1 A;  1UEL B;  4BUP A;  2Y75 A;  3HOU J;  3KPH A;  3DKW A;  4FQG A;  4U87 A;  1N75 A;  2HGC A;  4LFU A;  3Q5F A;  1VQ5 I;  3AQT A;  4NC8 A;  2BYV E;  4XLN F;  1OCR H;  1T6S A;  3S3O A;  4J19 A;  2EV5 A;  2YX4 A;  3GO5 A;  3DQV C;  1NTC A;  2WB1 A;  4GYG A;  4ANJ A;  4QWQ A;  3HKZ A;  4YII A;  4XLH A;  1XG1 A;  3I71 A;  5B1B H;  2EH3 A;  1BL0 A;  5TJJ A;  3E5U A;  4I01 A;  4FAS D;  2DO7 A;  1BI1 A;  2CUE A;  2IS6 A;  1ZYR F;  2HKU A;  3HOS A;  3FXQ A;  2IRF G;  5DCF A;  4FCY A;  4XL9 A;  3CO7 C;  2EIL H;  1LFU P;  3NEU A;  4M73 A;  1VQ6 I;  2XUB A;  1G59 A;  4ESJ A;  1JE8 A;  2CFX A;  3VVZ A;  2QKL B;  3S8P A;  3LQR A;  1OYI A;  4RGU A;  2LRE A;  1Z05 A;  2RQP A;  4Y15 A;  3RQ4 A;  1DU0 A;  3FXK A;  1FOK A;  2JSC A;  4LLG F;  2X6W A;  3ZRG A;  2KL4 A;  4I7H A;  4HV6 A;  3SQN A;  4CSW A;  1WKM A;  2DCE A;  3SZG A;  5JR3 A;  1Z67 A;  4C2T A;  4LG3 A;  5FKM A;  2VQL A;  1MBH A;  3F9K A;  3E5X A;  3QYB A;  2WV0 A;  4K2E A;  1OCT C;  2BY0 A;  2L9R A;  3IHU A;  3SHF A;  3HTJ A;  3BTI A;  1MBF A;  2G7L A;  2V1U A;  4BQA A;  3OOU A;  2XF7 A;  3K1P A;  3CCE I;  1OR7 A;  1GUU A;  3IUO A;  1T2K A;  2P6S A;  2IA2 A;  3V6G A;  1P7J A;  1JHH A;  4HNV A;  1ZG1 A;  5K5Q A;  2FF4 A;  4YIR X;  1UFM A;  3HPH A;  4LGW A;  5LD2 C;  5HDN A;  5LEJ A;  2GBY A;  4HLX A;  3LA3 A;  3KYL A;  1MJ9 A;  4BJT A;  1J09 A;  2FX0 A;  2LVS A;  2M4G A;  3CJN A;  3VP5 A;  4XOP A;  5KAI C;  3CUQ C;  4GCL A;  3BR2 A;  3SJM A;  4EJW A;  4MK6 A;  3H9Q A;  1H88 C;  3GLX A;  1ETW A;  4EMS A;  1SAX A;  1I50 J;  3E6C C;  4EEF G;  3S1N J;  2A5Y B;  1JJ6 C;  4CCO A;  1VF9 A;  3PIP F;  2LFB A;  2VKV A;  2QBY A;  3ZMD A;  3CUQ B;  1X1A A;  4MEX F;  1V3F A;  4PUS A;  5M5W J;  4LG0 B;  1MBK A;  2V9P A;  4AYB A;  3WGG A;  2ZXW H;  3LAP A;  4BY7 J;  3BCB A;  3KP5 A;  2PMU A;  2CQN A;  4B4C A;  2BY3 A;  1WWX A;  1XD7 A;  5F6F A;  5E20 A;  4CUG A;  3F8C A;  1QPI A;  3HHH A;  3LST A;  4M9X A;  1MMG A;  1YRN B;  1XSD A;  4AC6 A;  1S7E A;  3W2W A;  2PX9 A;  3M1C A;  3ZMV A;  4P9U A;  3J81 K;  2JJ7 A;  1YOV B;  3DKY A;  3AAF A;  4BBS J;  1S29 A;  5J40 A;  2V6E A;  1OCP A;  1I5Z A;  3CCR I;  3EUP A;  4DW6 A;  2R93 J;  3CP2 A;  3SDG A;  5GTH C;  3DLA A;  1KQ0 A;  4L62 A;  3JAM Z;  1D1A A;  3RKW A;  3O3K A;  1BR4 A;  5F1R A;  3LL7 A;  1FBQ A;  4XN3 A;  2KKO A;  3U9G A;  1QVU A;  3DTE A;  3PSI A;  1O3T A;  4U9L A;  5CQE A;  2KPM A;  4RB0 A;  2RHA A;  2DA7 A;  3O8H A;  1TLH B;  2BE5 F;  2QQA A;  3IP4 B;  4KN4 X;  4TV7 A;  4XM3 A;  1MDM A;  4XKB A;  4A3G J;  3P9T A;  2ZME B;  2HWV A;  4NNJ A;  2KLO A;  2DT5 A;  2TRT A;  4J00 A;  2YX7 A;  1VND A;  4G8X A;  3VVY A;  3IV5 A;  3CD6 I;  2WUI A;  2YVX A;  5J6X A;  1LB2 A;  1VQ8 I;  3PJR A;  1F1Z A;  1ZTR A;  3G56 A;  2LK2 A;  4RGS A;  1QNT A;  3S2W A;  1KQ9 A;  4L5J A;  1FT9 A;  4UB8 C;  3L1P A;  4WXC A;  5C4Y A;  4KUM A;  3ZN0 A;  3WTT C;  1O3S A;  3CF2 A;  1OLT A;  6PAX A;  1KQ8 A;  2D45 A;  5AIP A;  3BG7 A;  2FRH A;  3GF2 A;  2DTZ A;  1MIJ A;  2CUF A;  4BEH B;  2LR8 A;  2VBY A;  4Y13 A;  1S5L C;  2M0C A;  4HBL A;  2RGV A;  3HXL A;  3BR0 A;  5EYR A;  2XKO A;  2CW0 F;  5A2Q K;  3CDL A;  4F52 A;  2ZB9 A;  3M8E A;  4RM3 A;  2DA5 A;  3OYN A;  1PP7 U;  1T38 A;  5LFA A;  4V2F A;  3BZK A;  4DZP A;  1IO2 A;  4B47 A;  1F4K A;  1A6I A;  4E7J A;  4IQ4 A;  3Q0V A;  2MLK A;  2JA7 J;  2K3F A;  1Q1V A;  3VW0 A;  1K78 A;  2H6C A;  2JK3 A;  4QTR A;  5D5V B;  3COL A;  5E3N A;  2KDO A;  4OAZ A;  1U9N A;  2WC2 A;  2OTJ I;  2NXN B;  1SC7 A;  1FPQ A;  3GCM A;  5D6E A;  3SFI A;  1GT0 C;  3BRU A;  3CLQ A;  2ID6 A;  3RZD J;  5E17 F;  2E1N A;  3ZP5 A;  3I4P A;  4I99 C;  4BDY A;  3ZQI A;  2HYG D;  2A68 F;  2OZ6 A;  3P9C A;  4U7B A;  2L4A A;  3OYK A;  2HQ5 A;  2JA8 J;  3DBR B;  3BNI A;  5LGN A;  2LY1 A;  1QRY A;  5E8I A;  2BBY A;  2M7B A;  2W00 A;  4BS9 A;  1OYW A;  4ASN A;  3ZXS A;  3M3Y J;  4XBF A;  4RAZ A;  2XSJ C;  2Q0O A;  3CJT B;  3OYG A;  5CQG A;  2GFN A;  5IP7 J;  4MNU A;  4EAT A;  3I0T A;  2PFV A;  1SFO J;  2WAF A;  4UUS A;  2NOJ B;  5CVJ A;  4CXF A;  4BGD A;  2CGP A;  2L2O A;  5J1Y A;  3DLL F;  3MWM A;  3BP8 A;  1F43 A;  3KLN A;  3CRJ A;  1Z7U A;  1G6N A;  2NAZ A;  2RQQ A;  3OYB A;  2B63 J;  2COM A;  2RC4 A;  4NDL A;  5L3G A;  1ZGJ A;  3HSF A;  4N9I A;  1YJW I;  1JT6 A;  3I59 A;  3IRR A;  2EZL A;  3KET A;  3LSR A;  4BAC A;  5L3C A;  2PMZ A;  2W85 A;  3QOD A;  5GPA A;  4DVY P;  1QU3 A;  1FSE A;  3FIS A;  5FLM J;  3P5J A;  3KLO A;  3X2Q H;  2VBX A;  4HAM A;  5HNH A;  2HYT A;  3IH2 A;  2DFH A;  1MNE A;  1RIO H;  2QZ8 A;  1AWC A;  2XDV A;  3J7A Y;  4AVZ A;  1KA8 A;  3H36 A;  2EK5 A;  3CZ6 A;  4UDS A;  3DEW A;  3QP5 A;  1DPR A;  2KRH A;  2QWW A;  2W57 A;  1JJ8 C;  2JUG A;  3GBG A;  1VQO I;  3BZC A;  3R61 A;  4P55 A;  2F6C A;  1FNN A;  1Y8Q B;  4G9Y A;  3K8P C;  5B1A H;  3FMS A;  3KKD A;  4KNY A;  1T98 A;  2ZJ2 A;  3F8B A;  4YZE A;  2HDD A;  1EA3 A;  3ABT A;  4UVB A;  3CC4 I;  4PK4 A;  5FD5 A;  1I27 A;  3EET A;  3WTW C;  1Z1D A;  2V9V A;  2H8W A;  1J5Y A;  1W5C C;  2XPV A;  3ISP A;  3CF5 F;  2CQQ A;  5BMZ A;  5IT9 K;  2HR3 A;  4UY8 I;  2RAE A;  3CMM A;  5F64 A;  3A01 B;  2LP0 A;  2FML A;  3K10 A;  2L7Z A;  3KX2 A;  5GAE J;  2GQQ A;  3PUF A;  1JUP A;  4EM2 A;  4KIF A;  2XB0 X;  2WV1 A;  1Y6I A;  4KN7 X;  5HS7 A;  3GTO J;  4BE1 A;  2K40 A;  5LGT A;  2PBI A;  3EUH C;  4IPA A;  4D7M A;  5CXI A;  3GZN B;  2UZK A;  2QWT A;  3LFK A;  5D5W B;  2P6T A;  5EGO A;  2ZJP F;  3E3V A;  5HOO A;  5B3S H;  1IN8 A;  1OJL A;  2L9V A;  2MD5 A;  3HE0 A;  3BZ6 A;  3LWJ A;  2BVM A;  2GA1 A;  2Q2E B;  3HGG A;  1Z77 A;  2STW A;  3W2V A;  3HDD A;  2D5V A;  2XAS A;  1Z3Y A;  4HF2 A;  3I4N J;  1KU7 A;  1ZK8 A;  3P9K A;  3ABK H;  1A31 A;  4Y17 A;  4GCV A;  2R0Q C;  5JLX A;  4BXX J;  1SD4 A;  5HVQ C;  3FBI B;  4MIM A;  2E2H J;  3S17 J;  2AHQ A;  5J4Y A;  3O8G A;  1B9N A;  3ZQ7 A;  3HIF A;  3H9J A;  3KP2 A;  4X0G A;  4H0E A;  2BXY A;  4ENM A;  5FFZ A;  4XLC A;  1IN6 A;  3L2Q A;  2G3B A;  1NK2 P;  1XGO A;  5FFX A;  2E5N A;  4GFK A;  1YIJ I;  3VOE A;  2DU9 A;  3KP6 A;  1FMV A;  2FD5 A;  2E19 A;  3VW2 A;  3QRF F;  1FBS A;  3T8T A;  3V8K A;  2F48 A;  3H0D A;  5D18 A;  2P5K A;  3VYT B;  2V1D A;  2ICW G;  1FSH A;  3CMA I;  2W25 A;  4M3D A;  3FMQ A;  2FBQ A;  2CW7 A;  4CHU A;  2CQK A;  3B6C A;  1FJL A;  2ZNZ A;  2M2E A;  2ZFU A;  5F0F A;  1FYM A;  2CRG A;  4IOC F;  2M87 A;  2KQR A;  1SD7 A;  4B48 A;  2M34 A;  3I3L A;  3M9A A;  1IC8 A;  1FEX A;  2GOX B;  2G9W A;  4CCL A;  4M9Z A;  3TDZ C;  1ZGW A;  1NK3 P;  3GTG J;  1WHU A;  2G7H A;  2VOD A;  1RNL A;  2LLK A;  2MFZ A;  3HZJ A;  4DZJ A;  2ETH A;  5JFR A;  2PQ8 A;  1T08 B;  1R71 A;  4E7I A;  4IX7 A;  1L3L A;  2GIZ A;  1ZKG A;  3CC7 I;  3PFI A;  5DCM B;  3CCQ I;  3H5N A;  5E18 F;  3RKQ A;  2OU2 A;  4PSX A;  2JN6 A;  3N97 A;  1HF0 A;  1D3Y A;  2Q8K A;  4CZC A;  4RGX A;  4NB5 A;  1IJW C;  2Y9Y A;  2AO9 A;  2K4J A;  3T1B A;  2LYC A;  2ADU A;  3IL2 A;  1FY7 A;  3OL4 A;  3RH2 A;  4A3M J;  2KRC A;  1MH4 A;  3PUB A;  3BRO A;  1UG0 A;  4XOR A;  3IWZ A;  4BNC A;  5HLT A;  1W7P A;  3QWL A;  4UUT A;  5HS8 A;  1BM9 A;  1S7O A;  3GLL A;  2HNH A;  2FEZ A;  1ZAR A;  2CU7 A;  2ELK A;  3H35 A;  1BN5 A;  4DGW B;  2F4I A;  2Q24 A;  3GZI A;  5M3F J;  1SFK A;  2H09 A;  3F22 A;  4GCK A;  3HSE A;  4P1W A;  1N25 A;  3KE2 A;  3M07 A;  3QYF A;  2F5D A;  1IW7 F;  4WX9 A;  3KKC A;  1IDY A;  3E5Q A;  4XKC A;  4I0B A;  4NC7 A;  4L5I A;  3CCM I;  1ZH5 A;  2X6O A;  5AQC A;  5H2F C;  2D2W A;  3ZMS A;  2L0K A;  4A3I J;  3WU1 B;  3JR9 A;  2UXI A;  1Y39 A;  1SEU A;  1HXD A;  4EM0 B;  4NBQ A;  1PUF A;  1FLI A;  2YPR A;  2VAS A;  1VQK I;  2A61 A;  2DK8 A;  3RQI A;  1V5G A;  1U8R A;  2O6G E;  4PFP A;  2HYF A;  1CQT A;  3KNW A;  2GAU A;  2QYO A;  2Z1D A;  5J1U A;  3HTS B;  2IGM A;  2EJR A;  4PJL A;  3HM5 A;  5BOX A;  3CCV I;  4M6Y A;  2YS9 A;  4RM2 A;  5B5E C;  1J2X A;  1Y0U A;  2HVQ A;  3S1Q J;  2YU3 A;  3FXM A;  5FKN A;  1FZP B;  4A3B J;  4A2U A;  2EB7 A;  1RUO A;  3S93 A;  3CQZ J;  3FKJ A;  3T8R A;  2DOE A;  5E3L A;  3ZQG A;  1XC5 A;  4DYQ A;  4M72 A;  4CGR A;  1NG6 A;  5CVR A;  5D4R A;  4IHV A;  2DA6 A;  3PO3 J;  2W7N A;  2CFO A;  2HFH A;  1EH8 A;  4MO7 A;  4NQW A;  4EJV A;  2ZXH A;  1IRZ A;  2JA2 A;  1R1U A;  1DUX C;  2UXO A;  1YTY A;  3A03 A;  1O3Q A;  2VC1 A;  2IAI A;  1ZAO A;  5ICG A;  1JGS A;  2VXD A;  4BH9 A;  4EJO A;  3G6E I;  2O9L A;  4YFK F;  1WSU A;  5F0C A;  2VUM J;  3A2K A;  1JTX A;  2YSR A;  1R49 A;  2HVS A;  4LJZ F;  5DM6 F;  4I02 A;  2R3S A;  1NHA A;  1GHC A;  2WWY A;  5BPD A;  1CF7 B;  3BJA A;  2X85 A;  4M6X A;  2R5Y A;  2HVR A;  1QHG A;  1FC3 A;  2KHM A;  2ZXJ A;  1D5V A;  2KFD A;  1WJD A;  2CV0 A;  3LWF A;  4LIU A;  3BTC A;  2H1K A;  3IC7 A;  1K61 A;  3I54 A;  4I0A A;  4HPQ A;  3LAJ A;  5LGU A;  3A0B C;  3J80 K;  4C9Y A;  1B8I B;  3L9F A;  5D5X B;  4HX4 A;  5H20 A;  2E35 A;  3WHC A;  2NVY J;  3QPL A;  1F5T A;  1NG7 A;  2EZH A;  4JP0 A;  4IZZ A;  5IY5 H;  1X3Z B;  4AUX A;  2WAD A;  2XAJ A;  3HPG A;  4XON A;  5EZH A;  4N4N B;  1B1B A;  4HQM A;  4A3J J;  5LRR A;  3R6S A;  1ETO A;  2L7F P;  3N4M A;  1ZLJ A;  2R7S A;  1K6Y A;  3RKY A;  3LOC A;  2ZFW A;  4ENJ A;  2ZY9 A;  3FK6 A;  2KIF A;  5J8C A;  3F1B A;  3J81 Z;  3LSK A;  2CW8 A;  1D0X A;  1P4A A;  2VJ4 A;  3TQN A;  2KP6 A;  3AG3 H;  4FE7 A;  2ZNY A;  1XS9 A;  3FX3 A;  3ABU A;  1BW6 A;  3V8J A;  2DK5 A;  3K4N A;  2JVG A;  2A2F X;  4M3E A;  4EGZ A;  3J7Z I;  1WFX A;  2IPQ X;  1FIA A;  1Y56 A;  4PGH A;  2JA5 J;  4ZDO A;  1VQ9 I;  1LDD A;  2JRM A;  5KHD A;  2VXZ A;  1YS6 A;  1XSV A;  5K7H A;  4CCM A;  3HIM A;  2O0Y A;  3DPT A;  2WA0 A;  1IRF A;  2DMU A;  1RRJ A;  1T0F C;  1SD6 A;  3FHN A;  3RJP A;  2IVM A;  4PGG A;  3VFZ A;  3VW1 A;  2AQE A;  1TQP A;  1OQY A;  1YFH A;  1VQ7 I;  5JHU A;  2X0L A;  3RCO A;  5GP9 A;  5F1J A;  1RR7 A;  2VQC A;  2XAG A;  4IXA A;  4I2O A;  1TNS A;  1G3W A;  1YX5 A;  2XB5 A;  2ELJ A;  4A0X A;  4JNN A;  1BJA A;  1PVE A;  1R36 A;  2X6X A;  3HUG A;  2FNP A;  4AC0 A;  5CVI A;  3TOB A;  1JUS A;  3TMO A;  3COA C;  2A6E F;  2Y9Z A;  2EIJ H;  2DT6 A;  2VBW A;  4UV9 A;  3DF8 A;  2P5V A;  1B72 A;  1BW5 A;  5M3M J;  2R7U A;  4WWC A;  1IXC A;  4OD5 A;  2K9S A;  3OY9 A;  3DTK A;  4MHG A;  4ZDP A;  4PJ0 C;  2XSD C;  3EYY A;  3RD3 A;  3BC8 A;  1U5T C;  1BOB A;  1POG A;  2KZG A;  1FBU A;  3OYC A;  3CES A;  3H92 A;  3S2H J;  3NAR A;  5H6Q A;  2GEN A;  4YEL A;  1RET A;  1XGN A;  2MC3 A;  3W3C A;  4E7L A;  3J7Y J;  4WF2 A;  1MW7 A;  1WH7 A;  3K7A J;  4L5E A;  3U1K A;  5HLG A;  2L3D A;  3LSP A;  4KJZ A;  2OUM A;  2VON A;  3TDU C;  3CO6 C;  3DPL C;  4XID A;  3I56 I;  4JKZ A;  5BPI A;  1FOX A;  1U5T B;  3S14 J;  4YIF A;  2O03 A;  3OSG A;  4P96 A;  3ON4 A;  1R00 A;  2CUZ A;  4FTH A;  2MBF A;  2P8T A;  1N77 A;  2LBF B;  1Z9C A;  1MD0 A;  2X1C A;  3V7S A;  5IYC J;  2ZCX A;  3S5R A;  1G4D A;  3CMY A;  3ZGK A;  4F7Z A;  2N8G A;  1SFE A;  3DV8 A;  5IYB J;  3L2W A;  4X6A J;  3ZQC A;  3GEZ A;  3EGQ A;  1AU7 A;  1EV7 A;  3DU6 A;  2HQR A;  4MQV A;  1USS A;  4CCK A;  1LJ9 A;  5HBU A;  2Y0S N;  1IXS B;  1X1C A;  3D5L A;  3L2U A;  1YW9 A;  2NVX J;  3E6B A;  2CQ7 A;  4U0W A;  5TRD A;  3BJB A;  1LEB A;  2W53 A;  1UB9 A;  2D1H A;  4G12 A;  3VOD A;  4GCT A;  2EV0 A;  4CDG A;  1WJB A;  1PJR A;  2M30 A;  3TO9 A;  4EGY A;  3WGI A;  1HQC A;  2E2J J;  2EFO A;  2WY8 Q;  2QGU A;  3V7R A;  3ERE D;  2ISZ A;  3RDI A;  1GXP A;  1XX5 A;  4IHX A;  2YVE A;  1WI3 A;  5LHG A;  1EKE A;  2OCE A;  4HF0 A;  4KDP A;  2F5F A;  4AIH A;  2R7D A;  2XHK A;  1RKT A;  2BOL A;  4WK8 F;  3KZY A;  5L3D A;  2VKD A;  2M0M A;  5KVR A;  3PAS A;  1RR8 C;  3QKX A;  2CUJ A;  4FX0 A;  4DNC A;  4RMN A;  4HNT A;  4Z6Y A;  2DOF A;  3IRQ A;  1R22 A;  1U3E M;  3MQ0 A;  3G1O A;  1MBG A;  4LIT A;  2DDA A;  3TP0 A;  3PNV A;  3ZOB A;  4UB6 C;  5D4S A;  4ZYG A;  2NX4 A;  2DA2 A;  5IT9 Z;  2LY2 A;  5CXG A;  2NP5 A;  3VUQ A;  2IA0 A;  3MAJ A;  4D1Q A;  3VTI A;  2RAS A;  2GXB A;  3NXC A;  3Q0U A;  3E1S A;  4I76 A;  1GV5 A;  4GDF A;  2M8E A;  1ETV A;  2ESN A;  2ZME C;  3HOX J;  4A3F J;  1WH5 A;  4GFB A;  3HBL A;  3KZ9 A;  3GVA A;  4XR6 A;  1E0E A;  1J59 A;  1U9O A;  1OMI A;  4UVC A;  3L00 A;  4ZC3 A;  3OYE A;  4XMY A;  2DTR A;  4AWX B;  1Q1H A;  4HKU A;  1V55 H;  4M6V A;  1D0Z A;  4AM3 A;  4KIC A;  2MLG A;  3CWR A;  1BI2 A;  2E1O A;  1P92 A;  3GWZ A;  3PIO F;  2YR2 A;  4LIV A;  4PJM A;  1WVR A;  3EUH A;  2QEX I;  1UHW A;  2DMT A;  2KZV A;  3V42 A;  4NEL A;  2LKP A;  4P9F A;  1R23 A;  1U8B A;  3HSR A;  1S8N A;  2NVQ J;  2KJC A;  2FXA A;  1B6A A;  4C3J J;  2E2I J;  2V9K A;  3CJQ B;  4EVI A;  2XGE A;  1W0U A;  4XKW A;  5C44 J;  3TP3 A;  4KIG A;  3NPI A;  2R7W A;  3MKY B;  3PL8 A;  2QA4 I;  3BLY A;  2WBM A;  5ED4 A;  1DP3 A;  2K85 A;  2CYY A;  2DYR H;  2CV1 A;  3WE3 A;  2Y0S A;  1P9Q C;  4I98 B;  1K7A A;  5J4V A;  3K6G A;  5JI6 A;  3V78 A;  1P4X A;  2ZXI A;  2LD5 A;  3G1M A;  2K4B A;  3M8F A;  5CJ9 A;  1X1D A;  3F72 A;  3QAH A;  4OWR B;  1RPW A;  4WXH A;  3SZT A;  2B1E A;  2IJL A;  1YI2 I;  5FRM A;  1X2N A;  2J5O A;  3ONQ A;  4CGZ A;  4L0Y B;  4ZZL A;  4V2G A;  4IOA F;  5EG0 A;  1MMS A;  2GXG A;  2HU9 A;  4W1U A;  3RSN A;  3TW7 A;  2HXI A;  3U2R A;  2QLZ A;  3ZQF A;  2BXZ A;  4R79 A;  2JVH A;  3HOY J;  5EDN A;  2FOW A;  2Q1Z B;  3WTX C;  1XDU A;  1MZB A;  2BW3 A;  1MNM C;  3KEY A;  3OYJ A;  1K6O A;  3EUA A;  4C3I J;  1ERD A;  3FIW A;  3HEF A;  2ZKZ A;  5LHH A;  2X48 A;  2QUF A;  3R0A A;  1IRG A;  3QYE A;  2E1C A;  2BHZ A;  5FLX Z;  3CCJ I;  3F6V A;  3CCS I;  1TP4 A;  2O7O A;  3O60 A;  2OZU A;  1O7L A;  4ZYD A;  1SVM A;  4GFL A;  1TQI A;  3JCU C;  4ITV A;  1ACI A;  2W4S A;  2H94 A;  4CCJ A;  5L3E A;  3KP7 A;  4BJ5 C;  1X3U A;  2VBZ A;  1BOA A;  5AON A;  2LG4 A;  3FXR A;  3LSH A;  4R8H A;  3W6J B;  2G7S A;  2O61 A;  1D0Y A;  1VQ4 I;  4XQF A;  1YJN I;  3WE2 A;  3F3X A;  3KP3 A;  3C2B A;  2GOM A;  2KJB A;  2CG4 A;  4JOM A;  3MZH A;  1WCM J;  2OQG A;  2R5Z A;  3S3N A;  4A6D A;  2R7X A;  3H9G A;  4EJT A;  3ON2 A;  2M7A A;  4QLC U;  2RKH A;  1JKQ C;  5DUI A;  1FP1 D;  4B09 A;  1DGW Y;  3DPU A;  3GFM A;  2DJI A;  2K7L A;  1QHH D;  3QU3 A;  4HZF A;  5HDG A;  5DAJ A;  1MSE C;  4N4O B;  2FA5 A;  4JX4 A;  3JRA A;  3HG9 A;  4GGG A;  3HRT A;  1OCC H;  5IYD J;  3L2R A;  1LFB A;  4LK0 F;  2LRD A;  1R58 A;  2H1L A;  1E3P A;  2DQL A;  2ECC A;  1T39 A;  1SAU A;  2ZCM A;  3MVP A;  1ZLK A;  1JGG A;  3JRD A;  5DV5 A;  2PLY A;  2DFI A;  2X1E A;  4DYR A;  1N78 A;  4MXM A;  1VZ0 A;  1Z6T A;  4L0Z B;  2FBI A;  3BCA A;  3OYA A;  4BQN A;  2HOA A;  3H3Z A;  2DW4 A;  2XGD A;  1TL8 A;  4BL0 B;  4XRM A;  3HGY A;  4KA4 A;  2HZT A;  1FYK A;  2PI0 A;  2QBY B;  3FMR A;  4IL6 C;  3DBL B;  3HTI A;  3U1D A;  5J1R A;  4BHC A;  3OYM A;  2PJR A;  3CTA A;  4LD5 A;  2VOP A;  1OPC A;  1HKT A;  3CP8 A;  4U7D A;  1SAN A;  3BG3 A;  3PM1 A;  1GVJ A;  2KDZ A;  1ZRF A;  1Z91 A;  1Y8R B;  2HQA A;  2EZI A;  3GZ6 A;  1BR1 A;  2FBH A;  3FXU A;  4FX4 A;  3PSF A;  5FHP A;  4PJN A;  3BG9 A;  1TWF J;  1S3J A;  4PDK A;  4PCQ A;  3PFY A;  3RPU A;  3L09 A;  1DU6 A;  3A0H C;  3K9T A;  3ASN H;  1DGR M;  4S05 A;  4L9T A;  3PNT A;  3NWS A;  3G7R A;  2X9D A;  5DD8 A;  2WTE A;  1ENH A;  1SD5 A;  3JW4 A;  1AKH A;  3CCU I;  1YO5 C;  1U78 A;  4A3D J;  3SYT A;  3BTL A;  3BJ6 A;  4M71 A;  4I6Z A;  3LA7 A;  3BJO A;  4Q48 A;  1HA8 A;  2L9N A;  4II2 A;  3KEO A;  1OIS A;  1MDM B;  5LHI A;  2HTJ A;  5BNG A;  1IGN A;  4DJA A;  3S3M A;  4ENK A;  1B9M A;  2L01 A;  2KIQ A;  3BY6 A;  4LB6 B;  1XB4 A;  2FOK A;  3DXJ F;  4HA8 A;  2Y30 A;  2Z3Y A;  1HW5 A;  3G3Z A;  4NUB A;  4LOC A;  4RS8 A;  2IXS A;  3J7A O;  1ULY A;  4Q5S F;  3IUV A;  1XGS A;  2HTS A;  4CYC A;  4QPO A;  4JL3 A;  1EJ9 A;  2XPW A;  2DA3 A;  3N05 A;  4OIQ F;  3J80 Z;  1OYY A;  3MZY A;  4A5N A;  2PZ9 A;  2CQX A;  2AS5 F;  3ROU A;  2YVH A;  5EEG A;  2F5V A;  2O5R A;  2GM4 A;  5ILS A;  3L7W A;  3VWB A;  4B3X A;  2IS1 A;  3V8L A;  2QKO A;  5ILV A;  5FMP A;  2M1B A;  3BG6 A;  3R60 A;  1IRX A;  2LKS A;  2X1D A;  2FBK A;  2R4G A;  4KIT B;  2IGK A;  4XLA A;  2LKX A;  1W36 C;  4UHT A;  1WZ2 A;  2I8D A;  2BY2 A;  2JA6 J;  1R5I D;  3GTP J;  4M3B A;  3REO A;  2FE3 A;  4FE4 A;  2OC6 A;  4L18 B;  1W5S A;  1ZGA A;  4CYD A;  1IZ1 A;  5ICC A;  3FRQ A;  1A6Q A;  5KK1 A;  1K78 B;  4OMY A;  4ZH4 F;  1IN5 A;  3JRE A;  5GAH J;  2DYS H;  4R1H A;  4A6E A;  4F55 A;  2JPC A;  3E6D A;  4YFN F;  4IHY A;  3QQA A;  4ON0 A;  2EBI A;  1GXQ A;  1QBJ A;  4G7O F;  2R7R A;  2OV7 A;  2FNA A;  3WG7 H;  1JUM A;  1XPX A;  4KT5 C;  5GTI C;  2MC4 A;  3L2C A;  1R1T A;  2L4M A;  4OMZ A;  3RKX A;  4LLN A;  2G7G A;  2FJI 1;  4JK1 X;  4D9J A;  4YFX F;  3DKX A;  4ZTF A;  2FSW A;  4A3L J;  1WI9 A;  2R7Q A;  1RI7 A;  1LE8 A;  3K70 C;  5KAF C;  1ZR2 A;  1Z0X A;  1MKM A;  1QQI A;  1BC8 C;  1I3A A;  3JRG A;  2KT0 A;  1W36 D;  2MG4 A;  1TT0 A;  2DG8 A;  4UUS B;  1O4X A;  3KCC A;  2CMP A;  1M1E B;  4IRG A;  1I6H J;  1HC8 A;  3AG4 H;  2K9Q A;  5M5X J;  1TC3 C;  1PYV A;  1R6R A;  2HKX A;  1YIO A;  2O3F A;  1TT5 B;  4BJ6 C;  1P2F A;  3BQZ A;  2VI6 A;  1JI8 A;  1UZC A;  3QPT A;  1T0F A;  1WJC A;  2E36 A;  5ICF A;  3I59 B;  4ACI A;  4HLY A;  2O7T A;  3I64 A;  3VDX A;  3ZQH A;  3G4S I;  3HOT A;  3KP4 A;  3OR2 C;  2QTQ A;  2MAB A;  1ZR4 A;  5D1R A;  2KMU A;  2ZSI B;  2GXA A;  4B3A A;  2M9H A;  2O8K A;  1WJE A;  1A5J A;  3ESW B;  3S32 A;  2P4W A;  1TTY A;  1G8X A;  2UUZ A;  3ANG A;  3ML6 A;  3OV8 A;  3VEP A;  3DTI A;  3SXY A;  1ONV A;  1PP8 F;  2IA1 A;  4L9J A;  1KU3 A;  4S04 A;  1HW1 A;  3V7C A;  1W0T A;  3K70 D;  4M74 A;  3MN2 A;  1LKX A;  4JBA A;  3FXJ A;  3E7L A;  3M7G A;  2XC7 A;  2I10 A;  4IEJ A;  4IVN A;  4ABZ A;  3HOZ J;  2RNG A;  2HXO A;  2VQG A;  1A35 A;  3W6V A;  1Y1W J;  3EDP A;  2HKO A;  3K4B A;  3GTK J;  3GEU A;  2H27 A;  1MGT A;  4NC6 A;  2G7U A;  1YS7 A;  1IDZ A;  3K4M A;  2PJP A;  3AQS A;  3KYD B;  1R4N B;  1I3Q J;  4E7K A;  2XAH A;  5AIQ A;  1O3R A;  3CC2 I;  4UUV A;  4OU0 A;  2R7O A;  3BT9 A;  4RB3 C;  1BBY A;  1J7K A;  2CWE A;  2Z99 A;  2MYS A;  5EEH A;  3OSF A;  2Y31 A;  3KIO A;  4OD4 A;  3VYR B;  4BXF A;  1P4W A;  1YJ9 I;  4O3M A;  3HRS A;  2K9L A;  5EGO B;  3SEQ A;  1YE9 A;  3H3U A;  3BR3 A;  2IU5 A;  4LB5 A;  1X1P A;  3KEQ A;  3ANP A;  2VPL A;  3PPB A;  2R7Z J;  3T5X A;  2D6Y A;  3FHZ A;  1LVK A;  1WPK A;  2VKH A;  2R7T A;  4IHT A;  2LTP A;  2QSG X;  2FJ1 A;  2YUS A;  3FWE A;  2WB1 N;  4YRV A;  1I1S A;  4PXI A;  1V54 H;  2VJJ A;  1HCR A;  3RTR A;  3K4L A;  4IQJ A;  1TZL A;  4G94 A;  2JT1 A;  1U2W A;  3DEE A;  1OCO H;  2ZO4 A;  4MLO A;  2XGC A;  2E34 A;  2QIB A;  2GZW A;  1ZRC A;  1XSX A;  2EWN A;  3E97 A;  2YU9 J;  1E17 A;  3B02 A;  3AG1 H;  1Y0N A;  3MEX A;  3CUQ A;  3MKW B;  9ANT A;  4LG0 A;  5HNF A;  3IKT A;  4HYE A;  1H0M A;  5B66 C;  5CW8 A;  4XRS G;  4MFD A;  1XGM A;  5FGL A;  2K5C A;  3MMY B;  1XTA A;  3SDB A;  1KON A;  3U21 A;  4BYY A;  1FYL A;  1ETX A;  1TNT A;  1IUY A;  4O5V A;  1D8J A;  4RGR A;  4RLQ A;  4B44 A;  2WAE A;  3IAS 2;  4BQQ A;  4OOI A;  4AVP A;  3FF5 A;  3VSK A;  4UVA A;  3Q9V A;  1T95 A;  2NOG A;  5LEK A;  4CH7 A;  1YRN A;  2PMH A;  3FK7 A;  1HBX G;  2V26 A;  3D0S A;  3WU0 A;  1S6L A;  3G73 A;  1FTT A;  1TBX A;  2E1M B;  4ETS A;  1FOY A;  1S9H A;  2QQ8 A;  1QVT A;  1BC7 C;  5D8L B;  3WHB A;  4D7N A;  3OMY A;  2P0W A;  4QPQ A;  1Z21 A;  1CGP A;  1XN7 A;  2BHY A;  2LY9 A;  1PUE E;  4D5F A;  1L0O C;  4GYI A;  3HL2 A;  4Y7N J;  4ZZD A;  1RKW A;  1YLF A;  3BPX A;  1IN4 A;  3R0J A;  2VJI A;  1FWZ A;  3LA2 A;  1FOW A;  1TWA J;  2V1N A;  4AD9 A;  4ZJZ A;  3AG2 H;  4AID A;  2ZJQ F;  3BHQ A;  3ASO H;  1JKR C;  4XSZ F;  5EF6 A;  2JPB A;  3QPS A;  3HC7 A;  1AA7 A;  2ZME A;  5EEA A;  1SFU A;  4D5C A;  3JSO A;  3C1D A;  4KMU X;  2DPD A;  2VT3 A;  3W6K B;  2Z9O A;  4UV8 A;  2XDN A;  2OD5 A;  3HTU A;  4RAG A;  4GRI A;  3TW6 A;  3GTJ J;  1RC9 A;  3AKZ A;  4HRI A;  3ZPL A;  2XAU A;  3G1L A;  1ODD A;  1W7P B;  5F08 A;  3GFL A;  1R9T J;  4ESB A;  2EQR A;  1UMQ A;  4OIO F;  3F21 A;  2UXX A;  4NN1 A;  4U0Y A;  1SVL A;  1VQM I;  3C3W A;  5K7F A;  1HDD C;  4C2M A;  3OIQ A;  1IV6 A;  1MMN A;  3DPJ A;  2HI3 A;  5JHF A;  4BEH A;  2E7W A;  2LMD A;  3DFG A;  5A2Q Z;  3IKV A;  3CME I;  3NQO A;  2A69 F;  4AYB N;  5DYM A;  1R4M B;  2OCC H;  4YEJ A;  3WOD F;  4N0B A;  3OL3 A;  3HRU A;  4HST A;  1SVO A;  3JTG A;  4A93 J;  4C3H J;  1W7P D;  3F8N A;  4IHS A;  1G3T A;  1HDP A;  1W1W E;  4IKF A;  3A4C A;  4Q47 A;  1PUF B;  2ME6 A;  3GTL J;  1IV8 A;  1MSF C;  2DOD A;  1QZZ A;  5FO5 A;  3MFK A;  2EZK A;  1UG2 A;  2PEX A;  5J8F A;  2WAQ N;  2V4J C;  5IT3 A;  4M9S A;  3NWT A;  4DIQ A;  4BY1 J;  3ZCO A;  2LSO A;  4B43 A;  1E2X A;  2ZJR F;  2WY7 Q;  4HDV A;  3B73 A;  3JRC A;  3S16 J;  4NHJ A;  2Z5U A;  3G71 I;  3ZQL A;  3F23 A;  4A0Y A;  1HSJ A;  2PFB A;  4U88 A;  1UHS A;  3BPV A;  4KMF A;  1WJ5 A;  2KRF A;  2QSF X;  3K2A A;  1QZY A;  3DCF A;  2MH9 A;  2IS2 A;  4KFC A;  3GFI A;  5FKL A;  1X1B A;  3OOP A;  3C2G A;  3M1E A;  5CKT A;  3B6A A;  4A3K J;  2V57 A;  1AOY A;  3K4J A;  5TIS C;  3TO6 A;  2DQR A;  1D1B A;  4B8X A;  1ZQ3 P;  1G3Y A;  2C6Y A;  1QPM A;  3K1M A;  2DLL A;  4NQW B;  4HOB A;  2VL8 A;  3ULQ B;  2A05 A;  2COB A;  3ABL H;  4F93 B;  2Z33 A;  3LMM A;  2IGO A;  2NVT J;  2X4H A;  1IF1 A;  1UHM A;  4MTD A;  3KFW X;  2KIU A;  2X51 A;  1BR2 A;  5ILU A;  2WGB A;  2DMN A;  1GLN A;  1DPU A;  2CH0 A;  2F5C A;  2GWR A;  5JVT A;  5DS9 A;  4KIS A;  2VOO A;  1H9G A;  3BWG A;  3EUK L;  2XRO A;  2OF7 A;  1UI6 A;  1FP2 A;  4BE0 A;  4N9H A;  5FGM A;  3SZP A;  2R5Y B;  2MA3 A;  4E7S A;  3RYP A;  1VI0 A;  2NS8 A;  1OKR A;  1BIA A;  1ZHF A;  2LC2 A;  4JYK A;  3E7Q A;  5FD6 A;  2XAQ A;  2IP2 A;  1HST A;  5TGT A;  3EPZ A;  4RAY A;  4HW0 A;  5HSZ A;  2QM3 A;  2DG7 A;  2MGQ A;  1V5E A;  2JRT A;  3OYI A;  3Q0W A;  2STT A;  2A3S A;  3WU2 C;  4RLF A;  3WTY C;  4OIR F;  4P5O A;  4AIJ A;  1V4R A;  4OIP F;  4ZDL A;  2HDC A;  1SGM A;  2E5Z A;  1IUF A;  1YQA A;  2OJE D;  1ON1 A;  2VB6 A;  3QU6 A;  5K58 A;  1GDT A;  4MGR A;  1LDK B;  3PO2 J;  3A01 A;  2QCO A;  1LDJ A;  4BE2 A;  3CCY A;  2P81 A;  2OQR A;  3O6B B;  5CVU A;  4UNO A;  2HOS A;  4MFE A;  5E79 C;  3WGH A;  3CLO A;  3GTM J;  3OWT A;  2EIN H;  2L5Q A;  2F2E A;  2RRE A;  4BHB A;  4ZYE A;  1J75 A;  3JRF A;  2UXU A;  1DDN A;  2WAQ A;  1STZ A;  4Y33 A;  2JQ7 A;  4EQQ A;  2JSP A;  1BI3 A;  2HYJ A;  3DBH B;  5FJ8 J;  2UXP A;  4RDU A;  1HW2 A;  2NS7 A;  4A3C J;  1K79 A;  2JZY A;  3UKG A;  3TKY A;  1D8K A;  2F4M B;  4LLL A;  3I55 I;  1BIB A;  2Q2E A;  3VYS B;  2DA4 A;  4A0Z A;  3JRB A;  3ZMZ A;  1VQN I;  3IAM 2;  2VJ5 A;  4LK1 F;  2MD0 A;  3GZ5 A;  2UWM A;  2R7V A;  4A12 A;  1S7A A;  1DP7 P;  3SFZ A;  1VQP I;  1ON2 A;  2ME0 A;  5BS6 A;  4MQ9 F;  2H6B A;  2PMZ N;  4E70 A;  3TOA A;  1RES A;  2XV4 S;  4ESF A;  1C0W A;  3ECO A;  4HNU A;  5JLW A;  5D5U B;  1GVD A;  1W5T A;  2HEO A;  2A07 F;  3ZN1 A;  4HX8 A;  3I9V 2;  2B7E A;  3LNQ A;  1SFX A;  4LMY A;  1F36 A;  2CS3 A;  4CO8 A;  3LSG A;  3HOW J;  5K1Y A;  3JRI A;  2EIK H;  3TO7 A;  2IW5 A;  3CDI A;  1V5F A;  2K27 A;  4C2M J;  1FX7 A;  3HUG B;  1ETQ A;  2IT0 A;  2BY1 A;  4BKX A;  4M3F A;  4EV0 A;  3I4M J;  3T6N A;  2ZCN A;  1O57 A;  4XNF A;  5IP9 J;  2F5E A;  2XAF A;  5D6F A;  2Z16 A;  3FXL A;  2NS0 A;  1X4O A;  3BDD A;  4QIW N;  1X58 A;  1B72 B;  3LSI A;  4Z2Y A;  1SMT A;  2VC0 A;  2VN2 A;  3JRH A;  4CCN A;  2M5W A;  4HG2 A;  1MBE A;  2VE8 A;  3I5U A;  3LSJ A;  1TWC J;  4A69 C;  1ETY A;  2RDP A;  3BG5 A;  4XIC A;  1SMY F;  1JHF A;  2XF5 A;  3FKI J;  5EZG A;  3S1M J;  3F6O A;  2DAO A;  5DUK A;  1P6R A;  4XKV A;  4Q4Z F;  2W48 A;  4RBO A;  4E7H A;  2ZC2 A;  1A36 A;  4CA0 A;  1D1C A;  1RZ4 A;  3CJD A;  2IEK A;  2V6C A;  3A1Y A;  1HLV A;  3C07 A;  5DCM A;  4IJA A;  5C4J J;  4G7H F;  1OR7 C;  1ZRE A;  2QQB A;  3I53 A;  3D1N I;  1YYV A;  2OBP A;  4E7Z A;  2REK A;  4H4K C;  5ERI A;  3BOQ A;  1K4T A;  1G3S A;  2UXN A;  4X1E A;  2PBX A;  3HJE A;  2V7F A;  3HTA A;  3H1C A;  1H89 C;  1APL C;  2AXL A;  2VPR A;  3QOE A;  2E7X A;  3HB9 A;  3BR6 A;  5FKK A;  5CLS A;  3C18 A;  3ELK A;  2FQ4 A;  2MW8 A;  2VKE A;  4IRI A;  5E1X A;  3BQY A;  2AQF A;  3VOX A;  3FM5 A;  3IH4 A;  1HKQ A;  2TCT A;  1XDS A;  4DQ2 A;  5C3E J;  4HEA 2;  4ZTJ A;  2CO5 A;  3TGN A;  1QZE A;  3LQQ A;  1X2M A;  2FMY A;  4UXN A;  4XLE A;  4GO1 A;  3NNR A;  5BQT A;  4PZJ A;  2NVU B;  1YW7 A;  3OIO A;  2B0L A;  3OYL A;  1JKP C;  5ICE A;  2GA2 A;  3M4O J;  1LUJ B;  2R7F A;  1MBJ A;  1WQ2 A;  4BHP A;  4DBR A;  4II3 A;  2GLO A;  5JVG F;  2ID3 A;  2MH2 A;  1UST A;  3PNY A;  2QQ9 A;  4HV5 A;  2A5W A;  4WXD A;  3ZMT A;  3HTH A;  1W4M A;  2L9S A;  4XRF A;  3LHQ A;  1HKS A;  1QA6 A;  5D19 A;  2BVL A;  3OR1 C;  5E1Z B;  2E60 A;  5F04 A;  1YHQ I;  2Z2S B;  4XN0 A;  1VTN C;  2IGN A;  3M8J A;  2W24 A;  4FHT A;  1O7F A;  1REP C;  5HOD A;  3RPQ A;  1LEA A;  4WCG A;  5H6R A;  2XRL A;  1KU2 A;  3QBM A;  2JUC A;  5K5R A;  1EH7 A;  5FRN A;  4F91 B;  4EJU A;  1IAW A;  2DMQ A;  2LF8 A;  3T0Y A;  1A04 A;  2XIG A;  1NH3 A;  2UV1 A;  4PSW A;  3FM3 A;  2HPI A;  1Z6R A;  2QKM B;  5DD4 A;  4M3G A;  5LLQ A;  2VE9 A;  1K83 J;  1OFC X;  3KZI C;  1UAA A;  1EF4 A;  5F27 A;  3ABM H;  3OYF A;  2BGC A;  1XCB A;  3H5R A;  1R5G A;  3RI4 A;  4MTE A;  5GAG J;  4KWA A;  2AXT C;  2ZOZ A;  4AIK A;  3CDH A;  3EQL F;  4C30 A;  4WIB A;  2LDU A;  3GW2 A;  4AU7 A; 
#chains in the Genus database with same CATH homology
 4ABZ A;  1ZTR A;  3G56 A;  1T33 A;  3HOZ J;  2HXO A;  1B72 A;  2LK2 A;  1BW5 A;  3JSJ A;  5IPA A;  3W6V A;  1Y1W J;  1BA5 A;  3VVX A;  5M3M J;  3L1P A;  3GTK J;  2CJJ A;  1H8A C;  3GEU A;  2K9S A;  5C4Y A;  1IDZ A;  3AQS A;  1I3Q J;  5M5Y J;  2XSD C;  1AHD P;  3RD3 A;  3S15 J;  3BT9 A;  1FTZ A;  4QSH A;  1POG A;  2DTZ A;  3S2H J;  3NAR A;  2GEN A;  3OSF A;  1RET A;  2CUF A;  2Y31 A;  2LR8 A;  1WH7 A;  3K7A J;  4L5E A;  3LSP A;  2R92 J;  2M0C A;  3BR0 A;  5EYR A;  5EGO B;  3BR3 A;  4XID A;  2IU5 A;  3CDL A;  2ZB9 A;  4JKZ A;  3ANP A;  2DA5 A;  1MH3 A;  3S14 J;  3PPB A;  4V2F A;  5EFY A;  3H3V K;  2R7Z J;  4DZP A;  2D6Y A;  1A6I A;  1WPK A;  4W97 A;  2IBD A;  3OSG A;  1B8I A;  3Q0V A;  4IHW A;  2JA7 J;  4FTH A;  1Q1V A;  3ON4 A;  2LTP A;  3VW0 A;  2JK3 A;  2FJ1 A;  2YUS A;  4QTR A;  1ORK A;  2ZCX A;  2WB1 N;  5IYC J;  3COL A;  5E3N A;  1IG7 A;  3S5R A;  4PXI A;  1HCR A;  3CMY A;  1U9N A;  2N8G A;  5IYB J;  1GT0 C;  3SFI A;  3BRU A;  3MNL A;  2ID6 A;  3RZD J;  5E3O A;  4MLO A;  3ZQI A;  2XGC A;  4X6A J;  3ZQC A;  2QIB A;  3EGQ A;  1AU7 A;  2JA8 J;  2HQ5 A;  2YU9 J;  3VPR A;  3BNI A;  5HBU A;  2Y0S N;  5EG0 B;  1QRY A;  2NVX J;  2H8R A;  9ANT A;  3GTQ J;  1JTY A;  3BJB A;  5CW8 A;  3M3Y J;  4XRS G;  4MFD A;  2W53 A;  2GUH A;  5FGL A;  5FLV A;  4G12 A;  4GCT A;  2JWT A;  5IP7 J;  2GFN A;  1ETX A;  1SFO J;  4UUS A;  2E2J J;  5J1Y A;  3BCG A;  3IH3 A;  1F43 A;  5IP6 A;  2NOG A;  4XRS A;  1YRN A;  4IHX A;  2YVE A;  3CRJ A;  1WI3 A;  1T56 A;  3FK7 A;  1GV2 A;  3MKL A;  2B63 J;  2HOT A;  4NDL A;  1ETK A;  1Y1V J;  4FIS A;  1FTT A;  1JT6 A;  1BJZ A;  1QVT A;  1RKT A;  2EZL A;  3WHB A;  4B1R A;  4D7N A;  3LSR A;  3HOV J;  2LY9 A;  5GPA A;  3PAS A;  4D5F A;  3QKX A;  3FIS A;  5F0H A;  5FLM J;  2JMW A;  4Y7N J;  2XPU A;  2HYT A;  1RKW A;  3IH2 A;  3S1R J;  4BBR J;  5J3L A;  3G1O A;  1MBG A;  3TP0 A;  3ZOB A;  2NX4 A;  2DA2 A;  2ECB A;  4UDS A;  1WGX A;  1TWA J;  2NP5 A;  5CXG A;  3DEW A;  3VUQ A;  2R5Z B;  5DTD A;  3BHQ A;  1JKR C;  2RAS A;  3NXC A;  3Q0U A;  5EF6 A;  4I76 A;  1GV5 A;  1JJ8 C;  2L7M P;  3QPS A;  1ETV A;  3GBG A;  5EEA A;  4D5C A;  3KKD A;  4YZE A;  3HOX J;  4A3F J;  2HDD A;  1WH5 A;  3LJL A;  3A02 A;  4GFB A;  3HBL A;  2XDN A;  3KZ9 A;  3BR1 A;  3TW6 A;  1U9O A;  3GTJ J;  3Q3S A;  2XPV A;  2CQQ A;  3G1L A;  5F08 A;  2M8G X;  4HKU A;  2RAE A;  3A01 B;  4M6V A;  1R9T J;  2LP0 A;  2EQR A;  1UMQ A;  1HOM A;  3CWR A;  2L7Z A;  1P7I A;  2E1O A;  4NN1 A;  1JUP A;  5K7F A;  1HDD C;  2XB0 X;  1IV6 A;  2WV1 A;  3DPJ A;  2DMT A;  3GTO J;  2HI3 A;  4NEL A;  2K40 A;  4D7M A;  2OI8 A;  5CXI A;  1U8B A;  3H0G J;  2NVQ J;  2QWT A;  4AYB N;  4C3J J;  5EGO A;  2E2I J;  5GPC A;  2XGE A;  1W0U A;  5C44 J;  3TP3 A;  1OJL A;  4A93 J;  3NPI A;  4C3H J;  3HE0 A;  3LWJ A;  1HDP A;  1PUF B;  3HGG A;  1Z77 A;  2ME6 A;  3GTL J;  1D5Y A;  1MSF C;  3HDD A;  3S2D J;  2D5V A;  3I4N J;  3V78 A;  2EZK A;  1UG2 A;  1ZK8 A;  2WAQ N;  2LD5 A;  2R0Q C;  5JLX A;  3G1M A;  4BXX J;  4BY1 J;  1RPW A;  2G0E A;  1FIP A;  2DN0 A;  4MIM A;  1JT0 A;  2E2H J;  3S17 J;  1E3O C;  4JX6 A;  2AHQ A;  1X2N A;  3O8G A;  5IOY A;  1AKH B;  3NI7 A;  4ICH A;  3JRC A;  3S16 J;  5E3M A;  2G3B A;  3ZQL A;  1NK2 P;  4V2G A;  5EG0 A;  1UHS A;  4GFK A;  3VOK A;  3HKZ N;  3K2A A;  4S0H B;  3B81 A;  3DCF A;  3TW7 A;  4W1U A;  2FD5 A;  2E19 A;  2HXI A;  5FKL A;  3ZQF A;  3VW2 A;  3HOY J;  5EDN A;  2OPT A;  3F0C A;  3B6A A;  1TWH J;  4A3K J;  5IOZ A;  1MNM C;  2V57 A;  1TWG J;  5D18 A;  2K9N A;  4C3I J;  2ZOY A;  3FIW A;  3HEF A;  1ZQ3 P;  4M3D A;  2X48 A;  2FBQ A;  2COB A;  2NVT J;  3B6C A;  1FJL A;  5F0F A;  2M2E A;  4AF5 A;  2NP3 A;  2CRG A;  2DJN A;  4CYC B;  4ME9 A;  3BTJ A;  2M34 A;  2WGB A;  2O7O A;  3NRG A;  2UXH A;  2DMN A;  3O60 A;  5H9T A;  1IC8 A;  1FEX A;  4GFL A;  4JX5 A;  1ZGW A;  1NK3 P;  5DS9 A;  3GTG J;  2LLK A;  1UI5 A;  2DMP A;  2DA1 A;  4DZJ A;  2OF7 A;  1UI6 A;  2G7S A;  2R5Y B;  1VI0 A;  2NS8 A;  3C2B A;  1ZKG A;  4Y52 J;  1WCM J;  4JYK A;  2R5Z A;  3E7Q A;  5FKO A;  5HSZ A;  2DG7 A;  2MGQ A;  3ON2 A;  3RKQ A;  1JKQ C;  2JN6 A;  1HF0 A;  3Q0W A;  4A3E J;  1G2H A;  5DAJ A;  2Y2Z A;  1MSE C;  4JX4 A;  1IJW C;  2Y9Y A;  2AO9 A;  3JRA A;  1ITY A;  1VFC A;  5IYD J;  1LFB A;  3BR5 A;  1JKO C;  1SGM A;  2QOP A;  1IUF A;  5K7Z A;  3RH2 A;  5K58 A;  4A3M J;  2ECC A;  1GDT A;  1MH4 A;  3RZO J;  5C4X J;  2F07 A;  4XK4 A;  2ZCM A;  3MVP A;  2MSY A;  4UUT A;  4DYC A;  1JGG A;  3A01 A;  3JRD A;  2QCO A;  3PO2 J;  2CU7 A;  2ELK A;  4DYR A;  3NAU A;  3CCY A;  3TED A;  2P81 A;  2Q24 A;  4MXM A;  3GZI A;  5M3F J;  2OER A;  2HOA A;  2HOS A;  4MFE A;  2XGD A;  3VIB A;  4XRM A;  4GCK A;  3HGY A;  3GTM J;  2QF7 A;  5HAW A;  3JRF A;  2UXU A;  3HTI A;  1LE8 B;  5J1R A;  3KKC A;  1IDY A;  3HOU J;  2X6O A;  1SAN A;  2HYJ A;  3BG3 A;  3PM1 A;  2KDZ A;  5AQC A;  5FJ8 J;  2UXP A;  4RDU A;  3AQT A;  2L0K A;  2NS7 A;  2EZI A;  4A3I J;  4A3C J;  3JR9 A;  2UXI A;  3UKG A;  4J19 A;  5FHP A;  3JRB A;  1PUF A;  3BG9 A;  2DA4 A;  1TWF J;  1NTC A;  3RQI A;  1XG1 A;  1DU6 A;  1BL0 A;  2EH3 A;  1CQT A;  2ME0 A;  3KNW A;  5J1U A;  2PMZ N;  3G7R A;  2X9D A;  1RES A;  1ENH A;  3HM5 A;  2CUE A;  5JLW A;  1AKH A;  1GVD A;  2HKU A;  1U78 A;  2YS9 A;  4A3D J;  4FCY A;  3LNQ A;  1LFU P;  3S1Q J;  1F36 A;  3BTL A;  5FKN A;  4I6Z A;  3LSG A;  3HOW J;  4A3B J;  3JRI A;  3VVZ A;  3CQZ J;  5E3L A;  3ZQG A;  4C2M J;  1XC5 A;  1ETQ A;  5BNG A;  1IGN A;  4BKX A;  4DYQ A;  4CGR A;  4M3F A;  4IHV A;  2DA6 A;  3I4M J;  3T6N A;  3PO3 J;  2ZCN A;  1DU0 A;  5IP9 J;  4MO7 A;  2Y30 A;  4QIW N;  1X58 A;  4LOC A;  1B72 B;  1IRZ A;  3IUV A;  2UXO A;  3A03 A;  4CYC A;  2IAI A;  3JRH A;  4JL3 A;  1MBE A;  2O9L A;  2XPW A;  2DA3 A;  3LSJ A;  5F0C A;  2PZ9 A;  2CQX A;  2VUM J;  1TWC J;  1JTX A;  5FKM A;  2YVH A;  4A69 C;  1ETY A;  3BG5 A;  4XIC A;  2GM4 A;  3FKI J;  5EZG A;  3S1M J;  1MBH A;  1OCT C;  2L9R A;  3HTJ A;  2QKO A;  2W48 A;  3BTI A;  4RBO A;  1MBF A;  5FMP A;  2G7L A;  2R5Y A;  3OOU A;  1GUU A;  3CJD A;  2IEK A;  1HLV A;  3C07 A;  5C4J J;  2LKX A;  3BTC A;  2H1K A;  2JA6 J;  1P7J A;  3V6G A;  4HNV A;  3D1N I;  3GTP J;  4M3B A;  1K61 A;  2REK A;  4FE4 A;  4X1E A;  2PBX A;  1B8I B;  3HTA A;  2GBY A;  3WHC A;  2NVY J;  1H89 C;  3FRQ A;  1APL C;  2VPR A;  3HB9 A;  3QPL A;  2FX0 A;  3BR6 A;  5FKK A;  3JRE A;  2EZH A;  2LVS A;  4JP0 A;  2FQ4 A;  2MW8 A;  2VKE A;  3VP5 A;  4AUX A;  3BQY A;  4IHY A;  5EZH A;  3QQA A;  3VOX A;  2EBI A;  3IH4 A;  4GCL A;  3BR2 A;  3SJM A;  2TCT A;  5C3E J;  4A3J J;  4MK6 A;  1H88 C;  1JUM A;  1ETW A;  1ETO A;  1X2M A;  2L7F P;  3LOC A;  3NNR A;  1I50 J;  4EEF G;  3S1N J;  3FK6 A;  1JJ6 C;  2G7G A;  1VF9 A;  2LFB A;  3F1B A;  3OIO A;  1JKP C;  2VKV A;  3M4O J;  5M5W J;  4A3L J;  1MBJ A;  1MBK A;  1LE8 A;  1ZR2 A;  1Z0X A;  2GLO A;  4FE7 A;  3JRG A;  2ID3 A;  4BY7 J;  2KT0 A;  1XS9 A;  2MG4 A;  1BW6 A;  4B4C A;  2DG8 A;  4UUS B;  1O4X A;  4M3E A;  1QPI A;  3HTH A;  1I6H J;  1FIA A;  2K9Q A;  5M5X J;  1TC3 C;  1YRN B;  2JA5 J;  3LHQ A;  5D19 A;  5F04 A;  4AC6 A;  1S7E A;  3BQZ A;  5K7H A;  2VI6 A;  3HIM A;  2JJ7 A;  4BBS J;  2DMU A;  4ACI A;  5HOD A;  2O7T A;  3ZQH A;  1OCP A;  3EUP A;  2XRL A;  4DW6 A;  2QTQ A;  3QBM A;  3VW1 A;  1ZR4 A;  2R93 J;  5D1R A;  3SDG A;  4B3A A;  2M9H A;  2O8K A;  1A5J A;  4L62 A;  2DMQ A;  3ANG A;  5GP9 A;  5F1J A;  1QVU A;  1RR7 A;  2I10 A;  2RHA A;  4M3G A;  2XB5 A;  1K83 J;  1OFC X;  2DA7 A;  3O8H A;  1W0T A;  4JNN A;  1EF4 A;  4A3G J;  5F27 A;  3P9T A;  4AC0 A;  4KWA A;  2TRT A;  3MN2 A;  1JUS A;  1VND A;  2ZOZ A;  3E7L A;  3VVY A;  3IV5 A;  2WUI A;  2Y9Z A;  4IEJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...