1JT0A

Crystal structure of a cooperative qacr-dna complex
Total Genus 69
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
69
sequence length
188
structure length
188
Chain Sequence
b'NLKDKILGVAKELFIKNGYNATTTGEIVKLSESSKGNLYYHFKTKENLFLEILNIEESKWQEQWKKEQIKAKTNREKFYLYNELSLTTEYYYPLQNAIIEFYTEYYKTNSINEKMNKLENKYIDAYHVIFKEGNLNGEWSINDVNAVSKIAANAVNGIVTFTHEQNINERIKLMNKFSQIFLNGLSKH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords QACA operator
publication title Structural basis for cooperative DNA binding by two dimers of the multidrug-binding protein QacR.
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Transcription/dna
total genus 69
structure length 188
sequence length 188
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2001-08-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00440 TetR_N Bacterial regulatory proteins, tetR family
A PF08360 TetR_C_5 QacR-like protein, C-terminal region
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 1jt0A01
1.10.357.10 Mainly Alpha Orthogonal Bundle Tetracycline Repressor; domain 2 Tetracycline Repressor, domain 2 1jt0A02
4I6ZA 5K7FA 3GBGA 4DYCA 1P7IA 5IP7J 4C3IJ 4MXMA 4M3BA 3FISA 1MSFC 3RD3A 4V2FA 2DN0A 2LR8A 3K2AA 3JRIA 4D5FA 2MGQA 3Q0WA 1HLVA 3VOXA 2G0EA 1JT6A 3G1LA 2VPRA 2WB1N 4C3JJ 3SJMA 3HIMA 3OIOA 2FD5A 3ZQCA 1MNMC 4AC0A 1I50J 3T6NA 2FBQA 3PO2J 3ZOBA 2NX4A 4A3FJ 4FISA 3S2HJ 1PUFB 2UXIA 4MFDA 3SDGA 2CJJA 4FTHA 2Y9ZA 3JREA 3COLA 3PO3J 2HYJA 3GTKJ 5IYCJ 2K9QA 1NK2P 2K40A 2LY9A 3P9TA 5H9TA 4XICA 5FHPA 3G1MA 4GCKA 3BG3A 1NTCA 2HQ5A 2LLKA 4D5CA 5EGOA 5IPAA 3ZQHA 4C3HJ 1ETOA 4A3BJ 3IH4A 3MN2A 3S2DJ 3FRQA 2AO9A 4D7NA 5JLXA 2JA8J 4JX6A 4QSHA 3DCFA 2NP3A 1SGMA 4A3KJ 4A69C 4AUXA 4PXIA 2KDZA 3WHBA 4Y7NJ 1JGGA 1MSEC 4BY7J 2XRLA 2ECCA 2XGCA 2XGEA 2E2IJ 3HOZJ 3FK6A 2G7LA 3LSJA 5CXIA 2EZHA 3GTPJ 1ENHA 2DG7A 3BQZA 2ME0A 1WI3A 2JN6A 1K61A 4DYQA 3ZQGA 3JR9A 1JJ8C 3BRUA 3S15J 3HDDA 4MIMA 3GTMJ 1MBGA 2DA2A 5E3OA 3GTLJ 9ANTA 5EZHA 1HDDC 5EGOB 2HOSA 3LSRA 1ZK8A 1SANA 2P81A 4GFKA 2QCOA 1Z77A 3S1RJ 4A3EJ 4L62A 1IDZA 4XRSG 1QPIA 2W48A 2M0CA 1JTXA 1GV5A 2EBIA 3FIWA 2DMQA 3K7AJ 3VPRA 5HODA 2PBXA 2UXUA 3HE0A 4UDSA 5C3EJ 1H88C 2ZCXA 5GPCA 2HDDA 3TP0A 4IHVA 2DMNA 3QPLA 1FTTA 1P7JA 4IEJA 1IV6A 1W0TA 2PMZN 2ZOZA 4MK6A 3S16J 1K83J 2EH3A 4NDLA 2OPTA 1AHDP 4HKUA 2DMUA 1CQTA 2DG8A 3QPSA 1XS9A 1F36A 1JUMA 1U9NA 3TW7A 2B63J 3LSGA 2CRGA 3M3YJ 3TW6A 3HEFA 3NXCA 3Q0VA 5FKKA 5D19A 3RKQA 4GFBA 4XK4A 3FKIJ 1YRNA 2QKOA 5FLVA 2VUMJ 5M3MJ 1JUPA 5K7ZA 1Z0XA 1BL0A 4CGRA 2XSDC 1HOMA 2M8GX 3RQIA 2XPWA 3PPBA 5CXGA 4ME9A 2QF7A 3MVPA 4HNVA 3HTHA 1AU7A 5F0CA 1WCMJ 2HKUA 3WHCA 1PUFA 2UXPA 2ZOYA 3DEWA 3BR0A 1LFUP 4EEFG 4XRSA 1A6IA 5J1UA 2OF7A 1X2MA 1VI0A 5FKMA 3NRGA 3QQAA 2DA3A 4GCLA 1RESA 3BQYA 2D5VA 2Q24A 3VIBA 2XB5A 2LFBA 1OFCX 4M3GA 3BR1A 2K9NA 2NVQJ 3LSPA 3A01A 4CYCA 2ZCMA 3LWJA 3NARA 1HCRA 2D6YA 2FX0A 3HM5A 3F1BA 4L5EA 3FK7A 4B3AA 2NS7A 2E2HJ 1YRNB 5DTDA 1IUFA 5J3LA 5HAWA 3AQTA 1ETWA 4BBRJ 3KKCA 3JRAA 4BXXJ 3JRGA 1MBHA 2H1KA 5FJ8J 1IJWC 4NELA 1E3OC 1ZKGA 3MKLA 2JA7J 2PZ9A 3H3VK 4BKXA 2L0KA 3D1NI 4A3GJ 3B6AA 4D7MA 2LD5A 3ZQIA 1IG7A 3ON2A 3C2BA 1GDTA 2CUFA 2L9RA 2WAQN 3L1PA 2DA5A 2NVTJ 1GUUA 4V2GA 3Q0UA 2NVXJ 2DTZA 3GTGJ 2CQQA 5IOYA 3IH2A 4JYKA 4LOCA 1GV2A 3IH3A 3TP3A 1Y1VJ 4XIDA 2FQ4A 2EZLA 2CU7A 4CYCB 3A01B 3CMYA 1Y1WJ 2RASA 4JKZA 3GTJJ 1WH7A 5FKOA 3VW2A 2XPVA 4B4CA 2JWTA 5EZGA 2R0QC 1ORKA 2ECBA 1FTZA 3EGQA 1WGXA 1HF0A 2L7ZA 3JSJA 3QKXA 2GLOA 1XG1A 5E3MA 4A3LJ 1JKOC 3VVXA 2MSYA 1TWCJ 4W97A 5GP9A 5IP9J 2OERA 2Y30A 3B81A 2XDNA 5D18A 1U8BA 1G2HA 1RR7A 4RDUA 3HB9A 3LNQA 3HOVJ 3ZQLA 3PASA 5M3FJ 1WH5A 2VKEA 3A02A 1AKHA 4Y52J 5C4XJ 2GFNA 3ZQFA 2L7MP 1JT0A 2NS8A 2XGDA 3I4MJ 5F0FA 5BNGA 2HYTA 4IHWA 2UXHA 5M5WJ 2QTQA 2W53A 1ZQ3P 2HXIA 2R5YA 1LE8A 5DS9A 3HOYJ 3CQZJ 2O7OA 4KWAA 1VNDA 1JKPC 2HOTA 3JRHA 2EZIA 4A3DJ 5EF6A 3OOUA 2V57A 1ZR2A 2WV1A 1O4XA 2LTPA 2HI3A 2XPUA 3V6GA 2DA4A 1X2NA 1TWAJ 2DA6A 2VKVA 5IOZA 4A93J 5DAJA 2COBA 3JRDA 4JP0A 3BR2A 1XC5A 1BJZA 5F04A 1APLC 2QWTA 3LOCA 1OCTC 2E19A 2KT0A 2YVHA 2G7SA 2DA1A 3C07A 4I76A 1MH4A 1AKHB 2CQXA 1H89C 4ACIA 2LP0A 4DW6A 2YU9J 3ANGA 2FJ1A 2ID3A 2YUSA 2DJNA 4W1UA 2CUEA 1B8IA 4BBSJ 1MBJA 1TWFJ 5J1YA 2R5YB 1LE8B 5EEAA 4JX4A 5FLMJ 3OSGA 2ZB9A 4A3CJ 3B6CA 3UKGA 2MW8A 1UMQA 3HBLA 1B72A 2QIBA 1QVUA 2L7FP 2ELKA 1T33A 3BJBA 4JX5A 1F43A 2VI6A 3BTLA 3CCYA 2R7ZJ 3JRFA 3HTAA 1JJ6C 1ETQA 4GFLA 3GZIA 1VFCA 2YVEA 3NI7A 3VUQA 1A5JA 3S1MJ 4G12A 5M5YJ 3G56A 1JKRC 3BTIA 3BNIA 3VW0A 3KKDA 4AYBN 3E7QA 2DMPA 5K7HA 3G7RA 1FIAA 4GCTA 1DU6A 2UXOA 1MBFA 3PM1A 1OCPA 1TC3C 1TWHJ 1RKTA 2GUHA 1POGA 1MBEA 3CJDA 1EF4A 1FIPA 2O7TA 5FMPA 1RETA 3BTCA 4MO7A 1B8IB 3S14J 2G7GA 4A3IJ 5EFYA 1RKWA 3CDLA 5F27A 2E2JJ 1WPKA 4M6VA 2ZCNA 5E3NA 5C4JJ 5E3LA 4A3MJ 5AQCA 1JTYA 4X6AJ 1B72B 1I6HJ 4M3DA 2GBYA 4ABZA 1UHSA 4DZJA 2G3BA 2WGBA 3VW1A 2Y0SN 1D5YA 2IEKA 4MFEA 4DYRA 3ON4A 2OI8A 3IUVA 2YS9A 2Y31A 1UI6A 4M3EA 3RH2A 4DZPA 2LKXA 1HDPA 5F08A 1U9OA 4UUSA 3O8HA 1R9TJ 4IHXA 2ME6A 3HGYA 1ETVA 2NVYJ 3V78A 5HBUA 4XRMA 2WUIA 2M34A 1W0UA 5IYDJ 4AC6A 3VVZA 2HOAA 1JUSA 3HGGA 5J1RA 5EYRA 2O9LA 5M5XJ 1FJLA 2RHAA 3NNRA 3RZDJ 4FE4A 3S17J 1RPWA 3RZOJ 2ID6A 2DMTA 3GTQJ 1I3QJ 4B1RA 3BTJA 1T56A 3LJLA 3S1QJ 1H8AC 2M2EA 3BT9A 3G1OA 2X6OA 2RAEA 2TCTA 2LVSA 1DU0A 2JJ7A 5EG0A 1MBKA 2O8KA 3GTOJ 5FGLA 1SFOJ 3AQSA 5CW8A 4M3FA 1JKQC 1OJLA 3E7LA 4UUSB 3MNLA 1ETYA 1ZGWA 4IHYA 3LHQA 3NAUA 4MLOA 2IBDA 1VF9A 3GEUA 2EQRA 3S5RA 3BG9A 1TWGJ 1MH3A 2Y9YA 1BW5A 2JK3A 5GPAA 5C4YA 3BCGA 3NPIA 1U78A 3W6VA 2TRTA 1UI5A 3BR6A 3S1NJ 3SFIA 3O60A 1QVTA 1LFBA 4QIWN 5K58A 1ETKA 3I4NJ 3H0GJ 4RBOA 3BG5A 3HKZN 3HTIA 2I10A 1BW6A 5JLWA 5FKLA 3BHQA 1S7EA 3JRBA 5EG0B 5IYBJ 3F0CA 3VP5A 1IGNA 3HTJA 1X58A 3HOXJ 3DPJA 2DA7A 3EUPA 5D1RA 2XB0X 3HOUJ 5FKNA 2M9HA 2JA5J 2MG4A 3ANPA 2R92J 3OSFA 4BY1J 1Q1VA 5HSZA 2R5ZA 2IU5A 1ETXA 4A3JJ 2N8GA 3QBMA 4C2MJ 4J19A 3O8GA 3M4OJ 3KZ9A 3BR5A 2R93J 1BA5A 4UUTA 3JRCA 1IRZA 5IP6A 2Y2ZA 3Q3SA 4FCYA 1IDYA 1FEXA 2F07A 3TEDA 2IAIA 2LK2A 2X48A 4NN1A 5EDNA 3HOWJ 3KNWA 2GENA 1GVDA 3A03A 3VOKA 2NOGA 5C44J 4JL3A 4YZEA 1ZTRA 5F0HA 3VVYA 2AHQA 2NP5A 4FE7A 1UG2A 2K9SA 2EZKA 1IC8A 2JMWA 2REKA 3IV5A 4X1EA 2JA6J 4AF5A 2X9DA 1QRYA 4JNNA 2GM4A 4ICHA 1ZR4A 2E1OA 4QTRA 2HXOA 3BR3A 5F1JA 2R5ZB 2QOPA 1GT0C 3CRJA 1ITYA 3CWRA 1NK3P 2H8RA 4S0HB
chains in the Genus database with same CATH superfamily
2MD0A 4WXDA 4HSRA 2JUGA 1XCBA 2QM3A 2XGXA 3VYTB 3IRQA 3BZKA 3JRIA 2JRMA 1UAAA 5ILVA 4UV9A 4BGDA 4E4HA 3VOXA 5DYMA 4C3JJ 3SJMA 1I39A 1OISA 3OIOA 3EYYA 5HOOA 2DLLA 1DPUA 3ZOBA 2NX4A 4F3QA 2CO5A 3RYPA 1Z1DA 2HDCA 3S2HJ 3ESWB 3SDGA 2M30A 4BJTA 3HPHA 2Y9ZA 2HYGD 3PO3J 3COLA 5GTHC 2R7VA 4R1HA 2K9QA 4UVAA 2QSFX 2TDXA 3ONQA 4E7KA 1K78B 2K40A 1NK2P 4CCNA 3ZPLA 5FHPA 1LEBA 3BG3A 4D9JA 3G71I 1NTCA 2LLKA 3OYKA 5EGOA 4G7HF 2EWNA 4A0XA 2QEXI 3CDIA 1VQ8I 1YJWI 1SGMA 4I09A 2ZSHB 4A3KJ 3FZVA 3LL7A 3ZXSA 2KDZA 3ABLH 3ZCOA 4Y7NJ 1WSUA 1MSEC 1UHMA 2KQRA 1T39A 4DOZA 2ECCA 3M1EA 3RKWA 2E2IJ 2K9MA 4AWXB 2EILH 3TQNA 3HSRA 3LSJA 4XM3A 3G6EI 1UCRA 2EZHA 1VQPI 1K79A 2JTVA 2LDUA 5KNLA 2JSPA 2KZGA 2ME0A 1WI3A 4M71A 2HKOA 2IS1A 4BS9A 2HGCA 3OYDA 2RVCA 1EA3A 2QENA 4N4OB 3GTMJ 1MBGA 2PQ8A 3H0DA 3BZCA 1HSJA 4M6XA 3GTLJ 4E70A 4I7HA 3QAHA 5EZHA 4XSZF 5EGOB 1ZYRF 2HOSA 4CA0A 3LSRA 4RGUA 1ZK8A 2P81A 4IKFA 4FASD 4A3EJ 4L62A 4BHCA 5A2QZ 4G7OF 2IS6A 2W48A 1SVOA 2EBIA 1GV5A 2M0CA 3K7AJ 2DMQA 3K4MA 3Q9VA 3VPRA 3LAJA 2PBXA 5C3EJ 1REPC 3SXYA 4N9IA 4IHVA 2F4MB 3TO6A 2DMNA 3CLOA 3KX2A 4XNFA 2WAFA 1FTTA 3KLNA 2A6TA 4NDLA 4TV7A 1CQTA 3WE2A 5KK1A 3CCLI 1XS9A 3TW7A 3LSGA 2VODA 3SWHA 4XLNF 2CRGA 2IGKA 2BY3A 3FWEA 5FKKA 4YRVA 5D19A 4OAYA 4GFBA 4XK4A 2L02A 5FLVA 1X19A 3NQOA 4U9LA 4CGRA 5J8CA 3LWFA 5ILUA 2HTSA 1HOMA 2STTA 4I02A 3P9KA 3OOPA 5CXGA 3QOPA 2LYCA 4J01A 2CW7A 1AU7A 2ZOYA 2L4AA 2XAQA 4JBAA 3CUOA 2PG4A 2QQ9A 2W25A 2WAQA 5EJCA 4ZYDA 3CD6I 4DGWB 1X2MA 5FKMA 3NRGA 1SFEA 2Y48A 2M0MA 3VTIA 2Q24A 2XB5A 4KN7X 4M3GA 1HKQA 2K9NA 3NARA 1HCRA 3VODA 4L5EA 2Z9OA 2EIJH 3RKXA 4F91B 5DTDA 1IZ1A 5HAWA 3PNVA 3E5QA 3KKCA 4PJJA 3JRGA 2JVHA 2H94A 3PNTA 2L54A 1E3OC 1W5CC 5HLTA 2PZ9A 3W6JB 1JHFA 2BE5F 1R5GA 3LAPA 3L7WA 3D1NI 4A3GJ 5L3CA 2VBYA 5DCMA 3KIOA 3PIPF 2LD5A 2Z33A 4XONA 1GDTA 3SZTA 4KDPA 3NWTA 2WAQN 3L1PA 2DA5A 4LG3A 2NVTJ 4IQ4A 2CQQA 2WA0A 2FUG2 4JYKA 2O61A 4ANJA 4XIDA 2CU7A 3N4MA 1UFMA 4UNOA 2QWWA 2D1HA 1SFUA 5FKOA 2BVLA 4KISA 5CQGA 4PFOA 2H6CA 5E1WA 1YFHA 1L3LA 1WGXA 3JW4A 2DW4A 3QKXA 3M07A 1LB2A 4KA4A 1M1EB 3VVXA 5GP9A 4IVNA 3OYMA 1OYIA 4YFXF 1LDJA 3B81A 1D0YA 1U8BA 2B9SA 3PUBA 1QZZA 4IXAA 3J80K 5DCMB 5DM7F 3Q5FA 2BXYA 1AKHA 1MJ9A 5C4XJ 2R4GA 5LHGA 1HA8A 2GFNA 5LHIA 1DUXC 2NS8A 2A05A 5D6EA 1V5GA 4H0EA 2HYTA 4IHWA 1S29A 4FT8A 2QTQA 2KJBA 4WCGA 3W2VA 1UB9A 2L9SA 3L00A 1LVKA 3SFZA 4KYWA 1VNDA 1TLHB 3JRHA 2X51A 2X0LA 1XGMA 2EZIA 2WBMA 4A3DJ 3F8BA 1U8RA 1T95A 2ELJA 1YG2A 4ESBA 2BW3A 2EFQA 3GO5A 2P5KA 2LTPA 4CXFA 3HPGA 2RNJA 3DWLE 2EPFA 1G8XA 1X2NA 2DA6A 2XASA 1SAXA 1USSA 1J75A 4HDUA 4F92B 4U0WA 2M3AA 4JP0A 3W2WA 5LLQA 1BJZA 2LKSA 1RR8C 5BMZA 1APLC 1VQLI 4AYBA 2D2WA 3S3NA 2E19A 4IZZA 1F1ZA 4I76A 3J7YJ 2FQ3A 1AKHB 3VOEA 1Z6TA 4YIFA 1H89C 4DBRA 3MKWB 4ACIA 2YU9J 1D8JA 3LFKA 1HQCA 2FJ1A 2ID3A 1BIAA 2FBKA 1WJDA 1YW9A 2Z99A 2DJNA 2RC4A 3ABTA 2CUEA 2ZCWA 3IHUA 1TWFJ 3PFIA 5J1YA 4XR6A 1MZBA 5FLMJ 5D4SA 2L9VA 3B6CA 2WWYA 3BJ6A 5HVQC 1ZG1A 4ZJZA 4RGXA 3O6BB 1QVUA 2ELKA 1WQ2A 1QPMA 2BW3B 1T33A 3BJBA 4JX5A 3SZGA 3I59A 4OIQF 2VI6A 1TNSA 2KP6A 3V7SA 3HTAA 1GLNA 1Y0NA 1Z6RA 4CGZA 2IGNA 3KP7A 3S1MJ 4G12A 4LK1F 3G56A 1JKRC 4GGGA 3BLYA 3KKDA 4AYBN 4CCLA 1KU7A 4ZDPA 1X1CA 1DU6A 2XROA 1DDNA 4HV5A 4EJOA 3K4KA 2DOAA 1JI8A 1R58A 1IW7F 4NQWB 4DBQA 1POGA 1MBEA 2RREA 3RCOA 1VQOI 3BTCA 2A3SA 4KT5C 5H20A 2ZMEA 1TBXA 3S14J 2G7GA 1S7AA 4OMZA 1LKXA 2W24A 1YITI 5F27A 1WPKA 2BVMA 5JI6A 5E3NA 5AQCA 2Q1ZB 1R5ID 2MBFA 1I6HJ 1ZG5A 2GBYA 3CCQI 1UHSA 4LB5A 2FOKA 3I59B 4MEYF 2LF8A 3FXUA 4Q48A 3HL2A 3DTIA 3ON4A 1RZ4A 3ASOH 1U2WA 1SVMA 1UI6A 3C3WA 4DZPA 3V8LA 1XDUA 3ABUA 3C18A 1J5YA 4OIOF 3T1BA 5HBUA 4FX0A 4CCKA 2DJIA 4XRMA 2ZJ2A 3WG7H 4CH7A 2WUIA 2OAZA 2CSOA 1T8IA 2CGPA 2ZMEB 2QZ8A 1JUSA 3HGGA 2V7FA 2O9LA 2IJLA 2QQ8A 3RZDJ 4C2UA 5K5OA 3S17J 1RPWA 4DJAA 3OYHA 3RSNA 2DMTA 4PGHA 1LPQA 2ELHA 1S3JA 4ZTJA 2VPLA 2KKOA 3KZYA 3LJLA 1H8AC 3BT9A 3SDBA 2E1CA 2GZWA 4CZZA 2OUMA 2RAEA 2TCTA 2NS0A 2O8KA 2JJ7A 3QP5A 1MBKA 1WFXA 5EG0A 1R49A 1GXPA 3AQSA 5FGLA 1ZLJA 2V26A 1FY7A 3MNLA 4P96A 1TL8A 1TW2A 4IHYA 2L2OA 2CYYA 4M74A 3K4JA 3QPTA 3GEUA 4MQ9F 5TISC 5HS8A 1TWGJ 2Y9YA 4FQGA 1B1BA 1BIBA 1R1TA 2I5UA 1U78A 5FD6A 2TRTA 4WXHA 3BR6A 4OIPF 4CHUA 3S1NJ 1UI5A 2DYSH 1OCZH 3IC7A 1L0OC 1LFBA 4QIWN 2L9NA 5K58A 3H0GJ 4RBOA 5KAFC 1TTYA 4XLAA 1VQMI 2WADA 1BW6A 4IRVA 2ZBKA 5FRMA 5JLWA 1SD4A 2W82A 3F72A 2HZTA 5B66C 3KCCA 5EG0B 1G59A 2R7TA 1D8KA 3CCRI 2PMUA 1IGNA 1IRXA 4KMFA 5D1RA 4DNCA 3OYAA 1AWCA 1DGWY 3HOUJ 2Q0OA 3HIFA 4D1QA 1NG6A 2OBPA 3O2PE 2EA2A 2ZJQF 3KYLA 2STWA 2IU5A 2ZJPF 3D0SA 4RGSA 2R7DA 5FD5A 3EYIA 4LLNA 3M4OJ 3DFGA 1FWZA 1BA5A 4UUTA 1I5ZA 5IP6A 4FCYA 3HRSA 1J7KA 3I53A 1ZELA 3L9FA 4PGGA 4PZJA 4YELA 1TQPA 2XRNA 3KFWX 2QVOA 4GO1A 1LEAA 5JHFA 2IW5A 3KNWA 2WY7Q 3TDZC 2PFBA 2P7VB 3PNYA 5B5EC 5C44J 3GWZA 4N0BA 3AL0C 4YZEA 1ZTRA 3WU1B 4JL3A 2R7WA 2V9VA 5L3DA 1D0XA 4UUVA 3LA3A 2R7RA 2EZKA 2QSHX 1IC8A 2JMWA 1T0FA 4HV6A 5GTIC 1G3TA 4G8XA 2FNAA 3CUQC 2JA6J 3H3ZA 2KLOA 3CJQB 1P4WA 1QRYA 4JNNA 2GM4A 4ICHA 2CW8A 3IWZA 2M1BA 5CVIA 6PAXA 3IP4B 4A6EA 3CWRA 3AG2H 4I2OA 2VBZA 2UXXA 5CJ9A 4E7SA 5K7FA 2MH2A 4DIQA 2E36A 1Z3XA 2PMHA 1W5TA 3ZRGA 1P7IA 2KHMA 2LKPA 2HWVA 3E0JB 3BCAA 3OL4A 4E7IA 4V2FA 2K7LA 2VBXA 4OD4A 2L4MA 3K2AA 4A0YA 4HLXA 4IRGA 2VQCA 3TL4X 3OMYA 1P4AA 1JT6A 3G1LA 4NHJA 3HIMA 1FP1D 3K70D 3WTZA 1IXRC 2XC7A 3ELKA 5HLGA 4FISA 4NC6A 1Z7LA 2W85A 5CPRB 2UXIA 3HRTA 3TO9A 1OMIA 5E18F 3DKXA 5IYCJ 2LY9A 2A6EF 3HKZA 4IF4A 2ZY9A 2DFEA 2FXAA 3ZMUA 4IHSA 2DDBA 4HPQA 4D5CA 3MCZA 5IPAA 1IO2A 3ZQHA 3ZGKA 2J5PA 3E5XA 3TDUC 3S2DJ 1XB4A 1PUEE 2OZUA 3KETA 4BDYA 3DCFA 3MZYA 3N05A 1KU3A 3KEOA 1Z21A 4E6KG 2CUZA 1QHHD 3WHBA 3CESA 5HLIA 4MNUA 2K4BA 2XGCA 3V8JA 2XGEA 3OIQA 3S3MA 2G7LA 4GYGA 2P4WA 3HJEA 1FPQA 2PMZA 2K85A 3R0JA 1ZRFA 5CXIA 2DTRA 3GFMA 1ENHA 4II3A 1GXQA 1E17A 3BQZA 4XKBA 1QO0D 3WODF 2QA4I 2DG7A 2VXZA 3FDYA 1K61A 1X4OA 1ULYA 4DYQA 2QSGX 4L0ZB 1FT9A 4RAZA 1SVLA 4E7HA 4R79A 3ABMH 1K7AA 1I1SA 2JRTA 3OYEA 3OWTA 4G6DA 4ON0A 3L2RA 2A5YB 9ANTA 3BJAA 2MYSA 1Z67A 4GCVA 1Z3YA 2VL8A 3H92A 1IN8A 3A1YA 4BYYA 5CQEA 5GAGJ 1IDZA 4H4KC 2Z16A 3GZNB 3K69A 4XRSG 1YIJI 1JTXA 5HODA 4F55A 2PFVA 1O3RA 3AAFA 3HE0A 1H88C 2PN6A 2K9LA 2NNYA 1XSDA 1Y56A 4HQEA 3JCUC 2R7XA 3E6MA 3LSKA 1IXCA 2KMUA 2FRHA 1FSEA 1P7JA 1ZHFA 4IEJA 3DU6A 2IA2A 1LNWA 4UVBA 3ZMTA 1W0TA 2PMZN 1IV6A 3LSTA 5LRRA 3DPTA 1K83J 1EKEA 2OPTA 3F8FA 2QGUA 2MABA 3IL2A 4HX4A 3QPSA 2VXDA 2VJJA 4XKCA 1FOWA 3GUDA 3TW6A 2FE3A 2QBYA 2K27A 1YTYA 1N25A 2L3DA 4KUMA 2VUMJ 2A6HF 1JUPA 4BJ5C 1Z0XA 1J59A 1U5TA 3D5LA 1KYZA 3RQIA 2GIVA 4EM0B 2XPWA 4XBFA 1YI2I 3GFJA 3C2GA 3RDIA 1WCMJ 4HAMA 4LJZF 2UXPA 1LFUP 4EEFG 3SYTA 4ESFA 2W00A 3JAMK 3ISPA 4L9TA 2OF7A 5ED4A 3WTYC 4PUSA 2DA3A 1RESA 3BPXA 5HS7A 3CLQA 1JXSA 4F52A 1WWXA 2LFBA 3ZQ7A 3LSPA 3A01A 2ZCMA 3LWJA 3QRFF 2D6YA 3FK7A 2QBYB 4Y3OA 4KICA 4O6JA 3DEEA 4EJWA 5L3FA 5DUKA 5J3LA 3MZHA 3AQTA 1FBQA 4EATA 2H27A 2R7SA 4BAYA 1XMKA 1U5TB 5FJ8J 1W1WE 4PJLA 1IJWC 5D5WB 1ZKGA 4NB5A 2JA7J 3DU5A 4IJAA 4BKXA 2L0KA 3B6AA 1DGRM 1MJBA 2FOWA 1IG7A 1FX7A 2K86A 3OR1C 2VKDA 3ON2A 4UB8C 3U21A 1XMAA 2CUFA 2EFWA 2XHKA 4V19K 1BI0A 4CO8A 2NVXJ 4XL9A 2W4SA 1R71A 3GTGJ 1EH6A 2DPDA 2P5VA 1GV2A 3IH3A 4BXFA 1Y1VJ 1MMGA 3MQ0A 3A01B 4JKZA 1Y1WJ 4OMYA 1W7PA 3ABKH 4BJ6C 3IKVA 1YO5C 4LIVA 4CUGA 2ECBA 2VLAA 1FTZA 5CVVA 1HF0A 2FSWA 4I0BA 3S8PA 5BOXA 3P7NA 1ZGJA 2LF7A 5FO5A 5E3MA 1XGNA 2MSYA 4Q47A 1D5VA 1FC3A 4CSWA 5ICFA 2HQNA 5IP9J 3BJOA 5F64A 3PASA 1RRJA 3OYFA 5LEKA 3ZQLA 5M3FJ 5EEHA 3CTAA 3FXKA 5E20A 4MTDA 3ZQFA 2L7MP 3I9V2 3L2CA 1KA8A 3M8FA 3KEQA 3SEQA 2EFPA 2I8DA 5BNGA 1BBYA 4RLFA 2DK8A 4ESJA 2HXIA 3RTRA 2R5YA 1S8NA 1Z7UA 3HOYJ 5B1BH 1JKPC 2E7WA 1W7PB 2OQRA 4F93B 4IOAF 1DPRA 4L9VA 5EF6A 4HG2A 3OOUA 2WV1A 3DLAA 5B1AH 5DCFA 3MFKA 2X6XA 1PVEA 4CCJA 4EQQA 2DQRA 3GCMA 1NHAA 1S9HA 4KIGA 3WTXC 1TWAJ 4LMYA 2YU3A 2VE9A 3I64A 2B1EA 5DAJA 2OQGA 1G3SA 3JRDA 1XC5A 2IGOA 1E2XA 2QWTA 3LOCA 3PQKA 3FXMA 1OCTC 2IS4A 2DA1A 1MH4A 4AVZA 5DV5A 4CICA 2KJCA 2HVQA 2VOPA 4BL0B 2OU2A 2VC1A 1F9NA 2IT0A 2YUSA 2GXGA 2CQ7A 3SEZA 1N78A 2UV1A 3EUAA 1B8IA 3HG9A 4OAZA 2R5YB 3J7AO 4BBSJ 3JAMZ 5EEAA 3B02A 1SFXA 1R4MB 2DPUA 3VWBA 1IN7A 3K9TA 4WWCA 1FYMA 2ADUA 1UMQA 2MW8A 2XKPA 3HBLA 5HNFA 2QIBA 2L7FP 1BR4A 2WAEA 3EUHA 4OIRF 2DFHA 1ZGAA 2KZVA 3BP8A 2Z5UA 3DXJF 3MMYB 4E7ZA 1FLIA 5ICEA 2BGCA 3GZIA 2QKMB 1KQ8A 3VUQA 2E1MB 1FOKA 2X6YA 2B7EA 5E1XA 2O3FA 3BNIA 2H8WA 4FETA 4Z6YA 4S05A 1R5HA 1FIAA 4GCTA 3RPUA 4ZDOA 2Y0MA 3PM1A 1OCPA 2XAUA 1BI2A 4E7LA 4C9YA 2VQHA 2V1XA 3L2WA 2GUHA 3CJDA 1EF4A 1W36D 1YS7A 1FIPA 3NEUA 3GLXA 3MZ8A 1B8IB 1BI3A 2CMPA 3HOSA 4FHTA 1G3YA 2OTJI 1RC9A 3FF5A 1AOYA 2CQKA 4X6AJ 1BN5A 4HX8A 3J7ZI 1U6GA 2H6BA 4ETSA 3COAC 4ABZA 3FX3A 4IX7A 4LD5A 2M4GA 4MQVA 2G3BA 2IEKA 1K6YA 4MFEA 3GEZA 2G7HA 3H1CA 4LGWA 5TJJA 3ZMSA 2FMYA 1FBUA 1IAWA 3HXLA 3AG1H 3RH2A 2YR2A 1OR7A 1U9OA 3PFYA 4B44A 4AVPA 3LQQA 3CMEI 4XOTA 2CG4A 1W7PD 1IN6A 1JHHA 1R9TJ 4IHXA 2QKLB 2MLKA 5BS6A 3S93A 1O3SA 1W0UA 5IYDJ 4NC8A 2ZMEC 2DT6A 1V4RA 3VFZA 2M87A 5D8LB 2IA1A 1KONA 1MDMA 2K02A 5M5XJ 4IRIA 3ZP5A 4BHPA 2MLGA 3I55I 4FE4A 1P4XA 1MIJA 1XPXA 2VJ5A 4B1RA 2DFFA 3BTJA 3S1QJ 1FYKA 2JUCA 1TT0A 3G1OA 4EJUA 4MEXF 1XDSA 2E7XA 5JHUA 1A31A 3FXOA 5GAEJ 4M3FA 1JKQC 1SEUA 4HNUA 3KYDB 1ETYA 1EH7A 3VYSB 1E0EA 3LHQA 2G9WA 3C2HA 4MLOA 3OV8A 4ZH4F 2JT1A 4ENMA 4ENJA 5L3BA 2EQRA 2ZSIB 4G6TB 1YW7A 4BUPA 3KZIC 1ZARA 3HRUA 3U1KA 5D6FA 4EMSA 2LBFA 3BCGA 3NPIA 2L7KA 3W6VA 4A12A 4XQFA 1J0RA 1MDMB 1T38A 1HC8A 4DQ2A 3M9AA 1QVTA 4BE0A 5CVRA 4B09A 2P0WA 3KP5A 3EDPA 3VSKA 5FKLA 3GX4X 3I5UA 2HVSA 4BU2A 3BHQA 2GXBA 1OPCA 1IRFA 2GQQA 4PJMA 3VP5A 3HTJA 4NQWA 1QZYA 4MHGA 4O3MA 2XB0X 3U2RA 2H1LA 5FKNA 2MG4A 1BR2A 4BDZA 2R92J 2UWMA 1KYWA 2HTJA 5HDKA 3DBHB 4MTEA 4BY1J 5HSZA 3LQRA 4YIIA 4C30A 1VQ5I 3O8GA 3M7GA 3KZ9A 2LBFB 1H9GA 2R93J 1IRZA 2QLZA 3LA7A 2Y2ZA 3Q3SA 5FB2A 1IDYA 2F07A 2A69F 3K0LA 2F5FA 2BHYA 3FXRA 3JTHA 2ZXWH 2IAIA 2FMLA 2LK2A 2OV7A 2V6CA 3ML6A 2GXAA 1YHQI 4UV8A 4JQFA 3BY6A 3A03A 1KGSA 3BROA 3GVAA 3MEXA 3RPUD 4GDFA 1HBXG 4OWRB 2R7UA 4PSWA 2BHZA 1OLTA 3HSFA 2CV2A 2XIGA 3QWLA 2K9SA 5E79C 2AXTC 4HEA2 3I4PA 4RB3C 4X1EA 5DEQA 2V1UA 2X9DA 3WU0A 2VT3A 2X1EA 4EM1A 3BDDA 2BV6A 4BQQA 1G3WA 3BR3A 3ZMVA 3BPVA 4U0YA 1GT0C 1ITYA 1V54H 3A0HC 2ZKZA 4I6ZA 3VDXA 1ODDA 2VE8A 2MA3A 2Z1DA 3K6GA 4P55A 3FISA 3NWSA 3V7CA 4BEHA 1MSFC 3RD3A 1VQ4I 2LR8A 2KIFA 4D0PA 4D5FA 2MGQA 4WIBA 2KPMA 1FMWA 3Q0WA 1HLVA 3DTEA 2G0EA 4YFNF 2GAUA 4EGYA 4PCQA 3ROUA 3H5NA 3ZQCA 1T0FC 5IY5H 4ITVA 4AC0A 3VSLA 2CFXA 3E97A 2XF6A 3J80Z 3PO2J 1E3HA 2VT2A 4A3FJ 1PUFB 2LY1A 3GMEA 3K4BA 2CJJA 2Q2EA 3A4CA 2VQGA 3JREA 1J2XA 1YS6A 3FMRA 5IT3A 4A2UA 3P9TA 5H9TA 3G1MA 1P6RA 1O3QA 3P5JA 3K2ZA 2ACJA 1K4SA 3L09A 2ISYA 3OIPA 3HZJA 1VQ6I 3PQJA 3WGIA 2HZDA 3MN2A 2L01A 5AIPA 4BEHB 2O0YA 3HUGA 4LB6B 2NP3A 4EJTA 1YYVA 4A69C 5E8GA 4U7DA 1ON2A 5HDGA 1A6QA 3X2QH 3IAS2 4BY7J 2XRLA 4A5MA 2E71A 1A04A 3TO7A 3TBIA 3V8KA 2V9PA 3GTPJ 4AIKA 3VYRB 5FLXK 5JR3A 1NH3A 2E1NA 5CYVA 2W84A 4M72A 5J4YA 2Q2EB 3ZQGA 1JJ8C 3S15J 3ERMA 3HDDA 1F5TA 3C7JA 3KE2A 2X85A 5KVRA 2AQFA 1XSVA 2DA2A 5GADJ 4K2EA 5GAHJ 3IAM2 1T98A 5LRSA 5CVUA 2XV4S 4IQJA 1SANA 2M8EA 4B3XA 4GFKA 3TGNA 1Y0UA 3S1RJ 1VQ9I 3F21A 3HUGB 2F5EA 5ICCA 3E6CC 1R23A 3FIWA 4UDSA 2UXUA 4KIFA 4NUBA 2ZCXA 2HDDA 5HNHA 2EK5A 4L18B 1LVAA 2HYFA 4ZZLA 3CF2A 4GRIA 4B48A 2ZXJA 4HSTA 3HYIA 2EB7A 3JSPA 3RYRA 2VC0A 5J4VA 4MK6A 1EH8A 3CDHA 1SAUA 4HKUA 2DMUA 4QLCU 2DG8A 2B63J 5KHDA 1U9NA 4JOMA 1YIOA 3CCVI 4IHTA 2V79A 2XDVA 1TZLA 5CKTA 2VB6A 3HEFA 5IT9K 3NXCA 3T8TA 3RKQA 4P9UA 3FKIJ 5LEJA 1YRNA 2AS5F 3ULQB 2WY8Q 1Y8RB 4HBLA 4IRHA 5K5QA 5K7ZA 1BL0A 3A2KA 1FMVA 4G94A 2XSDC 3PPBA 2HNHA 3BG6A 5BPIA 4ME9A 4I99C 3MVPA 4YG2F 1KQ0A 2RNGA 3DP7A 2BBYA 3MWMA 3WHCA 2EFNA 4OINF 2BY0A 3SZPA 4XRSA 1A6IA 3AG4H 1UJ8A 3WTVC 1RIOH 3DTKA 1VI0A 3C1DA 4IO9F 1BJAA 4HF0A 4GCLA 4P5OA 3VIBA 1OFCX 4AIJA 3G3ZA 3HOTA 2MH9A 2FX0A 3HM5A 3G2BA 1TQMA 1YJ9I 4XLFA 1VTNC 2ZJRF 2VONA 1X1PA 4BACA 3TKYA 2E2HJ 1YRNB 3OYLA 4LK0F 3IWFA 1ETWA 1U5TC 1Y6IA 2QQAA 2XF5A 3JRAA 1WJEA 3PSFA 5J6XA 4CCOA 3EETA 4WXCA 2AQEA 3H3VK 2OZ6A 3F9KA 1ON1A 3IUOA 2DYRH 3BOQA 5LHHA 4D7MA 2LNBA 3ZQIA 3WTTC 1MD0A 1TT5B 1OYWA 2BZTA 2X6WA 2EV6A 4LLGF 1MW7A 4CYDA 4V2GA 3OS0A 1I3AA 3Q0UA 2XAJA 2DTZA 1DP3A 1TNTA 4FX4A 3IH2A 4LOCA 1FP2A 3ZN1A 3CMYA 2RASA 2HVRA 1HXDA 1XD7A 2X1DA 3FXJA 1WVRA 3M1CA 1WH7A 2LH9A 1ACIA 2EV5A 2XPVA 4MGRA 4B4CA 2R0QC 1QU3A 1MNEA 3GFLA 2FJI1 3EGQA 3GXOA 3DV8A 1XTAA 2L7ZA 4Y17A 2P7CB 1S6LA 2GLOA 4A3LJ 2FBIA 3U1DA 1TWCJ 4W97A 4U9NA 1WJAA 3OY9A 2XVCA 2XDNA 1G2HA 2LC2A 4RDUA 3BCBA 3LNQA 3HOVJ 5HDNA 2QYOA 1WH5A 3K4NA 4U7BA 2EIKH 4HNTA 1X3UA 4Q4ZF 4WX9A 4BHBA 4ENNA 4HF2A 4GXOA 2A5WA 3I4MJ 5F0FA 2FA5A 4G9YA 1K6OA 2UXHA 2JPBA 2F5DA 2DCEA 1WZ2A 4XN0A 3R4KA 1SD7A 1LE8A 5DS9A 1J09A 1MJAA 4KWAA 1R36A 4NBQA 4XN3A 2OTLI 5AONA 3I3LA 3ZQQA 1ZR2A 4CCMA 4I98B 1O4XA 2A2FX 2ZNYA 2DA4A 3PL8A 5IT9Z 3V6GA 1AA7A 2VKVA 4OOIA 2DT7B 5F04A 3MKZA 4KMUX 4RAYA 2YVHA 2KT0A 2HOEA 4HA8A 2M7AA 3DF8A 2G7SA 3C07A 1JGSA 2CQXA 2RQQA 1O7LA 2JA2A 4EGZA 4DW6A 3ANGA 2ETHA 4I01A 1XCVA 2KRFA 3PSIA 1H0MA 2ICWG 2ISZA 2YX4A 3QODA 4W1UA 3QYFA 1MBJA 3H9JA 3R6SA 2FU4A 1LE8B 2IRFG 1MMAA 2G7UA 3OSGA 4A3CJ 1D1AA 2IGMA 4RB2C 5AIQA 2AXLA 2O03A 3UKGA 1B72A 2PJPA 5KCMA 3WTWC 1V5FA 3RQ4A 5A2QK 1JE8A 1LUJB 2Y0SA 3A0BC 3OYGA 1U3EM 3CCYA 3BTLA 4N9HA 4U88A 5JVGF 3JRFA 2PJRA 2R7ZJ 2HS5A 1PP7U 1D3YA 4GFLA 2YSRA 2E1MC 2YVEA 1R00A 3CCSI 2BYVE 1RUOA 3NI7A 1X1BA 1QNTA 1A5JA 5M5YJ 2ZNZA 2PX9A 3E7QA 2HEOA 4M73A 4BH9A 5FRNA 1K4TA 1TC3C 1RKTA 3N97A 5DD4A 2F6CA 1RETA 5FMPA 3JTGA 3PUFA 4GYIA 4A3IJ 3DPLC 1YQAA 5EFYA 4UHTA 2O8XA 1RKWA 5HS9A 1GVJA 1HKSA 4ENKA 4CDGA 1FOXA 4PJNA 2ZCNA 3E3VA 2VASA 1X1DA 1B72B 3EUHC 4M3DA 2DT5A 3SQNA 4DZJA 5H6RA 2Z3YA 3VW1A 2Y0SN 2PJRB 1OCRH 3KZZA 3BWGA 2YS9A 2M45A 3QP6A 1YW8A 4UUSA 1ZG3A 4UVCA 2W1OA 3FKJA 1KU9A 3F8MA 2JQ7A 3NRVA 4Y33A 3V78A 3HGYA 1ETVA 4R8HA 2YVXA 3DLLF 2RGVA 5L3EA 1IUYA 3K4LA 2M34A 4ZYHA 2OC6A 4AC6A 2UXNA 3HHGA 5J1RA 3K1PA 1FJLA 2RHAA 3CO7C 3NNRA 2HFHA 1O3TA 1P2FA 1UELB 2ID6A 3RZOJ 4AU7A 2KRHA 2WV0A 3TOAA 1R6RA 4RAGA 2XAHA 3FM5A 3GTQJ 1XSXA 1I3QJ 3J81K 3LFUA 4NC7A 4YFKF 1T2KA 4CZCA 4O5VA 4RMNA 5J47A 3GF2A 1DU0A 5DM6F 1OR7C 4G6QA 4M6YA 1SFOJ 5CW8A 1OJLA 3E7LA 4XKVA 2IS2A 2XSJC 4UUSB 2B3WA 2NOJB 3F8CA 4U0VA 2OA4A 4RB0A 1ZGWA 2A07F 3NAUA 2LY2A 3P9CA 2IBDA 2NVUB 4LITA 1X3ZB 1Z05A 3KEYA 1MH3A 1SMYF 2NAZA 4J00A 2JK3A 1BW5A 5GPAA 4HW0A 4Y13A 2ESHA 1R22A 4AIHA 4HF1A 2UZKA 4IOCF 3LSMA 3SFIA 2F4OB 3WGHA 4LG0A 2ZXHA 3IRRA 2FNPA 4ZDLA 2CV0A 1HKTA 2IPQX 3BG5A 3PJRA 1YOVB 2HR3A 1WJ5A 4A5NA 3O3KA 3K10A 3H9QA 4BQNA 3S2WA 4RA2A 3JRBA 2GA2A 2CUJA 2NYXA 4EJVA 5ICGA 1X58A 3HOXJ 2DA7A 2H09A 3KP3A 5CLSA 1CF7A 2M9HA 2OCCH 2FBHA 1HW5A 2LSOA 4BNCA 4BQAA 3HC7A 2P6TA 3FHNA 1S72I 2CQNA 3BR5A 1Y8QB 3BZ6A 3JRCA 3QU6A 2C6YA 5E1ZB 4AIDA 2A61A 1FEXA 3E1SA 2UUZA 1ZLKA 4B8XA 2RV8A 4LG0B 5LGUA 2IA0A 1MMDA 2VN2A 1V55H 2R7OA 3H3UA 4RLQA 3R60A 4NN1A 2VJ4A 1FBSA 5EDNA 3HOWJ 2GENA 1MGTA 4LLLA 3WE3A 3VOKA 2WB1A 1D1CA 2DU9A 2K4JA 5F0HA 3VVYA 4II2A 3FBIB 2DDAA 4L5IA 1UG2A 2NP5A 3H35A 4ASNA 2F5VA 3WG9A 3IV5A 3I0TA 1CF7B 3J7AY 2DQLA 4AF5A 2HU9A 3I54A 3RKYA 2EFOA 5LD2C 4HLYA 4QTRA 5K1YA 3CRJA 4QWQA 3GW2A 2H8RA 3DPUA 4S0HB 2HQRA 3DQVC 3CMMA 1QHGA 3JSOA 2E5ZA 4KIBA 3GBGA 3W2AA 4DYCA 5J8FA 3WGGA 1OKRA 4C3IJ 5IP7J 3FMQA 3OYJA 4MXMA 4I0AA 4M3BA 2CH0A 3AFHA 2DN0A 2EINH 3CCMI 1LQ1A 1LDKB 2PEXA 5CVJA 1QQIA 2R7FA 2VPRA 3K1MA 2WB1N 4L9NA 4XLPF 2Z2SB 2RKHA 1IF1A 2K3FA 1MMSA 2FD5A 3KP2A 1MNMC 1MMNA 3QOEA 1I50J 3J81Z 2FBQA 3T6NA 2K5CA 1H9TA 4PK4A 5JFRA 4MFDA 3CCEI 4FTHA 3U9GA 2V1DA 1WJCA 2HYJA 3GTKJ 3H9GA 2O5RA 2OD5A 2HPIA 3DBLB 4GCKA 4XICA 2JZYA 2LG4A 3OYCA 2YPRA 2M4KA 3ASNH 2HQ5A 3GZ5A 2D1VA 2MC4A 1CGPA 4C3HJ 1ETOA 4A3BJ 3IH4A 3FRQA 2AO9A 2KISA 3LSHA 4D7NA 5JLXA 2JA8J 4JX6A 4QSHA 1X1AA 4BQOA 1B6AA 3GFIA 4AUXA 3BC8A 4PXIA 1EJ9A 2CWEA 3T8RA 1JGGA 3ZN0A 1ZREA 1IRGA 3HOZJ 3FK6A 3K70C 5F1RA 2IVMA 4ZTFA 1O57A 3E5UA 1YJNI 4L9JA 2JN6A 1WRJA 3CP8A 1T6SA 1XX5A 3JR9A 1BM9A 3F6OA 3BRUA 1HSTA 2OJED 4MIMA 2P6SA 1A35A 5FROA 4M9ZA 1SD5A 1RI7A 1YLFA 5E3OA 5D8KB 2ZXIA 1HDDC 2LMDA 2JVGA 2PLYA 2KFDA 3LSIA 1VQKI 3OYNA 2VQLA 2QCOA 1Z77A 5J40A 1QZEA 2QQBA 4EM2A 1FZPB 2Q8KA 4A0ZA 3AG3H 2DI3A 1QPIA 1VZ0A 3VYUB 3FM3A 5GPCA 3TP0A 5L3GA 3QPLA 1ZRDA 5K5RA 1TQIA 5H6QA 2ZOZA 3S16J 2EH3A 1DP7P 2ESNA 5TRDA 4AD9A 1AHDP 1FYLA 3OS1A 1F36A 1JUMA 2W57A 2F5CA 1XGOA 1XN7A 1XMXA 3M3YJ 1B9MA 3Q0VA 1TW3A 1LJ9A 4RS8A 2QKOA 3AKZA 5M3MJ 1W5SA 3NS4A 5BQTA 2NNNA 1B9NA 3CJRB 1SMTA 2M8GX 4L0YB 3D5RC 2W7NA 4BE1A 3RI4A 2QF7A 4HNVA 3HTHA 2DODA 5F0CA 3OYBA 2HKUA 1PUFA 2ZFWA 2JPCA 3BR0A 3DEWA 5DUIA 5ILSA 4S04A 1PJRA 5J1UA 4KITB 2YX7A 2RN7A 2V4JC 3QQAA 1KZHA 4PSXA 1B59A 2Y75A 4G7ZF 3BQYA 1T08B 2D5VA 3BR1A 2NVQJ 2E60A 4CYCA 1WJBA 5H2FC 3F1BA 4BE2A 4LFUA 1ZH5A 1YE9A 4B3AA 2NS7A 3OYIA 2EA4A 3DKYA 1IUFA 3G4SI 4BBRJ 1NG7A 2X4HA 4BXXJ 3T5XA 1MBHA 2H1KA 2CS3A 1KU2A 2X1CA 2PBIA 3G73A 4NELA 2IP2A 1SFKA 3MKLA 1GHCA 4HX7A 5BPDA 3S3OA 2GIZA 3CC7I 1VQNI 1W4MA 4P1WA 2F2EA 1WKMA 2LOOA 3C2BA 2KIMA 5LBQA 4ZYEA 2QUFA 2L9RA 1G6NA 4XOPA 3W6KB 1GUUA 2KDOA 5EEGA 5E8IA 4DVYP 3CMAI 3GZ6A 4HDVA 5IOYA 5LGNA 3TP3A 1LDDA 1QBJA 2FQ4A 2EZLA 4CYCB 4UXNA 2Y69H 2R3SA 2ZC2A 2GWRA 3GTJJ 3VW2A 2JWTA 5EZGA 1R1VA 5JVTA 2E35A 3DEUA 3F22A 1ORKA 5E17F 1LFPA 1RUNA 2VJIA 1YX5A 3JSJA 1OYYA 1V3FA 1XG1A 2DO7A 2MFZA 3V4GA 1JKOC 4HYEA 3CZ6A 2XUBA 2OERA 1HW1A 2Y30A 3KLOA 4NNJA 3TOBA 5D18A 1FNNA 1RR7A 3HB9A 3ZMZA 1BOAA 3K1NA 4Y52J 2VKEA 3A02A 1MKMA 1R4NB 1I6XA 3T0YA 4QPOA 1JT0A 1HW2A 1S5LC 1R7JA 2XGDA 3M8EA 2HKXA 1P92A 1V5EA 2DFIA 5M5WJ 2W53A 1ZQ3P 4IPAA 3H5RA 5LGTA 3V42A 2O7OA 3CQZJ 3FXQA 2HOTA 4XKWA 2D45A 2KRCA 3MD2A 4P9FA 2DXIA 1BI1A 2V57A 2OCEA 1PP8F 1I27A 2HI3A 3E6DA 2XPUA 1XGSA 1OQYA 3OR2C 2K3PA 4F7ZA 5IOZA 2HPMA 4Y15A 2O6GE 2COBA 3HSEA 4A93J 3BR2A 3D5SC 4C2TA 2VOOA 1Z91A 1N77A 4EV0A 3L2VA 1BR1A 3F8NA 3ZMDA 3H5AA 2F4IA 3F3XA 4ZC3A 4LIUA 3HHHA 2LP0A 4A6DA 5F6FA 3I58A 2PI0A 2NXNB 1P9QC 1QA6A 1STZA 3QYEA 3UR3C 4JX4A 3M8JA 3F6VA 1U0JA 2ZB9A 4OU0A 3F23A 1A36A 2CW0F 3VEPA 3LMMA 4C2MA 1WHUA 3K4CA 3CC4I 1Y39A 3K8PC 1USTA 4UY8I 4WK8F 1F43A 4KN4X 4RGRA 1Z9CA 1Q1HA 2IXSA 3EQLF 4L5JA 1JJ6C 1ETQA 2EV0A 2ZO4A 1VFCA 2XAGA 4HOBA 1DQUA 3TMOA 3BTIA 4B43A 3VW0A 3FHZA 2L5QA 2XF7A 4XLCA 2DMPA 5K7HA 3G7RA 2UXOA 1MBFA 2XAFA 4PDKA 3MKYB 1TWHJ 4M9SA 1ERDA 2BXZA 4Q5SF 3L2UA 2O7TA 4MO7A 4XMYA 1PDNC 4ZYGA 2P8TA 2GOXB 3CDLA 4OD5A 2DBBA 2E2JJ 3I71A 5KAIC 4M6VA 3FXLA 5C4JJ 3FBNB 5E3LA 4A3MJ 1JTYA 5D5VB 3SHFA 5HLHA 4ZZDA 2RQPA 4PFPA 3KYCB 2CV1A 1ZRCA 2J5OA 2LRDA 1D1BA 3RJPA 1S7OA 2ZFUA 1D5YA 2WGBA 3CP2A 4DYRA 2OI8A 4UB6C 1IN5A 3IUVA 2JSCA 2Y31A 3HRMA 4M3EA 2KL4A 3R0AA 1KQ9A 3IKTA 1HDPA 3E6BA 5F08A 2E5NA 3EPZA 3PIOF 2LKXA 4AM3A 2GA1A 2WTEA 3DKWA 3O8HA 2KIQA 2EIMH 3CCJI 2ME6A 2F48A 2NVYJ 1BOBA 4WF2A 1B4AA 4XLEA 5FLXZ 4XSXF 5FGMA 2BY2A 3VVZA 4X0GA 4E7JA 1W36C 1FSHA 2HOAA 3Q9SA 3ERED 2BOLA 2HQAA 5EYRA 2V6EA 4YEJA 3CJTB 3ECOA 3DBRB 1SC7A 2VIXA 1X4PA 2EJRA 3S32A 5DDGA 4RAFA 3B73A 2MC3A 2V1NA 3QU3A 5LFAA 1YX3A 1T56A 2DAOA 2HDWA 3HTUA 3H36A 1MNDA 2M2EA 3LA2A 2LREA 1UHWA 2X6OA 4KT6A 4BXUA 2LVSA 5ERIA 3GTOJ 3CJNA 3R61A 1EV7A 1FOYA 3OL3A 5D5UB 5FFXA 3ZR8X 1VF9A 3S5RA 5FFZA 3BG9A 5B3SH 3KPHA 2WC2A 1O7FA 4HQMA 4B47A 5C4YA 2GOMA 3MAJA 3ECHA 5D5XB 1G4DA 1X3WB 3L2QA 4XORA 3FMSA 3O60A 4EVIA 1WJFA 1ETKA 3W3CA 3I4NJ 1I1GA 2COMA 4JK1X 3RPQA 3HKZN 1C0WA 2KIUA 3HTIA 2I10A 1UZCA 1OCOH 2VKHA 3GLLA 1IXSB 4KFCA 3UNGC 2MD5A 3QYBA 2VBWA 1S7EA 2RDPA 3VB2A 1SD6A 3CO6C 2E34A 1VQ7I 3WTUC 5IYBJ 4QPQA 3F0CA 1WI9A 3P9IA 4RM2A 4KNYA 3DPJA 3EUPA 4U87A 2B0LA 2JA5J 3ANPA 1ONVA 2DOFA 4N4NB 3CUQA 4Y4RA 3KP6A 3CF5F 3BG7A 4HZFA 3OSFA 1Q1VA 2R5ZA 1ETXA 3WU2C 2N8GA 5TGTA 4A3JJ 3QBMA 4XRFA 4C2MJ 3QPHA 5DD8A 4IL6C 1IN4A 4J19A 2BEOA 2A68F 3CCUI 2NRAC 3GYHX 4HRIA 3V7RA 2R7QA 4M9XA 4ZYAA 4RB1A 1BC8C 4Z2YA 3TEDA 3OS2A 3REOA 2X48A 2XKOA 3HTSB 4KJZA 2CFOA 1J9IA 1GVDA 4PJ0C 1RNLA 1UG0A 3I56I 2NOGA 1TP4A 3AL0B 2AHQA 1D0ZA 1QGPA 4FE7A 3EUKL 1IV8A 2DOEA 2FF4A 3KP4A 4YIRX 2REKA 4XLHA 3WTSC 1PYVA 2FEZA 2M5WA 3CUQB 1N75A 2M7BA 5D4RA 1E3PA 1ZR4A 2E1OA 2HXOA 1ZAOA 5F1JA 4RM3A 2R5ZB 2BY1A 2QOPA 1BC7C 2P5LC 1K78A 1ZN2A 1R1UA 3CC2I 1OCCH 2DK5A 1NK3P 1F4KA 2V9KA 3RIRA
chains in the Genus database with same CATH topology
4I6ZA 5K7FA 3GBGA 4DYCA 1P7IA 5IP7J 4C3IJ 4MXMA 4M3BA 3FISA 1MSFC 3RD3A 4V2FA 2DN0A 2LR8A 3K2AA 3JRIA 4D5FA 2MGQA 3Q0WA 1HLVA 3VOXA 2G0EA 1JT6A 3G1LA 2VPRA 2WB1N 4C3JJ 3SJMA 3HIMA 3OIOA 2FD5A 3ZQCA 1MNMC 4AC0A 1I50J 3T6NA 2FBQA 3PO2J 3ZOBA 2NX4A 4A3FJ 4FISA 3S2HJ 1PUFB 2UXIA 4MFDA 3SDGA 2CJJA 4FTHA 2Y9ZA 3JREA 3COLA 3PO3J 2HYJA 3GTKJ 5IYCJ 2K9QA 1NK2P 2K40A 2LY9A 3P9TA 5H9TA 4XICA 5FHPA 3G1MA 4GCKA 3BG3A 1NTCA 2HQ5A 2LLKA 4D5CA 5EGOA 5IPAA 3ZQHA 4C3HJ 1ETOA 4A3BJ 3IH4A 3MN2A 3S2DJ 3FRQA 2AO9A 4D7NA 5JLXA 2JA8J 4JX6A 4QSHA 3DCFA 2NP3A 1SGMA 4A3KJ 4A69C 4AUXA 4PXIA 2KDZA 3WHBA 4Y7NJ 1JGGA 1MSEC 4BY7J 2XRLA 2ECCA 2XGCA 2XGEA 2E2IJ 3HOZJ 3FK6A 2G7LA 3LSJA 5CXIA 2EZHA 3GTPJ 1ENHA 2DG7A 3BQZA 2ME0A 1WI3A 2JN6A 1K61A 4DYQA 3ZQGA 3JR9A 1JJ8C 3BRUA 3S15J 3HDDA 4MIMA 3GTMJ 1MBGA 2DA2A 5E3OA 3GTLJ 9ANTA 5EZHA 1HDDC 5EGOB 2HOSA 3LSRA 1ZK8A 1SANA 2P81A 4GFKA 2QCOA 1Z77A 3S1RJ 4A3EJ 4L62A 1IDZA 4XRSG 1QPIA 2W48A 2M0CA 1JTXA 1GV5A 2EBIA 3FIWA 2DMQA 3K7AJ 3VPRA 5HODA 2PBXA 2UXUA 3HE0A 4UDSA 5C3EJ 1H88C 2ZCXA 5GPCA 2HDDA 3TP0A 4IHVA 2DMNA 3QPLA 1FTTA 1P7JA 4IEJA 1IV6A 1W0TA 2PMZN 2ZOZA 4MK6A 3S16J 1K83J 2EH3A 4NDLA 2OPTA 1AHDP 4HKUA 2DMUA 1CQTA 2DG8A 3QPSA 1XS9A 1F36A 1JUMA 1U9NA 3TW7A 2B63J 3LSGA 2CRGA 3M3YJ 3TW6A 3HEFA 3NXCA 3Q0VA 5FKKA 5D19A 3RKQA 4GFBA 4XK4A 3FKIJ 1YRNA 2QKOA 5FLVA 2VUMJ 5M3MJ 1JUPA 5K7ZA 1Z0XA 1BL0A 4CGRA 2XSDC 1HOMA 2M8GX 3RQIA 2XPWA 3PPBA 5CXGA 4ME9A 2QF7A 3MVPA 4HNVA 3HTHA 1AU7A 5F0CA 1WCMJ 2HKUA 3WHCA 1PUFA 2UXPA 2ZOYA 3DEWA 3BR0A 1LFUP 4EEFG 4XRSA 1A6IA 5J1UA 2OF7A 1X2MA 1VI0A 5FKMA 3NRGA 3QQAA 2DA3A 4GCLA 1RESA 3BQYA 2D5VA 2Q24A 3VIBA 2XB5A 2LFBA 1OFCX 4M3GA 3BR1A 2K9NA 2NVQJ 3LSPA 3A01A 4CYCA 2ZCMA 3LWJA 3NARA 1HCRA 2D6YA 2FX0A 3HM5A 3F1BA 4L5EA 3FK7A 4B3AA 2NS7A 2E2HJ 1YRNB 5DTDA 1IUFA 5J3LA 5HAWA 3AQTA 1ETWA 4BBRJ 3KKCA 3JRAA 4BXXJ 3JRGA 1MBHA 2H1KA 5FJ8J 1IJWC 4NELA 1E3OC 1ZKGA 3MKLA 2JA7J 2PZ9A 3H3VK 4BKXA 2L0KA 3D1NI 4A3GJ 3B6AA 4D7MA 2LD5A 3ZQIA 1IG7A 3ON2A 3C2BA 1GDTA 2CUFA 2L9RA 2WAQN 3L1PA 2DA5A 2NVTJ 1GUUA 4V2GA 3Q0UA 2NVXJ 2DTZA 3GTGJ 2CQQA 5IOYA 3IH2A 4JYKA 4LOCA 1GV2A 3IH3A 3TP3A 1Y1VJ 4XIDA 2FQ4A 2EZLA 2CU7A 4CYCB 3A01B 3CMYA 1Y1WJ 2RASA 4JKZA 3GTJJ 1WH7A 5FKOA 3VW2A 2XPVA 4B4CA 2JWTA 5EZGA 2R0QC 1ORKA 2ECBA 1FTZA 3EGQA 1WGXA 1HF0A 2L7ZA 3JSJA 3QKXA 2GLOA 1XG1A 5E3MA 4A3LJ 1JKOC 3VVXA 2MSYA 1TWCJ 4W97A 5GP9A 5IP9J 2OERA 2Y30A 3B81A 2XDNA 5D18A 1U8BA 1G2HA 1RR7A 4RDUA 3HB9A 3LNQA 3HOVJ 3ZQLA 3PASA 5M3FJ 1WH5A 2VKEA 3A02A 1AKHA 4Y52J 5C4XJ 2GFNA 3ZQFA 2L7MP 1JT0A 2NS8A 2XGDA 3I4MJ 5F0FA 5BNGA 2HYTA 4IHWA 2UXHA 5M5WJ 2QTQA 2W53A 1ZQ3P 2HXIA 2R5YA 1LE8A 5DS9A 3HOYJ 3CQZJ 2O7OA 4KWAA 1VNDA 1JKPC 2HOTA 3JRHA 2EZIA 4A3DJ 5EF6A 3OOUA 2V57A 1ZR2A 2WV1A 1O4XA 2LTPA 2HI3A 2XPUA 3V6GA 2DA4A 1X2NA 1TWAJ 2DA6A 2VKVA 5IOZA 4A93J 5DAJA 2COBA 3JRDA 4JP0A 3BR2A 1XC5A 1BJZA 5F04A 1APLC 2QWTA 3LOCA 1OCTC 2E19A 2KT0A 2YVHA 2G7SA 2DA1A 3C07A 4I76A 1MH4A 1AKHB 2CQXA 1H89C 4ACIA 2LP0A 4DW6A 2YU9J 3ANGA 2FJ1A 2ID3A 2YUSA 2DJNA 4W1UA 2CUEA 1B8IA 4BBSJ 1MBJA 1TWFJ 5J1YA 2R5YB 1LE8B 5EEAA 4JX4A 5FLMJ 3OSGA 2ZB9A 4A3CJ 3B6CA 3UKGA 2MW8A 1UMQA 3HBLA 1B72A 2QIBA 1QVUA 2L7FP 2ELKA 1T33A 3BJBA 4JX5A 1F43A 2VI6A 3BTLA 3CCYA 2R7ZJ 3JRFA 3HTAA 1JJ6C 1ETQA 4GFLA 3GZIA 1VFCA 2YVEA 3NI7A 3VUQA 1A5JA 3S1MJ 4G12A 5M5YJ 3G56A 1JKRC 3BTIA 3BNIA 3VW0A 3KKDA 4AYBN 3E7QA 2DMPA 5K7HA 3G7RA 1FIAA 4GCTA 1DU6A 2UXOA 1MBFA 3PM1A 1OCPA 1TC3C 1TWHJ 1RKTA 2GUHA 1POGA 1MBEA 3CJDA 1EF4A 1FIPA 2O7TA 5FMPA 1RETA 3BTCA 4MO7A 1B8IB 3S14J 2G7GA 4A3IJ 5EFYA 1RKWA 3CDLA 5F27A 2E2JJ 1WPKA 4M6VA 2ZCNA 5E3NA 5C4JJ 5E3LA 4A3MJ 5AQCA 1JTYA 4X6AJ 1B72B 1I6HJ 4M3DA 2GBYA 4ABZA 1UHSA 4DZJA 2G3BA 2WGBA 3VW1A 2Y0SN 1D5YA 2IEKA 4MFEA 4DYRA 3ON4A 2OI8A 3IUVA 2YS9A 2Y31A 1UI6A 4M3EA 3RH2A 4DZPA 2LKXA 1HDPA 5F08A 1U9OA 4UUSA 3O8HA 1R9TJ 4IHXA 2ME6A 3HGYA 1ETVA 2NVYJ 3V78A 5HBUA 4XRMA 2WUIA 2M34A 1W0UA 5IYDJ 4AC6A 3VVZA 2HOAA 1JUSA 3HGGA 5J1RA 5EYRA 2O9LA 5M5XJ 1FJLA 2RHAA 3NNRA 3RZDJ 4FE4A 3S17J 1RPWA 3RZOJ 2ID6A 2DMTA 3GTQJ 1I3QJ 4B1RA 3BTJA 1T56A 3LJLA 3S1QJ 1H8AC 2M2EA 3BT9A 3G1OA 2X6OA 2RAEA 2TCTA 2LVSA 1DU0A 2JJ7A 5EG0A 1MBKA 2O8KA 3GTOJ 5FGLA 1SFOJ 3AQSA 5CW8A 4M3FA 1JKQC 1OJLA 3E7LA 4UUSB 3MNLA 1ETYA 1ZGWA 4IHYA 3LHQA 3NAUA 4MLOA 2IBDA 1VF9A 3GEUA 2EQRA 3S5RA 3BG9A 1TWGJ 1MH3A 2Y9YA 1BW5A 2JK3A 5GPAA 5C4YA 3BCGA 3NPIA 1U78A 3W6VA 2TRTA 1UI5A 3BR6A 3S1NJ 3SFIA 3O60A 1QVTA 1LFBA 4QIWN 5K58A 1ETKA 3I4NJ 3H0GJ 4RBOA 3BG5A 3HKZN 3HTIA 2I10A 1BW6A 5JLWA 5FKLA 3BHQA 1S7EA 3JRBA 5EG0B 5IYBJ 3F0CA 3VP5A 1IGNA 3HTJA 1X58A 3HOXJ 3DPJA 2DA7A 3EUPA 5D1RA 2XB0X 3HOUJ 5FKNA 2M9HA 2JA5J 2MG4A 3ANPA 2R92J 3OSFA 4BY1J 1Q1VA 5HSZA 2R5ZA 2IU5A 1ETXA 4A3JJ 2N8GA 3QBMA 4C2MJ 4J19A 3O8GA 3M4OJ 3KZ9A 3BR5A 2R93J 1BA5A 4UUTA 3JRCA 1IRZA 5IP6A 2Y2ZA 3Q3SA 4FCYA 1IDYA 1FEXA 2F07A 3TEDA 2IAIA 2LK2A 2X48A 4NN1A 5EDNA 3HOWJ 3KNWA 2GENA 1GVDA 3A03A 3VOKA 2NOGA 5C44J 4JL3A 4YZEA 1ZTRA 5F0HA 3VVYA 2AHQA 2NP5A 4FE7A 1UG2A 2K9SA 2EZKA 1IC8A 2JMWA 2REKA 3IV5A 4X1EA 2JA6J 4AF5A 2X9DA 1QRYA 4JNNA 2GM4A 4ICHA 1ZR4A 2E1OA 4QTRA 2HXOA 3BR3A 5F1JA 2R5ZB 2QOPA 1GT0C 3CRJA 1ITYA 3CWRA 1NK3P 2H8RA 4S0HB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4I6Z A;  5K7F A;  3GBG A;  4DYC A;  1P7I A;  5IP7 J;  4C3I J;  4MXM A;  4M3B A;  3FIS A;  1MSF C;  3RD3 A;  4V2F A;  2DN0 A;  2LR8 A;  3K2A A;  3JRI A;  4D5F A;  2MGQ A;  3Q0W A;  1HLV A;  3VOX A;  2G0E A;  1JT6 A;  3G1L A;  2VPR A;  2WB1 N;  4C3J J;  3SJM A;  3HIM A;  3OIO A;  2FD5 A;  3ZQC A;  1MNM C;  4AC0 A;  1I50 J;  3T6N A;  2FBQ A;  3PO2 J;  3ZOB A;  2NX4 A;  4A3F J;  4FIS A;  3S2H J;  1PUF B;  2UXI A;  4MFD A;  3SDG A;  2CJJ A;  4FTH A;  2Y9Z A;  3JRE A;  3COL A;  3PO3 J;  2HYJ A;  3GTK J;  5IYC J;  2K9Q A;  1NK2 P;  2K40 A;  2LY9 A;  3P9T A;  5H9T A;  4XIC A;  5FHP A;  3G1M A;  4GCK A;  3BG3 A;  1NTC A;  2HQ5 A;  2LLK A;  4D5C A;  5EGO A;  5IPA A;  3ZQH A;  4C3H J;  1ETO A;  4A3B J;  3IH4 A;  3MN2 A;  3S2D J;  3FRQ A;  2AO9 A;  4D7N A;  5JLX A;  2JA8 J;  4JX6 A;  4QSH A;  3DCF A;  2NP3 A;  1SGM A;  4A3K J;  4A69 C;  4AUX A;  4PXI A;  2KDZ A;  3WHB A;  4Y7N J;  1JGG A;  1MSE C;  4BY7 J;  2XRL A;  2ECC A;  2XGC A;  2XGE A;  2E2I J;  3HOZ J;  3FK6 A;  2G7L A;  3LSJ A;  5CXI A;  2EZH A;  3GTP J;  1ENH A;  2DG7 A;  3BQZ A;  2ME0 A;  1WI3 A;  2JN6 A;  1K61 A;  4DYQ A;  3ZQG A;  3JR9 A;  1JJ8 C;  3BRU A;  3S15 J;  3HDD A;  4MIM A;  3GTM J;  1MBG A;  2DA2 A;  5E3O A;  3GTL J;  9ANT A;  5EZH A;  1HDD C;  5EGO B;  2HOS A;  3LSR A;  1ZK8 A;  1SAN A;  2P81 A;  4GFK A;  2QCO A;  1Z77 A;  3S1R J;  4A3E J;  4L62 A;  1IDZ A;  4XRS G;  1QPI A;  2W48 A;  2M0C A;  1JTX A;  1GV5 A;  2EBI A;  3FIW A;  2DMQ A;  3K7A J;  3VPR A;  5HOD A;  2PBX A;  2UXU A;  3HE0 A;  4UDS A;  5C3E J;  1H88 C;  2ZCX A;  5GPC A;  2HDD A;  3TP0 A;  4IHV A;  2DMN A;  3QPL A;  1FTT A;  1P7J A;  4IEJ A;  1IV6 A;  1W0T A;  2PMZ N;  2ZOZ A;  4MK6 A;  3S16 J;  1K83 J;  2EH3 A;  4NDL A;  2OPT A;  1AHD P;  4HKU A;  2DMU A;  1CQT A;  2DG8 A;  3QPS A;  1XS9 A;  1F36 A;  1JUM A;  1U9N A;  3TW7 A;  2B63 J;  3LSG A;  2CRG A;  3M3Y J;  3TW6 A;  3HEF A;  3NXC A;  3Q0V A;  5FKK A;  5D19 A;  3RKQ A;  4GFB A;  4XK4 A;  3FKI J;  1YRN A;  2QKO A;  5FLV A;  2VUM J;  5M3M J;  1JUP A;  5K7Z A;  1Z0X A;  1BL0 A;  4CGR A;  2XSD C;  1HOM A;  2M8G X;  3RQI A;  2XPW A;  3PPB A;  5CXG A;  4ME9 A;  2QF7 A;  3MVP A;  4HNV A;  3HTH A;  1AU7 A;  5F0C A;  1WCM J;  2HKU A;  3WHC A;  1PUF A;  2UXP A;  2ZOY A;  3DEW A;  3BR0 A;  1LFU P;  4EEF G;  4XRS A;  1A6I A;  5J1U A;  2OF7 A;  1X2M A;  1VI0 A;  5FKM A;  3NRG A;  3QQA A;  2DA3 A;  4GCL A;  1RES A;  3BQY A;  2D5V A;  2Q24 A;  3VIB A;  2XB5 A;  2LFB A;  1OFC X;  4M3G A;  3BR1 A;  2K9N A;  2NVQ J;  3LSP A;  3A01 A;  4CYC A;  2ZCM A;  3LWJ A;  3NAR A;  1HCR A;  2D6Y A;  2FX0 A;  3HM5 A;  3F1B A;  4L5E A;  3FK7 A;  4B3A A;  2NS7 A;  2E2H J;  1YRN B;  5DTD A;  1IUF A;  5J3L A;  5HAW A;  3AQT A;  1ETW A;  4BBR J;  3KKC A;  3JRA A;  4BXX J;  3JRG A;  1MBH A;  2H1K A;  5FJ8 J;  1IJW C;  4NEL A;  1E3O C;  1ZKG A;  3MKL A;  2JA7 J;  2PZ9 A;  3H3V K;  4BKX A;  2L0K A;  3D1N I;  4A3G J;  3B6A A;  4D7M A;  2LD5 A;  3ZQI A;  1IG7 A;  3ON2 A;  3C2B A;  1GDT A;  2CUF A;  2L9R A;  2WAQ N;  3L1P A;  2DA5 A;  2NVT J;  1GUU A;  4V2G A;  3Q0U A;  2NVX J;  2DTZ A;  3GTG J;  2CQQ A;  5IOY A;  3IH2 A;  4JYK A;  4LOC A;  1GV2 A;  3IH3 A;  3TP3 A;  1Y1V J;  4XID A;  2FQ4 A;  2EZL A;  2CU7 A;  4CYC B;  3A01 B;  3CMY A;  1Y1W J;  2RAS A;  4JKZ A;  3GTJ J;  1WH7 A;  5FKO A;  3VW2 A;  2XPV A;  4B4C A;  2JWT A;  5EZG A;  2R0Q C;  1ORK A;  2ECB A;  1FTZ A;  3EGQ A;  1WGX A;  1HF0 A;  2L7Z A;  3JSJ A;  3QKX A;  2GLO A;  1XG1 A;  5E3M A;  4A3L J;  1JKO C;  3VVX A;  2MSY A;  1TWC J;  4W97 A;  5GP9 A;  5IP9 J;  2OER A;  2Y30 A;  3B81 A;  2XDN A;  5D18 A;  1U8B A;  1G2H A;  1RR7 A;  4RDU A;  3HB9 A;  3LNQ A;  3HOV J;  3ZQL A;  3PAS A;  5M3F J;  1WH5 A;  2VKE A;  3A02 A;  1AKH A;  4Y52 J;  5C4X J;  2GFN A;  3ZQF A;  2L7M P;  1JT0 A;  2NS8 A;  2XGD A;  3I4M J;  5F0F A;  5BNG A;  2HYT A;  4IHW A;  2UXH A;  5M5W J;  2QTQ A;  2W53 A;  1ZQ3 P;  2HXI A;  2R5Y A;  1LE8 A;  5DS9 A;  3HOY J;  3CQZ J;  2O7O A;  4KWA A;  1VND A;  1JKP C;  2HOT A;  3JRH A;  2EZI A;  4A3D J;  5EF6 A;  3OOU A;  2V57 A;  1ZR2 A;  2WV1 A;  1O4X A;  2LTP A;  2HI3 A;  2XPU A;  3V6G A;  2DA4 A;  1X2N A;  1TWA J;  2DA6 A;  2VKV A;  5IOZ A;  4A93 J;  5DAJ A;  2COB A;  3JRD A;  4JP0 A;  3BR2 A;  1XC5 A;  1BJZ A;  5F04 A;  1APL C;  2QWT A;  3LOC A;  1OCT C;  2E19 A;  2KT0 A;  2YVH A;  2G7S A;  2DA1 A;  3C07 A;  4I76 A;  1MH4 A;  1AKH B;  2CQX A;  1H89 C;  4ACI A;  2LP0 A;  4DW6 A;  2YU9 J;  3ANG A;  2FJ1 A;  2ID3 A;  2YUS A;  2DJN A;  4W1U A;  2CUE A;  1B8I A;  4BBS J;  1MBJ A;  1TWF J;  5J1Y A;  2R5Y B;  1LE8 B;  5EEA A;  4JX4 A;  5FLM J;  3OSG A;  2ZB9 A;  4A3C J;  3B6C A;  3UKG A;  2MW8 A;  1UMQ A;  3HBL A;  1B72 A;  2QIB A;  1QVU A;  2L7F P;  2ELK A;  1T33 A;  3BJB A;  4JX5 A;  1F43 A;  2VI6 A;  3BTL A;  3CCY A;  2R7Z J;  3JRF A;  3HTA A;  1JJ6 C;  1ETQ A;  4GFL A;  3GZI A;  1VFC A;  2YVE A;  3NI7 A;  3VUQ A;  1A5J A;  3S1M J;  4G12 A;  5M5Y J;  3G56 A;  1JKR C;  3BTI A;  3BNI A;  3VW0 A;  3KKD A;  4AYB N;  3E7Q A;  2DMP A;  5K7H A;  3G7R A;  1FIA A;  4GCT A;  1DU6 A;  2UXO A;  1MBF A;  3PM1 A;  1OCP A;  1TC3 C;  1TWH J;  1RKT A;  2GUH A;  1POG A;  1MBE A;  3CJD A;  1EF4 A;  1FIP A;  2O7T A;  5FMP A;  1RET A;  3BTC A;  4MO7 A;  1B8I B;  3S14 J;  2G7G A;  4A3I J;  5EFY A;  1RKW A;  3CDL A;  5F27 A;  2E2J J;  1WPK A;  4M6V A;  2ZCN A;  5E3N A;  5C4J J;  5E3L A;  4A3M J;  5AQC A;  1JTY A;  4X6A J;  1B72 B;  1I6H J;  4M3D A;  2GBY A;  4ABZ A;  1UHS A;  4DZJ A;  2G3B A;  2WGB A;  3VW1 A;  2Y0S N;  1D5Y A;  2IEK A;  4MFE A;  4DYR A;  3ON4 A;  2OI8 A;  3IUV A;  2YS9 A;  2Y31 A;  1UI6 A;  4M3E A;  3RH2 A;  4DZP A;  2LKX A;  1HDP A;  5F08 A;  1U9O A;  4UUS A;  3O8H A;  1R9T J;  4IHX A;  2ME6 A;  3HGY A;  1ETV A;  2NVY J;  3V78 A;  5HBU A;  4XRM A;  2WUI A;  2M34 A;  1W0U A;  5IYD J;  4AC6 A;  3VVZ A;  2HOA A;  1JUS A;  3HGG A;  5J1R A;  5EYR A;  2O9L A;  5M5X J;  1FJL A;  2RHA A;  3NNR A;  3RZD J;  4FE4 A;  3S17 J;  1RPW A;  3RZO J;  2ID6 A;  2DMT A;  3GTQ J;  1I3Q J;  4B1R A;  3BTJ A;  1T56 A;  3LJL A;  3S1Q J;  1H8A C;  2M2E A;  3BT9 A;  3G1O A;  2X6O A;  2RAE A;  2TCT A;  2LVS A;  1DU0 A;  2JJ7 A;  5EG0 A;  1MBK A;  2O8K A;  3GTO J;  5FGL A;  1SFO J;  3AQS A;  5CW8 A;  4M3F A;  1JKQ C;  1OJL A;  3E7L A;  4UUS B;  3MNL A;  1ETY A;  1ZGW A;  4IHY A;  3LHQ A;  3NAU A;  4MLO A;  2IBD A;  1VF9 A;  3GEU A;  2EQR A;  3S5R A;  3BG9 A;  1TWG J;  1MH3 A;  2Y9Y A;  1BW5 A;  2JK3 A;  5GPA A;  5C4Y A;  3BCG A;  3NPI A;  1U78 A;  3W6V A;  2TRT A;  1UI5 A;  3BR6 A;  3S1N J;  3SFI A;  3O60 A;  1QVT A;  1LFB A;  4QIW N;  5K58 A;  1ETK A;  3I4N J;  3H0G J;  4RBO A;  3BG5 A;  3HKZ N;  3HTI A;  2I10 A;  1BW6 A;  5JLW A;  5FKL A;  3BHQ A;  1S7E A;  3JRB A;  5EG0 B;  5IYB J;  3F0C A;  3VP5 A;  1IGN A;  3HTJ A;  1X58 A;  3HOX J;  3DPJ A;  2DA7 A;  3EUP A;  5D1R A;  2XB0 X;  3HOU J;  5FKN A;  2M9H A;  2JA5 J;  2MG4 A;  3ANP A;  2R92 J;  3OSF A;  4BY1 J;  1Q1V A;  5HSZ A;  2R5Z A;  2IU5 A;  1ETX A;  4A3J J;  2N8G A;  3QBM A;  4C2M J;  4J19 A;  3O8G A;  3M4O J;  3KZ9 A;  3BR5 A;  2R93 J;  1BA5 A;  4UUT A;  3JRC A;  1IRZ A;  5IP6 A;  2Y2Z A;  3Q3S A;  4FCY A;  1IDY A;  1FEX A;  2F07 A;  3TED A;  2IAI A;  2LK2 A;  2X48 A;  4NN1 A;  5EDN A;  3HOW J;  3KNW A;  2GEN A;  1GVD A;  3A03 A;  3VOK A;  2NOG A;  5C44 J;  4JL3 A;  4YZE A;  1ZTR A;  5F0H A;  3VVY A;  2AHQ A;  2NP5 A;  4FE7 A;  1UG2 A;  2K9S A;  2EZK A;  1IC8 A;  2JMW A;  2REK A;  3IV5 A;  4X1E A;  2JA6 J;  4AF5 A;  2X9D A;  1QRY A;  4JNN A;  2GM4 A;  4ICH A;  1ZR4 A;  2E1O A;  4QTR A;  2HXO A;  3BR3 A;  5F1J A;  2R5Z B;  2QOP A;  1GT0 C;  3CRJ A;  1ITY A;  3CWR A;  1NK3 P;  2H8R A;  4S0H B; 
#chains in the Genus database with same CATH topology
 2MD0 A;  4WXD A;  4HSR A;  2JUG A;  1XCB A;  2QM3 A;  2XGX A;  3VYT B;  3IRQ A;  3BZK A;  3JRI A;  2JRM A;  1UAA A;  5ILV A;  4UV9 A;  4BGD A;  4E4H A;  3VOX A;  5DYM A;  4C3J J;  3SJM A;  1I39 A;  1OIS A;  3OIO A;  3EYY A;  5HOO A;  2DLL A;  1DPU A;  3ZOB A;  2NX4 A;  4F3Q A;  2CO5 A;  3RYP A;  1Z1D A;  2HDC A;  3S2H J;  3ESW B;  3SDG A;  2M30 A;  4BJT A;  3HPH A;  2Y9Z A;  2HYG D;  3PO3 J;  3COL A;  5GTH C;  2R7V A;  4R1H A;  2K9Q A;  4UVA A;  2QSF X;  2TDX A;  3ONQ A;  4E7K A;  1K78 B;  2K40 A;  1NK2 P;  4CCN A;  3ZPL A;  5FHP A;  1LEB A;  3BG3 A;  4D9J A;  3G71 I;  1NTC A;  2LLK A;  3OYK A;  5EGO A;  4G7H F;  2EWN A;  4A0X A;  2QEX I;  3CDI A;  1VQ8 I;  1YJW I;  1SGM A;  4I09 A;  2ZSH B;  4A3K J;  3FZV A;  3LL7 A;  3ZXS A;  2KDZ A;  3ABL H;  3ZCO A;  4Y7N J;  1WSU A;  1MSE C;  1UHM A;  2KQR A;  1T39 A;  4DOZ A;  2ECC A;  3M1E A;  3RKW A;  2E2I J;  2K9M A;  4AWX B;  2EIL H;  3TQN A;  3HSR A;  3LSJ A;  4XM3 A;  3G6E I;  1UCR A;  2EZH A;  1VQP I;  1K79 A;  2JTV A;  2LDU A;  5KNL A;  2JSP A;  2KZG A;  2ME0 A;  1WI3 A;  4M71 A;  2HKO A;  2IS1 A;  4BS9 A;  2HGC A;  3OYD A;  2RVC A;  1EA3 A;  2QEN A;  4N4O B;  3GTM J;  1MBG A;  2PQ8 A;  3H0D A;  3BZC A;  1HSJ A;  4M6X A;  3GTL J;  4E70 A;  4I7H A;  3QAH A;  5EZH A;  4XSZ F;  5EGO B;  1ZYR F;  2HOS A;  4CA0 A;  3LSR A;  4RGU A;  1ZK8 A;  2P81 A;  4IKF A;  4FAS D;  4A3E J;  4L62 A;  4BHC A;  5A2Q Z;  4G7O F;  2IS6 A;  2W48 A;  1SVO A;  2EBI A;  1GV5 A;  2M0C A;  3K7A J;  2DMQ A;  3K4M A;  3Q9V A;  3VPR A;  3LAJ A;  2PBX A;  5C3E J;  1REP C;  3SXY A;  4N9I A;  4IHV A;  2F4M B;  3TO6 A;  2DMN A;  3CLO A;  3KX2 A;  4XNF A;  2WAF A;  1FTT A;  3KLN A;  2A6T A;  4NDL A;  4TV7 A;  1CQT A;  3WE2 A;  5KK1 A;  3CCL I;  1XS9 A;  3TW7 A;  3LSG A;  2VOD A;  3SWH A;  4XLN F;  2CRG A;  2IGK A;  2BY3 A;  3FWE A;  5FKK A;  4YRV A;  5D19 A;  4OAY A;  4GFB A;  4XK4 A;  2L02 A;  5FLV A;  1X19 A;  3NQO A;  4U9L A;  4CGR A;  5J8C A;  3LWF A;  5ILU A;  2HTS A;  1HOM A;  2STT A;  4I02 A;  3P9K A;  3OOP A;  5CXG A;  3QOP A;  2LYC A;  4J01 A;  2CW7 A;  1AU7 A;  2ZOY A;  2L4A A;  2XAQ A;  4JBA A;  3CUO A;  2PG4 A;  2QQ9 A;  2W25 A;  2WAQ A;  5EJC A;  4ZYD A;  3CD6 I;  4DGW B;  1X2M A;  5FKM A;  3NRG A;  1SFE A;  2Y48 A;  2M0M A;  3VTI A;  2Q24 A;  2XB5 A;  4KN7 X;  4M3G A;  1HKQ A;  2K9N A;  3NAR A;  1HCR A;  3VOD A;  4L5E A;  2Z9O A;  2EIJ H;  3RKX A;  4F91 B;  5DTD A;  1IZ1 A;  5HAW A;  3PNV A;  3E5Q A;  3KKC A;  4PJJ A;  3JRG A;  2JVH A;  2H94 A;  3PNT A;  2L54 A;  1E3O C;  1W5C C;  5HLT A;  2PZ9 A;  3W6J B;  1JHF A;  2BE5 F;  1R5G A;  3LAP A;  3L7W A;  3D1N I;  4A3G J;  5L3C A;  2VBY A;  5DCM A;  3KIO A;  3PIP F;  2LD5 A;  2Z33 A;  4XON A;  1GDT A;  3SZT A;  4KDP A;  3NWT A;  2WAQ N;  3L1P A;  2DA5 A;  4LG3 A;  2NVT J;  4IQ4 A;  2CQQ A;  2WA0 A;  2FUG 2;  4JYK A;  2O61 A;  4ANJ A;  4XID A;  2CU7 A;  3N4M A;  1UFM A;  4UNO A;  2QWW A;  2D1H A;  1SFU A;  5FKO A;  2BVL A;  4KIS A;  5CQG A;  4PFO A;  2H6C A;  5E1W A;  1YFH A;  1L3L A;  1WGX A;  3JW4 A;  2DW4 A;  3QKX A;  3M07 A;  1LB2 A;  4KA4 A;  1M1E B;  3VVX A;  5GP9 A;  4IVN A;  3OYM A;  1OYI A;  4YFX F;  1LDJ A;  3B81 A;  1D0Y A;  1U8B A;  2B9S A;  3PUB A;  1QZZ A;  4IXA A;  3J80 K;  5DCM B;  5DM7 F;  3Q5F A;  2BXY A;  1AKH A;  1MJ9 A;  5C4X J;  2R4G A;  5LHG A;  1HA8 A;  2GFN A;  5LHI A;  1DUX C;  2NS8 A;  2A05 A;  5D6E A;  1V5G A;  4H0E A;  2HYT A;  4IHW A;  1S29 A;  4FT8 A;  2QTQ A;  2KJB A;  4WCG A;  3W2V A;  1UB9 A;  2L9S A;  3L00 A;  1LVK A;  3SFZ A;  4KYW A;  1VND A;  1TLH B;  3JRH A;  2X51 A;  2X0L A;  1XGM A;  2EZI A;  2WBM A;  4A3D J;  3F8B A;  1U8R A;  1T95 A;  2ELJ A;  1YG2 A;  4ESB A;  2BW3 A;  2EFQ A;  3GO5 A;  2P5K A;  2LTP A;  4CXF A;  3HPG A;  2RNJ A;  3DWL E;  2EPF A;  1G8X A;  1X2N A;  2DA6 A;  2XAS A;  1SAX A;  1USS A;  1J75 A;  4HDU A;  4F92 B;  4U0W A;  2M3A A;  4JP0 A;  3W2W A;  5LLQ A;  1BJZ A;  2LKS A;  1RR8 C;  5BMZ A;  1APL C;  1VQL I;  4AYB A;  2D2W A;  3S3N A;  2E19 A;  4IZZ A;  1F1Z A;  4I76 A;  3J7Y J;  2FQ3 A;  1AKH B;  3VOE A;  1Z6T A;  4YIF A;  1H89 C;  4DBR A;  3MKW B;  4ACI A;  2YU9 J;  1D8J A;  3LFK A;  1HQC A;  2FJ1 A;  2ID3 A;  1BIA A;  2FBK A;  1WJD A;  1YW9 A;  2Z99 A;  2DJN A;  2RC4 A;  3ABT A;  2CUE A;  2ZCW A;  3IHU A;  1TWF J;  3PFI A;  5J1Y A;  4XR6 A;  1MZB A;  5FLM J;  5D4S A;  2L9V A;  3B6C A;  2WWY A;  3BJ6 A;  5HVQ C;  1ZG1 A;  4ZJZ A;  4RGX A;  3O6B B;  1QVU A;  2ELK A;  1WQ2 A;  1QPM A;  2BW3 B;  1T33 A;  3BJB A;  4JX5 A;  3SZG A;  3I59 A;  4OIQ F;  2VI6 A;  1TNS A;  2KP6 A;  3V7S A;  3HTA A;  1GLN A;  1Y0N A;  1Z6R A;  4CGZ A;  2IGN A;  3KP7 A;  3S1M J;  4G12 A;  4LK1 F;  3G56 A;  1JKR C;  4GGG A;  3BLY A;  3KKD A;  4AYB N;  4CCL A;  1KU7 A;  4ZDP A;  1X1C A;  1DU6 A;  2XRO A;  1DDN A;  4HV5 A;  4EJO A;  3K4K A;  2DOA A;  1JI8 A;  1R58 A;  1IW7 F;  4NQW B;  4DBQ A;  1POG A;  1MBE A;  2RRE A;  3RCO A;  1VQO I;  3BTC A;  2A3S A;  4KT5 C;  5H20 A;  2ZME A;  1TBX A;  3S14 J;  2G7G A;  1S7A A;  4OMZ A;  1LKX A;  2W24 A;  1YIT I;  5F27 A;  1WPK A;  2BVM A;  5JI6 A;  5E3N A;  5AQC A;  2Q1Z B;  1R5I D;  2MBF A;  1I6H J;  1ZG5 A;  2GBY A;  3CCQ I;  1UHS A;  4LB5 A;  2FOK A;  3I59 B;  4MEY F;  2LF8 A;  3FXU A;  4Q48 A;  3HL2 A;  3DTI A;  3ON4 A;  1RZ4 A;  3ASO H;  1U2W A;  1SVM A;  1UI6 A;  3C3W A;  4DZP A;  3V8L A;  1XDU A;  3ABU A;  3C18 A;  1J5Y A;  4OIO F;  3T1B A;  5HBU A;  4FX0 A;  4CCK A;  2DJI A;  4XRM A;  2ZJ2 A;  3WG7 H;  4CH7 A;  2WUI A;  2OAZ A;  2CSO A;  1T8I A;  2CGP A;  2ZME B;  2QZ8 A;  1JUS A;  3HGG A;  2V7F A;  2O9L A;  2IJL A;  2QQ8 A;  3RZD J;  4C2U A;  5K5O A;  3S17 J;  1RPW A;  4DJA A;  3OYH A;  3RSN A;  2DMT A;  4PGH A;  1LPQ A;  2ELH A;  1S3J A;  4ZTJ A;  2VPL A;  2KKO A;  3KZY A;  3LJL A;  1H8A C;  3BT9 A;  3SDB A;  2E1C A;  2GZW A;  4CZZ A;  2OUM A;  2RAE A;  2TCT A;  2NS0 A;  2O8K A;  2JJ7 A;  3QP5 A;  1MBK A;  1WFX A;  5EG0 A;  1R49 A;  1GXP A;  3AQS A;  5FGL A;  1ZLJ A;  2V26 A;  1FY7 A;  3MNL A;  4P96 A;  1TL8 A;  1TW2 A;  4IHY A;  2L2O A;  2CYY A;  4M74 A;  3K4J A;  3QPT A;  3GEU A;  4MQ9 F;  5TIS C;  5HS8 A;  1TWG J;  2Y9Y A;  4FQG A;  1B1B A;  1BIB A;  1R1T A;  2I5U A;  1U78 A;  5FD6 A;  2TRT A;  4WXH A;  3BR6 A;  4OIP F;  4CHU A;  3S1N J;  1UI5 A;  2DYS H;  1OCZ H;  3IC7 A;  1L0O C;  1LFB A;  4QIW N;  2L9N A;  5K58 A;  3H0G J;  4RBO A;  5KAF C;  1TTY A;  4XLA A;  1VQM I;  2WAD A;  1BW6 A;  4IRV A;  2ZBK A;  5FRM A;  5JLW A;  1SD4 A;  2W82 A;  3F72 A;  2HZT A;  5B66 C;  3KCC A;  5EG0 B;  1G59 A;  2R7T A;  1D8K A;  3CCR I;  2PMU A;  1IGN A;  1IRX A;  4KMF A;  5D1R A;  4DNC A;  3OYA A;  1AWC A;  1DGW Y;  3HOU J;  2Q0O A;  3HIF A;  4D1Q A;  1NG6 A;  2OBP A;  3O2P E;  2EA2 A;  2ZJQ F;  3KYL A;  2STW A;  2IU5 A;  2ZJP F;  3D0S A;  4RGS A;  2R7D A;  5FD5 A;  3EYI A;  4LLN A;  3M4O J;  3DFG A;  1FWZ A;  1BA5 A;  4UUT A;  1I5Z A;  5IP6 A;  4FCY A;  3HRS A;  1J7K A;  3I53 A;  1ZEL A;  3L9F A;  4PGG A;  4PZJ A;  4YEL A;  1TQP A;  2XRN A;  3KFW X;  2QVO A;  4GO1 A;  1LEA A;  5JHF A;  2IW5 A;  3KNW A;  2WY7 Q;  3TDZ C;  2PFB A;  2P7V B;  3PNY A;  5B5E C;  5C44 J;  3GWZ A;  4N0B A;  3AL0 C;  4YZE A;  1ZTR A;  3WU1 B;  4JL3 A;  2R7W A;  2V9V A;  5L3D A;  1D0X A;  4UUV A;  3LA3 A;  2R7R A;  2EZK A;  2QSH X;  1IC8 A;  2JMW A;  1T0F A;  4HV6 A;  5GTI C;  1G3T A;  4G8X A;  2FNA A;  3CUQ C;  2JA6 J;  3H3Z A;  2KLO A;  3CJQ B;  1P4W A;  1QRY A;  4JNN A;  2GM4 A;  4ICH A;  2CW8 A;  3IWZ A;  2M1B A;  5CVI A;  6PAX A;  3IP4 B;  4A6E A;  3CWR A;  3AG2 H;  4I2O A;  2VBZ A;  2UXX A;  5CJ9 A;  4E7S A;  5K7F A;  2MH2 A;  4DIQ A;  2E36 A;  1Z3X A;  2PMH A;  1W5T A;  3ZRG A;  1P7I A;  2KHM A;  2LKP A;  2HWV A;  3E0J B;  3BCA A;  3OL4 A;  4E7I A;  4V2F A;  2K7L A;  2VBX A;  4OD4 A;  2L4M A;  3K2A A;  4A0Y A;  4HLX A;  4IRG A;  2VQC A;  3TL4 X;  3OMY A;  1P4A A;  1JT6 A;  3G1L A;  4NHJ A;  3HIM A;  1FP1 D;  3K70 D;  3WTZ A;  1IXR C;  2XC7 A;  3ELK A;  5HLG A;  4FIS A;  4NC6 A;  1Z7L A;  2W85 A;  5CPR B;  2UXI A;  3HRT A;  3TO9 A;  1OMI A;  5E18 F;  3DKX A;  5IYC J;  2LY9 A;  2A6E F;  3HKZ A;  4IF4 A;  2ZY9 A;  2DFE A;  2FXA A;  3ZMU A;  4IHS A;  2DDB A;  4HPQ A;  4D5C A;  3MCZ A;  5IPA A;  1IO2 A;  3ZQH A;  3ZGK A;  2J5P A;  3E5X A;  3TDU C;  3S2D J;  1XB4 A;  1PUE E;  2OZU A;  3KET A;  4BDY A;  3DCF A;  3MZY A;  3N05 A;  1KU3 A;  3KEO A;  1Z21 A;  4E6K G;  2CUZ A;  1QHH D;  3WHB A;  3CES A;  5HLI A;  4MNU A;  2K4B A;  2XGC A;  3V8J A;  2XGE A;  3OIQ A;  3S3M A;  2G7L A;  4GYG A;  2P4W A;  3HJE A;  1FPQ A;  2PMZ A;  2K85 A;  3R0J A;  1ZRF A;  5CXI A;  2DTR A;  3GFM A;  1ENH A;  4II3 A;  1GXQ A;  1E17 A;  3BQZ A;  4XKB A;  1QO0 D;  3WOD F;  2QA4 I;  2DG7 A;  2VXZ A;  3FDY A;  1K61 A;  1X4O A;  1ULY A;  4DYQ A;  2QSG X;  4L0Z B;  1FT9 A;  4RAZ A;  1SVL A;  4E7H A;  4R79 A;  3ABM H;  1K7A A;  1I1S A;  2JRT A;  3OYE A;  3OWT A;  4G6D A;  4ON0 A;  3L2R A;  2A5Y B;  9ANT A;  3BJA A;  2MYS A;  1Z67 A;  4GCV A;  1Z3Y A;  2VL8 A;  3H92 A;  1IN8 A;  3A1Y A;  4BYY A;  5CQE A;  5GAG J;  1IDZ A;  4H4K C;  2Z16 A;  3GZN B;  3K69 A;  4XRS G;  1YIJ I;  1JTX A;  5HOD A;  4F55 A;  2PFV A;  1O3R A;  3AAF A;  3HE0 A;  1H88 C;  2PN6 A;  2K9L A;  2NNY A;  1XSD A;  1Y56 A;  4HQE A;  3JCU C;  2R7X A;  3E6M A;  3LSK A;  1IXC A;  2KMU A;  2FRH A;  1FSE A;  1P7J A;  1ZHF A;  4IEJ A;  3DU6 A;  2IA2 A;  1LNW A;  4UVB A;  3ZMT A;  1W0T A;  2PMZ N;  1IV6 A;  3LST A;  5LRR A;  3DPT A;  1K83 J;  1EKE A;  2OPT A;  3F8F A;  2QGU A;  2MAB A;  3IL2 A;  4HX4 A;  3QPS A;  2VXD A;  2VJJ A;  4XKC A;  1FOW A;  3GUD A;  3TW6 A;  2FE3 A;  2QBY A;  2K27 A;  1YTY A;  1N25 A;  2L3D A;  4KUM A;  2VUM J;  2A6H F;  1JUP A;  4BJ5 C;  1Z0X A;  1J59 A;  1U5T A;  3D5L A;  1KYZ A;  3RQI A;  2GIV A;  4EM0 B;  2XPW A;  4XBF A;  1YI2 I;  3GFJ A;  3C2G A;  3RDI A;  1WCM J;  4HAM A;  4LJZ F;  2UXP A;  1LFU P;  4EEF G;  3SYT A;  4ESF A;  2W00 A;  3JAM K;  3ISP A;  4L9T A;  2OF7 A;  5ED4 A;  3WTY C;  4PUS A;  2DA3 A;  1RES A;  3BPX A;  5HS7 A;  3CLQ A;  1JXS A;  4F52 A;  1WWX A;  2LFB A;  3ZQ7 A;  3LSP A;  3A01 A;  2ZCM A;  3LWJ A;  3QRF F;  2D6Y A;  3FK7 A;  2QBY B;  4Y3O A;  4KIC A;  4O6J A;  3DEE A;  4EJW A;  5L3F A;  5DUK A;  5J3L A;  3MZH A;  3AQT A;  1FBQ A;  4EAT A;  2H27 A;  2R7S A;  4BAY A;  1XMK A;  1U5T B;  5FJ8 J;  1W1W E;  4PJL A;  1IJW C;  5D5W B;  1ZKG A;  4NB5 A;  2JA7 J;  3DU5 A;  4IJA A;  4BKX A;  2L0K A;  3B6A A;  1DGR M;  1MJB A;  2FOW A;  1IG7 A;  1FX7 A;  2K86 A;  3OR1 C;  2VKD A;  3ON2 A;  4UB8 C;  3U21 A;  1XMA A;  2CUF A;  2EFW A;  2XHK A;  4V19 K;  1BI0 A;  4CO8 A;  2NVX J;  4XL9 A;  2W4S A;  1R71 A;  3GTG J;  1EH6 A;  2DPD A;  2P5V A;  1GV2 A;  3IH3 A;  4BXF A;  1Y1V J;  1MMG A;  3MQ0 A;  3A01 B;  4JKZ A;  1Y1W J;  4OMY A;  1W7P A;  3ABK H;  4BJ6 C;  3IKV A;  1YO5 C;  4LIV A;  4CUG A;  2ECB A;  2VLA A;  1FTZ A;  5CVV A;  1HF0 A;  2FSW A;  4I0B A;  3S8P A;  5BOX A;  3P7N A;  1ZGJ A;  2LF7 A;  5FO5 A;  5E3M A;  1XGN A;  2MSY A;  4Q47 A;  1D5V A;  1FC3 A;  4CSW A;  5ICF A;  2HQN A;  5IP9 J;  3BJO A;  5F64 A;  3PAS A;  1RRJ A;  3OYF A;  5LEK A;  3ZQL A;  5M3F J;  5EEH A;  3CTA A;  3FXK A;  5E20 A;  4MTD A;  3ZQF A;  2L7M P;  3I9V 2;  3L2C A;  1KA8 A;  3M8F A;  3KEQ A;  3SEQ A;  2EFP A;  2I8D A;  5BNG A;  1BBY A;  4RLF A;  2DK8 A;  4ESJ A;  2HXI A;  3RTR A;  2R5Y A;  1S8N A;  1Z7U A;  3HOY J;  5B1B H;  1JKP C;  2E7W A;  1W7P B;  2OQR A;  4F93 B;  4IOA F;  1DPR A;  4L9V A;  5EF6 A;  4HG2 A;  3OOU A;  2WV1 A;  3DLA A;  5B1A H;  5DCF A;  3MFK A;  2X6X A;  1PVE A;  4CCJ A;  4EQQ A;  2DQR A;  3GCM A;  1NHA A;  1S9H A;  4KIG A;  3WTX C;  1TWA J;  4LMY A;  2YU3 A;  2VE9 A;  3I64 A;  2B1E A;  5DAJ A;  2OQG A;  1G3S A;  3JRD A;  1XC5 A;  2IGO A;  1E2X A;  2QWT A;  3LOC A;  3PQK A;  3FXM A;  1OCT C;  2IS4 A;  2DA1 A;  1MH4 A;  4AVZ A;  5DV5 A;  4CIC A;  2KJC A;  2HVQ A;  2VOP A;  4BL0 B;  2OU2 A;  2VC1 A;  1F9N A;  2IT0 A;  2YUS A;  2GXG A;  2CQ7 A;  3SEZ A;  1N78 A;  2UV1 A;  3EUA A;  1B8I A;  3HG9 A;  4OAZ A;  2R5Y B;  3J7A O;  4BBS J;  3JAM Z;  5EEA A;  3B02 A;  1SFX A;  1R4M B;  2DPU A;  3VWB A;  1IN7 A;  3K9T A;  4WWC A;  1FYM A;  2ADU A;  1UMQ A;  2MW8 A;  2XKP A;  3HBL A;  5HNF A;  2QIB A;  2L7F P;  1BR4 A;  2WAE A;  3EUH A;  4OIR F;  2DFH A;  1ZGA A;  2KZV A;  3BP8 A;  2Z5U A;  3DXJ F;  3MMY B;  4E7Z A;  1FLI A;  5ICE A;  2BGC A;  3GZI A;  2QKM B;  1KQ8 A;  3VUQ A;  2E1M B;  1FOK A;  2X6Y A;  2B7E A;  5E1X A;  2O3F A;  3BNI A;  2H8W A;  4FET A;  4Z6Y A;  4S05 A;  1R5H A;  1FIA A;  4GCT A;  3RPU A;  4ZDO A;  2Y0M A;  3PM1 A;  1OCP A;  2XAU A;  1BI2 A;  4E7L A;  4C9Y A;  2VQH A;  2V1X A;  3L2W A;  2GUH A;  3CJD A;  1EF4 A;  1W36 D;  1YS7 A;  1FIP A;  3NEU A;  3GLX A;  3MZ8 A;  1B8I B;  1BI3 A;  2CMP A;  3HOS A;  4FHT A;  1G3Y A;  2OTJ I;  1RC9 A;  3FF5 A;  1AOY A;  2CQK A;  4X6A J;  1BN5 A;  4HX8 A;  3J7Z I;  1U6G A;  2H6B A;  4ETS A;  3COA C;  4ABZ A;  3FX3 A;  4IX7 A;  4LD5 A;  2M4G A;  4MQV A;  2G3B A;  2IEK A;  1K6Y A;  4MFE A;  3GEZ A;  2G7H A;  3H1C A;  4LGW A;  5TJJ A;  3ZMS A;  2FMY A;  1FBU A;  1IAW A;  3HXL A;  3AG1 H;  3RH2 A;  2YR2 A;  1OR7 A;  1U9O A;  3PFY A;  4B44 A;  4AVP A;  3LQQ A;  3CME I;  4XOT A;  2CG4 A;  1W7P D;  1IN6 A;  1JHH A;  1R9T J;  4IHX A;  2QKL B;  2MLK A;  5BS6 A;  3S93 A;  1O3S A;  1W0U A;  5IYD J;  4NC8 A;  2ZME C;  2DT6 A;  1V4R A;  3VFZ A;  2M87 A;  5D8L B;  2IA1 A;  1KON A;  1MDM A;  2K02 A;  5M5X J;  4IRI A;  3ZP5 A;  4BHP A;  2MLG A;  3I55 I;  4FE4 A;  1P4X A;  1MIJ A;  1XPX A;  2VJ5 A;  4B1R A;  2DFF A;  3BTJ A;  3S1Q J;  1FYK A;  2JUC A;  1TT0 A;  3G1O A;  4EJU A;  4MEX F;  1XDS A;  2E7X A;  5JHU A;  1A31 A;  3FXO A;  5GAE J;  4M3F A;  1JKQ C;  1SEU A;  4HNU A;  3KYD B;  1ETY A;  1EH7 A;  3VYS B;  1E0E A;  3LHQ A;  2G9W A;  3C2H A;  4MLO A;  3OV8 A;  4ZH4 F;  2JT1 A;  4ENM A;  4ENJ A;  5L3B A;  2EQR A;  2ZSI B;  4G6T B;  1YW7 A;  4BUP A;  3KZI C;  1ZAR A;  3HRU A;  3U1K A;  5D6F A;  4EMS A;  2LBF A;  3BCG A;  3NPI A;  2L7K A;  3W6V A;  4A12 A;  4XQF A;  1J0R A;  1MDM B;  1T38 A;  1HC8 A;  4DQ2 A;  3M9A A;  1QVT A;  4BE0 A;  5CVR A;  4B09 A;  2P0W A;  3KP5 A;  3EDP A;  3VSK A;  5FKL A;  3GX4 X;  3I5U A;  2HVS A;  4BU2 A;  3BHQ A;  2GXB A;  1OPC A;  1IRF A;  2GQQ A;  4PJM A;  3VP5 A;  3HTJ A;  4NQW A;  1QZY A;  4MHG A;  4O3M A;  2XB0 X;  3U2R A;  2H1L A;  5FKN A;  2MG4 A;  1BR2 A;  4BDZ A;  2R92 J;  2UWM A;  1KYW A;  2HTJ A;  5HDK A;  3DBH B;  4MTE A;  4BY1 J;  5HSZ A;  3LQR A;  4YII A;  4C30 A;  1VQ5 I;  3O8G A;  3M7G A;  3KZ9 A;  2LBF B;  1H9G A;  2R93 J;  1IRZ A;  2QLZ A;  3LA7 A;  2Y2Z A;  3Q3S A;  5FB2 A;  1IDY A;  2F07 A;  2A69 F;  3K0L A;  2F5F A;  2BHY A;  3FXR A;  3JTH A;  2ZXW H;  2IAI A;  2FML A;  2LK2 A;  2OV7 A;  2V6C A;  3ML6 A;  2GXA A;  1YHQ I;  4UV8 A;  4JQF A;  3BY6 A;  3A03 A;  1KGS A;  3BRO A;  3GVA A;  3MEX A;  3RPU D;  4GDF A;  1HBX G;  4OWR B;  2R7U A;  4PSW A;  2BHZ A;  1OLT A;  3HSF A;  2CV2 A;  2XIG A;  3QWL A;  2K9S A;  5E79 C;  2AXT C;  4HEA 2;  3I4P A;  4RB3 C;  4X1E A;  5DEQ A;  2V1U A;  2X9D A;  3WU0 A;  2VT3 A;  2X1E A;  4EM1 A;  3BDD A;  2BV6 A;  4BQQ A;  1G3W A;  3BR3 A;  3ZMV A;  3BPV A;  4U0Y A;  1GT0 C;  1ITY A;  1V54 H;  3A0H C;  2ZKZ A;  4I6Z A;  3VDX A;  1ODD A;  2VE8 A;  2MA3 A;  2Z1D A;  3K6G A;  4P55 A;  3FIS A;  3NWS A;  3V7C A;  4BEH A;  1MSF C;  3RD3 A;  1VQ4 I;  2LR8 A;  2KIF A;  4D0P A;  4D5F A;  2MGQ A;  4WIB A;  2KPM A;  1FMW A;  3Q0W A;  1HLV A;  3DTE A;  2G0E A;  4YFN F;  2GAU A;  4EGY A;  4PCQ A;  3ROU A;  3H5N A;  3ZQC A;  1T0F C;  5IY5 H;  4ITV A;  4AC0 A;  3VSL A;  2CFX A;  3E97 A;  2XF6 A;  3J80 Z;  3PO2 J;  1E3H A;  2VT2 A;  4A3F J;  1PUF B;  2LY1 A;  3GME A;  3K4B A;  2CJJ A;  2Q2E A;  3A4C A;  2VQG A;  3JRE A;  1J2X A;  1YS6 A;  3FMR A;  5IT3 A;  4A2U A;  3P9T A;  5H9T A;  3G1M A;  1P6R A;  1O3Q A;  3P5J A;  3K2Z A;  2ACJ A;  1K4S A;  3L09 A;  2ISY A;  3OIP A;  3HZJ A;  1VQ6 I;  3PQJ A;  3WGI A;  2HZD A;  3MN2 A;  2L01 A;  5AIP A;  4BEH B;  2O0Y A;  3HUG A;  4LB6 B;  2NP3 A;  4EJT A;  1YYV A;  4A69 C;  5E8G A;  4U7D A;  1ON2 A;  5HDG A;  1A6Q A;  3X2Q H;  3IAS 2;  4BY7 J;  2XRL A;  4A5M A;  2E71 A;  1A04 A;  3TO7 A;  3TBI A;  3V8K A;  2V9P A;  3GTP J;  4AIK A;  3VYR B;  5FLX K;  5JR3 A;  1NH3 A;  2E1N A;  5CYV A;  2W84 A;  4M72 A;  5J4Y A;  2Q2E B;  3ZQG A;  1JJ8 C;  3S15 J;  3ERM A;  3HDD A;  1F5T A;  3C7J A;  3KE2 A;  2X85 A;  5KVR A;  2AQF A;  1XSV A;  2DA2 A;  5GAD J;  4K2E A;  5GAH J;  3IAM 2;  1T98 A;  5LRS A;  5CVU A;  2XV4 S;  4IQJ A;  1SAN A;  2M8E A;  4B3X A;  4GFK A;  3TGN A;  1Y0U A;  3S1R J;  1VQ9 I;  3F21 A;  3HUG B;  2F5E A;  5ICC A;  3E6C C;  1R23 A;  3FIW A;  4UDS A;  2UXU A;  4KIF A;  4NUB A;  2ZCX A;  2HDD A;  5HNH A;  2EK5 A;  4L18 B;  1LVA A;  2HYF A;  4ZZL A;  3CF2 A;  4GRI A;  4B48 A;  2ZXJ A;  4HST A;  3HYI A;  2EB7 A;  3JSP A;  3RYR A;  2VC0 A;  5J4V A;  4MK6 A;  1EH8 A;  3CDH A;  1SAU A;  4HKU A;  2DMU A;  4QLC U;  2DG8 A;  2B63 J;  5KHD A;  1U9N A;  4JOM A;  1YIO A;  3CCV I;  4IHT A;  2V79 A;  2XDV A;  1TZL A;  5CKT A;  2VB6 A;  3HEF A;  5IT9 K;  3NXC A;  3T8T A;  3RKQ A;  4P9U A;  3FKI J;  5LEJ A;  1YRN A;  2AS5 F;  3ULQ B;  2WY8 Q;  1Y8R B;  4HBL A;  4IRH A;  5K5Q A;  5K7Z A;  1BL0 A;  3A2K A;  1FMV A;  4G94 A;  2XSD C;  3PPB A;  2HNH A;  3BG6 A;  5BPI A;  4ME9 A;  4I99 C;  3MVP A;  4YG2 F;  1KQ0 A;  2RNG A;  3DP7 A;  2BBY A;  3MWM A;  3WHC A;  2EFN A;  4OIN F;  2BY0 A;  3SZP A;  4XRS A;  1A6I A;  3AG4 H;  1UJ8 A;  3WTV C;  1RIO H;  3DTK A;  1VI0 A;  3C1D A;  4IO9 F;  1BJA A;  4HF0 A;  4GCL A;  4P5O A;  3VIB A;  1OFC X;  4AIJ A;  3G3Z A;  3HOT A;  2MH9 A;  2FX0 A;  3HM5 A;  3G2B A;  1TQM A;  1YJ9 I;  4XLF A;  1VTN C;  2ZJR F;  2VON A;  1X1P A;  4BAC A;  3TKY A;  2E2H J;  1YRN B;  3OYL A;  4LK0 F;  3IWF A;  1ETW A;  1U5T C;  1Y6I A;  2QQA A;  2XF5 A;  3JRA A;  1WJE A;  3PSF A;  5J6X A;  4CCO A;  3EET A;  4WXC A;  2AQE A;  3H3V K;  2OZ6 A;  3F9K A;  1ON1 A;  3IUO A;  2DYR H;  3BOQ A;  5LHH A;  4D7M A;  2LNB A;  3ZQI A;  3WTT C;  1MD0 A;  1TT5 B;  1OYW A;  2BZT A;  2X6W A;  2EV6 A;  4LLG F;  1MW7 A;  4CYD A;  4V2G A;  3OS0 A;  1I3A A;  3Q0U A;  2XAJ A;  2DTZ A;  1DP3 A;  1TNT A;  4FX4 A;  3IH2 A;  4LOC A;  1FP2 A;  3ZN1 A;  3CMY A;  2RAS A;  2HVR A;  1HXD A;  1XD7 A;  2X1D A;  3FXJ A;  1WVR A;  3M1C A;  1WH7 A;  2LH9 A;  1ACI A;  2EV5 A;  2XPV A;  4MGR A;  4B4C A;  2R0Q C;  1QU3 A;  1MNE A;  3GFL A;  2FJI 1;  3EGQ A;  3GXO A;  3DV8 A;  1XTA A;  2L7Z A;  4Y17 A;  2P7C B;  1S6L A;  2GLO A;  4A3L J;  2FBI A;  3U1D A;  1TWC J;  4W97 A;  4U9N A;  1WJA A;  3OY9 A;  2XVC A;  2XDN A;  1G2H A;  2LC2 A;  4RDU A;  3BCB A;  3LNQ A;  3HOV J;  5HDN A;  2QYO A;  1WH5 A;  3K4N A;  4U7B A;  2EIK H;  4HNT A;  1X3U A;  4Q4Z F;  4WX9 A;  4BHB A;  4ENN A;  4HF2 A;  4GXO A;  2A5W A;  3I4M J;  5F0F A;  2FA5 A;  4G9Y A;  1K6O A;  2UXH A;  2JPB A;  2F5D A;  2DCE A;  1WZ2 A;  4XN0 A;  3R4K A;  1SD7 A;  1LE8 A;  5DS9 A;  1J09 A;  1MJA A;  4KWA A;  1R36 A;  4NBQ A;  4XN3 A;  2OTL I;  5AON A;  3I3L A;  3ZQQ A;  1ZR2 A;  4CCM A;  4I98 B;  1O4X A;  2A2F X;  2ZNY A;  2DA4 A;  3PL8 A;  5IT9 Z;  3V6G A;  1AA7 A;  2VKV A;  4OOI A;  2DT7 B;  5F04 A;  3MKZ A;  4KMU X;  4RAY A;  2YVH A;  2KT0 A;  2HOE A;  4HA8 A;  2M7A A;  3DF8 A;  2G7S A;  3C07 A;  1JGS A;  2CQX A;  2RQQ A;  1O7L A;  2JA2 A;  4EGZ A;  4DW6 A;  3ANG A;  2ETH A;  4I01 A;  1XCV A;  2KRF A;  3PSI A;  1H0M A;  2ICW G;  2ISZ A;  2YX4 A;  3QOD A;  4W1U A;  3QYF A;  1MBJ A;  3H9J A;  3R6S A;  2FU4 A;  1LE8 B;  2IRF G;  1MMA A;  2G7U A;  3OSG A;  4A3C J;  1D1A A;  2IGM A;  4RB2 C;  5AIQ A;  2AXL A;  2O03 A;  3UKG A;  1B72 A;  2PJP A;  5KCM A;  3WTW C;  1V5F A;  3RQ4 A;  5A2Q K;  1JE8 A;  1LUJ B;  2Y0S A;  3A0B C;  3OYG A;  1U3E M;  3CCY A;  3BTL A;  4N9H A;  4U88 A;  5JVG F;  3JRF A;  2PJR A;  2R7Z J;  2HS5 A;  1PP7 U;  1D3Y A;  4GFL A;  2YSR A;  2E1M C;  2YVE A;  1R00 A;  3CCS I;  2BYV E;  1RUO A;  3NI7 A;  1X1B A;  1QNT A;  1A5J A;  5M5Y J;  2ZNZ A;  2PX9 A;  3E7Q A;  2HEO A;  4M73 A;  4BH9 A;  5FRN A;  1K4T A;  1TC3 C;  1RKT A;  3N97 A;  5DD4 A;  2F6C A;  1RET A;  5FMP A;  3JTG A;  3PUF A;  4GYI A;  4A3I J;  3DPL C;  1YQA A;  5EFY A;  4UHT A;  2O8X A;  1RKW A;  5HS9 A;  1GVJ A;  1HKS A;  4ENK A;  4CDG A;  1FOX A;  4PJN A;  2ZCN A;  3E3V A;  2VAS A;  1X1D A;  1B72 B;  3EUH C;  4M3D A;  2DT5 A;  3SQN A;  4DZJ A;  5H6R A;  2Z3Y A;  3VW1 A;  2Y0S N;  2PJR B;  1OCR H;  3KZZ A;  3BWG A;  2YS9 A;  2M45 A;  3QP6 A;  1YW8 A;  4UUS A;  1ZG3 A;  4UVC A;  2W1O A;  3FKJ A;  1KU9 A;  3F8M A;  2JQ7 A;  3NRV A;  4Y33 A;  3V78 A;  3HGY A;  1ETV A;  4R8H A;  2YVX A;  3DLL F;  2RGV A;  5L3E A;  1IUY A;  3K4L A;  2M34 A;  4ZYH A;  2OC6 A;  4AC6 A;  2UXN A;  3HHG A;  5J1R A;  3K1P A;  1FJL A;  2RHA A;  3CO7 C;  3NNR A;  2HFH A;  1O3T A;  1P2F A;  1UEL B;  2ID6 A;  3RZO J;  4AU7 A;  2KRH A;  2WV0 A;  3TOA A;  1R6R A;  4RAG A;  2XAH A;  3FM5 A;  3GTQ J;  1XSX A;  1I3Q J;  3J81 K;  3LFU A;  4NC7 A;  4YFK F;  1T2K A;  4CZC A;  4O5V A;  4RMN A;  5J47 A;  3GF2 A;  1DU0 A;  5DM6 F;  1OR7 C;  4G6Q A;  4M6Y A;  1SFO J;  5CW8 A;  1OJL A;  3E7L A;  4XKV A;  2IS2 A;  2XSJ C;  4UUS B;  2B3W A;  2NOJ B;  3F8C A;  4U0V A;  2OA4 A;  4RB0 A;  1ZGW A;  2A07 F;  3NAU A;  2LY2 A;  3P9C A;  2IBD A;  2NVU B;  4LIT A;  1X3Z B;  1Z05 A;  3KEY A;  1MH3 A;  1SMY F;  2NAZ A;  4J00 A;  2JK3 A;  1BW5 A;  5GPA A;  4HW0 A;  4Y13 A;  2ESH A;  1R22 A;  4AIH A;  4HF1 A;  2UZK A;  4IOC F;  3LSM A;  3SFI A;  2F4O B;  3WGH A;  4LG0 A;  2ZXH A;  3IRR A;  2FNP A;  4ZDL A;  2CV0 A;  1HKT A;  2IPQ X;  3BG5 A;  3PJR A;  1YOV B;  2HR3 A;  1WJ5 A;  4A5N A;  3O3K A;  3K10 A;  3H9Q A;  4BQN A;  3S2W A;  4RA2 A;  3JRB A;  2GA2 A;  2CUJ A;  2NYX A;  4EJV A;  5ICG A;  1X58 A;  3HOX J;  2DA7 A;  2H09 A;  3KP3 A;  5CLS A;  1CF7 A;  2M9H A;  2OCC H;  2FBH A;  1HW5 A;  2LSO A;  4BNC A;  4BQA A;  3HC7 A;  2P6T A;  3FHN A;  1S72 I;  2CQN A;  3BR5 A;  1Y8Q B;  3BZ6 A;  3JRC A;  3QU6 A;  2C6Y A;  5E1Z B;  4AID A;  2A61 A;  1FEX A;  3E1S A;  2UUZ A;  1ZLK A;  4B8X A;  2RV8 A;  4LG0 B;  5LGU A;  2IA0 A;  1MMD A;  2VN2 A;  1V55 H;  2R7O A;  3H3U A;  4RLQ A;  3R60 A;  4NN1 A;  2VJ4 A;  1FBS A;  5EDN A;  3HOW J;  2GEN A;  1MGT A;  4LLL A;  3WE3 A;  3VOK A;  2WB1 A;  1D1C A;  2DU9 A;  2K4J A;  5F0H A;  3VVY A;  4II2 A;  3FBI B;  2DDA A;  4L5I A;  1UG2 A;  2NP5 A;  3H35 A;  4ASN A;  2F5V A;  3WG9 A;  3IV5 A;  3I0T A;  1CF7 B;  3J7A Y;  2DQL A;  4AF5 A;  2HU9 A;  3I54 A;  3RKY A;  2EFO A;  5LD2 C;  4HLY A;  4QTR A;  5K1Y A;  3CRJ A;  4QWQ A;  3GW2 A;  2H8R A;  3DPU A;  4S0H B;  2HQR A;  3DQV C;  3CMM A;  1QHG A;  3JSO A;  2E5Z A;  4KIB A;  3GBG A;  3W2A A;  4DYC A;  5J8F A;  3WGG A;  1OKR A;  4C3I J;  5IP7 J;  3FMQ A;  3OYJ A;  4MXM A;  4I0A A;  4M3B A;  2CH0 A;  3AFH A;  2DN0 A;  2EIN H;  3CCM I;  1LQ1 A;  1LDK B;  2PEX A;  5CVJ A;  1QQI A;  2R7F A;  2VPR A;  3K1M A;  2WB1 N;  4L9N A;  4XLP F;  2Z2S B;  2RKH A;  1IF1 A;  2K3F A;  1MMS A;  2FD5 A;  3KP2 A;  1MNM C;  1MMN A;  3QOE A;  1I50 J;  3J81 Z;  2FBQ A;  3T6N A;  2K5C A;  1H9T A;  4PK4 A;  5JFR A;  4MFD A;  3CCE I;  4FTH A;  3U9G A;  2V1D A;  1WJC A;  2HYJ A;  3GTK J;  3H9G A;  2O5R A;  2OD5 A;  2HPI A;  3DBL B;  4GCK A;  4XIC A;  2JZY A;  2LG4 A;  3OYC A;  2YPR A;  2M4K A;  3ASN H;  2HQ5 A;  3GZ5 A;  2D1V A;  2MC4 A;  1CGP A;  4C3H J;  1ETO A;  4A3B J;  3IH4 A;  3FRQ A;  2AO9 A;  2KIS A;  3LSH A;  4D7N A;  5JLX A;  2JA8 J;  4JX6 A;  4QSH A;  1X1A A;  4BQO A;  1B6A A;  3GFI A;  4AUX A;  3BC8 A;  4PXI A;  1EJ9 A;  2CWE A;  3T8R A;  1JGG A;  3ZN0 A;  1ZRE A;  1IRG A;  3HOZ J;  3FK6 A;  3K70 C;  5F1R A;  2IVM A;  4ZTF A;  1O57 A;  3E5U A;  1YJN I;  4L9J A;  2JN6 A;  1WRJ A;  3CP8 A;  1T6S A;  1XX5 A;  3JR9 A;  1BM9 A;  3F6O A;  3BRU A;  1HST A;  2OJE D;  4MIM A;  2P6S A;  1A35 A;  5FRO A;  4M9Z A;  1SD5 A;  1RI7 A;  1YLF A;  5E3O A;  5D8K B;  2ZXI A;  1HDD C;  2LMD A;  2JVG A;  2PLY A;  2KFD A;  3LSI A;  1VQK I;  3OYN A;  2VQL A;  2QCO A;  1Z77 A;  5J40 A;  1QZE A;  2QQB A;  4EM2 A;  1FZP B;  2Q8K A;  4A0Z A;  3AG3 H;  2DI3 A;  1QPI A;  1VZ0 A;  3VYU B;  3FM3 A;  5GPC A;  3TP0 A;  5L3G A;  3QPL A;  1ZRD A;  5K5R A;  1TQI A;  5H6Q A;  2ZOZ A;  3S16 J;  2EH3 A;  1DP7 P;  2ESN A;  5TRD A;  4AD9 A;  1AHD P;  1FYL A;  3OS1 A;  1F36 A;  1JUM A;  2W57 A;  2F5C A;  1XGO A;  1XN7 A;  1XMX A;  3M3Y J;  1B9M A;  3Q0V A;  1TW3 A;  1LJ9 A;  4RS8 A;  2QKO A;  3AKZ A;  5M3M J;  1W5S A;  3NS4 A;  5BQT A;  2NNN A;  1B9N A;  3CJR B;  1SMT A;  2M8G X;  4L0Y B;  3D5R C;  2W7N A;  4BE1 A;  3RI4 A;  2QF7 A;  4HNV A;  3HTH A;  2DOD A;  5F0C A;  3OYB A;  2HKU A;  1PUF A;  2ZFW A;  2JPC A;  3BR0 A;  3DEW A;  5DUI A;  5ILS A;  4S04 A;  1PJR A;  5J1U A;  4KIT B;  2YX7 A;  2RN7 A;  2V4J C;  3QQA A;  1KZH A;  4PSX A;  1B59 A;  2Y75 A;  4G7Z F;  3BQY A;  1T08 B;  2D5V A;  3BR1 A;  2NVQ J;  2E60 A;  4CYC A;  1WJB A;  5H2F C;  3F1B A;  4BE2 A;  4LFU A;  1ZH5 A;  1YE9 A;  4B3A A;  2NS7 A;  3OYI A;  2EA4 A;  3DKY A;  1IUF A;  3G4S I;  4BBR J;  1NG7 A;  2X4H A;  4BXX J;  3T5X A;  1MBH A;  2H1K A;  2CS3 A;  1KU2 A;  2X1C A;  2PBI A;  3G73 A;  4NEL A;  2IP2 A;  1SFK A;  3MKL A;  1GHC A;  4HX7 A;  5BPD A;  3S3O A;  2GIZ A;  3CC7 I;  1VQN I;  1W4M A;  4P1W A;  2F2E A;  1WKM A;  2LOO A;  3C2B A;  2KIM A;  5LBQ A;  4ZYE A;  2QUF A;  2L9R A;  1G6N A;  4XOP A;  3W6K B;  1GUU A;  2KDO A;  5EEG A;  5E8I A;  4DVY P;  3CMA I;  3GZ6 A;  4HDV A;  5IOY A;  5LGN A;  3TP3 A;  1LDD A;  1QBJ A;  2FQ4 A;  2EZL A;  4CYC B;  4UXN A;  2Y69 H;  2R3S A;  2ZC2 A;  2GWR A;  3GTJ J;  3VW2 A;  2JWT A;  5EZG A;  1R1V A;  5JVT A;  2E35 A;  3DEU A;  3F22 A;  1ORK A;  5E17 F;  1LFP A;  1RUN A;  2VJI A;  1YX5 A;  3JSJ A;  1OYY A;  1V3F A;  1XG1 A;  2DO7 A;  2MFZ A;  3V4G A;  1JKO C;  4HYE A;  3CZ6 A;  2XUB A;  2OER A;  1HW1 A;  2Y30 A;  3KLO A;  4NNJ A;  3TOB A;  5D18 A;  1FNN A;  1RR7 A;  3HB9 A;  3ZMZ A;  1BOA A;  3K1N A;  4Y52 J;  2VKE A;  3A02 A;  1MKM A;  1R4N B;  1I6X A;  3T0Y A;  4QPO A;  1JT0 A;  1HW2 A;  1S5L C;  1R7J A;  2XGD A;  3M8E A;  2HKX A;  1P92 A;  1V5E A;  2DFI A;  5M5W J;  2W53 A;  1ZQ3 P;  4IPA A;  3H5R A;  5LGT A;  3V42 A;  2O7O A;  3CQZ J;  3FXQ A;  2HOT A;  4XKW A;  2D45 A;  2KRC A;  3MD2 A;  4P9F A;  2DXI A;  1BI1 A;  2V57 A;  2OCE A;  1PP8 F;  1I27 A;  2HI3 A;  3E6D A;  2XPU A;  1XGS A;  1OQY A;  3OR2 C;  2K3P A;  4F7Z A;  5IOZ A;  2HPM A;  4Y15 A;  2O6G E;  2COB A;  3HSE A;  4A93 J;  3BR2 A;  3D5S C;  4C2T A;  2VOO A;  1Z91 A;  1N77 A;  4EV0 A;  3L2V A;  1BR1 A;  3F8N A;  3ZMD A;  3H5A A;  2F4I A;  3F3X A;  4ZC3 A;  4LIU A;  3HHH A;  2LP0 A;  4A6D A;  5F6F A;  3I58 A;  2PI0 A;  2NXN B;  1P9Q C;  1QA6 A;  1STZ A;  3QYE A;  3UR3 C;  4JX4 A;  3M8J A;  3F6V A;  1U0J A;  2ZB9 A;  4OU0 A;  3F23 A;  1A36 A;  2CW0 F;  3VEP A;  3LMM A;  4C2M A;  1WHU A;  3K4C A;  3CC4 I;  1Y39 A;  3K8P C;  1UST A;  4UY8 I;  4WK8 F;  1F43 A;  4KN4 X;  4RGR A;  1Z9C A;  1Q1H A;  2IXS A;  3EQL F;  4L5J A;  1JJ6 C;  1ETQ A;  2EV0 A;  2ZO4 A;  1VFC A;  2XAG A;  4HOB A;  1DQU A;  3TMO A;  3BTI A;  4B43 A;  3VW0 A;  3FHZ A;  2L5Q A;  2XF7 A;  4XLC A;  2DMP A;  5K7H A;  3G7R A;  2UXO A;  1MBF A;  2XAF A;  4PDK A;  3MKY B;  1TWH J;  4M9S A;  1ERD A;  2BXZ A;  4Q5S F;  3L2U A;  2O7T A;  4MO7 A;  4XMY A;  1PDN C;  4ZYG A;  2P8T A;  2GOX B;  3CDL A;  4OD5 A;  2DBB A;  2E2J J;  3I71 A;  5KAI C;  4M6V A;  3FXL A;  5C4J J;  3FBN B;  5E3L A;  4A3M J;  1JTY A;  5D5V B;  3SHF A;  5HLH A;  4ZZD A;  2RQP A;  4PFP A;  3KYC B;  2CV1 A;  1ZRC A;  2J5O A;  2LRD A;  1D1B A;  3RJP A;  1S7O A;  2ZFU A;  1D5Y A;  2WGB A;  3CP2 A;  4DYR A;  2OI8 A;  4UB6 C;  1IN5 A;  3IUV A;  2JSC A;  2Y31 A;  3HRM A;  4M3E A;  2KL4 A;  3R0A A;  1KQ9 A;  3IKT A;  1HDP A;  3E6B A;  5F08 A;  2E5N A;  3EPZ A;  3PIO F;  2LKX A;  4AM3 A;  2GA1 A;  2WTE A;  3DKW A;  3O8H A;  2KIQ A;  2EIM H;  3CCJ I;  2ME6 A;  2F48 A;  2NVY J;  1BOB A;  4WF2 A;  1B4A A;  4XLE A;  5FLX Z;  4XSX F;  5FGM A;  2BY2 A;  3VVZ A;  4X0G A;  4E7J A;  1W36 C;  1FSH A;  2HOA A;  3Q9S A;  3ERE D;  2BOL A;  2HQA A;  5EYR A;  2V6E A;  4YEJ A;  3CJT B;  3ECO A;  3DBR B;  1SC7 A;  2VIX A;  1X4P A;  2EJR A;  3S32 A;  5DDG A;  4RAF A;  3B73 A;  2MC3 A;  2V1N A;  3QU3 A;  5LFA A;  1YX3 A;  1T56 A;  2DAO A;  2HDW A;  3HTU A;  3H36 A;  1MND A;  2M2E A;  3LA2 A;  2LRE A;  1UHW A;  2X6O A;  4KT6 A;  4BXU A;  2LVS A;  5ERI A;  3GTO J;  3CJN A;  3R61 A;  1EV7 A;  1FOY A;  3OL3 A;  5D5U B;  5FFX A;  3ZR8 X;  1VF9 A;  3S5R A;  5FFZ A;  3BG9 A;  5B3S H;  3KPH A;  2WC2 A;  1O7F A;  4HQM A;  4B47 A;  5C4Y A;  2GOM A;  3MAJ A;  3ECH A;  5D5X B;  1G4D A;  1X3W B;  3L2Q A;  4XOR A;  3FMS A;  3O60 A;  4EVI A;  1WJF A;  1ETK A;  3W3C A;  3I4N J;  1I1G A;  2COM A;  4JK1 X;  3RPQ A;  3HKZ N;  1C0W A;  2KIU A;  3HTI A;  2I10 A;  1UZC A;  1OCO H;  2VKH A;  3GLL A;  1IXS B;  4KFC A;  3UNG C;  2MD5 A;  3QYB A;  2VBW A;  1S7E A;  2RDP A;  3VB2 A;  1SD6 A;  3CO6 C;  2E34 A;  1VQ7 I;  3WTU C;  5IYB J;  4QPQ A;  3F0C A;  1WI9 A;  3P9I A;  4RM2 A;  4KNY A;  3DPJ A;  3EUP A;  4U87 A;  2B0L A;  2JA5 J;  3ANP A;  1ONV A;  2DOF A;  4N4N B;  3CUQ A;  4Y4R A;  3KP6 A;  3CF5 F;  3BG7 A;  4HZF A;  3OSF A;  1Q1V A;  2R5Z A;  1ETX A;  3WU2 C;  2N8G A;  5TGT A;  4A3J J;  3QBM A;  4XRF A;  4C2M J;  3QPH A;  5DD8 A;  4IL6 C;  1IN4 A;  4J19 A;  2BEO A;  2A68 F;  3CCU I;  2NRA C;  3GYH X;  4HRI A;  3V7R A;  2R7Q A;  4M9X A;  4ZYA A;  4RB1 A;  1BC8 C;  4Z2Y A;  3TED A;  3OS2 A;  3REO A;  2X48 A;  2XKO A;  3HTS B;  4KJZ A;  2CFO A;  1J9I A;  1GVD A;  4PJ0 C;  1RNL A;  1UG0 A;  3I56 I;  2NOG A;  1TP4 A;  3AL0 B;  2AHQ A;  1D0Z A;  1QGP A;  4FE7 A;  3EUK L;  1IV8 A;  2DOE A;  2FF4 A;  3KP4 A;  4YIR X;  2REK A;  4XLH A;  3WTS C;  1PYV A;  2FEZ A;  2M5W A;  3CUQ B;  1N75 A;  2M7B A;  5D4R A;  1E3P A;  1ZR4 A;  2E1O A;  2HXO A;  1ZAO A;  5F1J A;  4RM3 A;  2R5Z B;  2BY1 A;  2QOP A;  1BC7 C;  2P5L C;  1K78 A;  1ZN2 A;  1R1U A;  3CC2 I;  1OCC H;  2DK5 A;  1NK3 P;  1F4K A;  2V9K A;  3RIR A; 
#chains in the Genus database with same CATH homology
 4I6Z A;  5K7F A;  3GBG A;  4DYC A;  1P7I A;  5IP7 J;  4C3I J;  4MXM A;  4M3B A;  3FIS A;  1MSF C;  3RD3 A;  4V2F A;  2DN0 A;  2LR8 A;  3K2A A;  3JRI A;  4D5F A;  2MGQ A;  3Q0W A;  1HLV A;  3VOX A;  2G0E A;  1JT6 A;  3G1L A;  2VPR A;  2WB1 N;  4C3J J;  3SJM A;  3HIM A;  3OIO A;  2FD5 A;  3ZQC A;  1MNM C;  4AC0 A;  1I50 J;  3T6N A;  2FBQ A;  3PO2 J;  3ZOB A;  2NX4 A;  4A3F J;  4FIS A;  3S2H J;  1PUF B;  2UXI A;  4MFD A;  3SDG A;  2CJJ A;  4FTH A;  2Y9Z A;  3JRE A;  3COL A;  3PO3 J;  2HYJ A;  3GTK J;  5IYC J;  2K9Q A;  1NK2 P;  2K40 A;  2LY9 A;  3P9T A;  5H9T A;  4XIC A;  5FHP A;  3G1M A;  4GCK A;  3BG3 A;  1NTC A;  2HQ5 A;  2LLK A;  4D5C A;  5EGO A;  5IPA A;  3ZQH A;  4C3H J;  1ETO A;  4A3B J;  3IH4 A;  3MN2 A;  3S2D J;  3FRQ A;  2AO9 A;  4D7N A;  5JLX A;  2JA8 J;  4JX6 A;  4QSH A;  3DCF A;  2NP3 A;  1SGM A;  4A3K J;  4A69 C;  4AUX A;  4PXI A;  2KDZ A;  3WHB A;  4Y7N J;  1JGG A;  1MSE C;  4BY7 J;  2XRL A;  2ECC A;  2XGC A;  2XGE A;  2E2I J;  3HOZ J;  3FK6 A;  2G7L A;  3LSJ A;  5CXI A;  2EZH A;  3GTP J;  1ENH A;  2DG7 A;  3BQZ A;  2ME0 A;  1WI3 A;  2JN6 A;  1K61 A;  4DYQ A;  3ZQG A;  3JR9 A;  1JJ8 C;  3BRU A;  3S15 J;  3HDD A;  4MIM A;  3GTM J;  1MBG A;  2DA2 A;  5E3O A;  3GTL J;  9ANT A;  5EZH A;  1HDD C;  5EGO B;  2HOS A;  3LSR A;  1ZK8 A;  1SAN A;  2P81 A;  4GFK A;  2QCO A;  1Z77 A;  3S1R J;  4A3E J;  4L62 A;  1IDZ A;  4XRS G;  1QPI A;  2W48 A;  2M0C A;  1JTX A;  1GV5 A;  2EBI A;  3FIW A;  2DMQ A;  3K7A J;  3VPR A;  5HOD A;  2PBX A;  2UXU A;  3HE0 A;  4UDS A;  5C3E J;  1H88 C;  2ZCX A;  5GPC A;  2HDD A;  3TP0 A;  4IHV A;  2DMN A;  3QPL A;  1FTT A;  1P7J A;  4IEJ A;  1IV6 A;  1W0T A;  2PMZ N;  2ZOZ A;  4MK6 A;  3S16 J;  1K83 J;  2EH3 A;  4NDL A;  2OPT A;  1AHD P;  4HKU A;  2DMU A;  1CQT A;  2DG8 A;  3QPS A;  1XS9 A;  1F36 A;  1JUM A;  1U9N A;  3TW7 A;  2B63 J;  3LSG A;  2CRG A;  3M3Y J;  3TW6 A;  3HEF A;  3NXC A;  3Q0V A;  5FKK A;  5D19 A;  3RKQ A;  4GFB A;  4XK4 A;  3FKI J;  1YRN A;  2QKO A;  5FLV A;  2VUM J;  5M3M J;  1JUP A;  5K7Z A;  1Z0X A;  1BL0 A;  4CGR A;  2XSD C;  1HOM A;  2M8G X;  3RQI A;  2XPW A;  3PPB A;  5CXG A;  4ME9 A;  2QF7 A;  3MVP A;  4HNV A;  3HTH A;  1AU7 A;  5F0C A;  1WCM J;  2HKU A;  3WHC A;  1PUF A;  2UXP A;  2ZOY A;  3DEW A;  3BR0 A;  1LFU P;  4EEF G;  4XRS A;  1A6I A;  5J1U A;  2OF7 A;  1X2M A;  1VI0 A;  5FKM A;  3NRG A;  3QQA A;  2DA3 A;  4GCL A;  1RES A;  3BQY A;  2D5V A;  2Q24 A;  3VIB A;  2XB5 A;  2LFB A;  1OFC X;  4M3G A;  3BR1 A;  2K9N A;  2NVQ J;  3LSP A;  3A01 A;  4CYC A;  2ZCM A;  3LWJ A;  3NAR A;  1HCR A;  2D6Y A;  2FX0 A;  3HM5 A;  3F1B A;  4L5E A;  3FK7 A;  4B3A A;  2NS7 A;  2E2H J;  1YRN B;  5DTD A;  1IUF A;  5J3L A;  5HAW A;  3AQT A;  1ETW A;  4BBR J;  3KKC A;  3JRA A;  4BXX J;  3JRG A;  1MBH A;  2H1K A;  5FJ8 J;  1IJW C;  4NEL A;  1E3O C;  1ZKG A;  3MKL A;  2JA7 J;  2PZ9 A;  3H3V K;  4BKX A;  2L0K A;  3D1N I;  4A3G J;  3B6A A;  4D7M A;  2LD5 A;  3ZQI A;  1IG7 A;  3ON2 A;  3C2B A;  1GDT A;  2CUF A;  2L9R A;  2WAQ N;  3L1P A;  2DA5 A;  2NVT J;  1GUU A;  4V2G A;  3Q0U A;  2NVX J;  2DTZ A;  3GTG J;  2CQQ A;  5IOY A;  3IH2 A;  4JYK A;  4LOC A;  1GV2 A;  3IH3 A;  3TP3 A;  1Y1V J;  4XID A;  2FQ4 A;  2EZL A;  2CU7 A;  4CYC B;  3A01 B;  3CMY A;  1Y1W J;  2RAS A;  4JKZ A;  3GTJ J;  1WH7 A;  5FKO A;  3VW2 A;  2XPV A;  4B4C A;  2JWT A;  5EZG A;  2R0Q C;  1ORK A;  2ECB A;  1FTZ A;  3EGQ A;  1WGX A;  1HF0 A;  2L7Z A;  3JSJ A;  3QKX A;  2GLO A;  1XG1 A;  5E3M A;  4A3L J;  1JKO C;  3VVX A;  2MSY A;  1TWC J;  4W97 A;  5GP9 A;  5IP9 J;  2OER A;  2Y30 A;  3B81 A;  2XDN A;  5D18 A;  1U8B A;  1G2H A;  1RR7 A;  4RDU A;  3HB9 A;  3LNQ A;  3HOV J;  3ZQL A;  3PAS A;  5M3F J;  1WH5 A;  2VKE A;  3A02 A;  1AKH A;  4Y52 J;  5C4X J;  2GFN A;  3ZQF A;  2L7M P;  1JT0 A;  2NS8 A;  2XGD A;  3I4M J;  5F0F A;  5BNG A;  2HYT A;  4IHW A;  2UXH A;  5M5W J;  2QTQ A;  2W53 A;  1ZQ3 P;  2HXI A;  2R5Y A;  1LE8 A;  5DS9 A;  3HOY J;  3CQZ J;  2O7O A;  4KWA A;  1VND A;  1JKP C;  2HOT A;  3JRH A;  2EZI A;  4A3D J;  5EF6 A;  3OOU A;  2V57 A;  1ZR2 A;  2WV1 A;  1O4X A;  2LTP A;  2HI3 A;  2XPU A;  3V6G A;  2DA4 A;  1X2N A;  1TWA J;  2DA6 A;  2VKV A;  5IOZ A;  4A93 J;  5DAJ A;  2COB A;  3JRD A;  4JP0 A;  3BR2 A;  1XC5 A;  1BJZ A;  5F04 A;  1APL C;  2QWT A;  3LOC A;  1OCT C;  2E19 A;  2KT0 A;  2YVH A;  2G7S A;  2DA1 A;  3C07 A;  4I76 A;  1MH4 A;  1AKH B;  2CQX A;  1H89 C;  4ACI A;  2LP0 A;  4DW6 A;  2YU9 J;  3ANG A;  2FJ1 A;  2ID3 A;  2YUS A;  2DJN A;  4W1U A;  2CUE A;  1B8I A;  4BBS J;  1MBJ A;  1TWF J;  5J1Y A;  2R5Y B;  1LE8 B;  5EEA A;  4JX4 A;  5FLM J;  3OSG A;  2ZB9 A;  4A3C J;  3B6C A;  3UKG A;  2MW8 A;  1UMQ A;  3HBL A;  1B72 A;  2QIB A;  1QVU A;  2L7F P;  2ELK A;  1T33 A;  3BJB A;  4JX5 A;  1F43 A;  2VI6 A;  3BTL A;  3CCY A;  2R7Z J;  3JRF A;  3HTA A;  1JJ6 C;  1ETQ A;  4GFL A;  3GZI A;  1VFC A;  2YVE A;  3NI7 A;  3VUQ A;  1A5J A;  3S1M J;  4G12 A;  5M5Y J;  3G56 A;  1JKR C;  3BTI A;  3BNI A;  3VW0 A;  3KKD A;  4AYB N;  3E7Q A;  2DMP A;  5K7H A;  3G7R A;  1FIA A;  4GCT A;  1DU6 A;  2UXO A;  1MBF A;  3PM1 A;  1OCP A;  1TC3 C;  1TWH J;  1RKT A;  2GUH A;  1POG A;  1MBE A;  3CJD A;  1EF4 A;  1FIP A;  2O7T A;  5FMP A;  1RET A;  3BTC A;  4MO7 A;  1B8I B;  3S14 J;  2G7G A;  4A3I J;  5EFY A;  1RKW A;  3CDL A;  5F27 A;  2E2J J;  1WPK A;  4M6V A;  2ZCN A;  5E3N A;  5C4J J;  5E3L A;  4A3M J;  5AQC A;  1JTY A;  4X6A J;  1B72 B;  1I6H J;  4M3D A;  2GBY A;  4ABZ A;  1UHS A;  4DZJ A;  2G3B A;  2WGB A;  3VW1 A;  2Y0S N;  1D5Y A;  2IEK A;  4MFE A;  4DYR A;  3ON4 A;  2OI8 A;  3IUV A;  2YS9 A;  2Y31 A;  1UI6 A;  4M3E A;  3RH2 A;  4DZP A;  2LKX A;  1HDP A;  5F08 A;  1U9O A;  4UUS A;  3O8H A;  1R9T J;  4IHX A;  2ME6 A;  3HGY A;  1ETV A;  2NVY J;  3V78 A;  5HBU A;  4XRM A;  2WUI A;  2M34 A;  1W0U A;  5IYD J;  4AC6 A;  3VVZ A;  2HOA A;  1JUS A;  3HGG A;  5J1R A;  5EYR A;  2O9L A;  5M5X J;  1FJL A;  2RHA A;  3NNR A;  3RZD J;  4FE4 A;  3S17 J;  1RPW A;  3RZO J;  2ID6 A;  2DMT A;  3GTQ J;  1I3Q J;  4B1R A;  3BTJ A;  1T56 A;  3LJL A;  3S1Q J;  1H8A C;  2M2E A;  3BT9 A;  3G1O A;  2X6O A;  2RAE A;  2TCT A;  2LVS A;  1DU0 A;  2JJ7 A;  5EG0 A;  1MBK A;  2O8K A;  3GTO J;  5FGL A;  1SFO J;  3AQS A;  5CW8 A;  4M3F A;  1JKQ C;  1OJL A;  3E7L A;  4UUS B;  3MNL A;  1ETY A;  1ZGW A;  4IHY A;  3LHQ A;  3NAU A;  4MLO A;  2IBD A;  1VF9 A;  3GEU A;  2EQR A;  3S5R A;  3BG9 A;  1TWG J;  1MH3 A;  2Y9Y A;  1BW5 A;  2JK3 A;  5GPA A;  5C4Y A;  3BCG A;  3NPI A;  1U78 A;  3W6V A;  2TRT A;  1UI5 A;  3BR6 A;  3S1N J;  3SFI A;  3O60 A;  1QVT A;  1LFB A;  4QIW N;  5K58 A;  1ETK A;  3I4N J;  3H0G J;  4RBO A;  3BG5 A;  3HKZ N;  3HTI A;  2I10 A;  1BW6 A;  5JLW A;  5FKL A;  3BHQ A;  1S7E A;  3JRB A;  5EG0 B;  5IYB J;  3F0C A;  3VP5 A;  1IGN A;  3HTJ A;  1X58 A;  3HOX J;  3DPJ A;  2DA7 A;  3EUP A;  5D1R A;  2XB0 X;  3HOU J;  5FKN A;  2M9H A;  2JA5 J;  2MG4 A;  3ANP A;  2R92 J;  3OSF A;  4BY1 J;  1Q1V A;  5HSZ A;  2R5Z A;  2IU5 A;  1ETX A;  4A3J J;  2N8G A;  3QBM A;  4C2M J;  4J19 A;  3O8G A;  3M4O J;  3KZ9 A;  3BR5 A;  2R93 J;  1BA5 A;  4UUT A;  3JRC A;  1IRZ A;  5IP6 A;  2Y2Z A;  3Q3S A;  4FCY A;  1IDY A;  1FEX A;  2F07 A;  3TED A;  2IAI A;  2LK2 A;  2X48 A;  4NN1 A;  5EDN A;  3HOW J;  3KNW A;  2GEN A;  1GVD A;  3A03 A;  3VOK A;  2NOG A;  5C44 J;  4JL3 A;  4YZE A;  1ZTR A;  5F0H A;  3VVY A;  2AHQ A;  2NP5 A;  4FE7 A;  1UG2 A;  2K9S A;  2EZK A;  1IC8 A;  2JMW A;  2REK A;  3IV5 A;  4X1E A;  2JA6 J;  4AF5 A;  2X9D A;  1QRY A;  4JNN A;  2GM4 A;  4ICH A;  1ZR4 A;  2E1O A;  4QTR A;  2HXO A;  3BR3 A;  5F1J A;  2R5Z B;  2QOP A;  1GT0 C;  3CRJ A;  1ITY A;  3CWR A;  1NK3 P;  2H8R A;  4S0H B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...