1JT0A

Crystal structure of a cooperative qacr-dna complex
Total Genus 69
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
69
sequence length
188
structure length
188
Chain Sequence
NLKDKILGVAKELFIKNGYNATTTGEIVKLSESSKGNLYYHFKTKENLFLEILNIEESKWQEQWKKEQIKAKTNREKFYLYNELSLTTEYYYPLQNAIIEFYTEYYKTNSINEKMNKLENKYIDAYHVIFKEGNLNGEWSINDVNAVSKIAANAVNGIVTFTHEQNINERIKLMNKFSQIFLNGLSKH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis for cooperative DNA binding by two dimers of the multidrug-binding protein QacR.
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Transcription/dna
molecule keywords QACA operator
total genus 69
structure length 188
sequence length 188
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2001-08-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00440 TetR_N Bacterial regulatory proteins, tetR family
A PF08360 TetR_C_5 QacR-like protein, C-terminal region
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 1jt0A01
1.10.357.10 Mainly Alpha Orthogonal Bundle Tetracycline Repressor; domain 2 Tetracycline Repressor, domain 2 1jt0A02
2ZCMA 2IU5A 1ETOA 2H1KA 3HTHA 2DN0A 3JSJA 3IUVA 1S7EA 2PMZN 4Y7NJ 1ORKA 3BR0A 1MBKA 2NS7A 2R92J 2ZOZA 3BTJA 1JKRC 1EF4A 1MBJA 1Y1VJ 3G1MA 4EEFG 1U78A 3L1PA 2E2JJ 1Z77A 5F27A 1R9TJ 1BL0A 2LVSA 4MFEA 3M3YJ 3VW2A 3BTIA 1HF0A 5CW8A 1LE8A 2WB1N 4QTRA 3G56A 1VF9A 2JA5J 5D1RA 3Q0VA 3AQTA 4XICA 2FBQA 3HOUJ 2PBXA 1JKPC 2X6OA 5HSZA 3QQAA 2V57A 5C3EJ 3ON2A 2QOPA 3QBMA 1ZQ3P 4IHVA 2WV1A 4A3KJ 2DTZA 1JUMA 4BBSJ 5J3LA 2REKA 3VW0A 4IHXA 2QWTA 1RPWA 5C4JJ 2DG7A 2XPWA 1FEXA 2LR8A 1G2HA 4S0HB 4XIDA 1TWGJ 3BHQA 1E3OC 3UKGA 1UI6A 3VIBA 3D1NI 2DMPA 3JRAA 4GCLA 4KWAA 1Y1WJ 3I4MJ 3BRUA 1BJZA 4ACIA 3CCYA 4CGRA 2MGQA 2GBYA 2GUHA 2YVHA 2XGEA 3DCFA 1B72B 4RBOA 2WAQN 3HBLA 2D6YA 1VFCA 1PUFA 5FMPA 1POGA 3BTLA 2GLOA 3EGQA 3OSFA 1H88C 4AC6A 2L7ZA 2ECBA 2XB5A 2R5YA 2LP0A 3HB9A 1ZKGA 2FX0A 1B8IB 4DYQA 5F08A 3LWJA 5HBUA 4JX4A 3HOYJ 1WH7A 3ZOBA 3BG9A 1PUFB 4ICHA 2ECCA 4L62A 1F36A 1YRNA 2GENA 2CUFA 3PO3J 2DA1A 2M0CA 3ANGA 1UMQA 5E3MA 1ETXA 5IP7J 4I76A 1D5YA 3PO2J 1BW5A 2JN6A 2CQXA 5EDNA 3B6CA 3WHCA 3JRFA 4X6AJ 2ZCXA 3CWRA 5E3LA 1UI5A 2M9HA 2NP3A 1TWFJ 3LSGA 4JNNA 3BG3A 2L7MP 3S15J 2LLKA 4FCYA 1WGXA 4YZEA 2LY9A 2M34A 2R93J 3FIWA 3S2DJ 3B6AA 3LOCA 4Y52J 1TWCJ 1XC5A 1P7IA 3HDDA 2G0EA 4IHYA 3JRCA 2DA3A 4FISA 3HTJA 1WCMJ 4DZJA 4A3CJ 1MH3A 2MW8A 3BR1A 4JP0A 4AC0A 2EBIA 2QKOA 5CXGA 4MO7A 2B63J 2G3BA 1A6IA 3NI7A 2WGBA 2AO9A 3HM5A 3G1LA 1OCTC 1FTTA 2UXPA 2LD5A 1UHSA 3LSPA 4A3LJ 4BY1J 3IH3A 2K9SA 5IP6A 5D19A 3BQZA 3G1OA 1FIPA 4M3DA 3FK7A 4J19A 5EYRA 1AKHA 5IOYA 3CDLA 1W0TA 1RR7A 3VW1A 3MVPA 5FKLA 2ZOYA 3LJLA 2H8RA 4XRSG 3BTCA 3O60A 5IP9J 3Q0WA 1BW6A 4MIMA 4A69C 2E2HJ 4G12A 2EZLA 4A3JJ 2VUMJ 1GV2A 4D5FA 1H8AC 3GTLJ 5EGOA 3MKLA 3S1QJ 2XDNA 1IV6A 4CYCB 2NS8A 3LSJA 2VKVA 1IJWC 2G7SA 3S1NJ 1HOMA 1I3QJ 3BG5A 5EZHA 1MBHA 4W97A 3ZQCA 2ME6A 2XPUA 5FKOA 3LNQA 3K2AA 2UXUA 4FTHA 2HQ5A 3ON4A 4UUSB 2TRTA 2P81A 3TP3A 3GTPJ 2OF7A 3BCGA 4NDLA 3HE0A 5AQCA 1APLC 2GM4A 1NTCA 4A3IJ 3TEDA 1HDPA 2W48A 3PPBA 3SFIA 5M3MJ 5D18A 5GPAA 2JA6J 1LFUP 1QVUA 1XG1A 3T6NA 1WPKA 4X1EA 2HI3A 1RESA 5J1RA 2O7TA 2G7GA 2XRLA 2NVXJ 1JUPA 2FQ4A 3GTQJ 3KNWA 4XRMA 2YVEA 2XSDC 4D5CA 4B4CA 1ZGWA 2MSYA 2MG4A 4A3FJ 2DA6A 2LKXA 5K58A 4JX5A 5EZGA 3FRQA 3PASA 5M5XJ 2O9LA 5C4XJ 3TW6A 5EG0B 5HAWA 4A3MJ 3QKXA 2IBDA 1IG7A 1YRNB 2JA7J 3GTOJ 1RKWA 4B3AA 2WUIA 5H9TA 3OOUA 1JKQC 3COLA 2EQRA 2UXOA 3TW7A 2HOAA 2CJJA 2LFBA 1VNDA 3JR9A 1A5JA 5F0FA 3BR3A 4BKXA 3HOXJ 3A02A 1DU0A 2XGCA 3QPLA 2R5ZA 3VVZA 1AU7A 2Q24A 4GCKA 2E19A 5F1JA 5IYBJ 1GVDA 4DYCA 2M8GX 2NP5A 5FHPA 5IOZA 3S17J 2VKEA 5FKMA 5J1UA 2JJ7A 3C07A 2E1OA 3EUPA 5IPAA 4M6VA 1ITYA 1FIAA 3MNLA 4XRSA 1JGGA 2DA4A 2VI6A 2Y0SN 5C4YA 5FLMJ 1LE8B 3HOVJ 4HKUA 2DMTA 2AHQA 2DMNA 3E7QA 2EZHA 2X9DA 3BR5A 2JA8J 3SDGA 2R5YB 1FTZA 3K7AJ 1GT0C 1NK2P 5M5YJ 1ZR4A 3CRJA 2VPRA 3S1RJ 1JJ6C 5DAJA 2I10A 2HYTA 2JWTA 3JREA 2HDDA 1AHDP 3HGYA 2ELKA 2EZIA 4LOCA 3B81A 3NPIA 2FJ1A 2QF7A 4UUSA 2DA2A 1TWHJ 2DJNA 2HXOA 2HKUA 2RASA 3PM1A 4D7NA 3Q0UA 3JRDA 2LTPA 1OJLA 3HOWJ 3RQIA 1DU6A 1VI0A 3GBGA 3A01A 3F1BA 1P7JA 2NOGA 2RAEA 3KZ9A 2YS9A 4JX6A 4A3BJ 4IHWA 2NVQJ 2ID6A 2L7FP 5EGOB 4B1RA 1RETA 4FE4A 2O8KA 1W0UA 1B8IA 1U9NA 4MK6A 3OIOA 4M3EA 4C3JJ 5EF6A 2YU9J 4HNVA 3S2HJ 2FD5A 1IUFA 2NX4A 3RD3A 1SGMA 1ETYA 3MN2A 3CJDA 3TP0A 4A93J 1ZR2A 4ABZA 3JRHA 2QIBA 1X58A 3F0CA 3ZQGA 3GZIA 3P9TA 3O8HA 2EZKA 3NARA 3JRGA 2CUEA 1X2NA 2IEKA 4MLOA 2M2EA 5K7ZA 3HOZJ 2L9RA 1GDTA 3VOKA 3S16J 5K7HA 4I6ZA 1O4XA 2DG8A 3ZQHA 3RH2A 1JTYA 2ZB9A 3NAUA 1WH5A 3ZQIA 3DPJA 1U9OA 4C3HJ 3GTJJ 4C2MJ 2KDZA 2X48A 4A3EJ 1H89C 3HKZN 4UDSA 4UUTA 2OI8A 1ETWA 5FGLA 1Z0XA 1MSFC 2YUSA 3RKQA 3VOXA 3HIMA 1HDDC 5JLWA 4DYRA 5EG0A 2CRGA 4FE7A 3LHQA 2QCOA 4M3BA 1JT6A 3BQYA 4V2FA 2UXHA 3HEFA 3V6GA 3A03A 2UXIA 1IDYA 2K9NA 4BY7J 3KKDA 4NELA 2CU7A 2DMUA 3LSRA 3CMYA 2Y31A 3GTMJ 3VP5A 9ANTA 5JLXA 3OSGA 2W53A 5FKNA 5E3NA 4D7MA 1T56A 3O8GA 2HOTA 1JJ8C 4PXIA 1U8BA 3RZDJ 4AUXA 3H0GJ 1QPIA 1ENHA 3W6VA 2TCTA 5E3OA 1ZK8A 4GFLA 4GFKA 3GTKJ 2R7ZJ 5EEAA 5BNGA 3JRIA 4AF5A 2E2IJ 5GPCA 1MSEC 4BXXJ 4M3GA 1WI3A 4L5EA 5M5WJ 3QPSA 1IDZA 4A3DJ 3DEWA 2OPTA 1TC3C 1K61A 1I6HJ 3VVXA 1ETVA 3BR2A 1LFBA 5K7FA 1AKHB 2G7LA 2ID3A 4CYCA 2D5VA 1K83J 1QVTA 2Y9YA 5GP9A 5FLVA 2GFNA 1TWAJ 2K40A 3BJBA 2ZCNA 4W1UA 1MBGA 1JTXA 2L0KA 3S1MJ 4DW6A 1T33A 2RHAA 3E7LA 3GTGJ 4C3IJ 2JK3A 5FKKA 5F04A 1ETKA 3G7RA 2LK2A 2ME0A 3HGGA 4IEJA 3H3VK 4QSHA 2XGDA 2HXIA 3HTAA 3NNRA 3S14J 3CQZJ 3C2BA 3KKCA 2HYJA 3FISA 4M3FA 2NVTJ 1Q1VA 1ZTRA 1MNMC 3Q3SA 4MXMA 1I50J 4RDUA 4QIWN 3VUQA 1RKTA 5HODA 5F0CA 2EH3A 3FK6A 1UG2A 2JMWA 5EFYA 4MFDA 3RZOJ 2OERA 5CXIA 2IAIA 3NXCA 1F43A 1GUUA 1CQTA 2N8GA 1IRZA 4JKZA 1MBFA 3I4NJ 3WHBA 2DA7A 4NN1A 5C44J 2PZ9A 2Y2ZA 2DMQA 2HOSA 1BA5A 4GCTA 4BBRJ 2Y30A 5FJ8J 2Y9ZA 2R5ZB 2R0QC 1NK3P 5DTDA 3VPRA 1JKOC 5IYCJ 2COBA 1FJLA 1JUSA 1OCPA 1HCRA 3BR6A 1SFOJ 3BT9A 4GFBA 3ANPA 3IH4A 2DA5A 1MBEA 3SJMA 3NRGA 3GEUA 2O7OA 1HLVA 2QTQA 5J1YA 5F0HA 3ZQFA 1IGNA 1B72A 3A01B 3VVYA 3V78A 5DS9A 1JT0A 3S5RA 3ZQLA 1ETQA 4ME9A 1SANA 3IV5A 1GV5A 3M4OJ 2K9QA 4AYBN 4JYKA 1XS9A 1QRYA 5M3FJ 3HTIA 2XB0X 3AQSA 2NVYJ 1X2MA 4DZPA 1OFCX 5IYDJ 2CQQA 2XPVA 3BNIA 4A3GJ 1MH4A 4V2GA 4XK4A 2F07A 1IC8A 3JRBA 4JL3A 3IH2A 2KT0A 3FKIJ
chains in the Genus database with same CATH superfamily
2IU5A 3HTHA 1LEAA 3PSFA 1S7EA 5CVVA 4L9NA 4Y7NJ 3HOTA 1S5LC 1VTNC 1N77A 4L5JA 2ZOZA 5E8GA 1K6OA 3ZN0A 1OYIA 1MBJA 1Y1VJ 4S04A 2K9MA 3L1PA 2E2JJ 2EK5A 3A2KA 2LVSA 3JW4A 3M3YJ 5B1BH 4LB6B 2R7XA 4U87A 3BLYA 1RZ4A 1HF0A 1WFXA 2CUZA 4PFPA 4BE1A 1VF9A 1BC7C 5D4RA 1VQ6I 5L3DA 2XC7A 1XD7A 1S7OA 2MC3A 4CCOA 1S7AA 4Y13A 2X6OA 1Z3XA 4EGYA 4XOTA 1FSHA 1N25A 3T1BA 4UV9A 5CVUA 2ZMEC 4J00A 2KIUA 3VW0A 2QWTA 1RPWA 1LDJA 4RA2A 3EUHA 3EDPA 2LR8A 1FEXA 1XDSA 2ELJA 1LUJB 4H4KC 1VQLI 3I4PA 3CCLI 1BC8C 3D1NI 1TLHB 1Y1WJ 2HZDA 3CCYA 1OR7A 1QHHD 2MGQA 2X6YA 4GGGA 3OIPA 4E4HA 1F9NA 1I39A 2DODA 4Y3OA 4UXNA 1PUFA 2VOOA 4BXUA 2GLOA 5TRDA 3EGQA 4L0YB 3RTRA 3TBIA 3EUHC 4HX4A 1T08B 2L7ZA 2XVCA 4BYYA 2ECBA 3W2AA 1X1PA 1V54H 1ZKGA 2LSOA 5E8IA 1VQ5I 3LWJA 4XN3A 2LDUA 2RDPA 1PUFB 4AVPA 2WBMA 2CV2A 1F36A 3KZYA 2CUFA 5DDGA 3PO3J 4N4NB 1SMTA 5J4YA 5J4VA 3OS1A 4HZFA 1ETXA 4LITA 4BNCA 5ICGA 1KYWA 3B6CA 1HKQA 3WHCA 3JRFA 1J9IA 1UI5A 2PFVA 1BIAA 2JSCA 4HSTA 3CJNA 3AAFA 3C2GA 3IWFA 2CFXA 2EA4A 2LY9A 1FMWA 2M34A 2WY7Q 4PZJA 1XSXA 4HSRA 3LOCA 3NEUA 3IAS2 4RAFA 2MFZA 2G0EA 2XAHA 3DEUA 4PJMA 4FISA 3DU5A 4XLEA 4A0YA 4MEXF 1WCMJ 1YW8A 2BW3B 2MW8A 2XROA 3I59A 4JP0A 4AC0A 2EBIA 5CXGA 4XRFA 1T95A 1NG6A 4ESJA 1A6IA 3H9JA 3K4JA 1XGMA 4ESFA 5LGTA 2AO9A 1Y0UA 2VQCA 4E7SA 3V8JA 4DNCA 1L0OC 1WJAA 3DU6A 3CMEI 4BY1J 1WVRA 2IXSA 2LBFA 3J7ZI 3BQZA 4M3DA 2VKDA 2V9VA 4HAMA 5CLSA 4U0WA 3HRTA 2MLKA 2IS1A 4F3QA 3MVPA 1ZG5A 4C30A 2HZTA 2LBFB 3BTCA 3S32A 2G7HA 2V9KA 2VASA 4C9YA 2BGCA 5IP9J 1BW6A 2E2HJ 4ON0A 2DO7A 4LG0B 3ESWB 2VUMJ 1BOBA 3BY6A 3EUKL 5EGOA 2OCEA 4OMZA 2W85A 2BYVE 2NS8A 3PIOF 3BJAA 1IJWC 3FBNB 3BG5A 1G6NA 5GTHC 3LNQA 4L5IA 1L3LA 1TZLA 4EVIA 1ZN2A 3CZ6A 2DFIA 1AA7A 2ICWG 2E1MB 3S2WA 1APLC 3GX4X 4UNOA 3LQQA 1U5TA 3PFYA 2OZ6A 5EEGA 1NH3A 2JA6J 2K9LA 3T6NA 1S8NA 3TO9A 4BXFA 2FOKA 2KHMA 3W3CA 1GXPA 1IAWA 2GOXB 4ASNA 3FXQA 3KP5A 3KFWX 4HPQA 3JSOA 5J1RA 1ERDA 3EUAA 5A2QK 2Z3YA 2XRLA 1IXRC 1JUPA 4FT8A 4V19K 2ZBKA 2JUCA 1ZGWA 2MSYA 2Z5UA 4A3FJ 2DA6A 4RAZA 5K58A 5BQTA 3ZQQA 3TW6A 4RM2A 5EG0B 2L3DA 4A2UA 4I7HA 5HAWA 2FE3A 4A3MJ 1IG7A 3VDXA 4U0VA 1YRNB 3P9CA 1RKWA 4B3AA 3QYBA 2WUIA 3OOUA 2EQRA 1MMAA 1PP8F 1I1GA 2HOAA 3FHNA 2HVSA 2XKPA 3BC8A 2L02A 4C2TA 2UXNA 5F0FA 4BKXA 4ENNA 2L01A 3O2PE 4G6DA 4HQMA 1J59A 2R5ZA 1LEBA 2UXXA 4NUBA 3ZMDA 1ZYRF 2EIJH 3P7NA 1ZLKA 1GVDA 5DUKA 1S6LA 4DYCA 4HF1A 1M1EB 2H09A 4M74A 5DD4A 4WXDA 4BS9A 2HU9A 3HHHA 3KIOA 2L4AA 2E1OA 4AIKA 1TBXA 1XX5A 5L3FA 4F92B 3MNLA 1JGGA 2VI6A 5FLMJ 3C3WA 3E7QA 3HRSA 2JA8J 2VJIA 3K4NA 3OR1C 2R5YB 3C1DA 5M5YJ 2KQRA 3N05A 2QYOA 1Z67A 4N0BA 2RN7A 3S1RJ 5DAJA 4GO1A 1HC8A 3ZGKA 3QODA 2FBHA 2D2WA 5KNLA 1AHDP 1O7LA 1MD0A 4LOCA 2VT2A 2QF7A 3MKZA 4UUSA 2HXOA 4A5NA 2CYYA 2NOJB 4B3XA 3JRDA 1FYMA 4BHBA 3A01A 2ZCWA 2RAEA 1BM9A 3EYIA 1SFXA 2F4MB 2YS9A 2V6EA 1V5EA 4GDFA 1X3WB 2NVQJ 2CFOA 4HV6A 3FZVA 3OYJA 4RS8A 2L7FP 4B1RA 1BBYA 1ZARA 4A12A 3OIOA 4C3JJ 5F64A 4G7HF 1ETYA 2DQRA 3MN2A 1W7PB 3TP0A 1XGSA 1SD6A 3H36A 4UVCA 1Y8RB 2OC6A 1T8IA 4AM3A 3BG7A 4BQAA 1IW7F 3F0CA 4CCKA 3F8NA 4PGHA 4CSWA 3P9TA 2EZKA 1Z3YA 2V1UA 2CUEA 5D5XB 2L9RA 1B6AA 3K6GA 2FUG2 2YPRA 5TGTA 4PJNA 3R0JA 2CSOA 3RH2A 3ZQHA 1JTYA 2IS6A 3SEQA 4E6KG 3H1CA 1DPUA 4A3EJ 1FBUA 1H89C 1YJWI 4YFKF 2F5FA 5KVRA 4UUTA 1A31A 2OI8A 1UB9A 3RKQA 3VOXA 1KONA 2FRHA 2M7BA 2PQ8A 4PSXA 3LHQA 2UXHA 3H5AA 3HEFA 1X3ZB 4UHTA 2F5DA 3HJEA 4FX4A 2EB7A 2OAZA 1VQ7I 1FOXA 2ESNA 5KHDA 2YU3A 2DMUA 3WE2A 5FO5A 3GTMJ 1V55H 2M0MA 3KYLA 3IP4B 3VP5A 3WU1B 4BHPA 5JLXA 2CQ7A 1I6XA 5FKNA 2H94A 2MC4A 5E3NA 1T56A 2DDAA 1U8BA 3RZDJ 4H0EA 3VSKA 2GXBA 4XL9A 1UFMA 5HDNA 3ZR8X 1W5CC 1ZK8A 2FBKA 4GFLA 1XMAA 4GFKA 4MHGA 3GTKJ 4DOZA 2DT7B 1VQOI 4XOPA 4OIPF 4AF5A 5GPCA 1MSEC 3DEEA 4M3GA 4ZTJA 1BN5A 3QYFA 4KUMA 5M5WJ 1J5YA 4XONA 4P5OA 4MEYF 3DEWA 1SFEA 4NNJA 3RCOA 1BI1A 2W24A 1K61A 3VVXA 3RPUD 2VT3A 3A0BC 1UJ8A 4CYCA 1K83J 4WIBA 3I59B 4ITVA 4UUVA 1XGOA 2K40A 2F6CA 1IZ1A 3SFZA 2ZSIB 1P4WA 1QZYA 1IN7A 2STWA 2R7TA 2XASA 3S1MJ 1R58A 3K4KA 2HQNA 2VBWA 5FKKA 2ZMEB 4IOAF 3H5RA 1TTYA 2BZTA 4XLCA 2A6TA 4RM3A 5KCMA 2HNHA 1P9QC 4XKCA 2R7RA 2DOAA 3KP7A 1FP2A 1VQKI 1QZEA 2RV8A 3S14J 1YW7A 4LMYA 3KKCA 3FISA 4M3FA 1R5GA 5HDGA 4MXMA 3I58A 3KYDB 3WTUC 2GZWA 1UG0A 2IA0A 1UAAA 4QIWN 1STZA 3VUQA 5LRRA 3ZP5A 3U2RA 3FK6A 2JMWA 2HYGD 4MFDA 3RZOJ 2OERA 2BVLA 2MLGA 5CPRB 2DXIA 4BGDA 3ML6A 2ZNZA 4XLAA 4CICA 1MZBA 2HPMA 3I53A 4KJZA 1BA5A 3J81K 5LFAA 2AS5F 4BUPA 2Y30A 3W6JB 1T6SA 4I99C 5B3SH 4FX0A 3V8KA 1IN8A 3UR3C 2B1EA 1V5FA 1HW2A 3VPRA 1W5TA 4MNUA 1G4DA 4BL0B 1YE9A 5JVTA 3PNVA 3BT9A 2KFDA 3IH4A 2LNBA 2DPDA 4M9XA 1ZLJA 3M8EA 4E7ZA 3G4SI 2COMA 3ULQB 2ZXIA 4XKWA 2ZY9A 5LGNA 1HLVA 3MAJA 2QTQA 5J1YA 5F0HA 2HTSA 4F7ZA 1WJ5A 1PVEA 4BE0A 4XLPF 3S5RA 1SANA 2KP6A 4AYBN 3HTIA 2XB0X 3E3VA 2Z16A 1FX7A 3I64A 2CQQA 3IUOA 2CUJA 3FF5A 1LDKB 1KQ8A 1MH4A 2BY1A 2QGUA 4WCGA 1R1TA 1V5GA 5D6FA 5K1YA 2F4OB 3AL0B 1I27A 2KT0A 5LEJA 2ZCMA 1ETOA 2H1KA 2M4GA 3JSJA 2KL4A 3MFKA 3IUVA 3CCVI 4F91B 3IL2A 2ZXJA 4PFOA 2VIXA 4QLCU 5F1RA 1JKRC 3G1MA 1GLNA 5F27A 4EM0B 5CVIA 3P9KA 1QU3A 1W7PD 2WA0A 3NQOA 3BTIA 3VODA 3F6OA 2VQGA 3MZYA 2JA5J 2R7VA 3AQTA 1E2XA 5E17F 4CH7A 2STTA 2M8EA 1AWCA 2FBQA 1A6QA 3HOUJ 2PBXA 1JKPC 5HSZA 3UNGC 5FRNA 2Q2EA 3ON2A 3VYRB 2Y48A 1G3YA 1ZQ3P 3K9TA 3RSNA 2DTZA 1JUMA 1MMSA 4Y15A 1U3EM 2REKA 2I8DA 2Q0OA 5C4JJ 2DG7A 4ZH4F 2BOLA 5GADJ 1G2HA 2A5WA 4S0HB 1UHMA 2Y69H 2ZJ2A 4A0ZA 3VIBA 4LK1F 4BQNA 3MD2A 3PUFA 3BRUA 2GBYA 2LREA 5AIPA 3ZMVA 3N4MA 2YVHA 2XGEA 1H9GA 3DCFA 5BOXA 2WAQN 2KJBA 2Z99A 2ETHA 3HSEA 5FMPA 4LK0F 2GOMA 3KEQA 2YX4A 3OSFA 4AWXB 3HB9A 5F6FA 5D4SA 4KISA 2RC4A 3F8BA 4JX4A 3BCBA 3TOBA 3T8TA 4L62A 4KNYA 2V1NA 3CCRI 5L3EA 1CGPA 2M0CA 3REOA 3ANGA 1I5ZA 1MMNA 3ASNH 5IP7J 4I76A 3TDUC 1BW5A 2CQXA 2Z33A 2QSFX 2R7QA 2ZCXA 4X6AJ 5E3LA 2M9HA 3QU3A 2G7UA 3HHGA 3BPVA 2LLKA 4MQVA 3Q5FA 1WGXA 5EJCA 3S2DJ 5E18F 3B6AA 3E1SA 4Y52J 2XUBA 3MKWB 4ZZDA 4L18B 2O0YA 3MEXA 3JRCA 2DA3A 5LHGA 3OY9A 2R7SA 3HTJA 2JSPA 2OQGA 3BR1A 1X1AA 3VOEA 1T39A 2WWYA 2G3BA 4LJZF 2L9NA 3G1LA 3WG7H 1OCTC 1DGWY 2FOWA 3CUQC 3KEYA 4HNTA 3FMRA 2LD5A 2EWNA 3IRRA 3LSPA 2RQQA 2DFFA 1CF7A 2M3AA 1YX3A 2FA5A 5IP6A 5D19A 1JXSA 3G1OA 4G6TB 3M8FA 3OYMA 3LSTA 3CDLA 2PJPA 2RASA 3KX2A 3RKXA 1W0TA 4P55A 1YYVA 1IN5A 3GZNB 3LJLA 2P6SA 2NNYA 1OQYA 4XRSG 4UB8C 4EMSA 2K5CA 3K1NA 2JRTA 3Q0WA 1ZH5A 4GYGA 2EZLA 3NWSA 5LRSA 2CQKA 4D5FA 3GTLJ 1DGRM 3MKLA 2XAQA 2BXZA 2JTVA 3S1QJ 4OIOF 5A2QZ 4EJOA 3V4GA 2G7SA 1KU3A 1IN4A 3S1NJ 1HOMA 1I3QJ 3M8JA 1BJAA 4IHTA 3WE3A 2ME6A 3HZJA 3ECOA 1MMGA 5FKOA 2UXUA 1MMDA 1OLTA 4UB6C 3E5UA 2P81A 3N97A 3K4CA 4NDLA 3H0DA 4A3IJ 3TEDA 3OYKA 3FXLA 1SVLA 2M4KA 3SFIA 2O6GE 2UV1A 5GPAA 1HW1A 1ZAOA 3TGNA 5BMZA 1LFUP 1LNWA 1QBJA 4IKFA 5JI6A 2R7OA 3U1KA 3RIRA 2CH0A 4E7LA 4KMUX 1RESA 2B0LA 3CJRB 3R4KA 2KZVA 3S3OA 2NVXJ 3RJPA 4ZDLA 2MH2A 4XRMA 4IQJA 2XSDC 3L00A 4MQ9F 3TKYA 2LKXA 1OCOH 5EZGA 2X6XA 3FRQA 2EIMH 5M5XJ 2F5EA 2P4WA 4YIIA 3PJRA 2IBDA 1G59A 1ODDA 2NYXA 1FZPB 3TL4X 3TO7A 3K10A 3TW7A 2DJIA 2CJJA 1LFPA 3ABKH 4PSWA 3FXKA 2MYSA 3HXLA 4FETA 2KIQA 3TQNA 2CO5A 4D0PA 4M71A 1S9HA 2X6WA 2XGCA 1LQ1A 3J7AY 2CWEA 3OOPA 3VVZA 2K4JA 3DTEA 2Q24A 4GCKA 3GW2A 1USTA 2QQ8A 2FNAA 4BAYA 3R60A 5F1JA 3JSPA 4YFXF 5IYBJ 1Y8QB 2M8GX 5FHPA 4CYDA 3F9KA 4AIJA 1I1SA 2E71A 4FASD 1P4AA 5FKMA 3C07A 2OZUA 3EUPA 4OD5A 3K4MA 1XDUA 3P9IA 3KP3A 3BZKA 3RKYA 2BE5F 1W1WE 1SVMA 2Y0SN 3KZZA 2WY8Q 4IRVA 1USSA 3WTTC 1D0ZA 4KYWA 3RDIA 3SDGA 1EH7A 5D5WB 1NK2P 3JCUC 2VPRA 3ZXSA 2E35A 1TQMA 1WJFA 2HYTA 3RKWA 2QBYB 2JWTA 2HDDA 2VONA 4IRIA 2KRFA 2M7AA 2HYFA 3B81A 3LWFA 4D9JA 2VBZA 3BPXA 3HOWJ 1OJLA 2IVMA 2CGPA 1DU6A 2H1LA 3OYHA 1P7JA 2NOGA 4PCQA 4BEHB 2P6TA 1MJBA 3SDBA 2FF4A 5KK1A 3FXUA 2OBPA 4A3BJ 4M6XA 2FXAA 2ID6A 2ZXHA 5CVRA 1S72I 2VBYA 1X1DA 4FE4A 2O8KA 1B8IA 1U9NA 4MK6A 5EF6A 2DDBA 3ZMUA 3K2ZA 1DP3A 3DV8A 5DYMA 2FD5A 5IT3A 4BE2A 2EFQA 1HW5A 2DBBA 2FMLA 5J47A 1QQIA 2Y0MA 3G71I 3VYTB 2DT6A 2E5NA 1SAXA 3SXYA 3M1EA 2NVUB 1D0XA 1RR8C 1FOKA 4CXFA 3NARA 3JRGA 2BW3A 1HSTA 5K7ZA 4XSXF 2M2EA 5H2FC 5AIQA 1KU7A 4EV0A 3FM3A 1GDTA 2LY1A 1WJCA 4HLYA 1YTYA 3S16J 5K7HA 3K4LA 4C2MA 2OA4A 2VJ4A 4RGRA 2ZB9A 2A05A 4EJWA 2IT0A 1REPC 3PQJA 3DPJA 4HLXA 3GTJJ 4C2MJ 4NB5A 3E97A 5BPIA 3CUQB 4M9SA 1K7AA 3PL8A 1Z0XA 1ZGAA 5FGLA 2YUSA 3W2VA 3TO6A 1MNEA 1TNSA 3FWEA 2QQAA 2QEXI 2PJRA 3F8CA 1MJ9A 4YRVA 1G3WA 2KRCA 1JT6A 2QCOA 3NRVA 4M3BA 3V6GA 1Z7UA 2R3SA 2KPMA 1F1ZA 4IO9F 2UXIA 1FLIA 1IXSB 2CU7A 3HUGA 5E1ZB 2Y31A 4Q47A 3ABLH 1ON2A 4Y4RA 5B5EC 3L2VA 2W53A 5D5VB 1JJ8C 3SZTA 2QUFA 3QP5A 4AUXA 3H0GJ 4F55A 5B66C 1Z6RA 3M7GA 2JA2A 1OPCA 4XNFA 2TCTA 1QGPA 2UUZA 5EEAA 3PIPF 5D8LB 1ACIA 3S93A 2BBYA 2KZGA 4AYBA 1R1VA 2Z9OA 4EM1A 2LG4A 1ZHFA 4L5EA 2LYCA 2XAUA 1FNNA 2VPLA 3F3XA 2ZJQF 2FU4A 2WV0A 1ETVA 3BR2A 3J81Z 4CUGA 2G7LA 2VQLA 1ZG1A 2ID3A 1VQ8I 2D5VA 1TT5B 5ERIA 4QPQA 2FEZA 1EJ9A 1W4MA 3MQ0A 1K6YA 2GFNA 3BJBA 2ZCNA 1IF1A 4L0ZB 2X51A 4ENMA 2L0KA 1WJEA 3KLNA 4DW6A 1T33A 2VJJA 4AU7A 4ZYDA 1ZG3A 3G7RA 2LK2A 3ZMSA 3CMAI 2IGOA 1D1BA 2K7LA 2XGDA 2E1MC 2HXIA 3M9AA 4NC6A 4B48A 5FD5A 3L09A 3HTAA 5BS6A 2QVOA 4FHTA 3HPHA 4RAGA 4RB2C 2H27A 3CQZJ 4X0GA 3MKYB 2BY3A 2DT5A 5GAGJ 4L9TA 1NG7A 4D1QA 4XLHA 5D8KB 1ZRCA 1BR2A 2G9WA 1RKTA 3WGGA 5HODA 1W5SA 3W6KB 3GLLA 1UG2A 4A6EA 4YG2F 4OOIA 3HIFA 1FP1D 1WHUA 5IT9Z 4XN0A 1VZ0A 3D5RC 2GA1A 2PZ9A 4WX9A 4PK4A 2VC0A 1FPQA 3HUGB 2HOSA 1ON1A 2M45A 4HOBA 1B9MA 4BBRJ 4Q4ZF 1MDMA 1NHAA 4KIBA 4GCTA 4IXAA 2Y9ZA 2DCEA 1QA6A 2HQAA 2IS2A 2W84A 1SMYF 1E17A 4YELA 2LMDA 2WAEA 4BH9A 3QPTA 3QP6A 1YJ9I 2W7NA 2MD5A 1HCRA 3BR6A 1FY7A 5B1AH 1SFOJ 3DQVC 2JVGA 4CA0A 2A68F 3OYAA 3LAPA 1MBEA 3L7WA 3NRGA 2O7OA 1R23A 3HG9A 2OD5A 1IGNA 3L2WA 4RB3C 2F48A 5E20A 2KDOA 3IV5A 1FWZA 3OYLA 1OCZH 1SD4A 2K9QA 4R8HA 1VQMI 2MD0A 4JYKA 2WAQA 2P5VA 3KEOA 2NVYJ 2IGMA 3E6BA 4DZPA 3IKVA 1OFCX 2YR2A 4NQWA 2VE9A 3H35A 2HDCA 1WRJA 5L3BA 4V2GA 2DOFA 1IC8A 4M72A 1SFUA 1BI2A 3I3LA 2DN0A 3QWLA 1G3SA 2Z2SB 1ORKA 3GFJA 3IRQA 2L54A 4UVAA 3BR0A 2NS7A 2R92J 2LF7A 4G7ZF 1FSEA 1U2WA 4OAZA 3EYYA 3VEPA 4XMYA 2AXLA 4IZZA 4RGXA 2EIKH 1W7PA 2NNNA 2X1DA 3OL3A 4F52A 4L9VA 4XM3A 1Q1HA 2OTJI 3KP2A 2EV6A 3V7RA 5HLGA 4KT5C 1QO0D 2L9VA 5CW8A 1LE8A 2WB1N 2YSRA 3S3MA 4RMNA 4QTRA 3G56A 1I3AA 4B44A 5D1RA 4CCJA 3Q0VA 4O5VA 4Y33A 4XICA 4JQFA 3E6MA 2QSHX 4NC8A 4M9ZA 4UV8A 1A04A 4YEJA 3F23A 2HWVA 3QQAA 2V57A 3FBIB 5FROA 2QOPA 3QBMA 5LBQA 2VE8A 2WV1A 4A3KJ 5J8CA 2A6HF 5LHHA 4BBSJ 5J3LA 3J80K 3DKYA 3TDZC 5JFRA 3RYRA 3CCUI 4WXCA 3WTWC 3GFIA 4XIDA 3KPHA 3BHQA 1FOYA 2X4HA 3UKGA 1XPXA 1UI6A 1TW2A 2D1VA 3JRAA 4P96A 3I9V2 4ACIA 3ABUA 4HG2A 4CGRA 1SAUA 2EFPA 3MZ8A 4KN4X 2GUHA 4DVYP 1TNTA 1JE8A 2QKMB 2CV1A 5HVQC 4KIGA 3HBLA 3SZGA 1OISA 1WWXA 1ZRFA 1VFCA 3DXJF 2MA3A 3MWMA 2VL8A 2K3FA 4G94A 4AC6A 4LG0A 2GQQA 1D8KA 3F72A 3H92A 2LP0A 2R5YA 1SEUA 5LD2C 3F8FA 5H6QA 2FX0A 1B8IB 1VQ9I 4DYQA 5HBUA 5CKTA 3HOYJ 1WH7A 5HLTA 3ZOBA 3WTVC 5CQEA 2D1HA 2PI0A 1D5VA 4I98B 4I2OA 2GENA 3E6DA 3AFHA 2DA1A 3GEZA 2KRHA 1S3JA 4EJUA 3PO2J 2CG4A 2KISA 1D5YA 2JN6A 3CF5F 2ACJA 3CWRA 1TWFJ 4JNNA 3G3ZA 1BR4A 3BG3A 3OS2A 4FCYA 4YZEA 1N75A 2HGCA 2R93J 3KP4A 2EJRA 1V3FA 4IL6C 3GLXA 3KZIC 4ZYAA 1P7IA 4IHYA 1TW3A 4ESBA 4DZJA 2OUMA 1MH3A 2QKOA 1WI9A 4MO7A 4A0XA 5LHIA 3E6CC 1R71A 2KJCA 2BHYA 1U6GA 3U21A 1TQPA 5TISC 4CCLA 4OAYA 3L2CA 4A3LJ 3IH3A 4HW0A 2K9SA 5DD8A 2VXZA 1DPRA 2X1CA 2XSJC 1FIPA 3DPLC 2W57A 4J19A 1AKHA 3HPGA 4ZTFA 1RR7A 3RPUA 3VW1A 2KIMA 2QQBA 5L3CA 5FKLA 1EA3A 1EV7A 2H8RA 3OS0A 1B1BA 2DFHA 3O60A 4A69C 4XLNF 1Y6IA 1OYYA 2M1BA 1ZGJA 4G12A 4NC7A 2KLOA 3U9GA 4GRIA 2K86A 4E7JA 4A3JJ 1K79A 4P9FA 5J6XA 5E79C 3GVAA 2VODA 4DBRA 3CO7C 4QWQA 5LLQA 3FXOA 3LSJA 3CCJI 3KYCB 1J09A 5J40A 1MBHA 1V4RA 4W97A 2DQLA 2XPUA 3QAHA 3K2AA 4BDZA 1UELB 2DTRA 4UUSB 3TP3A 2W4SA 2AQEA 3BCGA 5AQCA 1R5ID 2EA2A 2P8TA 2ZKZA 1NTCA 2GM4A 3GZ5A 3LQRA 1HDPA 1WJBA 2XF6A 4NHJA 5D18A 3QOPA 5CQGA 2UZKA 1QVUA 3OYGA 3L2RA 1WPKA 5JVGF 2Z1DA 4RLFA 2L2OA 1U5TC 2KKOA 3SEZA 3LA7A 1H0MA 2LF8A 4O3MA 3KETA 2G7GA 2E5ZA 1D1AA 1R36A 5FLXZ 2HKXA 2FQ4A 4AVZA 2PLYA 3KNWA 3KP6A 2YVEA 1MJAA 4D5CA 1XTAA 2LKPA 5K5QA 2O9LA 4BQOA 3SWHA 1P4XA 3QKXA 4XLFA 3HSRA 1Y56A 3Q9VA 5HS9A 1UHWA 5FFXA 1LJ9A 5H9TA 1UZCA 4WF2A 4PUSA 5L3GA 2LFBA 4RAYA 2JZYA 3OL4A 4LIUA 5FD6A 3JR9A 4UY8I 5H20A 2JUGA 4OIRF 5BPDA 1JHHA 3HC7A 4B47A 3LAJA 2NRAC 4K2EA 3DTIA 4U9LA 3LSHA 2XHKA 2A61A 1RUNA 4EATA 3QPLA 2VOPA 1S29A 1RRJA 5DM7F 1AU7A 4LLNA 2E19A 2CS3A 2ESHA 2FQ3A 2OJED 3ONQA 4M73A 3F21A 5IOZA 2PMUA 2Q2EB 2VKEA 1TP4A 3AG4H 3FX3A 3DKWA 4B43A 5J1UA 2JJ7A 1PUEE 1RIOH 3M1CA 2VXDA 4XRSA 2X85A 2J5PA 1R00A 2VN2A 2E34A 3OYNA 4U88A 5C4YA 2VQHA 5E1XA 1ZREA 2DMTA 2AHQA 3H3ZA 1RI7A 1BIBA 2X9DA 3BR5A 3K7AJ 4MTDA 1ZR4A 3HRMA 5ILVA 1O3SA 4U7BA 3CRJA 2ZFUA 4DGWB 4XORA 5ICEA 2DYRH 2H6CA 3QPHA 4OIQF 3A1YA 2P7CB 3HGYA 2ELKA 1X3UA 2EZIA 5HNFA 1P2FA 1EH8A 2DA2A 2DJNA 2RVCA 3GF2A 3WGIA 3SZPA 5HOOA 4J01A 3PM1A 2E1CA 1O57A 1QHGA 4D7NA 2LTPA 2O61A 1YITI 1MKMA 3RQIA 5CJ9A 1VI0A 2GIVA 4G9YA 2DK8A 1T0FC 5D6EA 1K4SA 3OYCA 4JX6A 3K70D 3I0TA 3M07A 1TQIA 3C18A 3FDYA 2YU9J 1XCVA 4HNVA 1AOYA 2DK5A 3PNYA 2NX4A 3ZRGA 1SGMA 3WGHA 3SYTA 2EINH 2K27A 2XAJA 4ABZA 2CV0A 1X58A 2BEOA 1Z91A 4MLOA 2IEKA 2CMPA 1YO5C 3HOZJ 1SFKA 1YLFA 3O6BB 2GA2A 3FM5A 1J7KA 2DG8A 3GXOA 4HX8A 3ZQIA 1WH5A 2QA4I 4BJTA 1U9OA 3DBHB 2KDZA 2XKOA 1Z9CA 1RNLA 3CCMI 2WB1A 4HEA2 1X19A 4OWRB 2ZFWA 4YIRX 3GFMA 2P5LC 3BZ6A 1HDDC 5DCMA 2R7UA 2A5YB 1OCRH 4KT6A 4ETSA 4LB5A 3CCQI 3BWGA 3BQYA 4V2FA 3CP2A 2H6BA 3A03A 4CCMA 1ZRDA 4ZZLA 1IDYA 2AQFA 2K9NA 2M87A 4BY7J 1Z6TA 3JAMZ 4EJTA 2HQRA 1N78A 1SC7A 1FBQA 1KU2A 2K4BA 9ANTA 3ECHA 3DFGA 1Z7LA 4XSZF 3OSGA 2V7FA 4D7MA 4N9HA 4O6JA 3C2HA 3OYDA 3O3KA 2VC1A 1KGSA 1FYLA 2HOTA 4GXOA 2DYSH 2DPUA 3QYEA 1QPIA 3FXJA 1WKMA 3CTAA 5KAFC 2YX7A 5JHFA 2R7ZJ 3JRIA 4PJ0C 1WQ2A 1RC9A 2GWRA 4LGWA 2E2IJ 1Z21A 1JGSA 4DIQA 5IT9K 2EPFA 2KMUA 3QPSA 1KYZA 1IDZA 4A3DJ 2Y75A 2OPTA 2W1OA 1TC3C 3CD6I 4IJAA 3ERED 4ZDOA 2BV6A 1LFBA 2FMYA 1SVOA 3CO6C 5K7FA 3FXRA 1AKHB 3A0HC 2DAOA 2NAZA 4LLLA 1QVTA 2Y9YA 3ELKA 3I71A 4M6YA 2LOOA 1D0YA 3BOQA 3HTUA 2F4IA 2V1DA 4W1UA 1U8RA 1X1BA 2D45A 1MBGA 2A07F 1XB4A 3OYEA 4BHCA 3GTGJ 4C3IJ 1LVKA 3T8RA 4MGRA 5AONA 3AL0C 1ETKA 1KA8A 1R5HA 4I0AA 4WWCA 3LSMA 3DLAA 5CYVA 4E7HA 3FXMA 3H3VK 4XBFA 1XSVA 4BEHA 3R6SA 5FGMA 3X2QH 1ULYA 4ZYHA 5DEQA 3NNRA 1EH6A 2BXYA 4GYIA 3C2BA 2HYJA 4I09A 4MTEA 1MNDA 4LFUA 1MNMC 4KA4A 1I50J 4RDUA 2VKHA 4G7OF 1FYKA 1KZHA 5F0CA 2EH3A 1DDNA 1U0JA 1YIJI 5EFYA 2VJ5A 5CXIA 3NXCA 1F43A 5HLIA 2N8GA 1IRZA 1DQUA 1R7JA 4JKZA 3CMMA 3I4NJ 2C6YA 4HX7A 2DA7A 4NN1A 1BI0A 5C44J 3HSFA 3V7SA 4KFCA 2Y2ZA 3CJTB 3WU0A 3LSIA 3LSKA 5FJ8J 5FFZA 1YHQI 5KAIC 2R0QC 5IY5H 2MH9A 5IYCJ 2V1XA 4QPOA 4LD5A 1FJLA 1HKTA 1OCPA 3FMSA 3RYPA 2HVQA 4GFBA 2L5QA 4KICA 3CUQA 2I5UA 3SHFA 3ZPLA 3K8PC 1YS6A 2DA5A 2E1NA 3SJMA 3GEUA 1HSJA 4ZYGA 2MABA 3ISPA 3ZQFA 3CLQA 1B72A 2TDXA 3U1DA 3S3NA 3A01B 4IX7A 3VVYA 4R1HA 2QWWA 4Y17A 2JQ7A 3ZQLA 1R49A 1ETQA 2LC2A 1KQ0A 2QZ8A 3HOSA 1W36D 4OMYA 4A6DA 2ZSHB 5GTIC 3M4OJ 4E7KA 1XS9A 1IUYA 3QRFF 1X2MA 2CW7A 1UCRA 2L9SA 3K0LA 4Z6YA 1E3HA 4XK4A 3NS4A 3VFZA 3CLOA 3JRBA 4JL3A 2O5RA 1IRFA 3IH2A 3G73A 3FKIJ 4XKVA 2E60A 1YFHA 1HA8A 2R7WA 3EPZA 2VBXA 2PMZN 2ZXWH 3V7CA 5FLXK 3QU6A 1MBKA 2PN6A 3WTXC 4DQ2A 1T38A 3BTJA 5DM6F 3DBRB 3J80Z 1EF4A 4HF2A 1U78A 1LKXA 4EEFG 1IRXA 3PQKA 4EM2A 1J2XA 1Z77A 3K70C 1R9TJ 1BL0A 3CUOA 4MFEA 1DUXC 3CCEI 3RQ4A 4XKBA 3VW2A 1HXDA 3FKJA 3T5XA 2BHZA 2UWMA 3R61A 3HKZA 3WTSC 1XSDA 4BACA 1O3TA 2BY2A 2QQ9A 3G2BA 5ICFA 1X4PA 4IRHA 1G3TA 1MGTA 2OCCH 2O03A 5ED4A 4Q48A 4AIHA 1TT0A 3H9QA 3LA3A 5C3EJ 3WU2C 3WODF 4IHVA 2PG4A 2W82A 1XMXA 4A5MA 3NWTA 3L2QA 4IHXA 1X1CA 3WTYC 1XMKA 2RQPA 3VWBA 2WAFA 3RPQA 2XF7A 2XPWA 1GVJA 5GAEJ 1WJDA 2LY2A 1TWGJ 2HDWA 3P5JA 4PJJA 4DJAA 1E3OC 4P1WA 3G6EI 1XGNA 2DMPA 4GCLA 2ZJRF 4KWAA 4P9UA 3I4MJ 3CC4I 1BJZA 2OV7A 2RNJA 4N9IA 1P6RA 3T0YA 2HR3A 3W2WA 1B72B 1W36C 4RBOA 1F4KA 2D6YA 2RGVA 1B4AA 4S05A 2ISZA 1POGA 3BTLA 1TL8A 1QPMA 1ZELA 2X0LA 1H88C 3H9GA 2ISYA 2XB5A 2EV5A 2IA1A 1PP7U 5TJJA 3IKTA 2KIFA 3LFUA 5F08A 2CW0F 3BG9A 4ICHA 2ECCA 3KE2A 3E5QA 3V8LA 1YRNA 2JPCA 2WTEA 2PFBA 4ZC3A 1UMQA 5E3MA 1R4MB 1E0EA 2F5VA 3BROA 2RNGA 1B59A 5EDNA 3MZHA 5ILSA 2NP3A 3LSGA 1R1UA 3H3UA 3LFKA 2L7MP 3S15J 4E7IA 4PJLA 2B7EA 3ERMA 3GWZA 3K1PA 3FIWA 1IRGA 3A4CA 2Y0SA 1TWCJ 1XC5A 4N4OB 3CC2I 2PMZA 2IW5A 3ZMZA 3HDDA 1LVAA 2PEXA 2GAUA 4II2A 3S8PA 4A3CJ 3ROUA 2XF5A 1FC3A 4XQFA 3ABTA 4CGZA 1R4NB 1XCBA 2B63J 3TOAA 1LPQA 4HA8A 3NI7A 3DKXA 3GMEA 2WGBA 1HBXG 2OQRA 3HM5A 4HDVA 1FTTA 4F93B 2UXPA 2Q8KA 2ZC2A 1UHSA 2O8XA 2WADA 2IS4A 3DP7A 1C0WA 3FK7A 5EYRA 4IF4A 5IOYA 4NQWB 2HTJA 1R6RA 2ZOYA 2VB6A 5JHUA 4MIMA 3VTIA 4LLGF 2FJI1 3AG2H 3VSLA 3WTZA 4WK8F 1GV2A 1H8AC 5GAHJ 2OU2A 2XDNA 4EGZA 1IV6A 3LA2A 4CYCB 1GHCA 1YG2A 2VKVA 3E0JB 1K78A 4TV7A 5EZHA 2JT1A 4IQ4A 4BJ6C 3OYBA 3ZQCA 4CDGA 4HV5A 3CF2A 4FTHA 2HQ5A 3GYHX 1H9TA 2B3WA 2EFOA 2TRTA 3ON4A 3GTPJ 2OF7A 3DWLE 3HE0A 2Q1ZB 1J0RA 4U0YA 1FBSA 3GCMA 3GO5A 2FNPA 2W48A 1YIOA 1MDMB 3PPBA 4HRIA 2GIZA 5M3MJ 4JK1X 1E3PA 2O3FA 5ICCA 1XG1A 2CQNA 1D1CA 4X1EA 3F6VA 2HI3A 2E7WA 2FBIA 3HL2A 3HYIA 2M5WA 2A2FX 5JR3A 1MW7A 2DLLA 2QLZA 2O7TA 3GUDA 3AG3H 3B02A 2NS0A 3OYIA 2L4MA 3JTGA 3Q9SA 3I54A 4YFNF 3GTQJ 2XRNA 4AD9A 4B4CA 1G8XA 2MG4A 2V79A 2ZMEA 4B8XA 2F2EA 4KITB 2W25A 4JX5A 5DV5A 3R0AA 3PASA 5DCMB 4Z2YA 5C4XJ 1Z05A 2LRDA 1A35A 3F8MA 2JA7J 3GTOJ 3RI4A 4KMFA 3FMQA 1K4TA 1JKQC 3COLA 2UXOA 4U7DA 3OWTA 5LEKA 1VNDA 1YJNI 1A5JA 3J7YJ 4E70A 1B9NA 3BR3A 2PX9A 4RGSA 3HOXJ 2BVMA 4WXHA 3A02A 4CHUA 5FRMA 2AXTC 1XN7A 3V42A 1DP7P 1DU0A 1KU9A 1JI8A 4HYEA 1QZZA 3E5XA 2M30A 3BJOA 4FQGA 3OYFA 2PMHA 3AKZA 3ZQ7A 2NP5A 2ADUA 3DPTA 3S17J 1FMVA 2IGKA 4G8XA 5IPAA 2A6EF 4KN7X 4M6VA 1RUOA 1ITYA 1FIAA 2IGNA 2DA4A 4PDKA 1Y39A 4RGUA 1LE8B 3HOVJ 3CJQB 1SD7A 4HKUA 4IVNA 2DMNA 2EZHA 4ENKA 4ANJA 1FTZA 1GXQA 2QENA 5EEHA 1WSUA 1GT0C 4RB0A 3H5NA 3I56I 2H8WA 3EQLF 1D3YA 1JJ6C 1YW9A 2I10A 1O7FA 3JREA 3ABMH 2R7FA 4G6QA 2EILH 3HRUA 3CP8A 2IP2A 2ZJPF 3NPIA 4KIFA 2FJ1A 2CW8A 2XIGA 1TWHJ 2HKUA 2XV4S 2R4GA 3Q0UA 3COAC 1BR1A 3BDDA 5DUIA 2EFNA 3SQNA 1D8JA 3F1BA 3GBGA 2OTLI 4C2UA 3CC7I 4IHSA 3KZ9A 2JRMA 4OU0A 4PGGA 2VLAA 1IO2A 1P92A 4IHWA 3BP8A 3JAMK 5EGOB 1RETA 4NBQA 2BY0A 1W0UA 2DFEA 4M3EA 2PBIA 4AIDA 4L9JA 3S2HJ 4XR6A 2HFHA 1IUFA 4HF0A 2HEOA 4BDYA 3RD3A 4CZZA 3J7AO 1R22A 3KCCA 1MIJA 2P0WA 3MCZA 3CJDA 1OCCH 4A93J 2WC2A 1ZR2A 3GZ6A 1Y0NA 3JRHA 2NXNB 2QIBA 3WG9A 3GZIA 3IC7A 3ZQGA 5J8FA 4IRGA 3QOEA 3O8HA 1X4OA 5CVJA 3I55I 4OD4A 1X2NA 2P7VB 4Q5SF 5E1WA 1HKSA 5HDKA 1PDNC 3OR2C 1YOVB 4ENJA 3VOKA 3K1MA 4EJVA 1IN6A 3VYSB 4I6ZA 1O4XA 2E7XA 1PJRA 3NAUA 3C7JA 2ZO4A 4YIFA 1LDDA 4C3HJ 1IV8A 5D5UB 1VQ4I 3L9FA 2X48A 3K69A 3PSIA 3HKZN 3D5SC 3JTHA 2QSGX 4UDSA 1ETWA 1SD5A 2FSWA 2V26A 1MSFC 3EETA 5HLHA 4BJ5C 3HIMA 2EV0A 3I5UA 5JLWA 2R7DA 4BU2A 4DYRA 5EG0A 2CRGA 4FE7A 1J75A 3FHZA 2B9SA 3BCAA 1BI3A 4OINF 2W00A 2L7KA 4GCVA 3KKDA 3DBLB 4NELA 4I02A 5DCFA 2QKLB 3IAM2 3LSRA 2XGXA 3CMYA 3PUBA 1YI2I 3BZCA 3O8GA 2RKHA 5K5OA 5HNHA 2XDVA 4RB1A 4PXIA 3L2UA 3PFIA 1HQCA 4UVBA 1OMIA 1F5TA 3DPUA 4ZDPA 2XAFA 3IHUA 3MMYB 4KDPA 1T98A 1Z1DA 1ENHA 3D0SA 3W6VA 1EKEA 3HTSB 1OKRA 5E3OA 2E36A 3TMOA 1JHFA 1T0FA 5BNGA 4HQEA 2MBFA 4ZYEA 4BXXJ 2V9PA 2F5CA 1WI3A 3D5LA 2LH9A 2HS5A 3GFLA 3ASOH 5H6RA 3BJ6A 4CZCA 1I6HJ 2GXGA 2HVRA 2IA2A 2EFWA 5GP9A 5FLVA 1TWAJ 2DW4A 3AG1H 4JOMA 4R79A 4IOCF 2JVHA 2A69F 4DBQA 1CF7B 1JTXA 1LB2A 3ZMTA 4BQQA 2QM3A 2RHAA 3E7LA 4IPAA 2JK3A 5F04A 3LL7A 1ONVA 2ME0A 3CDHA 3HGGA 3DLLF 4IEJA 2RREA 4JBAA 4QSHA 3VB2A 3ZCOA 3B73A 2XAGA 3OMYA 2V6CA 4B09A 2NVTJ 1Q1VA 1ZTRA 1PYVA 1U5TB 3OV8A 3Q3SA 3KLOA 2HKOA 1WZ2A 3CESA 1O3RA 1YX5A 1KQ9A 3IWZA 1VQNI 1OYWA 1OR7C 2IPQX 2IAIA 2X1EA 2K85A 1GUUA 1CQTA 1YQAA 3LMMA 1YS7A 2K02A 5K5RA 1MBFA 2J5OA 3PNTA 1T2KA 2ZNYA 3WHBA 1K78B 1BOAA 2IJLA 4HBLA 2YVXA 2DMQA 3K4BA 1A36A 2HPIA 1FOWA 2R5ZB 2PJRB 5LGUA 1IXCA 1FT9A 1NK3P 4I0BA 5DTDA 4ZJZA 1JKOC 2QBYA 2COBA 3F22A 3CCSI 4U9NA 1JUSA 2GXAA 4EQQA 1O3QA 4RLQA 5HS8A 6PAXA 3ANPA 4CCNA 2DI3A 2A3SA 2DU9A 4II3A 1QNTA 3ZN1A 4CO8A 3CDIA 2V4JC 1VQPI 2DOEA 2LKSA 3V78A 5DS9A 1JT0A 5HS7A 4ME9A 3OIQA 1GV5A 4HDUA 4LIVA 1QRYA 5M3FJ 4HNUA 3DTKA 3AQSA 2ELHA 4LG3A 2JPBA 5ILUA 2K3PA 5IYDJ 2IRFG 2P5KA 2XPVA 3BNIA 4A3GJ 2HOEA 4I01A 5FB2A 2F07A 3VYUB 3DF8A 3BG6A
chains in the Genus database with same CATH topology
2ZCMA 2IU5A 1ETOA 2H1KA 3HTHA 2DN0A 3JSJA 3IUVA 1S7EA 2PMZN 4Y7NJ 1ORKA 3BR0A 1MBKA 2NS7A 2R92J 2ZOZA 3BTJA 1JKRC 1EF4A 1MBJA 1Y1VJ 3G1MA 4EEFG 1U78A 3L1PA 2E2JJ 1Z77A 5F27A 1R9TJ 1BL0A 2LVSA 4MFEA 3M3YJ 3VW2A 3BTIA 1HF0A 5CW8A 1LE8A 2WB1N 4QTRA 3G56A 1VF9A 2JA5J 5D1RA 3Q0VA 3AQTA 4XICA 2FBQA 3HOUJ 2PBXA 1JKPC 2X6OA 5HSZA 3QQAA 2V57A 5C3EJ 3ON2A 2QOPA 3QBMA 1ZQ3P 4IHVA 2WV1A 4A3KJ 2DTZA 1JUMA 4BBSJ 5J3LA 2REKA 3VW0A 4IHXA 2QWTA 1RPWA 5C4JJ 2DG7A 2XPWA 1FEXA 2LR8A 1G2HA 4S0HB 4XIDA 1TWGJ 3BHQA 1E3OC 3UKGA 1UI6A 3VIBA 3D1NI 2DMPA 3JRAA 4GCLA 4KWAA 1Y1WJ 3I4MJ 3BRUA 1BJZA 4ACIA 3CCYA 4CGRA 2MGQA 2GBYA 2GUHA 2YVHA 2XGEA 3DCFA 1B72B 4RBOA 2WAQN 3HBLA 2D6YA 1VFCA 1PUFA 5FMPA 1POGA 3BTLA 2GLOA 3EGQA 3OSFA 1H88C 4AC6A 2L7ZA 2ECBA 2XB5A 2R5YA 2LP0A 3HB9A 1ZKGA 2FX0A 1B8IB 4DYQA 5F08A 3LWJA 5HBUA 4JX4A 3HOYJ 1WH7A 3ZOBA 3BG9A 1PUFB 4ICHA 2ECCA 4L62A 1F36A 1YRNA 2GENA 2CUFA 3PO3J 2DA1A 2M0CA 3ANGA 1UMQA 5E3MA 1ETXA 5IP7J 4I76A 1D5YA 3PO2J 1BW5A 2JN6A 2CQXA 5EDNA 3B6CA 3WHCA 3JRFA 4X6AJ 2ZCXA 3CWRA 5E3LA 1UI5A 2M9HA 2NP3A 1TWFJ 3LSGA 4JNNA 3BG3A 2L7MP 3S15J 2LLKA 4FCYA 1WGXA 4YZEA 2LY9A 2M34A 2R93J 3FIWA 3S2DJ 3B6AA 3LOCA 4Y52J 1TWCJ 1XC5A 1P7IA 3HDDA 2G0EA 4IHYA 3JRCA 2DA3A 4FISA 3HTJA 1WCMJ 4DZJA 4A3CJ 1MH3A 2MW8A 3BR1A 4JP0A 4AC0A 2EBIA 2QKOA 5CXGA 4MO7A 2B63J 2G3BA 1A6IA 3NI7A 2WGBA 2AO9A 3HM5A 3G1LA 1OCTC 1FTTA 2UXPA 2LD5A 1UHSA 3LSPA 4A3LJ 4BY1J 3IH3A 2K9SA 5IP6A 5D19A 3BQZA 3G1OA 1FIPA 4M3DA 3FK7A 4J19A 5EYRA 1AKHA 5IOYA 3CDLA 1W0TA 1RR7A 3VW1A 3MVPA 5FKLA 2ZOYA 3LJLA 2H8RA 4XRSG 3BTCA 3O60A 5IP9J 3Q0WA 1BW6A 4MIMA 4A69C 2E2HJ 4G12A 2EZLA 4A3JJ 2VUMJ 1GV2A 4D5FA 1H8AC 3GTLJ 5EGOA 3MKLA 3S1QJ 2XDNA 1IV6A 4CYCB 2NS8A 3LSJA 2VKVA 1IJWC 2G7SA 3S1NJ 1HOMA 1I3QJ 3BG5A 5EZHA 1MBHA 4W97A 3ZQCA 2ME6A 2XPUA 5FKOA 3LNQA 3K2AA 2UXUA 4FTHA 2HQ5A 3ON4A 4UUSB 2TRTA 2P81A 3TP3A 3GTPJ 2OF7A 3BCGA 4NDLA 3HE0A 5AQCA 1APLC 2GM4A 1NTCA 4A3IJ 3TEDA 1HDPA 2W48A 3PPBA 3SFIA 5M3MJ 5D18A 5GPAA 2JA6J 1LFUP 1QVUA 1XG1A 3T6NA 1WPKA 4X1EA 2HI3A 1RESA 5J1RA 2O7TA 2G7GA 2XRLA 2NVXJ 1JUPA 2FQ4A 3GTQJ 3KNWA 4XRMA 2YVEA 2XSDC 4D5CA 4B4CA 1ZGWA 2MSYA 2MG4A 4A3FJ 2DA6A 2LKXA 5K58A 4JX5A 5EZGA 3FRQA 3PASA 5M5XJ 2O9LA 5C4XJ 3TW6A 5EG0B 5HAWA 4A3MJ 3QKXA 2IBDA 1IG7A 1YRNB 2JA7J 3GTOJ 1RKWA 4B3AA 2WUIA 5H9TA 3OOUA 1JKQC 3COLA 2EQRA 2UXOA 3TW7A 2HOAA 2CJJA 2LFBA 1VNDA 3JR9A 1A5JA 5F0FA 3BR3A 4BKXA 3HOXJ 3A02A 1DU0A 2XGCA 3QPLA 2R5ZA 3VVZA 1AU7A 2Q24A 4GCKA 2E19A 5F1JA 5IYBJ 1GVDA 4DYCA 2M8GX 2NP5A 5FHPA 5IOZA 3S17J 2VKEA 5FKMA 5J1UA 2JJ7A 3C07A 2E1OA 3EUPA 5IPAA 4M6VA 1ITYA 1FIAA 3MNLA 4XRSA 1JGGA 2DA4A 2VI6A 2Y0SN 5C4YA 5FLMJ 1LE8B 3HOVJ 4HKUA 2DMTA 2AHQA 2DMNA 3E7QA 2EZHA 2X9DA 3BR5A 2JA8J 3SDGA 2R5YB 1FTZA 3K7AJ 1GT0C 1NK2P 5M5YJ 1ZR4A 3CRJA 2VPRA 3S1RJ 1JJ6C 5DAJA 2I10A 2HYTA 2JWTA 3JREA 2HDDA 1AHDP 3HGYA 2ELKA 2EZIA 4LOCA 3B81A 3NPIA 2FJ1A 2QF7A 4UUSA 2DA2A 1TWHJ 2DJNA 2HXOA 2HKUA 2RASA 3PM1A 4D7NA 3Q0UA 3JRDA 2LTPA 1OJLA 3HOWJ 3RQIA 1DU6A 1VI0A 3GBGA 3A01A 3F1BA 1P7JA 2NOGA 2RAEA 3KZ9A 2YS9A 4JX6A 4A3BJ 4IHWA 2NVQJ 2ID6A 2L7FP 5EGOB 4B1RA 1RETA 4FE4A 2O8KA 1W0UA 1B8IA 1U9NA 4MK6A 3OIOA 4M3EA 4C3JJ 5EF6A 2YU9J 4HNVA 3S2HJ 2FD5A 1IUFA 2NX4A 3RD3A 1SGMA 1ETYA 3MN2A 3CJDA 3TP0A 4A93J 1ZR2A 4ABZA 3JRHA 2QIBA 1X58A 3F0CA 3ZQGA 3GZIA 3P9TA 3O8HA 2EZKA 3NARA 3JRGA 2CUEA 1X2NA 2IEKA 4MLOA 2M2EA 5K7ZA 3HOZJ 2L9RA 1GDTA 3VOKA 3S16J 5K7HA 4I6ZA 1O4XA 2DG8A 3ZQHA 3RH2A 1JTYA 2ZB9A 3NAUA 1WH5A 3ZQIA 3DPJA 1U9OA 4C3HJ 3GTJJ 4C2MJ 2KDZA 2X48A 4A3EJ 1H89C 3HKZN 4UDSA 4UUTA 2OI8A 1ETWA 5FGLA 1Z0XA 1MSFC 2YUSA 3RKQA 3VOXA 3HIMA 1HDDC 5JLWA 4DYRA 5EG0A 2CRGA 4FE7A 3LHQA 2QCOA 4M3BA 1JT6A 3BQYA 4V2FA 2UXHA 3HEFA 3V6GA 3A03A 2UXIA 1IDYA 2K9NA 4BY7J 3KKDA 4NELA 2CU7A 2DMUA 3LSRA 3CMYA 2Y31A 3GTMJ 3VP5A 9ANTA 5JLXA 3OSGA 2W53A 5FKNA 5E3NA 4D7MA 1T56A 3O8GA 2HOTA 1JJ8C 4PXIA 1U8BA 3RZDJ 4AUXA 3H0GJ 1QPIA 1ENHA 3W6VA 2TCTA 5E3OA 1ZK8A 4GFLA 4GFKA 3GTKJ 2R7ZJ 5EEAA 5BNGA 3JRIA 4AF5A 2E2IJ 5GPCA 1MSEC 4BXXJ 4M3GA 1WI3A 4L5EA 5M5WJ 3QPSA 1IDZA 4A3DJ 3DEWA 2OPTA 1TC3C 1K61A 1I6HJ 3VVXA 1ETVA 3BR2A 1LFBA 5K7FA 1AKHB 2G7LA 2ID3A 4CYCA 2D5VA 1K83J 1QVTA 2Y9YA 5GP9A 5FLVA 2GFNA 1TWAJ 2K40A 3BJBA 2ZCNA 4W1UA 1MBGA 1JTXA 2L0KA 3S1MJ 4DW6A 1T33A 2RHAA 3E7LA 3GTGJ 4C3IJ 2JK3A 5FKKA 5F04A 1ETKA 3G7RA 2LK2A 2ME0A 3HGGA 4IEJA 3H3VK 4QSHA 2XGDA 2HXIA 3HTAA 3NNRA 3S14J 3CQZJ 3C2BA 3KKCA 2HYJA 3FISA 4M3FA 2NVTJ 1Q1VA 1ZTRA 1MNMC 3Q3SA 4MXMA 1I50J 4RDUA 4QIWN 3VUQA 1RKTA 5HODA 5F0CA 2EH3A 3FK6A 1UG2A 2JMWA 5EFYA 4MFDA 3RZOJ 2OERA 5CXIA 2IAIA 3NXCA 1F43A 1GUUA 1CQTA 2N8GA 1IRZA 4JKZA 1MBFA 3I4NJ 3WHBA 2DA7A 4NN1A 5C44J 2PZ9A 2Y2ZA 2DMQA 2HOSA 1BA5A 4GCTA 4BBRJ 2Y30A 5FJ8J 2Y9ZA 2R5ZB 2R0QC 1NK3P 5DTDA 3VPRA 1JKOC 5IYCJ 2COBA 1FJLA 1JUSA 1OCPA 1HCRA 3BR6A 1SFOJ 3BT9A 4GFBA 3ANPA 3IH4A 2DA5A 1MBEA 3SJMA 3NRGA 3GEUA 2O7OA 1HLVA 2QTQA 5J1YA 5F0HA 3ZQFA 1IGNA 1B72A 3A01B 3VVYA 3V78A 5DS9A 1JT0A 3S5RA 3ZQLA 1ETQA 4ME9A 1SANA 3IV5A 1GV5A 3M4OJ 2K9QA 4AYBN 4JYKA 1XS9A 1QRYA 5M3FJ 3HTIA 2XB0X 3AQSA 2NVYJ 1X2MA 4DZPA 1OFCX 5IYDJ 2CQQA 2XPVA 3BNIA 4A3GJ 1MH4A 4V2GA 4XK4A 2F07A 1IC8A 3JRBA 4JL3A 3IH2A 2KT0A 3FKIJ
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2ZCM A;  2IU5 A;  1ETO A;  2H1K A;  3HTH A;  2DN0 A;  3JSJ A;  3IUV A;  1S7E A;  2PMZ N;  4Y7N J;  1ORK A;  3BR0 A;  1MBK A;  2NS7 A;  2R92 J;  2ZOZ A;  3BTJ A;  1JKR C;  1EF4 A;  1MBJ A;  1Y1V J;  3G1M A;  4EEF G;  1U78 A;  3L1P A;  2E2J J;  1Z77 A;  5F27 A;  1R9T J;  1BL0 A;  2LVS A;  4MFE A;  3M3Y J;  3VW2 A;  3BTI A;  1HF0 A;  5CW8 A;  1LE8 A;  2WB1 N;  4QTR A;  3G56 A;  1VF9 A;  2JA5 J;  5D1R A;  3Q0V A;  3AQT A;  4XIC A;  2FBQ A;  3HOU J;  2PBX A;  1JKP C;  2X6O A;  5HSZ A;  3QQA A;  2V57 A;  5C3E J;  3ON2 A;  2QOP A;  3QBM A;  1ZQ3 P;  4IHV A;  2WV1 A;  4A3K J;  2DTZ A;  1JUM A;  4BBS J;  5J3L A;  2REK A;  3VW0 A;  4IHX A;  2QWT A;  1RPW A;  5C4J J;  2DG7 A;  2XPW A;  1FEX A;  2LR8 A;  1G2H A;  4S0H B;  4XID A;  1TWG J;  3BHQ A;  1E3O C;  3UKG A;  1UI6 A;  3VIB A;  3D1N I;  2DMP A;  3JRA A;  4GCL A;  4KWA A;  1Y1W J;  3I4M J;  3BRU A;  1BJZ A;  4ACI A;  3CCY A;  4CGR A;  2MGQ A;  2GBY A;  2GUH A;  2YVH A;  2XGE A;  3DCF A;  1B72 B;  4RBO A;  2WAQ N;  3HBL A;  2D6Y A;  1VFC A;  1PUF A;  5FMP A;  1POG A;  3BTL A;  2GLO A;  3EGQ A;  3OSF A;  1H88 C;  4AC6 A;  2L7Z A;  2ECB A;  2XB5 A;  2R5Y A;  2LP0 A;  3HB9 A;  1ZKG A;  2FX0 A;  1B8I B;  4DYQ A;  5F08 A;  3LWJ A;  5HBU A;  4JX4 A;  3HOY J;  1WH7 A;  3ZOB A;  3BG9 A;  1PUF B;  4ICH A;  2ECC A;  4L62 A;  1F36 A;  1YRN A;  2GEN A;  2CUF A;  3PO3 J;  2DA1 A;  2M0C A;  3ANG A;  1UMQ A;  5E3M A;  1ETX A;  5IP7 J;  4I76 A;  1D5Y A;  3PO2 J;  1BW5 A;  2JN6 A;  2CQX A;  5EDN A;  3B6C A;  3WHC A;  3JRF A;  4X6A J;  2ZCX A;  3CWR A;  5E3L A;  1UI5 A;  2M9H A;  2NP3 A;  1TWF J;  3LSG A;  4JNN A;  3BG3 A;  2L7M P;  3S15 J;  2LLK A;  4FCY A;  1WGX A;  4YZE A;  2LY9 A;  2M34 A;  2R93 J;  3FIW A;  3S2D J;  3B6A A;  3LOC A;  4Y52 J;  1TWC J;  1XC5 A;  1P7I A;  3HDD A;  2G0E A;  4IHY A;  3JRC A;  2DA3 A;  4FIS A;  3HTJ A;  1WCM J;  4DZJ A;  4A3C J;  1MH3 A;  2MW8 A;  3BR1 A;  4JP0 A;  4AC0 A;  2EBI A;  2QKO A;  5CXG A;  4MO7 A;  2B63 J;  2G3B A;  1A6I A;  3NI7 A;  2WGB A;  2AO9 A;  3HM5 A;  3G1L A;  1OCT C;  1FTT A;  2UXP A;  2LD5 A;  1UHS A;  3LSP A;  4A3L J;  4BY1 J;  3IH3 A;  2K9S A;  5IP6 A;  5D19 A;  3BQZ A;  3G1O A;  1FIP A;  4M3D A;  3FK7 A;  4J19 A;  5EYR A;  1AKH A;  5IOY A;  3CDL A;  1W0T A;  1RR7 A;  3VW1 A;  3MVP A;  5FKL A;  2ZOY A;  3LJL A;  2H8R A;  4XRS G;  3BTC A;  3O60 A;  5IP9 J;  3Q0W A;  1BW6 A;  4MIM A;  4A69 C;  2E2H J;  4G12 A;  2EZL A;  4A3J J;  2VUM J;  1GV2 A;  4D5F A;  1H8A C;  3GTL J;  5EGO A;  3MKL A;  3S1Q J;  2XDN A;  1IV6 A;  4CYC B;  2NS8 A;  3LSJ A;  2VKV A;  1IJW C;  2G7S A;  3S1N J;  1HOM A;  1I3Q J;  3BG5 A;  5EZH A;  1MBH A;  4W97 A;  3ZQC A;  2ME6 A;  2XPU A;  5FKO A;  3LNQ A;  3K2A A;  2UXU A;  4FTH A;  2HQ5 A;  3ON4 A;  4UUS B;  2TRT A;  2P81 A;  3TP3 A;  3GTP J;  2OF7 A;  3BCG A;  4NDL A;  3HE0 A;  5AQC A;  1APL C;  2GM4 A;  1NTC A;  4A3I J;  3TED A;  1HDP A;  2W48 A;  3PPB A;  3SFI A;  5M3M J;  5D18 A;  5GPA A;  2JA6 J;  1LFU P;  1QVU A;  1XG1 A;  3T6N A;  1WPK A;  4X1E A;  2HI3 A;  1RES A;  5J1R A;  2O7T A;  2G7G A;  2XRL A;  2NVX J;  1JUP A;  2FQ4 A;  3GTQ J;  3KNW A;  4XRM A;  2YVE A;  2XSD C;  4D5C A;  4B4C A;  1ZGW A;  2MSY A;  2MG4 A;  4A3F J;  2DA6 A;  2LKX A;  5K58 A;  4JX5 A;  5EZG A;  3FRQ A;  3PAS A;  5M5X J;  2O9L A;  5C4X J;  3TW6 A;  5EG0 B;  5HAW A;  4A3M J;  3QKX A;  2IBD A;  1IG7 A;  1YRN B;  2JA7 J;  3GTO J;  1RKW A;  4B3A A;  2WUI A;  5H9T A;  3OOU A;  1JKQ C;  3COL A;  2EQR A;  2UXO A;  3TW7 A;  2HOA A;  2CJJ A;  2LFB A;  1VND A;  3JR9 A;  1A5J A;  5F0F A;  3BR3 A;  4BKX A;  3HOX J;  3A02 A;  1DU0 A;  2XGC A;  3QPL A;  2R5Z A;  3VVZ A;  1AU7 A;  2Q24 A;  4GCK A;  2E19 A;  5F1J A;  5IYB J;  1GVD A;  4DYC A;  2M8G X;  2NP5 A;  5FHP A;  5IOZ A;  3S17 J;  2VKE A;  5FKM A;  5J1U A;  2JJ7 A;  3C07 A;  2E1O A;  3EUP A;  5IPA A;  4M6V A;  1ITY A;  1FIA A;  3MNL A;  4XRS A;  1JGG A;  2DA4 A;  2VI6 A;  2Y0S N;  5C4Y A;  5FLM J;  1LE8 B;  3HOV J;  4HKU A;  2DMT A;  2AHQ A;  2DMN A;  3E7Q A;  2EZH A;  2X9D A;  3BR5 A;  2JA8 J;  3SDG A;  2R5Y B;  1FTZ A;  3K7A J;  1GT0 C;  1NK2 P;  5M5Y J;  1ZR4 A;  3CRJ A;  2VPR A;  3S1R J;  1JJ6 C;  5DAJ A;  2I10 A;  2HYT A;  2JWT A;  3JRE A;  2HDD A;  1AHD P;  3HGY A;  2ELK A;  2EZI A;  4LOC A;  3B81 A;  3NPI A;  2FJ1 A;  2QF7 A;  4UUS A;  2DA2 A;  1TWH J;  2DJN A;  2HXO A;  2HKU A;  2RAS A;  3PM1 A;  4D7N A;  3Q0U A;  3JRD A;  2LTP A;  1OJL A;  3HOW J;  3RQI A;  1DU6 A;  1VI0 A;  3GBG A;  3A01 A;  3F1B A;  1P7J A;  2NOG A;  2RAE A;  3KZ9 A;  2YS9 A;  4JX6 A;  4A3B J;  4IHW A;  2NVQ J;  2ID6 A;  2L7F P;  5EGO B;  4B1R A;  1RET A;  4FE4 A;  2O8K A;  1W0U A;  1B8I A;  1U9N A;  4MK6 A;  3OIO A;  4M3E A;  4C3J J;  5EF6 A;  2YU9 J;  4HNV A;  3S2H J;  2FD5 A;  1IUF A;  2NX4 A;  3RD3 A;  1SGM A;  1ETY A;  3MN2 A;  3CJD A;  3TP0 A;  4A93 J;  1ZR2 A;  4ABZ A;  3JRH A;  2QIB A;  1X58 A;  3F0C A;  3ZQG A;  3GZI A;  3P9T A;  3O8H A;  2EZK A;  3NAR A;  3JRG A;  2CUE A;  1X2N A;  2IEK A;  4MLO A;  2M2E A;  5K7Z A;  3HOZ J;  2L9R A;  1GDT A;  3VOK A;  3S16 J;  5K7H A;  4I6Z A;  1O4X A;  2DG8 A;  3ZQH A;  3RH2 A;  1JTY A;  2ZB9 A;  3NAU A;  1WH5 A;  3ZQI A;  3DPJ A;  1U9O A;  4C3H J;  3GTJ J;  4C2M J;  2KDZ A;  2X48 A;  4A3E J;  1H89 C;  3HKZ N;  4UDS A;  4UUT A;  2OI8 A;  1ETW A;  5FGL A;  1Z0X A;  1MSF C;  2YUS A;  3RKQ A;  3VOX A;  3HIM A;  1HDD C;  5JLW A;  4DYR A;  5EG0 A;  2CRG A;  4FE7 A;  3LHQ A;  2QCO A;  4M3B A;  1JT6 A;  3BQY A;  4V2F A;  2UXH A;  3HEF A;  3V6G A;  3A03 A;  2UXI A;  1IDY A;  2K9N A;  4BY7 J;  3KKD A;  4NEL A;  2CU7 A;  2DMU A;  3LSR A;  3CMY A;  2Y31 A;  3GTM J;  3VP5 A;  9ANT A;  5JLX A;  3OSG A;  2W53 A;  5FKN A;  5E3N A;  4D7M A;  1T56 A;  3O8G A;  2HOT A;  1JJ8 C;  4PXI A;  1U8B A;  3RZD J;  4AUX A;  3H0G J;  1QPI A;  1ENH A;  3W6V A;  2TCT A;  5E3O A;  1ZK8 A;  4GFL A;  4GFK A;  3GTK J;  2R7Z J;  5EEA A;  5BNG A;  3JRI A;  4AF5 A;  2E2I J;  5GPC A;  1MSE C;  4BXX J;  4M3G A;  1WI3 A;  4L5E A;  5M5W J;  3QPS A;  1IDZ A;  4A3D J;  3DEW A;  2OPT A;  1TC3 C;  1K61 A;  1I6H J;  3VVX A;  1ETV A;  3BR2 A;  1LFB A;  5K7F A;  1AKH B;  2G7L A;  2ID3 A;  4CYC A;  2D5V A;  1K83 J;  1QVT A;  2Y9Y A;  5GP9 A;  5FLV A;  2GFN A;  1TWA J;  2K40 A;  3BJB A;  2ZCN A;  4W1U A;  1MBG A;  1JTX A;  2L0K A;  3S1M J;  4DW6 A;  1T33 A;  2RHA A;  3E7L A;  3GTG J;  4C3I J;  2JK3 A;  5FKK A;  5F04 A;  1ETK A;  3G7R A;  2LK2 A;  2ME0 A;  3HGG A;  4IEJ A;  3H3V K;  4QSH A;  2XGD A;  2HXI A;  3HTA A;  3NNR A;  3S14 J;  3CQZ J;  3C2B A;  3KKC A;  2HYJ A;  3FIS A;  4M3F A;  2NVT J;  1Q1V A;  1ZTR A;  1MNM C;  3Q3S A;  4MXM A;  1I50 J;  4RDU A;  4QIW N;  3VUQ A;  1RKT A;  5HOD A;  5F0C A;  2EH3 A;  3FK6 A;  1UG2 A;  2JMW A;  5EFY A;  4MFD A;  3RZO J;  2OER A;  5CXI A;  2IAI A;  3NXC A;  1F43 A;  1GUU A;  1CQT A;  2N8G A;  1IRZ A;  4JKZ A;  1MBF A;  3I4N J;  3WHB A;  2DA7 A;  4NN1 A;  5C44 J;  2PZ9 A;  2Y2Z A;  2DMQ A;  2HOS A;  1BA5 A;  4GCT A;  4BBR J;  2Y30 A;  5FJ8 J;  2Y9Z A;  2R5Z B;  2R0Q C;  1NK3 P;  5DTD A;  3VPR A;  1JKO C;  5IYC J;  2COB A;  1FJL A;  1JUS A;  1OCP A;  1HCR A;  3BR6 A;  1SFO J;  3BT9 A;  4GFB A;  3ANP A;  3IH4 A;  2DA5 A;  1MBE A;  3SJM A;  3NRG A;  3GEU A;  2O7O A;  1HLV A;  2QTQ A;  5J1Y A;  5F0H A;  3ZQF A;  1IGN A;  1B72 A;  3A01 B;  3VVY A;  3V78 A;  5DS9 A;  1JT0 A;  3S5R A;  3ZQL A;  1ETQ A;  4ME9 A;  1SAN A;  3IV5 A;  1GV5 A;  3M4O J;  2K9Q A;  4AYB N;  4JYK A;  1XS9 A;  1QRY A;  5M3F J;  3HTI A;  2XB0 X;  3AQS A;  2NVY J;  1X2M A;  4DZP A;  1OFC X;  5IYD J;  2CQQ A;  2XPV A;  3BNI A;  4A3G J;  1MH4 A;  4V2G A;  4XK4 A;  2F07 A;  1IC8 A;  3JRB A;  4JL3 A;  3IH2 A;  2KT0 A;  3FKI J; 
#chains in the Genus database with same CATH topology
 2IU5 A;  3HTH A;  1LEA A;  3PSF A;  1S7E A;  5CVV A;  4L9N A;  4Y7N J;  3HOT A;  1S5L C;  1VTN C;  1N77 A;  4L5J A;  2ZOZ A;  5E8G A;  1K6O A;  3ZN0 A;  1OYI A;  1MBJ A;  1Y1V J;  4S04 A;  2K9M A;  3L1P A;  2E2J J;  2EK5 A;  3A2K A;  2LVS A;  3JW4 A;  3M3Y J;  5B1B H;  4LB6 B;  2R7X A;  4U87 A;  3BLY A;  1RZ4 A;  1HF0 A;  1WFX A;  2CUZ A;  4PFP A;  4BE1 A;  1VF9 A;  1BC7 C;  5D4R A;  1VQ6 I;  5L3D A;  2XC7 A;  1XD7 A;  1S7O A;  2MC3 A;  4CCO A;  1S7A A;  4Y13 A;  2X6O A;  1Z3X A;  4EGY A;  4XOT A;  1FSH A;  1N25 A;  3T1B A;  4UV9 A;  5CVU A;  2ZME C;  4J00 A;  2KIU A;  3VW0 A;  2QWT A;  1RPW A;  1LDJ A;  4RA2 A;  3EUH A;  3EDP A;  2LR8 A;  1FEX A;  1XDS A;  2ELJ A;  1LUJ B;  4H4K C;  1VQL I;  3I4P A;  3CCL I;  1BC8 C;  3D1N I;  1TLH B;  1Y1W J;  2HZD A;  3CCY A;  1OR7 A;  1QHH D;  2MGQ A;  2X6Y A;  4GGG A;  3OIP A;  4E4H A;  1F9N A;  1I39 A;  2DOD A;  4Y3O A;  4UXN A;  1PUF A;  2VOO A;  4BXU A;  2GLO A;  5TRD A;  3EGQ A;  4L0Y B;  3RTR A;  3TBI A;  3EUH C;  4HX4 A;  1T08 B;  2L7Z A;  2XVC A;  4BYY A;  2ECB A;  3W2A A;  1X1P A;  1V54 H;  1ZKG A;  2LSO A;  5E8I A;  1VQ5 I;  3LWJ A;  4XN3 A;  2LDU A;  2RDP A;  1PUF B;  4AVP A;  2WBM A;  2CV2 A;  1F36 A;  3KZY A;  2CUF A;  5DDG A;  3PO3 J;  4N4N B;  1SMT A;  5J4Y A;  5J4V A;  3OS1 A;  4HZF A;  1ETX A;  4LIT A;  4BNC A;  5ICG A;  1KYW A;  3B6C A;  1HKQ A;  3WHC A;  3JRF A;  1J9I A;  1UI5 A;  2PFV A;  1BIA A;  2JSC A;  4HST A;  3CJN A;  3AAF A;  3C2G A;  3IWF A;  2CFX A;  2EA4 A;  2LY9 A;  1FMW A;  2M34 A;  2WY7 Q;  4PZJ A;  1XSX A;  4HSR A;  3LOC A;  3NEU A;  3IAS 2;  4RAF A;  2MFZ A;  2G0E A;  2XAH A;  3DEU A;  4PJM A;  4FIS A;  3DU5 A;  4XLE A;  4A0Y A;  4MEX F;  1WCM J;  1YW8 A;  2BW3 B;  2MW8 A;  2XRO A;  3I59 A;  4JP0 A;  4AC0 A;  2EBI A;  5CXG A;  4XRF A;  1T95 A;  1NG6 A;  4ESJ A;  1A6I A;  3H9J A;  3K4J A;  1XGM A;  4ESF A;  5LGT A;  2AO9 A;  1Y0U A;  2VQC A;  4E7S A;  3V8J A;  4DNC A;  1L0O C;  1WJA A;  3DU6 A;  3CME I;  4BY1 J;  1WVR A;  2IXS A;  2LBF A;  3J7Z I;  3BQZ A;  4M3D A;  2VKD A;  2V9V A;  4HAM A;  5CLS A;  4U0W A;  3HRT A;  2MLK A;  2IS1 A;  4F3Q A;  3MVP A;  1ZG5 A;  4C30 A;  2HZT A;  2LBF B;  3BTC A;  3S32 A;  2G7H A;  2V9K A;  2VAS A;  4C9Y A;  2BGC A;  5IP9 J;  1BW6 A;  2E2H J;  4ON0 A;  2DO7 A;  4LG0 B;  3ESW B;  2VUM J;  1BOB A;  3BY6 A;  3EUK L;  5EGO A;  2OCE A;  4OMZ A;  2W85 A;  2BYV E;  2NS8 A;  3PIO F;  3BJA A;  1IJW C;  3FBN B;  3BG5 A;  1G6N A;  5GTH C;  3LNQ A;  4L5I A;  1L3L A;  1TZL A;  4EVI A;  1ZN2 A;  3CZ6 A;  2DFI A;  1AA7 A;  2ICW G;  2E1M B;  3S2W A;  1APL C;  3GX4 X;  4UNO A;  3LQQ A;  1U5T A;  3PFY A;  2OZ6 A;  5EEG A;  1NH3 A;  2JA6 J;  2K9L A;  3T6N A;  1S8N A;  3TO9 A;  4BXF A;  2FOK A;  2KHM A;  3W3C A;  1GXP A;  1IAW A;  2GOX B;  4ASN A;  3FXQ A;  3KP5 A;  3KFW X;  4HPQ A;  3JSO A;  5J1R A;  1ERD A;  3EUA A;  5A2Q K;  2Z3Y A;  2XRL A;  1IXR C;  1JUP A;  4FT8 A;  4V19 K;  2ZBK A;  2JUC A;  1ZGW A;  2MSY A;  2Z5U A;  4A3F J;  2DA6 A;  4RAZ A;  5K58 A;  5BQT A;  3ZQQ A;  3TW6 A;  4RM2 A;  5EG0 B;  2L3D A;  4A2U A;  4I7H A;  5HAW A;  2FE3 A;  4A3M J;  1IG7 A;  3VDX A;  4U0V A;  1YRN B;  3P9C A;  1RKW A;  4B3A A;  3QYB A;  2WUI A;  3OOU A;  2EQR A;  1MMA A;  1PP8 F;  1I1G A;  2HOA A;  3FHN A;  2HVS A;  2XKP A;  3BC8 A;  2L02 A;  4C2T A;  2UXN A;  5F0F A;  4BKX A;  4ENN A;  2L01 A;  3O2P E;  4G6D A;  4HQM A;  1J59 A;  2R5Z A;  1LEB A;  2UXX A;  4NUB A;  3ZMD A;  1ZYR F;  2EIJ H;  3P7N A;  1ZLK A;  1GVD A;  5DUK A;  1S6L A;  4DYC A;  4HF1 A;  1M1E B;  2H09 A;  4M74 A;  5DD4 A;  4WXD A;  4BS9 A;  2HU9 A;  3HHH A;  3KIO A;  2L4A A;  2E1O A;  4AIK A;  1TBX A;  1XX5 A;  5L3F A;  4F92 B;  3MNL A;  1JGG A;  2VI6 A;  5FLM J;  3C3W A;  3E7Q A;  3HRS A;  2JA8 J;  2VJI A;  3K4N A;  3OR1 C;  2R5Y B;  3C1D A;  5M5Y J;  2KQR A;  3N05 A;  2QYO A;  1Z67 A;  4N0B A;  2RN7 A;  3S1R J;  5DAJ A;  4GO1 A;  1HC8 A;  3ZGK A;  3QOD A;  2FBH A;  2D2W A;  5KNL A;  1AHD P;  1O7L A;  1MD0 A;  4LOC A;  2VT2 A;  2QF7 A;  3MKZ A;  4UUS A;  2HXO A;  4A5N A;  2CYY A;  2NOJ B;  4B3X A;  3JRD A;  1FYM A;  4BHB A;  3A01 A;  2ZCW A;  2RAE A;  1BM9 A;  3EYI A;  1SFX A;  2F4M B;  2YS9 A;  2V6E A;  1V5E A;  4GDF A;  1X3W B;  2NVQ J;  2CFO A;  4HV6 A;  3FZV A;  3OYJ A;  4RS8 A;  2L7F P;  4B1R A;  1BBY A;  1ZAR A;  4A12 A;  3OIO A;  4C3J J;  5F64 A;  4G7H F;  1ETY A;  2DQR A;  3MN2 A;  1W7P B;  3TP0 A;  1XGS A;  1SD6 A;  3H36 A;  4UVC A;  1Y8R B;  2OC6 A;  1T8I A;  4AM3 A;  3BG7 A;  4BQA A;  1IW7 F;  3F0C A;  4CCK A;  3F8N A;  4PGH A;  4CSW A;  3P9T A;  2EZK A;  1Z3Y A;  2V1U A;  2CUE A;  5D5X B;  2L9R A;  1B6A A;  3K6G A;  2FUG 2;  2YPR A;  5TGT A;  4PJN A;  3R0J A;  2CSO A;  3RH2 A;  3ZQH A;  1JTY A;  2IS6 A;  3SEQ A;  4E6K G;  3H1C A;  1DPU A;  4A3E J;  1FBU A;  1H89 C;  1YJW I;  4YFK F;  2F5F A;  5KVR A;  4UUT A;  1A31 A;  2OI8 A;  1UB9 A;  3RKQ A;  3VOX A;  1KON A;  2FRH A;  2M7B A;  2PQ8 A;  4PSX A;  3LHQ A;  2UXH A;  3H5A A;  3HEF A;  1X3Z B;  4UHT A;  2F5D A;  3HJE A;  4FX4 A;  2EB7 A;  2OAZ A;  1VQ7 I;  1FOX A;  2ESN A;  5KHD A;  2YU3 A;  2DMU A;  3WE2 A;  5FO5 A;  3GTM J;  1V55 H;  2M0M A;  3KYL A;  3IP4 B;  3VP5 A;  3WU1 B;  4BHP A;  5JLX A;  2CQ7 A;  1I6X A;  5FKN A;  2H94 A;  2MC4 A;  5E3N A;  1T56 A;  2DDA A;  1U8B A;  3RZD J;  4H0E A;  3VSK A;  2GXB A;  4XL9 A;  1UFM A;  5HDN A;  3ZR8 X;  1W5C C;  1ZK8 A;  2FBK A;  4GFL A;  1XMA A;  4GFK A;  4MHG A;  3GTK J;  4DOZ A;  2DT7 B;  1VQO I;  4XOP A;  4OIP F;  4AF5 A;  5GPC A;  1MSE C;  3DEE A;  4M3G A;  4ZTJ A;  1BN5 A;  3QYF A;  4KUM A;  5M5W J;  1J5Y A;  4XON A;  4P5O A;  4MEY F;  3DEW A;  1SFE A;  4NNJ A;  3RCO A;  1BI1 A;  2W24 A;  1K61 A;  3VVX A;  3RPU D;  2VT3 A;  3A0B C;  1UJ8 A;  4CYC A;  1K83 J;  4WIB A;  3I59 B;  4ITV A;  4UUV A;  1XGO A;  2K40 A;  2F6C A;  1IZ1 A;  3SFZ A;  2ZSI B;  1P4W A;  1QZY A;  1IN7 A;  2STW A;  2R7T A;  2XAS A;  3S1M J;  1R58 A;  3K4K A;  2HQN A;  2VBW A;  5FKK A;  2ZME B;  4IOA F;  3H5R A;  1TTY A;  2BZT A;  4XLC A;  2A6T A;  4RM3 A;  5KCM A;  2HNH A;  1P9Q C;  4XKC A;  2R7R A;  2DOA A;  3KP7 A;  1FP2 A;  1VQK I;  1QZE A;  2RV8 A;  3S14 J;  1YW7 A;  4LMY A;  3KKC A;  3FIS A;  4M3F A;  1R5G A;  5HDG A;  4MXM A;  3I58 A;  3KYD B;  3WTU C;  2GZW A;  1UG0 A;  2IA0 A;  1UAA A;  4QIW N;  1STZ A;  3VUQ A;  5LRR A;  3ZP5 A;  3U2R A;  3FK6 A;  2JMW A;  2HYG D;  4MFD A;  3RZO J;  2OER A;  2BVL A;  2MLG A;  5CPR B;  2DXI A;  4BGD A;  3ML6 A;  2ZNZ A;  4XLA A;  4CIC A;  1MZB A;  2HPM A;  3I53 A;  4KJZ A;  1BA5 A;  3J81 K;  5LFA A;  2AS5 F;  4BUP A;  2Y30 A;  3W6J B;  1T6S A;  4I99 C;  5B3S H;  4FX0 A;  3V8K A;  1IN8 A;  3UR3 C;  2B1E A;  1V5F A;  1HW2 A;  3VPR A;  1W5T A;  4MNU A;  1G4D A;  4BL0 B;  1YE9 A;  5JVT A;  3PNV A;  3BT9 A;  2KFD A;  3IH4 A;  2LNB A;  2DPD A;  4M9X A;  1ZLJ A;  3M8E A;  4E7Z A;  3G4S I;  2COM A;  3ULQ B;  2ZXI A;  4XKW A;  2ZY9 A;  5LGN A;  1HLV A;  3MAJ A;  2QTQ A;  5J1Y A;  5F0H A;  2HTS A;  4F7Z A;  1WJ5 A;  1PVE A;  4BE0 A;  4XLP F;  3S5R A;  1SAN A;  2KP6 A;  4AYB N;  3HTI A;  2XB0 X;  3E3V A;  2Z16 A;  1FX7 A;  3I64 A;  2CQQ A;  3IUO A;  2CUJ A;  3FF5 A;  1LDK B;  1KQ8 A;  1MH4 A;  2BY1 A;  2QGU A;  4WCG A;  1R1T A;  1V5G A;  5D6F A;  5K1Y A;  2F4O B;  3AL0 B;  1I27 A;  2KT0 A;  5LEJ A;  2ZCM A;  1ETO A;  2H1K A;  2M4G A;  3JSJ A;  2KL4 A;  3MFK A;  3IUV A;  3CCV I;  4F91 B;  3IL2 A;  2ZXJ A;  4PFO A;  2VIX A;  4QLC U;  5F1R A;  1JKR C;  3G1M A;  1GLN A;  5F27 A;  4EM0 B;  5CVI A;  3P9K A;  1QU3 A;  1W7P D;  2WA0 A;  3NQO A;  3BTI A;  3VOD A;  3F6O A;  2VQG A;  3MZY A;  2JA5 J;  2R7V A;  3AQT A;  1E2X A;  5E17 F;  4CH7 A;  2STT A;  2M8E A;  1AWC A;  2FBQ A;  1A6Q A;  3HOU J;  2PBX A;  1JKP C;  5HSZ A;  3UNG C;  5FRN A;  2Q2E A;  3ON2 A;  3VYR B;  2Y48 A;  1G3Y A;  1ZQ3 P;  3K9T A;  3RSN A;  2DTZ A;  1JUM A;  1MMS A;  4Y15 A;  1U3E M;  2REK A;  2I8D A;  2Q0O A;  5C4J J;  2DG7 A;  4ZH4 F;  2BOL A;  5GAD J;  1G2H A;  2A5W A;  4S0H B;  1UHM A;  2Y69 H;  2ZJ2 A;  4A0Z A;  3VIB A;  4LK1 F;  4BQN A;  3MD2 A;  3PUF A;  3BRU A;  2GBY A;  2LRE A;  5AIP A;  3ZMV A;  3N4M A;  2YVH A;  2XGE A;  1H9G A;  3DCF A;  5BOX A;  2WAQ N;  2KJB A;  2Z99 A;  2ETH A;  3HSE A;  5FMP A;  4LK0 F;  2GOM A;  3KEQ A;  2YX4 A;  3OSF A;  4AWX B;  3HB9 A;  5F6F A;  5D4S A;  4KIS A;  2RC4 A;  3F8B A;  4JX4 A;  3BCB A;  3TOB A;  3T8T A;  4L62 A;  4KNY A;  2V1N A;  3CCR I;  5L3E A;  1CGP A;  2M0C A;  3REO A;  3ANG A;  1I5Z A;  1MMN A;  3ASN H;  5IP7 J;  4I76 A;  3TDU C;  1BW5 A;  2CQX A;  2Z33 A;  2QSF X;  2R7Q A;  2ZCX A;  4X6A J;  5E3L A;  2M9H A;  3QU3 A;  2G7U A;  3HHG A;  3BPV A;  2LLK A;  4MQV A;  3Q5F A;  1WGX A;  5EJC A;  3S2D J;  5E18 F;  3B6A A;  3E1S A;  4Y52 J;  2XUB A;  3MKW B;  4ZZD A;  4L18 B;  2O0Y A;  3MEX A;  3JRC A;  2DA3 A;  5LHG A;  3OY9 A;  2R7S A;  3HTJ A;  2JSP A;  2OQG A;  3BR1 A;  1X1A A;  3VOE A;  1T39 A;  2WWY A;  2G3B A;  4LJZ F;  2L9N A;  3G1L A;  3WG7 H;  1OCT C;  1DGW Y;  2FOW A;  3CUQ C;  3KEY A;  4HNT A;  3FMR A;  2LD5 A;  2EWN A;  3IRR A;  3LSP A;  2RQQ A;  2DFF A;  1CF7 A;  2M3A A;  1YX3 A;  2FA5 A;  5IP6 A;  5D19 A;  1JXS A;  3G1O A;  4G6T B;  3M8F A;  3OYM A;  3LST A;  3CDL A;  2PJP A;  2RAS A;  3KX2 A;  3RKX A;  1W0T A;  4P55 A;  1YYV A;  1IN5 A;  3GZN B;  3LJL A;  2P6S A;  2NNY A;  1OQY A;  4XRS G;  4UB8 C;  4EMS A;  2K5C A;  3K1N A;  2JRT A;  3Q0W A;  1ZH5 A;  4GYG A;  2EZL A;  3NWS A;  5LRS A;  2CQK A;  4D5F A;  3GTL J;  1DGR M;  3MKL A;  2XAQ A;  2BXZ A;  2JTV A;  3S1Q J;  4OIO F;  5A2Q Z;  4EJO A;  3V4G A;  2G7S A;  1KU3 A;  1IN4 A;  3S1N J;  1HOM A;  1I3Q J;  3M8J A;  1BJA A;  4IHT A;  3WE3 A;  2ME6 A;  3HZJ A;  3ECO A;  1MMG A;  5FKO A;  2UXU A;  1MMD A;  1OLT A;  4UB6 C;  3E5U A;  2P81 A;  3N97 A;  3K4C A;  4NDL A;  3H0D A;  4A3I J;  3TED A;  3OYK A;  3FXL A;  1SVL A;  2M4K A;  3SFI A;  2O6G E;  2UV1 A;  5GPA A;  1HW1 A;  1ZAO A;  3TGN A;  5BMZ A;  1LFU P;  1LNW A;  1QBJ A;  4IKF A;  5JI6 A;  2R7O A;  3U1K A;  3RIR A;  2CH0 A;  4E7L A;  4KMU X;  1RES A;  2B0L A;  3CJR B;  3R4K A;  2KZV A;  3S3O A;  2NVX J;  3RJP A;  4ZDL A;  2MH2 A;  4XRM A;  4IQJ A;  2XSD C;  3L00 A;  4MQ9 F;  3TKY A;  2LKX A;  1OCO H;  5EZG A;  2X6X A;  3FRQ A;  2EIM H;  5M5X J;  2F5E A;  2P4W A;  4YII A;  3PJR A;  2IBD A;  1G59 A;  1ODD A;  2NYX A;  1FZP B;  3TL4 X;  3TO7 A;  3K10 A;  3TW7 A;  2DJI A;  2CJJ A;  1LFP A;  3ABK H;  4PSW A;  3FXK A;  2MYS A;  3HXL A;  4FET A;  2KIQ A;  3TQN A;  2CO5 A;  4D0P A;  4M71 A;  1S9H A;  2X6W A;  2XGC A;  1LQ1 A;  3J7A Y;  2CWE A;  3OOP A;  3VVZ A;  2K4J A;  3DTE A;  2Q24 A;  4GCK A;  3GW2 A;  1UST A;  2QQ8 A;  2FNA A;  4BAY A;  3R60 A;  5F1J A;  3JSP A;  4YFX F;  5IYB J;  1Y8Q B;  2M8G X;  5FHP A;  4CYD A;  3F9K A;  4AIJ A;  1I1S A;  2E71 A;  4FAS D;  1P4A A;  5FKM A;  3C07 A;  2OZU A;  3EUP A;  4OD5 A;  3K4M A;  1XDU A;  3P9I A;  3KP3 A;  3BZK A;  3RKY A;  2BE5 F;  1W1W E;  1SVM A;  2Y0S N;  3KZZ A;  2WY8 Q;  4IRV A;  1USS A;  3WTT C;  1D0Z A;  4KYW A;  3RDI A;  3SDG A;  1EH7 A;  5D5W B;  1NK2 P;  3JCU C;  2VPR A;  3ZXS A;  2E35 A;  1TQM A;  1WJF A;  2HYT A;  3RKW A;  2QBY B;  2JWT A;  2HDD A;  2VON A;  4IRI A;  2KRF A;  2M7A A;  2HYF A;  3B81 A;  3LWF A;  4D9J A;  2VBZ A;  3BPX A;  3HOW J;  1OJL A;  2IVM A;  2CGP A;  1DU6 A;  2H1L A;  3OYH A;  1P7J A;  2NOG A;  4PCQ A;  4BEH B;  2P6T A;  1MJB A;  3SDB A;  2FF4 A;  5KK1 A;  3FXU A;  2OBP A;  4A3B J;  4M6X A;  2FXA A;  2ID6 A;  2ZXH A;  5CVR A;  1S72 I;  2VBY A;  1X1D A;  4FE4 A;  2O8K A;  1B8I A;  1U9N A;  4MK6 A;  5EF6 A;  2DDB A;  3ZMU A;  3K2Z A;  1DP3 A;  3DV8 A;  5DYM A;  2FD5 A;  5IT3 A;  4BE2 A;  2EFQ A;  1HW5 A;  2DBB A;  2FML A;  5J47 A;  1QQI A;  2Y0M A;  3G71 I;  3VYT B;  2DT6 A;  2E5N A;  1SAX A;  3SXY A;  3M1E A;  2NVU B;  1D0X A;  1RR8 C;  1FOK A;  4CXF A;  3NAR A;  3JRG A;  2BW3 A;  1HST A;  5K7Z A;  4XSX F;  2M2E A;  5H2F C;  5AIQ A;  1KU7 A;  4EV0 A;  3FM3 A;  1GDT A;  2LY1 A;  1WJC A;  4HLY A;  1YTY A;  3S16 J;  5K7H A;  3K4L A;  4C2M A;  2OA4 A;  2VJ4 A;  4RGR A;  2ZB9 A;  2A05 A;  4EJW A;  2IT0 A;  1REP C;  3PQJ A;  3DPJ A;  4HLX A;  3GTJ J;  4C2M J;  4NB5 A;  3E97 A;  5BPI A;  3CUQ B;  4M9S A;  1K7A A;  3PL8 A;  1Z0X A;  1ZGA A;  5FGL A;  2YUS A;  3W2V A;  3TO6 A;  1MNE A;  1TNS A;  3FWE A;  2QQA A;  2QEX I;  2PJR A;  3F8C A;  1MJ9 A;  4YRV A;  1G3W A;  2KRC A;  1JT6 A;  2QCO A;  3NRV A;  4M3B A;  3V6G A;  1Z7U A;  2R3S A;  2KPM A;  1F1Z A;  4IO9 F;  2UXI A;  1FLI A;  1IXS B;  2CU7 A;  3HUG A;  5E1Z B;  2Y31 A;  4Q47 A;  3ABL H;  1ON2 A;  4Y4R A;  5B5E C;  3L2V A;  2W53 A;  5D5V B;  1JJ8 C;  3SZT A;  2QUF A;  3QP5 A;  4AUX A;  3H0G J;  4F55 A;  5B66 C;  1Z6R A;  3M7G A;  2JA2 A;  1OPC A;  4XNF A;  2TCT A;  1QGP A;  2UUZ A;  5EEA A;  3PIP F;  5D8L B;  1ACI A;  3S93 A;  2BBY A;  2KZG A;  4AYB A;  1R1V A;  2Z9O A;  4EM1 A;  2LG4 A;  1ZHF A;  4L5E A;  2LYC A;  2XAU A;  1FNN A;  2VPL A;  3F3X A;  2ZJQ F;  2FU4 A;  2WV0 A;  1ETV A;  3BR2 A;  3J81 Z;  4CUG A;  2G7L A;  2VQL A;  1ZG1 A;  2ID3 A;  1VQ8 I;  2D5V A;  1TT5 B;  5ERI A;  4QPQ A;  2FEZ A;  1EJ9 A;  1W4M A;  3MQ0 A;  1K6Y A;  2GFN A;  3BJB A;  2ZCN A;  1IF1 A;  4L0Z B;  2X51 A;  4ENM A;  2L0K A;  1WJE A;  3KLN A;  4DW6 A;  1T33 A;  2VJJ A;  4AU7 A;  4ZYD A;  1ZG3 A;  3G7R A;  2LK2 A;  3ZMS A;  3CMA I;  2IGO A;  1D1B A;  2K7L A;  2XGD A;  2E1M C;  2HXI A;  3M9A A;  4NC6 A;  4B48 A;  5FD5 A;  3L09 A;  3HTA A;  5BS6 A;  2QVO A;  4FHT A;  3HPH A;  4RAG A;  4RB2 C;  2H27 A;  3CQZ J;  4X0G A;  3MKY B;  2BY3 A;  2DT5 A;  5GAG J;  4L9T A;  1NG7 A;  4D1Q A;  4XLH A;  5D8K B;  1ZRC A;  1BR2 A;  2G9W A;  1RKT A;  3WGG A;  5HOD A;  1W5S A;  3W6K B;  3GLL A;  1UG2 A;  4A6E A;  4YG2 F;  4OOI A;  3HIF A;  1FP1 D;  1WHU A;  5IT9 Z;  4XN0 A;  1VZ0 A;  3D5R C;  2GA1 A;  2PZ9 A;  4WX9 A;  4PK4 A;  2VC0 A;  1FPQ A;  3HUG B;  2HOS A;  1ON1 A;  2M45 A;  4HOB A;  1B9M A;  4BBR J;  4Q4Z F;  1MDM A;  1NHA A;  4KIB A;  4GCT A;  4IXA A;  2Y9Z A;  2DCE A;  1QA6 A;  2HQA A;  2IS2 A;  2W84 A;  1SMY F;  1E17 A;  4YEL A;  2LMD A;  2WAE A;  4BH9 A;  3QPT A;  3QP6 A;  1YJ9 I;  2W7N A;  2MD5 A;  1HCR A;  3BR6 A;  1FY7 A;  5B1A H;  1SFO J;  3DQV C;  2JVG A;  4CA0 A;  2A68 F;  3OYA A;  3LAP A;  1MBE A;  3L7W A;  3NRG A;  2O7O A;  1R23 A;  3HG9 A;  2OD5 A;  1IGN A;  3L2W A;  4RB3 C;  2F48 A;  5E20 A;  2KDO A;  3IV5 A;  1FWZ A;  3OYL A;  1OCZ H;  1SD4 A;  2K9Q A;  4R8H A;  1VQM I;  2MD0 A;  4JYK A;  2WAQ A;  2P5V A;  3KEO A;  2NVY J;  2IGM A;  3E6B A;  4DZP A;  3IKV A;  1OFC X;  2YR2 A;  4NQW A;  2VE9 A;  3H35 A;  2HDC A;  1WRJ A;  5L3B A;  4V2G A;  2DOF A;  1IC8 A;  4M72 A;  1SFU A;  1BI2 A;  3I3L A;  2DN0 A;  3QWL A;  1G3S A;  2Z2S B;  1ORK A;  3GFJ A;  3IRQ A;  2L54 A;  4UVA A;  3BR0 A;  2NS7 A;  2R92 J;  2LF7 A;  4G7Z F;  1FSE A;  1U2W A;  4OAZ A;  3EYY A;  3VEP A;  4XMY A;  2AXL A;  4IZZ A;  4RGX A;  2EIK H;  1W7P A;  2NNN A;  2X1D A;  3OL3 A;  4F52 A;  4L9V A;  4XM3 A;  1Q1H A;  2OTJ I;  3KP2 A;  2EV6 A;  3V7R A;  5HLG A;  4KT5 C;  1QO0 D;  2L9V A;  5CW8 A;  1LE8 A;  2WB1 N;  2YSR A;  3S3M A;  4RMN A;  4QTR A;  3G56 A;  1I3A A;  4B44 A;  5D1R A;  4CCJ A;  3Q0V A;  4O5V A;  4Y33 A;  4XIC A;  4JQF A;  3E6M A;  2QSH X;  4NC8 A;  4M9Z A;  4UV8 A;  1A04 A;  4YEJ A;  3F23 A;  2HWV A;  3QQA A;  2V57 A;  3FBI B;  5FRO A;  2QOP A;  3QBM A;  5LBQ A;  2VE8 A;  2WV1 A;  4A3K J;  5J8C A;  2A6H F;  5LHH A;  4BBS J;  5J3L A;  3J80 K;  3DKY A;  3TDZ C;  5JFR A;  3RYR A;  3CCU I;  4WXC A;  3WTW C;  3GFI A;  4XID A;  3KPH A;  3BHQ A;  1FOY A;  2X4H A;  3UKG A;  1XPX A;  1UI6 A;  1TW2 A;  2D1V A;  3JRA A;  4P96 A;  3I9V 2;  4ACI A;  3ABU A;  4HG2 A;  4CGR A;  1SAU A;  2EFP A;  3MZ8 A;  4KN4 X;  2GUH A;  4DVY P;  1TNT A;  1JE8 A;  2QKM B;  2CV1 A;  5HVQ C;  4KIG A;  3HBL A;  3SZG A;  1OIS A;  1WWX A;  1ZRF A;  1VFC A;  3DXJ F;  2MA3 A;  3MWM A;  2VL8 A;  2K3F A;  4G94 A;  4AC6 A;  4LG0 A;  2GQQ A;  1D8K A;  3F72 A;  3H92 A;  2LP0 A;  2R5Y A;  1SEU A;  5LD2 C;  3F8F A;  5H6Q A;  2FX0 A;  1B8I B;  1VQ9 I;  4DYQ A;  5HBU A;  5CKT A;  3HOY J;  1WH7 A;  5HLT A;  3ZOB A;  3WTV C;  5CQE A;  2D1H A;  2PI0 A;  1D5V A;  4I98 B;  4I2O A;  2GEN A;  3E6D A;  3AFH A;  2DA1 A;  3GEZ A;  2KRH A;  1S3J A;  4EJU A;  3PO2 J;  2CG4 A;  2KIS A;  1D5Y A;  2JN6 A;  3CF5 F;  2ACJ A;  3CWR A;  1TWF J;  4JNN A;  3G3Z A;  1BR4 A;  3BG3 A;  3OS2 A;  4FCY A;  4YZE A;  1N75 A;  2HGC A;  2R93 J;  3KP4 A;  2EJR A;  1V3F A;  4IL6 C;  3GLX A;  3KZI C;  4ZYA A;  1P7I A;  4IHY A;  1TW3 A;  4ESB A;  4DZJ A;  2OUM A;  1MH3 A;  2QKO A;  1WI9 A;  4MO7 A;  4A0X A;  5LHI A;  3E6C C;  1R71 A;  2KJC A;  2BHY A;  1U6G A;  3U21 A;  1TQP A;  5TIS C;  4CCL A;  4OAY A;  3L2C A;  4A3L J;  3IH3 A;  4HW0 A;  2K9S A;  5DD8 A;  2VXZ A;  1DPR A;  2X1C A;  2XSJ C;  1FIP A;  3DPL C;  2W57 A;  4J19 A;  1AKH A;  3HPG A;  4ZTF A;  1RR7 A;  3RPU A;  3VW1 A;  2KIM A;  2QQB A;  5L3C A;  5FKL A;  1EA3 A;  1EV7 A;  2H8R A;  3OS0 A;  1B1B A;  2DFH A;  3O60 A;  4A69 C;  4XLN F;  1Y6I A;  1OYY A;  2M1B A;  1ZGJ A;  4G12 A;  4NC7 A;  2KLO A;  3U9G A;  4GRI A;  2K86 A;  4E7J A;  4A3J J;  1K79 A;  4P9F A;  5J6X A;  5E79 C;  3GVA A;  2VOD A;  4DBR A;  3CO7 C;  4QWQ A;  5LLQ A;  3FXO A;  3LSJ A;  3CCJ I;  3KYC B;  1J09 A;  5J40 A;  1MBH A;  1V4R A;  4W97 A;  2DQL A;  2XPU A;  3QAH A;  3K2A A;  4BDZ A;  1UEL B;  2DTR A;  4UUS B;  3TP3 A;  2W4S A;  2AQE A;  3BCG A;  5AQC A;  1R5I D;  2EA2 A;  2P8T A;  2ZKZ A;  1NTC A;  2GM4 A;  3GZ5 A;  3LQR A;  1HDP A;  1WJB A;  2XF6 A;  4NHJ A;  5D18 A;  3QOP A;  5CQG A;  2UZK A;  1QVU A;  3OYG A;  3L2R A;  1WPK A;  5JVG F;  2Z1D A;  4RLF A;  2L2O A;  1U5T C;  2KKO A;  3SEZ A;  3LA7 A;  1H0M A;  2LF8 A;  4O3M A;  3KET A;  2G7G A;  2E5Z A;  1D1A A;  1R36 A;  5FLX Z;  2HKX A;  2FQ4 A;  4AVZ A;  2PLY A;  3KNW A;  3KP6 A;  2YVE A;  1MJA A;  4D5C A;  1XTA A;  2LKP A;  5K5Q A;  2O9L A;  4BQO A;  3SWH A;  1P4X A;  3QKX A;  4XLF A;  3HSR A;  1Y56 A;  3Q9V A;  5HS9 A;  1UHW A;  5FFX A;  1LJ9 A;  5H9T A;  1UZC A;  4WF2 A;  4PUS A;  5L3G A;  2LFB A;  4RAY A;  2JZY A;  3OL4 A;  4LIU A;  5FD6 A;  3JR9 A;  4UY8 I;  5H20 A;  2JUG A;  4OIR F;  5BPD A;  1JHH A;  3HC7 A;  4B47 A;  3LAJ A;  2NRA C;  4K2E A;  3DTI A;  4U9L A;  3LSH A;  2XHK A;  2A61 A;  1RUN A;  4EAT A;  3QPL A;  2VOP A;  1S29 A;  1RRJ A;  5DM7 F;  1AU7 A;  4LLN A;  2E19 A;  2CS3 A;  2ESH A;  2FQ3 A;  2OJE D;  3ONQ A;  4M73 A;  3F21 A;  5IOZ A;  2PMU A;  2Q2E B;  2VKE A;  1TP4 A;  3AG4 H;  3FX3 A;  3DKW A;  4B43 A;  5J1U A;  2JJ7 A;  1PUE E;  1RIO H;  3M1C A;  2VXD A;  4XRS A;  2X85 A;  2J5P A;  1R00 A;  2VN2 A;  2E34 A;  3OYN A;  4U88 A;  5C4Y A;  2VQH A;  5E1X A;  1ZRE A;  2DMT A;  2AHQ A;  3H3Z A;  1RI7 A;  1BIB A;  2X9D A;  3BR5 A;  3K7A J;  4MTD A;  1ZR4 A;  3HRM A;  5ILV A;  1O3S A;  4U7B A;  3CRJ A;  2ZFU A;  4DGW B;  4XOR A;  5ICE A;  2DYR H;  2H6C A;  3QPH A;  4OIQ F;  3A1Y A;  2P7C B;  3HGY A;  2ELK A;  1X3U A;  2EZI A;  5HNF A;  1P2F A;  1EH8 A;  2DA2 A;  2DJN A;  2RVC A;  3GF2 A;  3WGI A;  3SZP A;  5HOO A;  4J01 A;  3PM1 A;  2E1C A;  1O57 A;  1QHG A;  4D7N A;  2LTP A;  2O61 A;  1YIT I;  1MKM A;  3RQI A;  5CJ9 A;  1VI0 A;  2GIV A;  4G9Y A;  2DK8 A;  1T0F C;  5D6E A;  1K4S A;  3OYC A;  4JX6 A;  3K70 D;  3I0T A;  3M07 A;  1TQI A;  3C18 A;  3FDY A;  2YU9 J;  1XCV A;  4HNV A;  1AOY A;  2DK5 A;  3PNY A;  2NX4 A;  3ZRG A;  1SGM A;  3WGH A;  3SYT A;  2EIN H;  2K27 A;  2XAJ A;  4ABZ A;  2CV0 A;  1X58 A;  2BEO A;  1Z91 A;  4MLO A;  2IEK A;  2CMP A;  1YO5 C;  3HOZ J;  1SFK A;  1YLF A;  3O6B B;  2GA2 A;  3FM5 A;  1J7K A;  2DG8 A;  3GXO A;  4HX8 A;  3ZQI A;  1WH5 A;  2QA4 I;  4BJT A;  1U9O A;  3DBH B;  2KDZ A;  2XKO A;  1Z9C A;  1RNL A;  3CCM I;  2WB1 A;  4HEA 2;  1X19 A;  4OWR B;  2ZFW A;  4YIR X;  3GFM A;  2P5L C;  3BZ6 A;  1HDD C;  5DCM A;  2R7U A;  2A5Y B;  1OCR H;  4KT6 A;  4ETS A;  4LB5 A;  3CCQ I;  3BWG A;  3BQY A;  4V2F A;  3CP2 A;  2H6B A;  3A03 A;  4CCM A;  1ZRD A;  4ZZL A;  1IDY A;  2AQF A;  2K9N A;  2M87 A;  4BY7 J;  1Z6T A;  3JAM Z;  4EJT A;  2HQR A;  1N78 A;  1SC7 A;  1FBQ A;  1KU2 A;  2K4B A;  9ANT A;  3ECH A;  3DFG A;  1Z7L A;  4XSZ F;  3OSG A;  2V7F A;  4D7M A;  4N9H A;  4O6J A;  3C2H A;  3OYD A;  3O3K A;  2VC1 A;  1KGS A;  1FYL A;  2HOT A;  4GXO A;  2DYS H;  2DPU A;  3QYE A;  1QPI A;  3FXJ A;  1WKM A;  3CTA A;  5KAF C;  2YX7 A;  5JHF A;  2R7Z J;  3JRI A;  4PJ0 C;  1WQ2 A;  1RC9 A;  2GWR A;  4LGW A;  2E2I J;  1Z21 A;  1JGS A;  4DIQ A;  5IT9 K;  2EPF A;  2KMU A;  3QPS A;  1KYZ A;  1IDZ A;  4A3D J;  2Y75 A;  2OPT A;  2W1O A;  1TC3 C;  3CD6 I;  4IJA A;  3ERE D;  4ZDO A;  2BV6 A;  1LFB A;  2FMY A;  1SVO A;  3CO6 C;  5K7F A;  3FXR A;  1AKH B;  3A0H C;  2DAO A;  2NAZ A;  4LLL A;  1QVT A;  2Y9Y A;  3ELK A;  3I71 A;  4M6Y A;  2LOO A;  1D0Y A;  3BOQ A;  3HTU A;  2F4I A;  2V1D A;  4W1U A;  1U8R A;  1X1B A;  2D45 A;  1MBG A;  2A07 F;  1XB4 A;  3OYE A;  4BHC A;  3GTG J;  4C3I J;  1LVK A;  3T8R A;  4MGR A;  5AON A;  3AL0 C;  1ETK A;  1KA8 A;  1R5H A;  4I0A A;  4WWC A;  3LSM A;  3DLA A;  5CYV A;  4E7H A;  3FXM A;  3H3V K;  4XBF A;  1XSV A;  4BEH A;  3R6S A;  5FGM A;  3X2Q H;  1ULY A;  4ZYH A;  5DEQ A;  3NNR A;  1EH6 A;  2BXY A;  4GYI A;  3C2B A;  2HYJ A;  4I09 A;  4MTE A;  1MND A;  4LFU A;  1MNM C;  4KA4 A;  1I50 J;  4RDU A;  2VKH A;  4G7O F;  1FYK A;  1KZH A;  5F0C A;  2EH3 A;  1DDN A;  1U0J A;  1YIJ I;  5EFY A;  2VJ5 A;  5CXI A;  3NXC A;  1F43 A;  5HLI A;  2N8G A;  1IRZ A;  1DQU A;  1R7J A;  4JKZ A;  3CMM A;  3I4N J;  2C6Y A;  4HX7 A;  2DA7 A;  4NN1 A;  1BI0 A;  5C44 J;  3HSF A;  3V7S A;  4KFC A;  2Y2Z A;  3CJT B;  3WU0 A;  3LSI A;  3LSK A;  5FJ8 J;  5FFZ A;  1YHQ I;  5KAI C;  2R0Q C;  5IY5 H;  2MH9 A;  5IYC J;  2V1X A;  4QPO A;  4LD5 A;  1FJL A;  1HKT A;  1OCP A;  3FMS A;  3RYP A;  2HVQ A;  4GFB A;  2L5Q A;  4KIC A;  3CUQ A;  2I5U A;  3SHF A;  3ZPL A;  3K8P C;  1YS6 A;  2DA5 A;  2E1N A;  3SJM A;  3GEU A;  1HSJ A;  4ZYG A;  2MAB A;  3ISP A;  3ZQF A;  3CLQ A;  1B72 A;  2TDX A;  3U1D A;  3S3N A;  3A01 B;  4IX7 A;  3VVY A;  4R1H A;  2QWW A;  4Y17 A;  2JQ7 A;  3ZQL A;  1R49 A;  1ETQ A;  2LC2 A;  1KQ0 A;  2QZ8 A;  3HOS A;  1W36 D;  4OMY A;  4A6D A;  2ZSH B;  5GTI C;  3M4O J;  4E7K A;  1XS9 A;  1IUY A;  3QRF F;  1X2M A;  2CW7 A;  1UCR A;  2L9S A;  3K0L A;  4Z6Y A;  1E3H A;  4XK4 A;  3NS4 A;  3VFZ A;  3CLO A;  3JRB A;  4JL3 A;  2O5R A;  1IRF A;  3IH2 A;  3G73 A;  3FKI J;  4XKV A;  2E60 A;  1YFH A;  1HA8 A;  2R7W A;  3EPZ A;  2VBX A;  2PMZ N;  2ZXW H;  3V7C A;  5FLX K;  3QU6 A;  1MBK A;  2PN6 A;  3WTX C;  4DQ2 A;  1T38 A;  3BTJ A;  5DM6 F;  3DBR B;  3J80 Z;  1EF4 A;  4HF2 A;  1U78 A;  1LKX A;  4EEF G;  1IRX A;  3PQK A;  4EM2 A;  1J2X A;  1Z77 A;  3K70 C;  1R9T J;  1BL0 A;  3CUO A;  4MFE A;  1DUX C;  3CCE I;  3RQ4 A;  4XKB A;  3VW2 A;  1HXD A;  3FKJ A;  3T5X A;  2BHZ A;  2UWM A;  3R61 A;  3HKZ A;  3WTS C;  1XSD A;  4BAC A;  1O3T A;  2BY2 A;  2QQ9 A;  3G2B A;  5ICF A;  1X4P A;  4IRH A;  1G3T A;  1MGT A;  2OCC H;  2O03 A;  5ED4 A;  4Q48 A;  4AIH A;  1TT0 A;  3H9Q A;  3LA3 A;  5C3E J;  3WU2 C;  3WOD F;  4IHV A;  2PG4 A;  2W82 A;  1XMX A;  4A5M A;  3NWT A;  3L2Q A;  4IHX A;  1X1C A;  3WTY C;  1XMK A;  2RQP A;  3VWB A;  2WAF A;  3RPQ A;  2XF7 A;  2XPW A;  1GVJ A;  5GAE J;  1WJD A;  2LY2 A;  1TWG J;  2HDW A;  3P5J A;  4PJJ A;  4DJA A;  1E3O C;  4P1W A;  3G6E I;  1XGN A;  2DMP A;  4GCL A;  2ZJR F;  4KWA A;  4P9U A;  3I4M J;  3CC4 I;  1BJZ A;  2OV7 A;  2RNJ A;  4N9I A;  1P6R A;  3T0Y A;  2HR3 A;  3W2W A;  1B72 B;  1W36 C;  4RBO A;  1F4K A;  2D6Y A;  2RGV A;  1B4A A;  4S05 A;  2ISZ A;  1POG A;  3BTL A;  1TL8 A;  1QPM A;  1ZEL A;  2X0L A;  1H88 C;  3H9G A;  2ISY A;  2XB5 A;  2EV5 A;  2IA1 A;  1PP7 U;  5TJJ A;  3IKT A;  2KIF A;  3LFU A;  5F08 A;  2CW0 F;  3BG9 A;  4ICH A;  2ECC A;  3KE2 A;  3E5Q A;  3V8L A;  1YRN A;  2JPC A;  2WTE A;  2PFB A;  4ZC3 A;  1UMQ A;  5E3M A;  1R4M B;  1E0E A;  2F5V A;  3BRO A;  2RNG A;  1B59 A;  5EDN A;  3MZH A;  5ILS A;  2NP3 A;  3LSG A;  1R1U A;  3H3U A;  3LFK A;  2L7M P;  3S15 J;  4E7I A;  4PJL A;  2B7E A;  3ERM A;  3GWZ A;  3K1P A;  3FIW A;  1IRG A;  3A4C A;  2Y0S A;  1TWC J;  1XC5 A;  4N4O B;  3CC2 I;  2PMZ A;  2IW5 A;  3ZMZ A;  3HDD A;  1LVA A;  2PEX A;  2GAU A;  4II2 A;  3S8P A;  4A3C J;  3ROU A;  2XF5 A;  1FC3 A;  4XQF A;  3ABT A;  4CGZ A;  1R4N B;  1XCB A;  2B63 J;  3TOA A;  1LPQ A;  4HA8 A;  3NI7 A;  3DKX A;  3GME A;  2WGB A;  1HBX G;  2OQR A;  3HM5 A;  4HDV A;  1FTT A;  4F93 B;  2UXP A;  2Q8K A;  2ZC2 A;  1UHS A;  2O8X A;  2WAD A;  2IS4 A;  3DP7 A;  1C0W A;  3FK7 A;  5EYR A;  4IF4 A;  5IOY A;  4NQW B;  2HTJ A;  1R6R A;  2ZOY A;  2VB6 A;  5JHU A;  4MIM A;  3VTI A;  4LLG F;  2FJI 1;  3AG2 H;  3VSL A;  3WTZ A;  4WK8 F;  1GV2 A;  1H8A C;  5GAH J;  2OU2 A;  2XDN A;  4EGZ A;  1IV6 A;  3LA2 A;  4CYC B;  1GHC A;  1YG2 A;  2VKV A;  3E0J B;  1K78 A;  4TV7 A;  5EZH A;  2JT1 A;  4IQ4 A;  4BJ6 C;  3OYB A;  3ZQC A;  4CDG A;  4HV5 A;  3CF2 A;  4FTH A;  2HQ5 A;  3GYH X;  1H9T A;  2B3W A;  2EFO A;  2TRT A;  3ON4 A;  3GTP J;  2OF7 A;  3DWL E;  3HE0 A;  2Q1Z B;  1J0R A;  4U0Y A;  1FBS A;  3GCM A;  3GO5 A;  2FNP A;  2W48 A;  1YIO A;  1MDM B;  3PPB A;  4HRI A;  2GIZ A;  5M3M J;  4JK1 X;  1E3P A;  2O3F A;  5ICC A;  1XG1 A;  2CQN A;  1D1C A;  4X1E A;  3F6V A;  2HI3 A;  2E7W A;  2FBI A;  3HL2 A;  3HYI A;  2M5W A;  2A2F X;  5JR3 A;  1MW7 A;  2DLL A;  2QLZ A;  2O7T A;  3GUD A;  3AG3 H;  3B02 A;  2NS0 A;  3OYI A;  2L4M A;  3JTG A;  3Q9S A;  3I54 A;  4YFN F;  3GTQ J;  2XRN A;  4AD9 A;  4B4C A;  1G8X A;  2MG4 A;  2V79 A;  2ZME A;  4B8X A;  2F2E A;  4KIT B;  2W25 A;  4JX5 A;  5DV5 A;  3R0A A;  3PAS A;  5DCM B;  4Z2Y A;  5C4X J;  1Z05 A;  2LRD A;  1A35 A;  3F8M A;  2JA7 J;  3GTO J;  3RI4 A;  4KMF A;  3FMQ A;  1K4T A;  1JKQ C;  3COL A;  2UXO A;  4U7D A;  3OWT A;  5LEK A;  1VND A;  1YJN I;  1A5J A;  3J7Y J;  4E70 A;  1B9N A;  3BR3 A;  2PX9 A;  4RGS A;  3HOX J;  2BVM A;  4WXH A;  3A02 A;  4CHU A;  5FRM A;  2AXT C;  1XN7 A;  3V42 A;  1DP7 P;  1DU0 A;  1KU9 A;  1JI8 A;  4HYE A;  1QZZ A;  3E5X A;  2M30 A;  3BJO A;  4FQG A;  3OYF A;  2PMH A;  3AKZ A;  3ZQ7 A;  2NP5 A;  2ADU A;  3DPT A;  3S17 J;  1FMV A;  2IGK A;  4G8X A;  5IPA A;  2A6E F;  4KN7 X;  4M6V A;  1RUO A;  1ITY A;  1FIA A;  2IGN A;  2DA4 A;  4PDK A;  1Y39 A;  4RGU A;  1LE8 B;  3HOV J;  3CJQ B;  1SD7 A;  4HKU A;  4IVN A;  2DMN A;  2EZH A;  4ENK A;  4ANJ A;  1FTZ A;  1GXQ A;  2QEN A;  5EEH A;  1WSU A;  1GT0 C;  4RB0 A;  3H5N A;  3I56 I;  2H8W A;  3EQL F;  1D3Y A;  1JJ6 C;  1YW9 A;  2I10 A;  1O7F A;  3JRE A;  3ABM H;  2R7F A;  4G6Q A;  2EIL H;  3HRU A;  3CP8 A;  2IP2 A;  2ZJP F;  3NPI A;  4KIF A;  2FJ1 A;  2CW8 A;  2XIG A;  1TWH J;  2HKU A;  2XV4 S;  2R4G A;  3Q0U A;  3COA C;  1BR1 A;  3BDD A;  5DUI A;  2EFN A;  3SQN A;  1D8J A;  3F1B A;  3GBG A;  2OTL I;  4C2U A;  3CC7 I;  4IHS A;  3KZ9 A;  2JRM A;  4OU0 A;  4PGG A;  2VLA A;  1IO2 A;  1P92 A;  4IHW A;  3BP8 A;  3JAM K;  5EGO B;  1RET A;  4NBQ A;  2BY0 A;  1W0U A;  2DFE A;  4M3E A;  2PBI A;  4AID A;  4L9J A;  3S2H J;  4XR6 A;  2HFH A;  1IUF A;  4HF0 A;  2HEO A;  4BDY A;  3RD3 A;  4CZZ A;  3J7A O;  1R22 A;  3KCC A;  1MIJ A;  2P0W A;  3MCZ A;  3CJD A;  1OCC H;  4A93 J;  2WC2 A;  1ZR2 A;  3GZ6 A;  1Y0N A;  3JRH A;  2NXN B;  2QIB A;  3WG9 A;  3GZI A;  3IC7 A;  3ZQG A;  5J8F A;  4IRG A;  3QOE A;  3O8H A;  1X4O A;  5CVJ A;  3I55 I;  4OD4 A;  1X2N A;  2P7V B;  4Q5S F;  5E1W A;  1HKS A;  5HDK A;  1PDN C;  3OR2 C;  1YOV B;  4ENJ A;  3VOK A;  3K1M A;  4EJV A;  1IN6 A;  3VYS B;  4I6Z A;  1O4X A;  2E7X A;  1PJR A;  3NAU A;  3C7J A;  2ZO4 A;  4YIF A;  1LDD A;  4C3H J;  1IV8 A;  5D5U B;  1VQ4 I;  3L9F A;  2X48 A;  3K69 A;  3PSI A;  3HKZ N;  3D5S C;  3JTH A;  2QSG X;  4UDS A;  1ETW A;  1SD5 A;  2FSW A;  2V26 A;  1MSF C;  3EET A;  5HLH A;  4BJ5 C;  3HIM A;  2EV0 A;  3I5U A;  5JLW A;  2R7D A;  4BU2 A;  4DYR A;  5EG0 A;  2CRG A;  4FE7 A;  1J75 A;  3FHZ A;  2B9S A;  3BCA A;  1BI3 A;  4OIN F;  2W00 A;  2L7K A;  4GCV A;  3KKD A;  3DBL B;  4NEL A;  4I02 A;  5DCF A;  2QKL B;  3IAM 2;  3LSR A;  2XGX A;  3CMY A;  3PUB A;  1YI2 I;  3BZC A;  3O8G A;  2RKH A;  5K5O A;  5HNH A;  2XDV A;  4RB1 A;  4PXI A;  3L2U A;  3PFI A;  1HQC A;  4UVB A;  1OMI A;  1F5T A;  3DPU A;  4ZDP A;  2XAF A;  3IHU A;  3MMY B;  4KDP A;  1T98 A;  1Z1D A;  1ENH A;  3D0S A;  3W6V A;  1EKE A;  3HTS B;  1OKR A;  5E3O A;  2E36 A;  3TMO A;  1JHF A;  1T0F A;  5BNG A;  4HQE A;  2MBF A;  4ZYE A;  4BXX J;  2V9P A;  2F5C A;  1WI3 A;  3D5L A;  2LH9 A;  2HS5 A;  3GFL A;  3ASO H;  5H6R A;  3BJ6 A;  4CZC A;  1I6H J;  2GXG A;  2HVR A;  2IA2 A;  2EFW A;  5GP9 A;  5FLV A;  1TWA J;  2DW4 A;  3AG1 H;  4JOM A;  4R79 A;  4IOC F;  2JVH A;  2A69 F;  4DBQ A;  1CF7 B;  1JTX A;  1LB2 A;  3ZMT A;  4BQQ A;  2QM3 A;  2RHA A;  3E7L A;  4IPA A;  2JK3 A;  5F04 A;  3LL7 A;  1ONV A;  2ME0 A;  3CDH A;  3HGG A;  3DLL F;  4IEJ A;  2RRE A;  4JBA A;  4QSH A;  3VB2 A;  3ZCO A;  3B73 A;  2XAG A;  3OMY A;  2V6C A;  4B09 A;  2NVT J;  1Q1V A;  1ZTR A;  1PYV A;  1U5T B;  3OV8 A;  3Q3S A;  3KLO A;  2HKO A;  1WZ2 A;  3CES A;  1O3R A;  1YX5 A;  1KQ9 A;  3IWZ A;  1VQN I;  1OYW A;  1OR7 C;  2IPQ X;  2IAI A;  2X1E A;  2K85 A;  1GUU A;  1CQT A;  1YQA A;  3LMM A;  1YS7 A;  2K02 A;  5K5R A;  1MBF A;  2J5O A;  3PNT A;  1T2K A;  2ZNY A;  3WHB A;  1K78 B;  1BOA A;  2IJL A;  4HBL A;  2YVX A;  2DMQ A;  3K4B A;  1A36 A;  2HPI A;  1FOW A;  2R5Z B;  2PJR B;  5LGU A;  1IXC A;  1FT9 A;  1NK3 P;  4I0B A;  5DTD A;  4ZJZ A;  1JKO C;  2QBY A;  2COB A;  3F22 A;  3CCS I;  4U9N A;  1JUS A;  2GXA A;  4EQQ A;  1O3Q A;  4RLQ A;  5HS8 A;  6PAX A;  3ANP A;  4CCN A;  2DI3 A;  2A3S A;  2DU9 A;  4II3 A;  1QNT A;  3ZN1 A;  4CO8 A;  3CDI A;  2V4J C;  1VQP I;  2DOE A;  2LKS A;  3V78 A;  5DS9 A;  1JT0 A;  5HS7 A;  4ME9 A;  3OIQ A;  1GV5 A;  4HDU A;  4LIV A;  1QRY A;  5M3F J;  4HNU A;  3DTK A;  3AQS A;  2ELH A;  4LG3 A;  2JPB A;  5ILU A;  2K3P A;  5IYD J;  2IRF G;  2P5K A;  2XPV A;  3BNI A;  4A3G J;  2HOE A;  4I01 A;  5FB2 A;  2F07 A;  3VYU B;  3DF8 A;  3BG6 A; 
#chains in the Genus database with same CATH homology
 2ZCM A;  2IU5 A;  1ETO A;  2H1K A;  3HTH A;  2DN0 A;  3JSJ A;  3IUV A;  1S7E A;  2PMZ N;  4Y7N J;  1ORK A;  3BR0 A;  1MBK A;  2NS7 A;  2R92 J;  2ZOZ A;  3BTJ A;  1JKR C;  1EF4 A;  1MBJ A;  1Y1V J;  3G1M A;  4EEF G;  1U78 A;  3L1P A;  2E2J J;  1Z77 A;  5F27 A;  1R9T J;  1BL0 A;  2LVS A;  4MFE A;  3M3Y J;  3VW2 A;  3BTI A;  1HF0 A;  5CW8 A;  1LE8 A;  2WB1 N;  4QTR A;  3G56 A;  1VF9 A;  2JA5 J;  5D1R A;  3Q0V A;  3AQT A;  4XIC A;  2FBQ A;  3HOU J;  2PBX A;  1JKP C;  2X6O A;  5HSZ A;  3QQA A;  2V57 A;  5C3E J;  3ON2 A;  2QOP A;  3QBM A;  1ZQ3 P;  4IHV A;  2WV1 A;  4A3K J;  2DTZ A;  1JUM A;  4BBS J;  5J3L A;  2REK A;  3VW0 A;  4IHX A;  2QWT A;  1RPW A;  5C4J J;  2DG7 A;  2XPW A;  1FEX A;  2LR8 A;  1G2H A;  4S0H B;  4XID A;  1TWG J;  3BHQ A;  1E3O C;  3UKG A;  1UI6 A;  3VIB A;  3D1N I;  2DMP A;  3JRA A;  4GCL A;  4KWA A;  1Y1W J;  3I4M J;  3BRU A;  1BJZ A;  4ACI A;  3CCY A;  4CGR A;  2MGQ A;  2GBY A;  2GUH A;  2YVH A;  2XGE A;  3DCF A;  1B72 B;  4RBO A;  2WAQ N;  3HBL A;  2D6Y A;  1VFC A;  1PUF A;  5FMP A;  1POG A;  3BTL A;  2GLO A;  3EGQ A;  3OSF A;  1H88 C;  4AC6 A;  2L7Z A;  2ECB A;  2XB5 A;  2R5Y A;  2LP0 A;  3HB9 A;  1ZKG A;  2FX0 A;  1B8I B;  4DYQ A;  5F08 A;  3LWJ A;  5HBU A;  4JX4 A;  3HOY J;  1WH7 A;  3ZOB A;  3BG9 A;  1PUF B;  4ICH A;  2ECC A;  4L62 A;  1F36 A;  1YRN A;  2GEN A;  2CUF A;  3PO3 J;  2DA1 A;  2M0C A;  3ANG A;  1UMQ A;  5E3M A;  1ETX A;  5IP7 J;  4I76 A;  1D5Y A;  3PO2 J;  1BW5 A;  2JN6 A;  2CQX A;  5EDN A;  3B6C A;  3WHC A;  3JRF A;  4X6A J;  2ZCX A;  3CWR A;  5E3L A;  1UI5 A;  2M9H A;  2NP3 A;  1TWF J;  3LSG A;  4JNN A;  3BG3 A;  2L7M P;  3S15 J;  2LLK A;  4FCY A;  1WGX A;  4YZE A;  2LY9 A;  2M34 A;  2R93 J;  3FIW A;  3S2D J;  3B6A A;  3LOC A;  4Y52 J;  1TWC J;  1XC5 A;  1P7I A;  3HDD A;  2G0E A;  4IHY A;  3JRC A;  2DA3 A;  4FIS A;  3HTJ A;  1WCM J;  4DZJ A;  4A3C J;  1MH3 A;  2MW8 A;  3BR1 A;  4JP0 A;  4AC0 A;  2EBI A;  2QKO A;  5CXG A;  4MO7 A;  2B63 J;  2G3B A;  1A6I A;  3NI7 A;  2WGB A;  2AO9 A;  3HM5 A;  3G1L A;  1OCT C;  1FTT A;  2UXP A;  2LD5 A;  1UHS A;  3LSP A;  4A3L J;  4BY1 J;  3IH3 A;  2K9S A;  5IP6 A;  5D19 A;  3BQZ A;  3G1O A;  1FIP A;  4M3D A;  3FK7 A;  4J19 A;  5EYR A;  1AKH A;  5IOY A;  3CDL A;  1W0T A;  1RR7 A;  3VW1 A;  3MVP A;  5FKL A;  2ZOY A;  3LJL A;  2H8R A;  4XRS G;  3BTC A;  3O60 A;  5IP9 J;  3Q0W A;  1BW6 A;  4MIM A;  4A69 C;  2E2H J;  4G12 A;  2EZL A;  4A3J J;  2VUM J;  1GV2 A;  4D5F A;  1H8A C;  3GTL J;  5EGO A;  3MKL A;  3S1Q J;  2XDN A;  1IV6 A;  4CYC B;  2NS8 A;  3LSJ A;  2VKV A;  1IJW C;  2G7S A;  3S1N J;  1HOM A;  1I3Q J;  3BG5 A;  5EZH A;  1MBH A;  4W97 A;  3ZQC A;  2ME6 A;  2XPU A;  5FKO A;  3LNQ A;  3K2A A;  2UXU A;  4FTH A;  2HQ5 A;  3ON4 A;  4UUS B;  2TRT A;  2P81 A;  3TP3 A;  3GTP J;  2OF7 A;  3BCG A;  4NDL A;  3HE0 A;  5AQC A;  1APL C;  2GM4 A;  1NTC A;  4A3I J;  3TED A;  1HDP A;  2W48 A;  3PPB A;  3SFI A;  5M3M J;  5D18 A;  5GPA A;  2JA6 J;  1LFU P;  1QVU A;  1XG1 A;  3T6N A;  1WPK A;  4X1E A;  2HI3 A;  1RES A;  5J1R A;  2O7T A;  2G7G A;  2XRL A;  2NVX J;  1JUP A;  2FQ4 A;  3GTQ J;  3KNW A;  4XRM A;  2YVE A;  2XSD C;  4D5C A;  4B4C A;  1ZGW A;  2MSY A;  2MG4 A;  4A3F J;  2DA6 A;  2LKX A;  5K58 A;  4JX5 A;  5EZG A;  3FRQ A;  3PAS A;  5M5X J;  2O9L A;  5C4X J;  3TW6 A;  5EG0 B;  5HAW A;  4A3M J;  3QKX A;  2IBD A;  1IG7 A;  1YRN B;  2JA7 J;  3GTO J;  1RKW A;  4B3A A;  2WUI A;  5H9T A;  3OOU A;  1JKQ C;  3COL A;  2EQR A;  2UXO A;  3TW7 A;  2HOA A;  2CJJ A;  2LFB A;  1VND A;  3JR9 A;  1A5J A;  5F0F A;  3BR3 A;  4BKX A;  3HOX J;  3A02 A;  1DU0 A;  2XGC A;  3QPL A;  2R5Z A;  3VVZ A;  1AU7 A;  2Q24 A;  4GCK A;  2E19 A;  5F1J A;  5IYB J;  1GVD A;  4DYC A;  2M8G X;  2NP5 A;  5FHP A;  5IOZ A;  3S17 J;  2VKE A;  5FKM A;  5J1U A;  2JJ7 A;  3C07 A;  2E1O A;  3EUP A;  5IPA A;  4M6V A;  1ITY A;  1FIA A;  3MNL A;  4XRS A;  1JGG A;  2DA4 A;  2VI6 A;  2Y0S N;  5C4Y A;  5FLM J;  1LE8 B;  3HOV J;  4HKU A;  2DMT A;  2AHQ A;  2DMN A;  3E7Q A;  2EZH A;  2X9D A;  3BR5 A;  2JA8 J;  3SDG A;  2R5Y B;  1FTZ A;  3K7A J;  1GT0 C;  1NK2 P;  5M5Y J;  1ZR4 A;  3CRJ A;  2VPR A;  3S1R J;  1JJ6 C;  5DAJ A;  2I10 A;  2HYT A;  2JWT A;  3JRE A;  2HDD A;  1AHD P;  3HGY A;  2ELK A;  2EZI A;  4LOC A;  3B81 A;  3NPI A;  2FJ1 A;  2QF7 A;  4UUS A;  2DA2 A;  1TWH J;  2DJN A;  2HXO A;  2HKU A;  2RAS A;  3PM1 A;  4D7N A;  3Q0U A;  3JRD A;  2LTP A;  1OJL A;  3HOW J;  3RQI A;  1DU6 A;  1VI0 A;  3GBG A;  3A01 A;  3F1B A;  1P7J A;  2NOG A;  2RAE A;  3KZ9 A;  2YS9 A;  4JX6 A;  4A3B J;  4IHW A;  2NVQ J;  2ID6 A;  2L7F P;  5EGO B;  4B1R A;  1RET A;  4FE4 A;  2O8K A;  1W0U A;  1B8I A;  1U9N A;  4MK6 A;  3OIO A;  4M3E A;  4C3J J;  5EF6 A;  2YU9 J;  4HNV A;  3S2H J;  2FD5 A;  1IUF A;  2NX4 A;  3RD3 A;  1SGM A;  1ETY A;  3MN2 A;  3CJD A;  3TP0 A;  4A93 J;  1ZR2 A;  4ABZ A;  3JRH A;  2QIB A;  1X58 A;  3F0C A;  3ZQG A;  3GZI A;  3P9T A;  3O8H A;  2EZK A;  3NAR A;  3JRG A;  2CUE A;  1X2N A;  2IEK A;  4MLO A;  2M2E A;  5K7Z A;  3HOZ J;  2L9R A;  1GDT A;  3VOK A;  3S16 J;  5K7H A;  4I6Z A;  1O4X A;  2DG8 A;  3ZQH A;  3RH2 A;  1JTY A;  2ZB9 A;  3NAU A;  1WH5 A;  3ZQI A;  3DPJ A;  1U9O A;  4C3H J;  3GTJ J;  4C2M J;  2KDZ A;  2X48 A;  4A3E J;  1H89 C;  3HKZ N;  4UDS A;  4UUT A;  2OI8 A;  1ETW A;  5FGL A;  1Z0X A;  1MSF C;  2YUS A;  3RKQ A;  3VOX A;  3HIM A;  1HDD C;  5JLW A;  4DYR A;  5EG0 A;  2CRG A;  4FE7 A;  3LHQ A;  2QCO A;  4M3B A;  1JT6 A;  3BQY A;  4V2F A;  2UXH A;  3HEF A;  3V6G A;  3A03 A;  2UXI A;  1IDY A;  2K9N A;  4BY7 J;  3KKD A;  4NEL A;  2CU7 A;  2DMU A;  3LSR A;  3CMY A;  2Y31 A;  3GTM J;  3VP5 A;  9ANT A;  5JLX A;  3OSG A;  2W53 A;  5FKN A;  5E3N A;  4D7M A;  1T56 A;  3O8G A;  2HOT A;  1JJ8 C;  4PXI A;  1U8B A;  3RZD J;  4AUX A;  3H0G J;  1QPI A;  1ENH A;  3W6V A;  2TCT A;  5E3O A;  1ZK8 A;  4GFL A;  4GFK A;  3GTK J;  2R7Z J;  5EEA A;  5BNG A;  3JRI A;  4AF5 A;  2E2I J;  5GPC A;  1MSE C;  4BXX J;  4M3G A;  1WI3 A;  4L5E A;  5M5W J;  3QPS A;  1IDZ A;  4A3D J;  3DEW A;  2OPT A;  1TC3 C;  1K61 A;  1I6H J;  3VVX A;  1ETV A;  3BR2 A;  1LFB A;  5K7F A;  1AKH B;  2G7L A;  2ID3 A;  4CYC A;  2D5V A;  1K83 J;  1QVT A;  2Y9Y A;  5GP9 A;  5FLV A;  2GFN A;  1TWA J;  2K40 A;  3BJB A;  2ZCN A;  4W1U A;  1MBG A;  1JTX A;  2L0K A;  3S1M J;  4DW6 A;  1T33 A;  2RHA A;  3E7L A;  3GTG J;  4C3I J;  2JK3 A;  5FKK A;  5F04 A;  1ETK A;  3G7R A;  2LK2 A;  2ME0 A;  3HGG A;  4IEJ A;  3H3V K;  4QSH A;  2XGD A;  2HXI A;  3HTA A;  3NNR A;  3S14 J;  3CQZ J;  3C2B A;  3KKC A;  2HYJ A;  3FIS A;  4M3F A;  2NVT J;  1Q1V A;  1ZTR A;  1MNM C;  3Q3S A;  4MXM A;  1I50 J;  4RDU A;  4QIW N;  3VUQ A;  1RKT A;  5HOD A;  5F0C A;  2EH3 A;  3FK6 A;  1UG2 A;  2JMW A;  5EFY A;  4MFD A;  3RZO J;  2OER A;  5CXI A;  2IAI A;  3NXC A;  1F43 A;  1GUU A;  1CQT A;  2N8G A;  1IRZ A;  4JKZ A;  1MBF A;  3I4N J;  3WHB A;  2DA7 A;  4NN1 A;  5C44 J;  2PZ9 A;  2Y2Z A;  2DMQ A;  2HOS A;  1BA5 A;  4GCT A;  4BBR J;  2Y30 A;  5FJ8 J;  2Y9Z A;  2R5Z B;  2R0Q C;  1NK3 P;  5DTD A;  3VPR A;  1JKO C;  5IYC J;  2COB A;  1FJL A;  1JUS A;  1OCP A;  1HCR A;  3BR6 A;  1SFO J;  3BT9 A;  4GFB A;  3ANP A;  3IH4 A;  2DA5 A;  1MBE A;  3SJM A;  3NRG A;  3GEU A;  2O7O A;  1HLV A;  2QTQ A;  5J1Y A;  5F0H A;  3ZQF A;  1IGN A;  1B72 A;  3A01 B;  3VVY A;  3V78 A;  5DS9 A;  1JT0 A;  3S5R A;  3ZQL A;  1ETQ A;  4ME9 A;  1SAN A;  3IV5 A;  1GV5 A;  3M4O J;  2K9Q A;  4AYB N;  4JYK A;  1XS9 A;  1QRY A;  5M3F J;  3HTI A;  2XB0 X;  3AQS A;  2NVY J;  1X2M A;  4DZP A;  1OFC X;  5IYD J;  2CQQ A;  2XPV A;  3BNI A;  4A3G J;  1MH4 A;  4V2G A;  4XK4 A;  2F07 A;  1IC8 A;  3JRB A;  4JL3 A;  3IH2 A;  2KT0 A;  3FKI J; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...