1JT0A

Crystal structure of a cooperative qacr-dna complex
Total Genus 69
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
69
sequence length
188
structure length
188
Chain Sequence
NLKDKILGVAKELFIKNGYNATTTGEIVKLSESSKGNLYYHFKTKENLFLEILNIEESKWQEQWKKEQIKAKTNREKFYLYNELSLTTEYYYPLQNAIIEFYTEYYKTNSINEKMNKLENKYIDAYHVIFKEGNLNGEWSINDVNAVSKIAANAVNGIVTFTHEQNINERIKLMNKFSQIFLNGLSKH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis for cooperative DNA binding by two dimers of the multidrug-binding protein QacR.
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Transcription/dna
molecule keywords QACA operator
total genus 69
structure length 188
sequence length 188
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2001-08-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00440 TetR_N Bacterial regulatory proteins, tetR family
A PF08360 TetR_C_5 QacR-like protein, C-terminal region
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 1jt0A01
1.10.357.10 Mainly Alpha Orthogonal Bundle Tetracycline Repressor; domain 2 Tetracycline Repressor, domain 2 1jt0A02
2XB5A 2IAIA 5E3OA 4HNVA 5M3FJ 3O8HA 2DMUA 1NTCA 1H8AC 3HTIA 9ANTA 3CMYA 2G7SA 2XPWA 1APLC 3HM5A 3PO3J 2GENA 1HCRA 3A03A 2JA7J 4V2GA 5IYCJ 3VOKA 2O7TA 3HB9A 3NRGA 3HOUJ 4JX4A 2O8KA 4XK4A 1OCPA 5M5YJ 1Q1VA 3UKGA 2GUHA 5FKOA 4A3KJ 4M3DA 2ME0A 1MBJA 3QBMA 1ETXA 2K9SA 5EYRA 4DYCA 4J19A 2Y0SN 1AHDP 1NK3P 2XRLA 2HOSA 2HYTA 1JUSA 4XICA 3F1BA 3B6CA 2MGQA 1XG1A 2ZB9A 3NAUA 5HAWA 1H88C 3DCFA 3P9TA 1TWFJ 1JJ6C 2H8RA 5C3EJ 3JREA 5DAJA 4BY1J 3TEDA 3HOZJ 3BRUA 2L7FP 1QVUA 3OSGA 1JT0A 2QIBA 2JN6A 3IH3A 1RR7A 3GEUA 2XDNA 1X2NA 4A3FJ 4A3JJ 4BBSJ 5JLXA 1VFCA 4A3BJ 3K2AA 3K7AJ 5F04A 2NVTJ 4A69C 3IH2A 1TWGJ 4PXIA 3PASA 3LSRA 1MH3A 1IUFA 1F43A 3QKXA 4NN1A 2OERA 2WAQN 4I76A 3S15J 4GFKA 1MBFA 4GFBA 2FD5A 1NK2P 3CJDA 3OSFA 3GTOJ 1ZK8A 1JGGA 3JRDA 3CCYA 5E3MA 2EQRA 3SJMA 4A3IJ 1H89C 2E2HJ 3TP0A 3W6VA 2R0QC 2CJJA 3S16J 4I6ZA 2G0EA 3S1QJ 5AQCA 3HOYJ 2UXIA 1DU6A 2JK3A 1GV5A 2XGCA 5HSZA 1ETVA 2JA6J 4XIDA 1GT0C 1LE8B 1XC5A 3BR3A 2LY9A 2R7ZJ 3BHQA 3H0GJ 2DA7A 3BTCA 5GPAA 3COLA 3OIOA 2QWTA 3BCGA 2ME6A 2HQ5A 2QCOA 1DU0A 4L5EA 3HOXJ 2DTZA 3BQZA 2ZCXA 3PM1A 3HE0A 1BW6A 1B72A 3LHQA 4ACIA 1TWHJ 5CXIA 2JWTA 4B1RA 2NP3A 5E3LA 2JMWA 4M6VA 2QOPA 3HOWJ 3S1MJ 3A02A 4BY7J 5FKMA 4A3EJ 1FEXA 3TP3A 4A3MJ 3CQZJ 2E2IJ 4B4CA 1OCTC 2ZOYA 3RD3A 2R5ZB 3SDGA 2LKXA 1D5YA 3E7LA 1LFBA 2EZIA 3AQSA 3T6NA 5IP9J 2ZCMA 5FLMJ 4XRSA 5EZGA 4RBOA 2RHAA 1POGA 3GTKJ 1WCMJ 2G3BA 2EZKA 1WGXA 2VUMJ 3NI7A 4QTRA 2N8GA 1A5JA 5FJ8J 3S1RJ 3QPLA 5GP9A 1WPKA 4MLOA 3VIBA 1MH4A 3GBGA 3QPSA 1W0TA 5FHPA 3ANGA 3WHBA 1GV2A 1W0UA 3GZIA 2REKA 2DA2A 2M34A 4FCYA 3M3YJ 3M4OJ 5J3LA 2YVHA 5FKKA 4JX6A 2XPUA 2QTQA 1S7EA 1ETQA 3NXCA 2Y30A 1HDDC 3IH4A 2Y9YA 4D5FA 4DYRA 2EH3A 2D5VA 4ME9A 2EZHA 5BNGA 1TWAJ 4CYCB 2MW8A 1MBEA 4LOCA 3GTQJ 5FKLA 5IOYA 3LNQA 1UI6A 1BW5A 2LFBA 3CWRA 2DMTA 4UDSA 2LTPA 3JR9A 3NNRA 3TW7A 1E3OC 1ETKA 3MN2A 3HTAA 3ON2A 1I50J 2UXOA 2M8GX 4XRMA 4S0HB 3JRHA 3GTMJ 4AYBN 1X2MA 4Y7NJ 3VUQA 2HOTA 4DYQA 2ECCA 4FE4A 3B6AA 5D1RA 5EDNA 4C3JJ 1MBHA 5IP6A 3EUPA 3FK6A 1FTTA 2LLKA 2IBDA 4JNNA 2E2JJ 2WGBA 2ZOZA 4GCLA 3JRFA 3S1NJ 3DPJA 1ZR4A 5IYBJ 3FRQA 1JUPA 2CUEA 2B63J 1WH5A 3VOXA 5J1UA 2G7LA 4DZJA 3LSJA 2DA6A 2M0CA 3RZOJ 1BJZA 1K83J 1VF9A 1ZQ3P 3HOVJ 4C2MJ 2ECBA 4D7NA 2FX0A 2GBYA 2K40A 1A6IA 2ID6A 3BR0A 3HTJA 3ZQCA 2LK2A 2M2EA 4ABZA 4AF5A 2YUSA 1UG2A 1HDPA 5K58A 2TCTA 4Y52J 1VNDA 5F27A 3FK7A 4A3LJ 4C3HJ 1WI3A 2F07A 2PBXA 3MKLA 1JUMA 2FJ1A 1T56A 2DG7A 3ZQFA 2FQ4A 3G1MA 3HDDA 5DS9A 1JKQC 1SGMA 1RPWA 1IJWC 2E1OA 2I10A 5HODA 5FKNA 5M5WJ 4BXXJ 5FLVA 2HI3A 2RAEA 3GTLJ 2XB0X 2JA5J 4KWAA 2OI8A 4FTHA 1X58A 2LVSA 3GTGJ 2DA4A 3LJLA 3L1PA 5HBUA 2AHQA 3ANPA 5DTDA 4JL3A 1GUUA 2LP0A 3EGQA 4HKUA 2W53A 2L7ZA 2V57A 1JTYA 4A3GJ 3KKCA 2K9QA 1IV6A 5CXGA 5J1RA 3VW0A 3SFIA 3BG9A 2XSDC 1MBKA 4MIMA 3FKIJ 1JKOC 1SANA 1U78A 1TWCJ 2L7MP 2NOGA 1ETYA 3IUVA 2O9LA 2YU9J 3HEFA 2GLOA 1I6HJ 3ZQLA 4MK6A 2GM4A 5K7HA 2EBIA 3D1NI 4IHXA 2R5ZA 3RKQA 1FTZA 2CUFA 1AKHB 4MO7A 2HDDA 1BA5A 2M9HA 3B81A 2UXUA 1K61A 1P7IA 5C4JJ 3QQAA 4EEFG 1ETWA 2EZLA 4MFEA 1LE8A 3KNWA 1RKTA 4UUSA 2LD5A 5IYDJ 4W97A 3HIMA 2YS9A 1QPIA 5IP7J 4GCTA 2R93J 3JRAA 2R5YA 4M3BA 4JP0A 1VI0A 2UXHA 2IU5A 3VW1A 2Q24A 1IC8A 5C4YA 2VPRA 4ICHA 3LSPA 4G12A 3JRCA 1MSEC 1IDZA 1UMQA 3G7RA 1RKWA 5M3MJ 2DJNA 4IHYA 2PMZN 2R5YB 1B8IA 3JRIA 3FISA 3V78A 4CYCA 5EGOB 2CQQA 2E19A 2XPVA 1AU7A 5D19A 2FBQA 2UXPA 1IG7A 1IGNA 1ETOA 3BTLA 2DMNA 3ZQHA 5CW8A 5F0HA 3C07A 3S14J 1FIAA 1RETA 5H9TA 5M5XJ 2H1KA 4A3CJ 4JKZA 1F36A 2P81A 2OPTA 3KKDA 3Q0UA 3PO2J 5F0FA 2CQXA 1JTXA 2W48A 5C4XJ 2WUIA 3BJBA 5K7ZA 2DMPA 2VKVA 1JKPC 4D5CA 4JYKA 2ZCNA 1U9OA 2NVXJ 4C3IJ 4IHVA 2HXIA 1BL0A 3C2BA 2YVEA 1JKRC 4A3DJ 1ZKGA 2WV1A 1MBGA 4NELA 2DG8A 3LWJA 3VVZA 2Y2ZA 4W1UA 1UI5A 3CRJA 3BG5A 3LOCA 2Y9ZA 4XRSG 3MVPA 3ZOBA 3Q0VA 4QSHA 3DEWA 4NDLA 1FIPA 3JRBA 4GCKA 1MNMC 3ON4A 3HGGA 5FMPA 3KZ9A 2HKUA 2DA5A 1YRNA 3VW2A 2NVQJ 2TRTA 1EF4A 2X6OA 1B8IB 2GFNA 2MSYA 4JX5A 2NX4A 2CU7A 3IV5A 2KDZA 5EFYA 4AC0A 1QVTA 4QIWN 3I4MJ 1O4XA 1OFCX 1Z0XA 2DA1A 3HBLA 1JT6A 2L9RA 1QRYA 3H3VK 3BR2A 3BR5A 3BNIA 3BG3A 3V6GA 3I4NJ 3Q3SA 3RQIA 5FGLA 3PPBA 3BTJA 3VPRA 5GPCA 4M3GA 4DZPA 2NVYJ 1FJLA 2COBA 2OF7A 5EEAA 4UUSB 4IHWA 3LSGA 1ENHA 3JSJA 2DA3A 2VKEA 2XGEA 5F0CA 1YRNB 3A01B 2R92J 2DN0A 2AO9A 3VVYA 1I3QJ 3RZDJ 4BKXA 4X6AJ 5JLWA 1IRZA 5F08A 5IOZA 3OOUA 2PZ9A 3BT9A 4D7MA 1GVDA 3HTHA 1GDTA 4CGRA 3ZQIA 3FIWA 1Y1WJ 4DW6A 2KT0A 2WB1N 1UHSA 1CQTA 3S2DJ 3G1LA 3BR1A 3WHCA 4FE7A 3CDLA 5EG0A 4MXMA 5EGOA 4B3AA 1WH7A 1OJLA 2NS7A 2O7OA 1PUFB 4M3FA 5D18A 5F1JA 5K7FA 3TW6A 2JA8J 1ZR2A 3A01A 2CRGA 4MFDA 2QF7A 3Q0WA 2HOAA 4A93J 1LFUP 5IPAA 3F0CA 2ELKA 4X1EA 4YZEA 1RESA 1ZGWA 1T33A 2X48A 2L0KA 3G1OA 3JRGA 2DMQA 4UUTA 5E3NA 1Y1VJ 2IEKA 3NPIA 2K9NA 4BBRJ 4V2FA 1ORKA 3GTJJ 2QKOA 2ID3A 3S2HJ 4AC6A 3VP5A 4FISA 2NS8A 2Y31A 3S17J 4RDUA 4M3EA 1PUFA 1G2HA 4GFLA 3HGYA 5C44J 1Z77A 2MG4A 3O60A 1B72B 2D6YA 5EF6A 2HXOA 1XS9A 3BTIA 4IEJA 2HYJA 1HLVA 1HF0A 3BQYA 3NARA 1AKHA 3VVXA 1MSFC 2XGDA 1TC3C 3HKZN 5EZHA 1IDYA 5EG0B 1HOMA 3G56A 2VI6A 3E7QA 2X9DA 1ZTRA 4AUXA 5J1YA 2G7GA 1U8BA 2LR8A 1P7JA 3ZQGA 1R9TJ 3S5RA 3O8GA 1SFOJ 2RASA 3AQTA 2JJ7A 1U9NA 3GTPJ 4L62A 3BR6A 1JJ8C 3MNLA 3RH2A 2NP5A 1ITYA
chains in the Genus database with same CATH superfamily
3VSLA 3P9CA 4ZYAA 1MMGA 1MZBA 3V8LA 2ZNZA 3M1CA 3OOPA 5M3FJ 1JE8A 2IS4A 1NTCA 1R1VA 2AQFA 2HYGD 3HTIA 1XD7A 1FOXA 4UUVA 5CVRA 2FE3A 2XPWA 4AIHA 3PO3J 2D2WA 1VQ4I 3OYFA 4BQAA 2WTEA 3MMYB 3ZMSA 2JA7J 4V2GA 2DLLA 2HPIA 3ABKH 4HF0A 4V19K 2G7UA 1KYWA 2H94A 4AWXB 2MLKA 3IWZA 4U88A 1P92A 2WBMA 4JX4A 4XK4A 1D0YA 3PSFA 1B9MA 4BYYA 3E6CC 1D0XA 5D8KB 3IAM2 1LFPA 1OCRH 1K78A 2ME0A 2F4MB 5JVGF 4A5MA 2BY3A 3ZXSA 3CCEI 3RPUA 2IVMA 2MGQA 3NAUA 2HVRA 2CW0F 3DCFA 3KE2A 5C3EJ 5FB2A 1YW9A 4UHTA 2CGPA 3I59B 2ZO4A 2KZVA 3QOPA 2QIBA 2JRTA 5KHDA 4HX4A 2A69F 2E5ZA 2DK8A 2HDWA 2V1XA 3F6VA 4FX0A 3TQNA 4KNYA 2XKPA 1SFKA 1VFCA 1YQAA 3K2AA 4IJAA 4JK1X 1BR4A 2NVUB 3QAHA 3BP8A 2AXLA 3F22A 1J59A 2Y48A 2QBYB 5F6FA 2EA4A 2ELJA 4DBQA 4BE1A 2DDAA 5CVJA 3JRDA 1JGGA 2JTVA 4ZJZA 3CCYA 2A68F 2XDVA 3W3CA 2R0QC 3LL7A 3QYBA 4RB1A 2G0EA 3IP4B 3HOYJ 4UY8I 2UXIA 4ZDPA 3GCMA 3PFYA 5HSZA 4AIDA 2JA6J 2BZTA 1V5FA 4B47A 3BHQA 3WODF 3ZR8X 1B4AA 4F3QA 2DA7A 3K4LA 3BTCA 3IAS2 3PIPF 4KT5C 3LSTA 5HDNA 3BCGA 1J09A 2ME6A 5JHFA 1Y56A 3WU1B 4TV7A 5B66C 1PDNC 4B09A 3PM1A 3LAJA 2ESNA 5EJCA 3LHQA 1G6NA 3ZN1A 2B0LA 2DOFA 2X1EA 1TWHJ 3FKJA 5E20A 3HOWJ 4BY7J 4A3EJ 1FEXA 3DWLE 4B4CA 3REOA 1WRJA 4HQEA 3HUGB 2ZJPF 3ABTA 2CUJA 4QLCU 1J0RA 2L4MA 1KQ9A 3RJPA 2LKXA 4KYWA 1BR2A 1IN5A 4Z6YA 5FLMJ 2DOAA 1KA8A 3EUHC 2PMHA 1T39A 1KU7A 2E1NA 1WGXA 3IWFA 4IRHA 4IO9F 1PYVA 1X4PA 2LYCA 5BQTA 3ZRGA 1MW7A 3GXOA 3QPLA 1XDSA 1U2WA 2Y69H 1QZYA 1LPQA 2GZWA 1W0UA 2Z5UA 4ZYDA 3CF5F 2EFWA 3CC2I 2REKA 2IGKA 3DPLC 2GXGA 3GVAA 3CLQA 4RAGA 3K6GA 1S7EA 4BJ6C 2I5UA 2A3SA 2Y9YA 2O6GE 4DYRA 1W36D 2EZHA 1TWAJ 1MBEA 3BC8A 2M45A 3LA7A 3M1EA 2QQ8A 1Z21A 4E7HA 4MQVA 5JHUA 3JR9A 3NNRA 3TW7A 2EV6A 5ERIA 1S7AA 2FXAA 1WWXA 1J9IA 5KNLA 2JPCA 4Y7NJ 3ECOA 3I53A 5H6RA 4HBLA 1QZZA 2H6CA 2WY8Q 5B1AH 1TNSA 2LLKA 5LGNA 1REPC 1XCVA 2DQRA 4B43A 1WJAA 4WXHA 3RKXA 5IYBJ 1ZR4A 1T8IA 3IKVA 3I0TA 4RGSA 2G7LA 2L5QA 3LSJA 4PJMA 4CO8A 1I5ZA 2NXNB 1XSXA 1V54H 1ZQ3P 3HOVJ 4C2MJ 4D7NA 4U7DA 2WB1A 4Q48A 3I4PA 1XGOA 3ABLH 4M9SA 3ZQCA 1X19A 4PSWA 4A2UA 2G9WA 2GWRA 4AF5A 1UAAA 2RGVA 4Y52J 1VNDA 3S3OA 1TL8A 1D0ZA 4P55A 3PUFA 2PMUA 1BI1A 3C1DA 3MKLA 3EETA 1FNNA 2OD5A 4JQFA 4P9UA 1HSTA 2CQKA 1OCOH 3VYSB 4OMYA 2HQAA 4RGUA 4UV9A 2DG7A 3E0JB 1QZEA 4IXAA 3OS2A 1Y0NA 1Z05A 4X0GA 4MEXF 2CV1A 2OBPA 2JA2A 3HDDA 4MTDA 3P5JA 5DS9A 1RPWA 2R7TA 4LK0F 3WU2C 1LDDA 2R7WA 4HRIA 2HI3A 2RAEA 3HIFA 4GRIA 3LSHA 2JA5J 4KWAA 4FTHA 2GOXB 5ICEA 1ZG1A 2AHQA 3ANPA 3F21A 2FNPA 3GFIA 1LNWA 2RKHA 4HKUA 2ZKZA 2VPLA 3L2VA 1OQYA 4WF2A 1RR8C 4EM2A 2KJCA 4MNUA 1IV6A 5CXGA 3F3XA 3H9JA 1IV8A 2RDPA 3SFIA 2JPBA 2XSDC 2UZKA 2CQ7A 3WE2A 4HEA2 5BS6A 1ZRCA 5DD8A 1W4MA 1TWCJ 2WAQA 4E4HA 4HSRA 2O5RA 3IUVA 4XLEA 4HNUA 4HX8A 1FC3A 4N4OB 2GM4A 1VQ5I 3SZGA 3M8FA 3HTSB 5J6XA 3QWLA 3SZPA 2UXXA 2E5NA 2Q2EA 1TQMA 1RIOH 2KMUA 2OCEA 4XQFA 2HU9A 1L3LA 2VC1A 2LY2A 1FP1D 4P9FA 3NS4A 4ZYGA 3QQAA 5KK1A 2EZLA 4F93B 2LD5A 3LWFA 3HIMA 1QPIA 2BY1A 3OYHA 5IP7J 3TL4X 4GCTA 3JRAA 1FBSA 4AIKA 4PUSA 3GFMA 4YIRX 1VI0A 2K9MA 1BC8C 3RSNA 2GQQA 4KJZA 2NS0A 3VW1A 2Q24A 3ZP5A 1X1DA 2M4KA 3H36A 3H3ZA 3K10A 4BAYA 2VPRA 3I9V2 4LG0B 1IXSB 3LSPA 1UELB 1MSEC 1IDZA 1QBJA 2LRDA 4I0AA 4CDGA 4KISA 2DJNA 2PMZN 4A6DA 2R5YB 1B8IA 3ECHA 1W7PA 3V78A 2E19A 4ON0A 3HUGA 4FX4A 3U2RA 1AU7A 1IG7A 1IGNA 5D19A 3VYRB 3ASNH 5CW8A 1FIAA 5H9TA 2G7HA 5TISC 2JSCA 2P81A 2W1OA 3Q0UA 3Q5FA 2CQXA 1JTXA 3BJBA 2HPMA 1JHHA 2VKVA 1JKPC 4WXDA 3HJEA 4JYKA 2ZCNA 1SC7A 1H9GA 4HSTA 3RDIA 4XLPF 2HXIA 3C2BA 3P7NA 4XORA 2CYYA 4DIQA 1JKRC 2ZFUA 3CCQI 1K7AA 2KRHA 4E7SA 2OA4A 3MVPA 3RKYA 3ZOBA 1HW5A 3Q0VA 4LFUA 4QSHA 4C2UA 4OIOF 3KZZA 3HGGA 2XAQA 2IGNA 3QU3A 3HSEA 5DUIA 3HZJA 1S9HA 2NVQJ 2X6OA 1ULYA 2QKLB 4JX5A 2DK5A 1I39A 2ELHA 4F7ZA 2MC3A 1QVTA 4PJNA 3OYLA 2OV7A 3CCVI 1O7FA 1MMAA 1Z0XA 5A2QK 2CQNA 3BR2A 3BR5A 1KU9A 5CVIA 3EQLF 2KQRA 3RYPA 4RB2C 1RRJA 2Z33A 3FBIB 3RQIA 4J00A 3E97A 2F5DA 3VPRA 5GPCA 2RNGA 4HDUA 4M3GA 1N78A 4M71A 4ZTJA 1FJLA 2OF7A 4UUSB 2KISA 5TRDA 3JTGA 1OLTA 2FA5A 2XGEA 5F0CA 4WK8F 3H92A 1YRNB 3A01B 2AO9A 4HA8A 2KIQA 4BKXA 4L0YB 4I09A 5JLWA 6PAXA 5F08A 1IRZA 2A6TA 1MMDA 3OOUA 2PZ9A 2KIUA 4D7MA 1GVDA 3TO7A 2YX7A 3KEYA 4ZTFA 2HKOA 3DPTA 3FIWA 3FF5A 2E35A 4B44A 3LAPA 3M9AA 3DEUA 4KITB 3DU6A 3HL2A 4I02A 1Y8RB 3BR1A 3FBNB 1QQIA 3L09A 1G3SA 4IOAF 1DUXC 4ZDLA 4N4NB 1T98A 5FO5A 3BDDA 2QF7A 1Z6RA 2BYVE 3PNYA 2DFHA 5IPAA 5FLXK 2QSHX 3E6DA 4X1EA 1XSDA 1RESA 2FUG2 1ZGWA 2LMDA 3VFZA 1T33A 2AQEA 2X48A 1LEAA 3G1OA 1DPRA 1FSHA 3LFUA 4HAMA 2K9NA 4ESJA 4Z2YA 2ADUA 4AC6A 3OYCA 4BDZA 5K5QA 1ZYRF 3G2BA 3S17J 3GZ5A 4RDUA 1G2HA 4IQJA 1Z77A 2O0YA 1B72B 3DTEA 2QKMB 5EF6A 2HXOA 2ZJRF 4EGZA 3C2GA 2HYJA 3ULQB 3NARA 2DT7B 1ZAOA 2KP6A 4LGWA 4DJAA 1MSFC 2DYSH 4HPQA 2XGDA 3HKZN 1FP2A 3WGIA 3RQ4A 2VI6A 3FZVA 2X9DA 2ZMEC 1W5SA 5J1YA 2R7UA 1R1UA 2O3FA 3O8GA 4AVPA 2JJ7A 3MZHA 1U9NA 4MGRA 3E5QA 3VSKA 2HEOA 1JJ8C 2VOPA 1YIOA 2EIMH 2K9LA 1UG0A 1ITYA 4AIJA 5E3OA 3GMEA 1USTA 2CO5A 2ZC2A 4L9VA 1H8AC 3V42A 1YO5C 1OMIA 2XAHA 1MD0A 4EJVA 2KIMA 4ETSA 3CJNA 1YFHA 3CMYA 3DU5A 1APLC 3HM5A 4XKWA 5J4VA 3A4CA 2L01A 4YFXF 4HV6A 2M1BA 1S29A 3VOKA 1K79A 2LG4A 2LKSA 3ASOH 1P4XA 1YE9A 4CCOA 3DFGA 1Q1VA 1YIJI 1PP8F 3CDHA 1BIBA 1BR1A 1USSA 1XGNA 1W5CC 1MBJA 5BOXA 1NK3P 2Y0SN 4R8HA 4Y33A 2Z1DA 2Z9OA 2HOSA 2CW7A 4XICA 2ZB9A 5J40A 1XDUA 2OQRA 2KL4A 2K3FA 5HAWA 5GTIC 1ZLJA 1TWFJ 1WQ2A 3ONQA 1JJ6C 2H8RA 3FMQA 1ZLKA 2M4GA 2V26A 1R4MB 3KP4A 1D3YA 2L7FP 5CVUA 3OSGA 1JT0A 3VODA 5DYMA 3ZMDA 1RR7A 2M5WA 1T2KA 3GEUA 2QWWA 2XDNA 1X2NA 4A3JJ 2FMYA 3LSIA 3BY6A 4XR6A 5DUKA 2NVTJ 4A69C 5L3EA 3J81K 1TWGJ 3FXRA 4PXIA 5CKTA 3PASA 3LSRA 2BVMA 1MH3A 3LA3A 1C0WA 2CUZA 2OERA 2FF4A 4GFKA 2LBFB 1MBFA 4GFBA 3LQQA 4CA0A 4XOTA 3FHZA 4WIBA 3PNTA 1BOAA 1ZK8A 1F1ZA 2EQRA 1YLFA 2XF5A 2L9SA 3W6VA 3WTYC 2CJJA 3S16J 1IO2A 4KICA 4I0BA 2W25A 4KIBA 1SFUA 2GA1A 3VYTB 4NQWA 3J7AY 4KIGA 3DBRB 3LMMA 4G9YA 4XIDA 1GT0C 1XC5A 2DXIA 3WTSC 3EUKL 2LY9A 4B8XA 1SFEA 3R61A 2BHYA 1VQPI 5J8CA 4QPOA 1HC8A 2QWTA 1T0FA 1DGRM 1HA8A 2WV0A 2HQ5A 4R79A 1XMKA 2IGMA 1W1WE 1DU0A 1MNDA 1FWZA 3M8JA 1LJ9A 1R5GA 2BV6A 2COMA 2ZCXA 1B72A 1NHAA 3V7RA 4XONA 4ACIA 3H3UA 2LDUA 1O3RA 4PGGA 2JMWA 4M6VA 4FT8A 3V7CA 4E6KG 2D1HA 3HOSA 3RPUD 5FKMA 2E2IJ 3CQZJ 3QYEA 4L0ZB 3E6BA 4ZC3A 2R5ZB 3NEUA 3SDGA 5DCMB 3K4BA 1IF1A 4O3MA 2QENA 3QU6A 3OYAA 3CCLI 4JBAA 2V1DA 1ZGJA 3T0YA 1WCMJ 4PGHA 1G8XA 2VUMJ 4QTRA 2N8GA 2RV8A 3RYRA 4DNCA 2Y75A 3AG2H 3CP2A 2NNNA 5GP9A 3VIBA 1MH4A 4LITA 2VC0A 5TJJA 3E1SA 1VQ9I 1GV2A 1BI3A 1E0EA 2M34A 2ZFWA 3M3YJ 2DDBA 4YIIA 1QHHD 5FKKA 4JX6A 2F5CA 2XPUA 3DKXA 1J5YA 3K4JA 1CGPA 4OIPF 5ILSA 2QEXI 1MMSA 3NXCA 1I6XA 1HDDC 2F4OB 2PQ8A 3F72A 4IVNA 4ME9A 1W7PB 2EH3A 5HNHA 2D5VA 2OU2A 1I1SA 1VQLI 4LOCA 2V1NA 3R0AA 1HSJA 5K5OA 5IOYA 1UI6A 1BW5A 2LFBA 3CWRA 2DMTA 1Q1HA 2ZCWA 5HLHA 2BOLA 4UDSA 1BM9A 2KPMA 4YFNF 1K4SA 1S7OA 4I01A 1LUJB 1ETKA 1Y6IA 3DBHB 3MN2A 1E3OC 5CVVA 3AG4H 3HTAA 2M8GX 4D1QA 4S0HB 1X2MA 4RLQA 2OTLI 4RGXA 1A35A 1XGMA 2C6YA 3K1PA 3OL3A 2PG4A 4DYQA 5D5VB 2ECCA 4FE4A 5EDNA 2RN7A 1SD6A 1A6QA 1QPMA 2WAFA 3EUPA 2X6YA 3I54A 2BW3B 4GCLA 1EV7A 2LY1A 3H1CA 5FGMA 3MAJA 4BEHA 2R7VA 1WH5A 3VOXA 1WSUA 1FYLA 1BJZA 1UFMA 3NQOA 3PSIA 3AFHA 1R4NB 2EFQA 2A07F 2FX0A 4PCQA 2H27A 3SZTA 3CTAA 2CG4A 2K40A 3LSKA 5FRMA 2ID6A 3BR0A 1AA7A 5DDGA 5JI6A 4BJTA 3Q9SA 2HQNA 4IX7A 2BEOA 4C2MA 3W2AA 2YUSA 5LFAA 1HDPA 1YW8A 5K58A 3DLLF 1GVJA 3FK7A 1JXSA 4C3HJ 1WI3A 2PBXA 4M6XA 3LSMA 5HVQC 1T56A 1FMWA 1H9TA 4LG0A 4KN4X 5GAGJ 1IJWC 2LBFA 2E1OA 4L9TA 4BQOA 5HODA 3EYIA 4BJ5C 3FXKA 1F9NA 1YYVA 4M6YA 5FLVA 2R3SA 3GTLJ 1W36C 4E7JA 1D1CA 5LRRA 1IZ1A 4A0ZA 3EUHA 4OAZA 1GLNA 2L2OA 3LFKA 2LVSA 3D5SC 2GXAA 1NH3A 2QQAA 4JL3A 1X3WB 1K4TA 3KP2A 2B7EA 5F64A 3W2WA 4LB6B 1JTYA 2STTA 2JRMA 2L02A 3KKCA 1BIAA 2Q2EB 2W4SA 3QPHA 2P6TA 3MZYA 5J1RA 3VW0A 4FETA 4HW0A 2KIFA 1R22A 3OYNA 3PQJA 3T8RA 1JKOC 1SANA 2K4BA 3HG9A 3O2PE 2L7MP 3P9IA 5E79C 4G7ZF 3I55I 4OINF 3KYLA 3DKYA 3CUQA 1O3QA 3I3LA 3VDXA 1I6HJ 5D5UB 3OIPA 3FXQA 4MK6A 3GLXA 4NBQA 2HZTA 2ZBKA 4D9JA 1E2XA 3D1NI 1ZRDA 3J81Z 3KP5A 3OYEA 3KLNA 2E71A 1PUEE 2CUFA 3FX3A 1WJFA 1KU3A 2DT5A 2W57A 3IRRA 1Z7LA 4S04A 2HR3A 1P7IA 5C4JJ 3CJRB 4RAFA 4GYGA 1SMTA 1RKTA 1MJBA 2W85A 2M7BA 4BE2A 5LHHA 4CCMA 3PJRA 2R93J 3O3KA 1FYMA 2EWNA 2DAOA 2VB6A 3DV8A 4JP0A 4BS9A 3I71A 1YW7A 2IU5A 3L2UA 1MDMA 3J80Z 5LRSA 2YR2A 4G12A 3JRCA 1STZA 3GW2A 1UMQA 1SAUA 3KLOA 4HV5A 2QGUA 5M3MJ 4NC7A 1MGTA 1SD7A 1U0JA 2R7XA 2M0MA 1RUNA 1S5LC 5CQEA 1WKMA 2CQQA 1G3TA 2VLAA 5F0HA 1QU3A 3C07A 2XAJA 2QQ9A 1F36A 5LGTA 4EJTA 3KKDA 3GLLA 3NWTA 1Z67A 5F0FA 2W48A 1OPCA 2ZJQF 3J7AO 5C4XJ 1Z1DA 1R5HA 4IHVA 1BL0A 2IRFG 2YVEA 2DPDA 4A3DJ 1ZKGA 2FU4A 1MBGA 3KETA 2F5FA 4YG2F 1T0FC 3EDPA 3HRTA 3H9GA 3DEWA 4XN3A 2HGCA 4GCKA 2CWEA 1TBXA 3KZ9A 2W7NA 1YRNA 3VW2A 1EF4A 3L9FA 4AM3A 4G8XA 5GAEJ 2R7SA 1BJAA 2KDZA 2LREA 4O6JA 2LNBA 2VJIA 4AC0A 4BHCA 4PFOA 5E8GA 2IA1A 5CQGA 4R1HA 2L9RA 3BNIA 3AG1H 4H4KC 3OYIA 4RM2A 1U5TB 2OAZA 3BG3A 2NNYA 3G73A 3FXJA 3GFJA 2HOEA 2LF7A 4HLXA 2VT3A 5FROA 1DGWY 4GCVA 1Z7UA 2DA3A 3F6OA 3HPHA 1R58A 1VQOI 3HRSA 2DN0A 3KP3A 5LBQA 4BQNA 1I3QJ 4OD5A 1XN7A 2K02A 4BL0B 1FOWA 2ZJ2A 2XF6A 1UB9A 1ODDA 1ZG3A 3AL0B 2VXZA 2Z99A 4U7BA 2P8TA 3FMRA 3NWSA 3OIQA 1RNLA 3ZQIA 4YEJA 1IRGA 1KQ0A 4IHSA 3VTIA 3F23A 4XOPA 2PJRB 1EJ9A 2IW5A 1HQCA 3ZPLA 3FWEA 3CDLA 1R00A 3CUOA 5EG0A 3VYUB 1X4OA 4PJLA 1V5EA 2E1MB 4BDYA 1PUFB 4M3FA 4M73A 2L7KA 5CJ9A 5K7FA 2J5OA 1DQUA 2D1VA 3IUOA 3Q0WA 2JUGA 2XUBA 4A93J 3N4MA 1LFUP 5KCMA 2ELKA 2VJ5A 3GFLA 2L0KA 3FM3A 3JRGA 2DMQA 3A1YA 4UUTA 2IP2A 1YI2I 2IEKA 3SHFA 3NPIA 4V2FA 2XHKA 2ID3A 3IC7A 1A36A 3VP5A 4FISA 4I7HA 3I58A 1PUFA 3HGYA 4FQGA 2H09A 2MG4A 3HYIA 2F6CA 3L2QA 3MEXA 3O60A 2D6YA 4OOIA 3BTIA 4IEJA 3W6JB 4KMFA 3WTWC 3K70C 2QUFA 1TC3C 1OYYA 4KUMA 5EG0B 1WZ2A 1HOMA 2DYRH 1ZTRA 4HDVA 4Q5SF 2OC6A 2DFFA 1LEBA 5DM7F 3S93A 2G7GA 5E8IA 3WTXC 2M3AA 4XLNF 4WXCA 2DO7A 1SFOJ 2RASA 4LIUA 1F5TA 2H1LA 2VBZA 1U5TC 2E7WA 3BR6A 2H8WA 4L62A 2QZ8A 3GYHX 1X1PA 1TQPA 3CCJI 3OYMA 2BXYA 2HTJA 2IAIA 1FPQA 3ERED 5E17F 4HNVA 3JTHA 1FOKA 4OWRB 3QOEA 2X51A 4G6QA 1OCZH 2DMUA 5E1ZB 4Y17A 1S72I 3BCBA 3OS1A 2MH9A 2IGOA 3CLOA 2HTSA 4GYIA 3ML6A 4DQ2A 2G7SA 2Y0SA 3TGNA 3CUQC 4BH9A 3E6MA 2ZSIB 5FD5A 3S2WA 5IYCJ 1YJNI 2JSPA 4L5IA 3HRUA 3UNGC 2OZUA 5HLGA 4A12A 2O7TA 4ZYEA 3NRGA 2UUZA 3HOUJ 2E1MC 1ZHFA 2WC2A 4OU0A 1TLHB 5M5YJ 3GZ6A 1FT9A 4BU2A 2EV0A 3FMSA 3FXUA 4A3KJ 4M3DA 1A04A 1XMAA 3BOQA 2M7AA 1ZGAA 4B3XA 2K9SA 4J19A 3QP6A 1AHDP 3CP8A 2HYTA 2HVSA 3SDBA 1ONVA 3F1BA 3SWHA 1XG1A 3LQRA 1H88C 4BNCA 3WTTC 1I27A 5FFZA 3HOZJ 4F55A 4IKFA 4AYBA 1QVUA 2VBXA 5B5EC 2VODA 2JN6A 3GF2A 1IUYA 2FSWA 4HF2A 4G6TB 3N05A 4EJUA 4A3FJ 2DJIA 4IRGA 4A3BJ 2Z3YA 5F04A 4CCJA 2XASA 2F4IA 5IY5H 1V4RA 4L18B 3HRMA 1F43A 4NN1A 4HYEA 4I76A 1EA3A 3S15J 1O7LA 2V6EA 2L3DA 2XGXA 3CO6C 3OSFA 3GTOJ 3MKZA 1TW3A 2XAUA 5E3MA 4HZFA 2VOOA 1H89C 2E2HJ 3TP0A 2L54A 4I6ZA 2QSGX 3S1QJ 3CC7I 5AQCA 5D4SA 3OY9A 3QYFA 1GV5A 5KAFC 2LH9A 3KIOA 4KFCA 1FOYA 4RAZA 3H0GJ 1X3UA 3ZMUA 5GPAA 1CF7A 4E7LA 4UVCA 3O6BB 3TDUC 2QCOA 1QGPA 1P9QC 2DTZA 3BQZA 3HE0A 1BW6A 3CMEI 4BEHB 3H0DA 4IPAA 3CC4I 1S6LA 5CXIA 2JWTA 2WADA 1SD4A 4NC6A 1HKQA 4B1RA 1FBUA 1QO0D 2EA2A 2HWVA 3D5RC 2NP3A 5LGUA 4GO1A 3PIOF 2QOPA 1WVRA 3U21A 3L2RA 1A31A 4A3MJ 1OCTC 2MH2A 2LF8A 3ZN0A 1J75A 3RD3A 2OCCH 4XLCA 3WGHA 4QPQA 2XV4S 3MFKA 3E7LA 2EZIA 4EV0A 1CF7B 3T6NA 3X2QH 3TBIA 1RZ4A 4RM3A 3OYGA 2ZCMA 2VJ4A 5DCFA 1YS6A 4YELA 4CCLA 1WJEA 1KZHA 4A0YA 4ASNA 4CSWA 5D6FA 3NI7A 2L9VA 2EFPA 3WTZA 2IA0A 2P4WA 4XLHA 3KX2A 5FJ8J 1WPKA 2ZXIA 5LHGA 1OR7C 3AKZA 3QPSA 3OYBA 1W0TA 1JGSA 1XB4A 1NG7A 3DTIA 2HS5A 2CS3A 3WHBA 2VE8A 3GZIA 5IT9Z 2DA2A 4FCYA 4LIVA 2DCEA 2QA4I 5J3LA 2YVHA 2GAUA 3PUBA 2GXBA 5AONA 2XRNA 3UR3C 1TT0A 3IH4A 4KT6A 1T38A 4M74A 3M8EA 5BNGA 2MA3A 2MW8A 2HZDA 5HS8A 3GTQJ 5FKLA 4JOMA 1R23A 3LNQA 2L4AA 2UXNA 3C7JA 1WJCA 2ZNYA 2FMLA 1P2FA 2HVQA 3FHNA 4A5NA 4M72A 4OAYA 1K6YA 4XRMA 3GTMJ 4AYBN 3CCSI 5EEHA 2R7RA 4F52A 3HKZA 1YJWI 1WJDA 4DVYP 3P9KA 4NB5A 1R71A 2HOTA 2K3PA 1D1BA 2ZXHA 4EMSA 2V9KA 4EQQA 3B6AA 5D1RA 4C3JJ 2B1EA 5IP6A 3F8BA 2PI0A 1UJ8A 4KMUX 1ZARA 4AD9A 2ZOZA 2DOEA 4XLAA 1R5ID 3DPJA 1B1BA 3ABMH 1JUPA 2GIZA 4EM0B 3K69A 4QWQA 3EYYA 5J1UA 3D5LA 4DZJA 2DA6A 4D0PA 1DP3A 2M0CA 2CH0A 3BPVA 1K83J 1VF9A 1YG2A 3MWMA 1U6GA 2ECBA 3KP6A 3TDZC 3HTJA 4I99C 2LK2A 5HS9A 1Z6TA 2M2EA 4ITVA 4MEYF 2D45A 4ABZA 5DCMA 1Y39A 2RVCA 2MFZA 1UG2A 1DP7P 1U5TA 2BHZA 2VIXA 5F27A 1S3JA 2VN2A 2F07A 2V1UA 2FJ1A 5ED4A 1SVLA 5D5XB 1J7KA 4E7KA 5K5RA 1VZ0A 3WTVC 1PP7U 4FHTA 4HQMA 2CW8A 4UXNA 2I8DA 5LEJA 1JKQC 1IN6A 5D8LB 1AOYA 5FKNA 5M5WJ 4BXXJ 2OZ6A 5DEQA 2VBWA 2E1CA 3BZKA 2VQGA 1GXPA 3PNVA 2P5LC 1X1AA 4B48A 5HBUA 3L1PA 3JCUC 2K7LA 2O03A 1G3WA 3Q9VA 2RC4A 3H5RA 3EGQA 1I1GA 3LA2A 2W53A 2V57A 2MABA 4CHUA 3W6KB 2K9QA 2ZXJA 4M9XA 1XPXA 2E36A 1G4DA 2JQ7A 3OS0A 2XC7A 3TMOA 2PX9A 1MBKA 1UHMA 3C2HA 3FKIJ 2CSOA 3SEZA 4XKVA 1W5TA 2GA2A 2NOGA 4I98B 1ETYA 2YU9J 1UZCA 1IN7A 4ZZLA 1T08B 3KFWX 3OL4A 4CH7A 1X1CA 2HYFA 1MDMB 1SMYF 3F9KA 3RKQA 3M07A 3MZ8A 1AKHB 3KEOA 2HDDA 3B81A 3ABUA 2M8EA 2YPRA 2A6HF 3HHGA 2WAEA 2OTJI 3BCAA 4XL9A 1K61A 4GDFA 1EH8A 2BY0A 2ZSHB 2UXUA 2IS2A 5DM6F 2IT0A 3HSFA 4MFEA 3V8KA 1LE8A 3KNWA 3SQNA 5IYDJ 2MC4A 2YS9A 2BGCA 3L00A 3BLYA 3GWZA 2R5YA 4M3BA 1JHFA 2FOKA 2JVGA 4CUGA 1LVKA 1ZREA 4RB3C 3RTRA 2BVLA 5FFXA 2EINH 1IC8A 2PEXA 5EEGA 5C4YA 4G6DA 2QM3A 3BG7A 4ENMA 3G7RA 1RKWA 2A05A 2VKHA 2ZY9A 5HDGA 1Z91A 3I5UA 4N9IA 2IJLA 2XKOA 3S8PA 2OJED 2QSFX 2XPVA 2J5PA 4PFPA 2UXPA 4LLNA 3BZCA 3R0JA 2DMNA 2DBBA 1W7PD 2NRAC 1ZELA 1RETA 3SYTA 2H1KA 4A3CJ 4CGZA 4G7HF 2OPTA 5JVTA 3F8FA 3HC7A 3PO2J 4U0WA 3RCOA 3G3ZA 2NVXJ 4C3IJ 3K4CA 1RI7A 4Y4RA 2WV1A 1FX7A 4NELA 2DFEA 2DG8A 1YTYA 3LWJA 3VVZA 2Y2ZA 4N0BA 1UI5A 2PLYA 3CRJA 4ZYHA 2Y9ZA 2FJI1 4XRSG 5HS7A 3K1MA 1FIPA 3QPTA 1MNMC 5F1RA 3K0LA 2VQHA 2V6CA 4BUPA 3H5AA 2BBYA 1YX5A 2TRTA 4NHJA 1PJRA 2MSYA 2NX4A 3IV5A 1O57A 2DFIA 2UWMA 1YJ9I 5EFYA 1B9NA 5H2FC 4CICA 3VOEA 1EH7A 4BXUA 2O61A 5FLXZ 3CZ6A 5D5WB 1TQIA 1KONA 3IKTA 3Q3SA 1VQMI 4PSXA 3PPBA 1RC9A 2NVYJ 1Y8QB 4N9HA 3TKYA 2VE9A 5EEAA 1HKSA 3HPGA 4AU7A 5L3CA 3K4KA 4IHWA 3E3VA 2DQLA 2NYXA 4IRVA 3RZDJ 2OUMA 5BMZA 3T5XA 2VBYA 1HW2A 4BGDA 3H5NA 3HTHA 1VQKI 1L0OC 1KYZA 3JSOA 1Y1WJ 2A5YB 1ERDA 3V8JA 1UHSA 3S2DJ 3HHHA 2X1DA 3G1LA 2YX4A 3WHCA 2KKOA 4EVIA 2WWYA 5EGOA 1OJLA 1WH7A 2NS7A 1VQ6I 1LKXA 4E7IA 2JA8J 2ESHA 1ZR2A 3A01A 2ICWG 5FD6A 2RQQA 1V5GA 3L2WA 3MD2A 4UNOA 4L9NA 3ZQQA 5A2QZ 4OIRF 3SEQA 1SEUA 3QRFF 2IA2A 5E3NA 1OR7A 2F5EA 4KIFA 4BBRJ 2VASA 1ORKA 3GTJJ 3WTUC 3S2HJ 2QKOA 5ILUA 4XLFA 2NS8A 4RB0A 4CZCA 4HNTA 3PQKA 1DDNA 3MCZA 4M3EA 4Q4ZF 1IRFA 5GADJ 5IT3A 3DXJF 2IXSA 3MKYB 2Q8KA 4XKCA 2A61A 3G71I 1GXQA 5TGTA 3DPUA 3TOAA 1HF0A 5KVRA 2M87A 3FXMA 3G4SI 3VVXA 3L7WA 5EZHA 3B02A 3G6EI 2XROA 4C2TA 4CXFA 3E7QA 4RA2A 4AUXA 3M7GA 3GX4X 3FM5A 1MJ9A 2LR8A 4NNJA 5HLIA 3J7ZI 2KLOA 4YFKF 1U8BA 3A2KA 1R9TJ 1BI0A 4G7OF 3AL0C 2Y0MA 5GTHC 3AQTA 2KRCA 3JW4A 2JT1A 3A0HC 3DKWA 3MNLA 2NP5A 1G3YA 1I3AA 2XSJC 1NG6A 2M30A 1LQ1A 2DODA 2ETHA 2XB5A 3K4NA 5CPRB 1Z3YA 3ZGKA 2BE5F 4OD4A 1WHUA 2HNHA 3O8HA 1DPUA 2VXDA 1R36A 4O5VA 3IHUA 1BI2A 2W82A 1ZN2A 2PFVA 9ANTA 1ZRFA 3MQ0A 4PJJA 2XAGA 2GENA 2F48A 1HCRA 4LMYA 1U8RA 3GEZA 1U3EM 1IXCA 1KGSA 3A03A 1TZLA 5H6QA 1BC7C 3HB9A 2P0WA 2MLGA 2QYOA 3HOTA 2O8KA 1OCPA 2LKPA 3UKGA 2GUHA 5FKOA 3CCMI 1GHCA 4KA4A 3QBMA 1ETXA 1BBYA 5EYRA 4DYCA 1QHGA 2MBFA 1LB2A 5ICFA 2XRLA 1JUSA 1T6SA 3B6CA 1OCCH 4ESBA 1ACIA 2ISYA 1VQNI 3P9TA 3E5XA 4Y15A 4G94A 4RS8A 3JREA 2DTRA 4BY1J 3TEDA 5DAJA 1TNTA 1XMXA 1MKMA 1K78B 3BRUA 3IH3A 2IS6A 4K2EA 2A6EF 5L3FA 4MHGA 4II2A 4BBSJ 5JLXA 1BOBA 4U0YA 4NC8A 3K7AJ 4PJ0C 2QLZA 4LB5A 3IH2A 4CZZA 3TO9A 4RLFA 3S32A 2DPUA 1IUFA 2K27A 1IAWA 3QKXA 2WAQN 3ISPA 3K9TA 4UB6C 5HOOA 4I2OA 2CV2A 2FD5A 3DTKA 1NK2P 3CJDA 2PFBA 1VQ8I 4U9LA 1R7JA 1MIJA 1MNEA 3SJMA 4ENKA 2OQGA 4A3IJ 1D8KA 2LSOA 4MTEA 3CCRI 2E60A 4A6EA 2JZYA 1DU6A 2JK3A 1LVAA 1B59A 2XGCA 1ETVA 5H20A 4IRIA 3V4GA 2FBHA 2EILH 3OYKA 1LE8B 3BR3A 1SAXA 2R7ZJ 3IRQA 2K4JA 2UV1A 4HOBA 4IL6C 1Z9CA 3COLA 3OIOA 2KHMA 1FYKA 3ZQ7A 2TDXA 2KFDA 3U9GA 2F2EA 2FEZA 4NQWB 1P4AA 3CF2A 4L5EA 4L9JA 3HOXJ 2BXZA 4S05A 3F8CA 3T1BA 4ZDOA 3OMYA 3TOBA 2CV0A 1HKTA 2RNJA 4EM1A 5E3LA 2VL8A 1YX3A 3S1MJ 3PL8A 3A02A 5D4RA 5BPDA 2DI3A 2KJBA 2P7VB 3TP3A 2STWA 2LC2A 2ZOYA 1SFXA 4M9ZA 4LG3A 5B1BH 4BACA 1D5YA 1LFBA 3AQSA 2CMPA 2W84A 5IP9J 1P4WA 2YU3A 3BJOA 4XRSA 5EZGA 2EB7A 4A0XA 1POGA 4RBOA 2RHAA 3GTKJ 1OKRA 2G3BA 2FNAA 2EZKA 3F8NA 5D6EA 4BE0A 1D1AA 2EFNA 1A5JA 3TO6A 3WU0A 2X6WA 3DQVC 1EKEA 1FMVA 3S1RJ 4DBRA 4ESFA 1TW2A 2V7FA 4MLOA 2B9SA 3GBGA 3S3MA 5FHPA 2K86A 4Y13A 4C9YA 3ANGA 3SFZA 2DT6A 4DOZA 1YOVB 3SXYA 2L9NA 4KDPA 3M4OJ 2XAFA 2V9PA 2PMZA 3IL2A 2QTQA 4WCGA 2V9VA 4E7ZA 5KAIC 1ETQA 2JUCA 2MD0A 3L2CA 2Y30A 2P5VA 1IN4A 4XMYA 4D5FA 1WJBA 4XSZF 4CYCB 3U1DA 1E3HA 1XCBA 2E7XA 1QA6A 2WY7Q 4AVZA 3ZMTA 3T8TA 3KEQA 3DLAA 3ZMVA 3DP7A 4PZJA 1D5VA 3AAFA 2LTPA 1XSVA 2EPFA 3KYCB 5J4YA 2DW4A 1I50J 1IRXA 2EIJH 4XM3A 2UXOA 3JRHA 3I64A 4NUBA 3N97A 3VUQA 4BHBA 4CCKA 1SVOA 1ZG5A 3WG9A 4IHTA 1O3SA 1MBHA 3FK6A 4MQ9F 1FTTA 2EIKH 2IBDA 4JNNA 2E2JJ 2WGBA 2RQPA 3ELKA 5JFRA 3JRFA 1B6AA 1XGSA 4IZZA 3S1NJ 2H6BA 4J01A 3OYDA 3FRQA 4IQ4A 2CUEA 2B63J 5AIPA 1FSEA 2B3WA 5LLQA 2HDCA 3RZOJ 1KQ8A 3VB2A 2A2FX 1R1TA 4Q47A 3K8PC 3K70D 2GBYA 4LK1F 4XNFA 1LDJA 1A6IA 2ACJA 1V3FA 4RMNA 4XSXF 5HDKA 1G59A 3HTUA 2IS1A 4ENJA 2TCTA 2ZMEB 2R7OA 5ILVA 1HBXG 4A3LJ 2BW3A 4EJOA 1JUMA 2EV5A 3BG6A 3JSPA 2XIGA 3FDYA 2ISZA 2Z2SB 3ZQFA 2FQ4A 2Q0OA 4DGWB 3G1MA 5CYVA 5HLTA 2P7CB 5L3BA 1SGMA 2Q1ZB 2BY2A 2NAZA 3CJQB 3RIRA 4E70A 2I10A 5HNFA 2XB0X 3BROA 3U1KA 2OI8A 4LLGF 4YRVA 3FXLA 1N75A 2A5WA 1BN5A 1X58A 2X1CA 3CUQB 2KZGA 3K2ZA 4Y3OA 4ANJA 3GTGJ 2DA4A 3LJLA 3QP5A 5DTDA 4P5OA 4RAYA 1GUUA 5DD4A 2LP0A 4EATA 5J8FA 2L7ZA 3DBLB 1PVEA 3CJTB 5BPIA 4F92B 4A3GJ 2GOMA 3OYJA 2LOOA 2K5CA 4OMZA 3JAMZ 2VKDA 2DU9A 2PN6A 1QNTA 4U0VA 3BG9A 4RGRA 3K4MA 1HW1A 1YS7A 3S3NA 2W24A 5B3SH 4ZZDA 4MIMA 3JAMK 3OWTA 2P5KA 1U78A 3W2VA 5LD2C 1SD5A 2O9LA 3HEFA 2GLOA 1UCRA 5L3DA 3ZQLA 2HKXA 1EH6A 1FLIA 3BPXA 5K7HA 1R49A 2EBIA 1OISA 5LEKA 3FXOA 2QQBA 3CESA 4EJWA 1S8NA 4LJZF 4IHXA 1SVMA 2EJRA 3QODA 2VJJA 1HXDA 2R5ZA 1FTZA 4H0EA 3NRVA 4MO7A 3MKWB 1BA5A 2M9HA 2K85A 2IPQX 2FRHA 1E17A 1T95A 2W00A 3KP7A 1WFXA 3ESWB 4PK4A 4UVBA 1ETWA 4EEFG 3ON2A 4UUSA 4PDKA 4UV8A 4W97A 1MJAA 5L3GA 3VWBA 1K6OA 1IXRC 1R6RA 3WG7H 3K1NA 3R60A 3DEEA 2UXHA 3RPQA 4ENNA 3WE3A 1YITI 4P1WA 4ICHA 2R7QA 2YSRA 3KCCA 4GXOA 3BZ6A 3CCUI 4IHYA 1M1EB 2X4HA 4U87A 5E1XA 3OR1C 4XN0A 1VQ7I 3JRIA 3FISA 1RUOA 4CYCA 5EGOB 3R4KA 2FOWA 4GGGA 2FBQA 1ETOA 3BTLA 3OV8A 5FRNA 1OYWA 3ZQHA 3S14J 1ON1A 5M5XJ 4CYDA 4JKZA 3EUAA 5AIQA 1LDKB 1WI9A 2HQRA 4L5JA 1IN8A 3RI4A 1TTYA 3KZYA 2HFHA 2WUIA 2KRFA 2CFXA 5K7ZA 2VONA 2DMPA 4D5CA 3RKWA 1U9OA 1TT5B 3A0BC 3HSRA 1AWCA 1Y0UA 5ICGA 4EGYA 3CMMA 2XVCA 2R7DA 3C18A 2R7FA 2MYSA 1Z3XA 3H35A 4W1UA 2VT2A 2ZMEA 3BG5A 3LOCA 5DV5A 2XF7A 4NDLA 3JRBA 3H9QA 1N77A 3ON4A 4UVAA 5FMPA 2VQLA 3I59A 2HKUA 2DA5A 5K1YA 1IW7F 1B8IB 2GFNA 2CU7A 3I56I 3GUDA 2F5VA 2JVHA 5CLSA 3ERMA 5E1WA 3HXLA 4QIWN 3I4MJ 1O4XA 1OFCX 2DA1A 3HBLA 1JT6A 2O8XA 2FBIA 3KZIC 3OR2C 1QRYA 3H3VK 4IOCF 5E18F 1O3TA 4OIQF 2NOJB 3V6GA 4CCNA 3I4NJ 3ZCOA 1WJ5A 2MD5A 5FGLA 4UB8C 3BTJA 2EK5A 3GZNB 1ON2A 4DZPA 2COBA 2ZXWH 3CD6I 1MMNA 2X85A 3BWGA 3LSGA 1ENHA 2WA0A 3JSJA 2VKEA 3VVYA 2V79A 3D0SA 1OYIA 3BJ6A 2RREA 2R92J 3BJAA 4X6AJ 4ZH4F 5IOZA 2CFOA 4KN7X 4HLYA 3BT9A 2V4JC 2VQCA 4XKBA 1GDTA 3R6SA 1KU2A 4WX9A 2AS5F 4CGRA 1N25A 4DW6A 2KT0A 2E34A 4HF1A 2WB1N 2PBIA 2Z16A 1CQTA 3J7YJ 2QBYA 5J47A 3DF8A 4FE7A 3ROUA 2P6SA 4MXMA 4B3AA 2O7OA 3CO7C 2YVXA 1TP4A 3CDIA 3GO5A 5F1JA 3VEPA 1YHQI 1D8JA 5D18A 2KDOA 2QVOA 3TW6A 3EPZA 2R4GA 2CRGA 3AG3H 3C3WA 4MFDA 4P96A 1F4KA 1VTNC 4LD5A 1E3PA 5JR3A 1X3ZB 1X1BA 2HOAA 1FZPB 3F0CA 4II3A 4YZEA 4F91B 1V55H 1H0MA 1Y1VJ 1UHWA 4HG2A 4IF4A 2FQ3A 4C30A 3PFIA 2Y31A 5ICCA 1FY7A 4YIFA 2AXTC 3KYDB 3ZMZA 4GFLA 5C44J 4FASD 5GAHJ 5LHIA 1P6RA 2GIVA 3F8MA 3WGGA 1ZH5A 1XS9A 4XBFA 1HLVA 4BQQA 3BQYA 3V7SA 1AKHA 1JI8A 2PJRA 3B73A 1IDYA 2FBKA 3G56A 4HX7A 1XX5A 4XRFA 1J2XA 2EFOA 1P7JA 3ZQGA 2X0LA 2X6XA 3E5UA 3S5RA 4BHPA 4BXFA 5IT9K 3KPHA 4U9NA 3J80K 4WWCA 1XTAA 3COAC 3GTPJ 3RH2A 4LLLA 3CMAI 1FBQA 2PJPA
chains in the Genus database with same CATH topology
2XB5A 2IAIA 5E3OA 4HNVA 5M3FJ 3O8HA 2DMUA 1NTCA 1H8AC 3HTIA 9ANTA 3CMYA 2G7SA 2XPWA 1APLC 3HM5A 3PO3J 2GENA 1HCRA 3A03A 2JA7J 4V2GA 5IYCJ 3VOKA 2O7TA 3HB9A 3NRGA 3HOUJ 4JX4A 2O8KA 4XK4A 1OCPA 5M5YJ 1Q1VA 3UKGA 2GUHA 5FKOA 4A3KJ 4M3DA 2ME0A 1MBJA 3QBMA 1ETXA 2K9SA 5EYRA 4DYCA 4J19A 2Y0SN 1AHDP 1NK3P 2XRLA 2HOSA 2HYTA 1JUSA 4XICA 3F1BA 3B6CA 2MGQA 1XG1A 2ZB9A 3NAUA 5HAWA 1H88C 3DCFA 3P9TA 1TWFJ 1JJ6C 2H8RA 5C3EJ 3JREA 5DAJA 4BY1J 3TEDA 3HOZJ 3BRUA 2L7FP 1QVUA 3OSGA 1JT0A 2QIBA 2JN6A 3IH3A 1RR7A 3GEUA 2XDNA 1X2NA 4A3FJ 4A3JJ 4BBSJ 5JLXA 1VFCA 4A3BJ 3K2AA 3K7AJ 5F04A 2NVTJ 4A69C 3IH2A 1TWGJ 4PXIA 3PASA 3LSRA 1MH3A 1IUFA 1F43A 3QKXA 4NN1A 2OERA 2WAQN 4I76A 3S15J 4GFKA 1MBFA 4GFBA 2FD5A 1NK2P 3CJDA 3OSFA 3GTOJ 1ZK8A 1JGGA 3JRDA 3CCYA 5E3MA 2EQRA 3SJMA 4A3IJ 1H89C 2E2HJ 3TP0A 3W6VA 2R0QC 2CJJA 3S16J 4I6ZA 2G0EA 3S1QJ 5AQCA 3HOYJ 2UXIA 1DU6A 2JK3A 1GV5A 2XGCA 5HSZA 1ETVA 2JA6J 4XIDA 1GT0C 1LE8B 1XC5A 3BR3A 2LY9A 2R7ZJ 3BHQA 3H0GJ 2DA7A 3BTCA 5GPAA 3COLA 3OIOA 2QWTA 3BCGA 2ME6A 2HQ5A 2QCOA 1DU0A 4L5EA 3HOXJ 2DTZA 3BQZA 2ZCXA 3PM1A 3HE0A 1BW6A 1B72A 3LHQA 4ACIA 1TWHJ 5CXIA 2JWTA 4B1RA 2NP3A 5E3LA 2JMWA 4M6VA 2QOPA 3HOWJ 3S1MJ 3A02A 4BY7J 5FKMA 4A3EJ 1FEXA 3TP3A 4A3MJ 3CQZJ 2E2IJ 4B4CA 1OCTC 2ZOYA 3RD3A 2R5ZB 3SDGA 2LKXA 1D5YA 3E7LA 1LFBA 2EZIA 3AQSA 3T6NA 5IP9J 2ZCMA 5FLMJ 4XRSA 5EZGA 4RBOA 2RHAA 1POGA 3GTKJ 1WCMJ 2G3BA 2EZKA 1WGXA 2VUMJ 3NI7A 4QTRA 2N8GA 1A5JA 5FJ8J 3S1RJ 3QPLA 5GP9A 1WPKA 4MLOA 3VIBA 1MH4A 3GBGA 3QPSA 1W0TA 5FHPA 3ANGA 3WHBA 1GV2A 1W0UA 3GZIA 2REKA 2DA2A 2M34A 4FCYA 3M3YJ 3M4OJ 5J3LA 2YVHA 5FKKA 4JX6A 2XPUA 2QTQA 1S7EA 1ETQA 3NXCA 2Y30A 1HDDC 3IH4A 2Y9YA 4D5FA 4DYRA 2EH3A 2D5VA 4ME9A 2EZHA 5BNGA 1TWAJ 4CYCB 2MW8A 1MBEA 4LOCA 3GTQJ 5FKLA 5IOYA 3LNQA 1UI6A 1BW5A 2LFBA 3CWRA 2DMTA 4UDSA 2LTPA 3JR9A 3NNRA 3TW7A 1E3OC 1ETKA 3MN2A 3HTAA 3ON2A 1I50J 2UXOA 2M8GX 4XRMA 4S0HB 3JRHA 3GTMJ 4AYBN 1X2MA 4Y7NJ 3VUQA 2HOTA 4DYQA 2ECCA 4FE4A 3B6AA 5D1RA 5EDNA 4C3JJ 1MBHA 5IP6A 3EUPA 3FK6A 1FTTA 2LLKA 2IBDA 4JNNA 2E2JJ 2WGBA 2ZOZA 4GCLA 3JRFA 3S1NJ 3DPJA 1ZR4A 5IYBJ 3FRQA 1JUPA 2CUEA 2B63J 1WH5A 3VOXA 5J1UA 2G7LA 4DZJA 3LSJA 2DA6A 2M0CA 3RZOJ 1BJZA 1K83J 1VF9A 1ZQ3P 3HOVJ 4C2MJ 2ECBA 4D7NA 2FX0A 2GBYA 2K40A 1A6IA 2ID6A 3BR0A 3HTJA 3ZQCA 2LK2A 2M2EA 4ABZA 4AF5A 2YUSA 1UG2A 1HDPA 5K58A 2TCTA 4Y52J 1VNDA 5F27A 3FK7A 4A3LJ 4C3HJ 1WI3A 2F07A 2PBXA 3MKLA 1JUMA 2FJ1A 1T56A 2DG7A 3ZQFA 2FQ4A 3G1MA 3HDDA 5DS9A 1JKQC 1SGMA 1RPWA 1IJWC 2E1OA 2I10A 5HODA 5FKNA 5M5WJ 4BXXJ 5FLVA 2HI3A 2RAEA 3GTLJ 2XB0X 2JA5J 4KWAA 2OI8A 4FTHA 1X58A 2LVSA 3GTGJ 2DA4A 3LJLA 3L1PA 5HBUA 2AHQA 3ANPA 5DTDA 4JL3A 1GUUA 2LP0A 3EGQA 4HKUA 2W53A 2L7ZA 2V57A 1JTYA 4A3GJ 3KKCA 2K9QA 1IV6A 5CXGA 5J1RA 3VW0A 3SFIA 3BG9A 2XSDC 1MBKA 4MIMA 3FKIJ 1JKOC 1SANA 1U78A 1TWCJ 2L7MP 2NOGA 1ETYA 3IUVA 2O9LA 2YU9J 3HEFA 2GLOA 1I6HJ 3ZQLA 4MK6A 2GM4A 5K7HA 2EBIA 3D1NI 4IHXA 2R5ZA 3RKQA 1FTZA 2CUFA 1AKHB 4MO7A 2HDDA 1BA5A 2M9HA 3B81A 2UXUA 1K61A 1P7IA 5C4JJ 3QQAA 4EEFG 1ETWA 2EZLA 4MFEA 1LE8A 3KNWA 1RKTA 4UUSA 2LD5A 5IYDJ 4W97A 3HIMA 2YS9A 1QPIA 5IP7J 4GCTA 2R93J 3JRAA 2R5YA 4M3BA 4JP0A 1VI0A 2UXHA 2IU5A 3VW1A 2Q24A 1IC8A 5C4YA 2VPRA 4ICHA 3LSPA 4G12A 3JRCA 1MSEC 1IDZA 1UMQA 3G7RA 1RKWA 5M3MJ 2DJNA 4IHYA 2PMZN 2R5YB 1B8IA 3JRIA 3FISA 3V78A 4CYCA 5EGOB 2CQQA 2E19A 2XPVA 1AU7A 5D19A 2FBQA 2UXPA 1IG7A 1IGNA 1ETOA 3BTLA 2DMNA 3ZQHA 5CW8A 5F0HA 3C07A 3S14J 1FIAA 1RETA 5H9TA 5M5XJ 2H1KA 4A3CJ 4JKZA 1F36A 2P81A 2OPTA 3KKDA 3Q0UA 3PO2J 5F0FA 2CQXA 1JTXA 2W48A 5C4XJ 2WUIA 3BJBA 5K7ZA 2DMPA 2VKVA 1JKPC 4D5CA 4JYKA 2ZCNA 1U9OA 2NVXJ 4C3IJ 4IHVA 2HXIA 1BL0A 3C2BA 2YVEA 1JKRC 4A3DJ 1ZKGA 2WV1A 1MBGA 4NELA 2DG8A 3LWJA 3VVZA 2Y2ZA 4W1UA 1UI5A 3CRJA 3BG5A 3LOCA 2Y9ZA 4XRSG 3MVPA 3ZOBA 3Q0VA 4QSHA 3DEWA 4NDLA 1FIPA 3JRBA 4GCKA 1MNMC 3ON4A 3HGGA 5FMPA 3KZ9A 2HKUA 2DA5A 1YRNA 3VW2A 2NVQJ 2TRTA 1EF4A 2X6OA 1B8IB 2GFNA 2MSYA 4JX5A 2NX4A 2CU7A 3IV5A 2KDZA 5EFYA 4AC0A 1QVTA 4QIWN 3I4MJ 1O4XA 1OFCX 1Z0XA 2DA1A 3HBLA 1JT6A 2L9RA 1QRYA 3H3VK 3BR2A 3BR5A 3BNIA 3BG3A 3V6GA 3I4NJ 3Q3SA 3RQIA 5FGLA 3PPBA 3BTJA 3VPRA 5GPCA 4M3GA 4DZPA 2NVYJ 1FJLA 2COBA 2OF7A 5EEAA 4UUSB 4IHWA 3LSGA 1ENHA 3JSJA 2DA3A 2VKEA 2XGEA 5F0CA 1YRNB 3A01B 2R92J 2DN0A 2AO9A 3VVYA 1I3QJ 3RZDJ 4BKXA 4X6AJ 5JLWA 1IRZA 5F08A 5IOZA 3OOUA 2PZ9A 3BT9A 4D7MA 1GVDA 3HTHA 1GDTA 4CGRA 3ZQIA 3FIWA 1Y1WJ 4DW6A 2KT0A 2WB1N 1UHSA 1CQTA 3S2DJ 3G1LA 3BR1A 3WHCA 4FE7A 3CDLA 5EG0A 4MXMA 5EGOA 4B3AA 1WH7A 1OJLA 2NS7A 2O7OA 1PUFB 4M3FA 5D18A 5F1JA 5K7FA 3TW6A 2JA8J 1ZR2A 3A01A 2CRGA 4MFDA 2QF7A 3Q0WA 2HOAA 4A93J 1LFUP 5IPAA 3F0CA 2ELKA 4X1EA 4YZEA 1RESA 1ZGWA 1T33A 2X48A 2L0KA 3G1OA 3JRGA 2DMQA 4UUTA 5E3NA 1Y1VJ 2IEKA 3NPIA 2K9NA 4BBRJ 4V2FA 1ORKA 3GTJJ 2QKOA 2ID3A 3S2HJ 4AC6A 3VP5A 4FISA 2NS8A 2Y31A 3S17J 4RDUA 4M3EA 1PUFA 1G2HA 4GFLA 3HGYA 5C44J 1Z77A 2MG4A 3O60A 1B72B 2D6YA 5EF6A 2HXOA 1XS9A 3BTIA 4IEJA 2HYJA 1HLVA 1HF0A 3BQYA 3NARA 1AKHA 3VVXA 1MSFC 2XGDA 1TC3C 3HKZN 5EZHA 1IDYA 5EG0B 1HOMA 3G56A 2VI6A 3E7QA 2X9DA 1ZTRA 4AUXA 5J1YA 2G7GA 1U8BA 2LR8A 1P7JA 3ZQGA 1R9TJ 3S5RA 3O8GA 1SFOJ 2RASA 3AQTA 2JJ7A 1U9NA 3GTPJ 4L62A 3BR6A 1JJ8C 3MNLA 3RH2A 2NP5A 1ITYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2XB5 A;  2IAI A;  5E3O A;  4HNV A;  5M3F J;  3O8H A;  2DMU A;  1NTC A;  1H8A C;  3HTI A;  9ANT A;  3CMY A;  2G7S A;  2XPW A;  1APL C;  3HM5 A;  3PO3 J;  2GEN A;  1HCR A;  3A03 A;  2JA7 J;  4V2G A;  5IYC J;  3VOK A;  2O7T A;  3HB9 A;  3NRG A;  3HOU J;  4JX4 A;  2O8K A;  4XK4 A;  1OCP A;  5M5Y J;  1Q1V A;  3UKG A;  2GUH A;  5FKO A;  4A3K J;  4M3D A;  2ME0 A;  1MBJ A;  3QBM A;  1ETX A;  2K9S A;  5EYR A;  4DYC A;  4J19 A;  2Y0S N;  1AHD P;  1NK3 P;  2XRL A;  2HOS A;  2HYT A;  1JUS A;  4XIC A;  3F1B A;  3B6C A;  2MGQ A;  1XG1 A;  2ZB9 A;  3NAU A;  5HAW A;  1H88 C;  3DCF A;  3P9T A;  1TWF J;  1JJ6 C;  2H8R A;  5C3E J;  3JRE A;  5DAJ A;  4BY1 J;  3TED A;  3HOZ J;  3BRU A;  2L7F P;  1QVU A;  3OSG A;  1JT0 A;  2QIB A;  2JN6 A;  3IH3 A;  1RR7 A;  3GEU A;  2XDN A;  1X2N A;  4A3F J;  4A3J J;  4BBS J;  5JLX A;  1VFC A;  4A3B J;  3K2A A;  3K7A J;  5F04 A;  2NVT J;  4A69 C;  3IH2 A;  1TWG J;  4PXI A;  3PAS A;  3LSR A;  1MH3 A;  1IUF A;  1F43 A;  3QKX A;  4NN1 A;  2OER A;  2WAQ N;  4I76 A;  3S15 J;  4GFK A;  1MBF A;  4GFB A;  2FD5 A;  1NK2 P;  3CJD A;  3OSF A;  3GTO J;  1ZK8 A;  1JGG A;  3JRD A;  3CCY A;  5E3M A;  2EQR A;  3SJM A;  4A3I J;  1H89 C;  2E2H J;  3TP0 A;  3W6V A;  2R0Q C;  2CJJ A;  3S16 J;  4I6Z A;  2G0E A;  3S1Q J;  5AQC A;  3HOY J;  2UXI A;  1DU6 A;  2JK3 A;  1GV5 A;  2XGC A;  5HSZ A;  1ETV A;  2JA6 J;  4XID A;  1GT0 C;  1LE8 B;  1XC5 A;  3BR3 A;  2LY9 A;  2R7Z J;  3BHQ A;  3H0G J;  2DA7 A;  3BTC A;  5GPA A;  3COL A;  3OIO A;  2QWT A;  3BCG A;  2ME6 A;  2HQ5 A;  2QCO A;  1DU0 A;  4L5E A;  3HOX J;  2DTZ A;  3BQZ A;  2ZCX A;  3PM1 A;  3HE0 A;  1BW6 A;  1B72 A;  3LHQ A;  4ACI A;  1TWH J;  5CXI A;  2JWT A;  4B1R A;  2NP3 A;  5E3L A;  2JMW A;  4M6V A;  2QOP A;  3HOW J;  3S1M J;  3A02 A;  4BY7 J;  5FKM A;  4A3E J;  1FEX A;  3TP3 A;  4A3M J;  3CQZ J;  2E2I J;  4B4C A;  1OCT C;  2ZOY A;  3RD3 A;  2R5Z B;  3SDG A;  2LKX A;  1D5Y A;  3E7L A;  1LFB A;  2EZI A;  3AQS A;  3T6N A;  5IP9 J;  2ZCM A;  5FLM J;  4XRS A;  5EZG A;  4RBO A;  2RHA A;  1POG A;  3GTK J;  1WCM J;  2G3B A;  2EZK A;  1WGX A;  2VUM J;  3NI7 A;  4QTR A;  2N8G A;  1A5J A;  5FJ8 J;  3S1R J;  3QPL A;  5GP9 A;  1WPK A;  4MLO A;  3VIB A;  1MH4 A;  3GBG A;  3QPS A;  1W0T A;  5FHP A;  3ANG A;  3WHB A;  1GV2 A;  1W0U A;  3GZI A;  2REK A;  2DA2 A;  2M34 A;  4FCY A;  3M3Y J;  3M4O J;  5J3L A;  2YVH A;  5FKK A;  4JX6 A;  2XPU A;  2QTQ A;  1S7E A;  1ETQ A;  3NXC A;  2Y30 A;  1HDD C;  3IH4 A;  2Y9Y A;  4D5F A;  4DYR A;  2EH3 A;  2D5V A;  4ME9 A;  2EZH A;  5BNG A;  1TWA J;  4CYC B;  2MW8 A;  1MBE A;  4LOC A;  3GTQ J;  5FKL A;  5IOY A;  3LNQ A;  1UI6 A;  1BW5 A;  2LFB A;  3CWR A;  2DMT A;  4UDS A;  2LTP A;  3JR9 A;  3NNR A;  3TW7 A;  1E3O C;  1ETK A;  3MN2 A;  3HTA A;  3ON2 A;  1I50 J;  2UXO A;  2M8G X;  4XRM A;  4S0H B;  3JRH A;  3GTM J;  4AYB N;  1X2M A;  4Y7N J;  3VUQ A;  2HOT A;  4DYQ A;  2ECC A;  4FE4 A;  3B6A A;  5D1R A;  5EDN A;  4C3J J;  1MBH A;  5IP6 A;  3EUP A;  3FK6 A;  1FTT A;  2LLK A;  2IBD A;  4JNN A;  2E2J J;  2WGB A;  2ZOZ A;  4GCL A;  3JRF A;  3S1N J;  3DPJ A;  1ZR4 A;  5IYB J;  3FRQ A;  1JUP A;  2CUE A;  2B63 J;  1WH5 A;  3VOX A;  5J1U A;  2G7L A;  4DZJ A;  3LSJ A;  2DA6 A;  2M0C A;  3RZO J;  1BJZ A;  1K83 J;  1VF9 A;  1ZQ3 P;  3HOV J;  4C2M J;  2ECB A;  4D7N A;  2FX0 A;  2GBY A;  2K40 A;  1A6I A;  2ID6 A;  3BR0 A;  3HTJ A;  3ZQC A;  2LK2 A;  2M2E A;  4ABZ A;  4AF5 A;  2YUS A;  1UG2 A;  1HDP A;  5K58 A;  2TCT A;  4Y52 J;  1VND A;  5F27 A;  3FK7 A;  4A3L J;  4C3H J;  1WI3 A;  2F07 A;  2PBX A;  3MKL A;  1JUM A;  2FJ1 A;  1T56 A;  2DG7 A;  3ZQF A;  2FQ4 A;  3G1M A;  3HDD A;  5DS9 A;  1JKQ C;  1SGM A;  1RPW A;  1IJW C;  2E1O A;  2I10 A;  5HOD A;  5FKN A;  5M5W J;  4BXX J;  5FLV A;  2HI3 A;  2RAE A;  3GTL J;  2XB0 X;  2JA5 J;  4KWA A;  2OI8 A;  4FTH A;  1X58 A;  2LVS A;  3GTG J;  2DA4 A;  3LJL A;  3L1P A;  5HBU A;  2AHQ A;  3ANP A;  5DTD A;  4JL3 A;  1GUU A;  2LP0 A;  3EGQ A;  4HKU A;  2W53 A;  2L7Z A;  2V57 A;  1JTY A;  4A3G J;  3KKC A;  2K9Q A;  1IV6 A;  5CXG A;  5J1R A;  3VW0 A;  3SFI A;  3BG9 A;  2XSD C;  1MBK A;  4MIM A;  3FKI J;  1JKO C;  1SAN A;  1U78 A;  1TWC J;  2L7M P;  2NOG A;  1ETY A;  3IUV A;  2O9L A;  2YU9 J;  3HEF A;  2GLO A;  1I6H J;  3ZQL A;  4MK6 A;  2GM4 A;  5K7H A;  2EBI A;  3D1N I;  4IHX A;  2R5Z A;  3RKQ A;  1FTZ A;  2CUF A;  1AKH B;  4MO7 A;  2HDD A;  1BA5 A;  2M9H A;  3B81 A;  2UXU A;  1K61 A;  1P7I A;  5C4J J;  3QQA A;  4EEF G;  1ETW A;  2EZL A;  4MFE A;  1LE8 A;  3KNW A;  1RKT A;  4UUS A;  2LD5 A;  5IYD J;  4W97 A;  3HIM A;  2YS9 A;  1QPI A;  5IP7 J;  4GCT A;  2R93 J;  3JRA A;  2R5Y A;  4M3B A;  4JP0 A;  1VI0 A;  2UXH A;  2IU5 A;  3VW1 A;  2Q24 A;  1IC8 A;  5C4Y A;  2VPR A;  4ICH A;  3LSP A;  4G12 A;  3JRC A;  1MSE C;  1IDZ A;  1UMQ A;  3G7R A;  1RKW A;  5M3M J;  2DJN A;  4IHY A;  2PMZ N;  2R5Y B;  1B8I A;  3JRI A;  3FIS A;  3V78 A;  4CYC A;  5EGO B;  2CQQ A;  2E19 A;  2XPV A;  1AU7 A;  5D19 A;  2FBQ A;  2UXP A;  1IG7 A;  1IGN A;  1ETO A;  3BTL A;  2DMN A;  3ZQH A;  5CW8 A;  5F0H A;  3C07 A;  3S14 J;  1FIA A;  1RET A;  5H9T A;  5M5X J;  2H1K A;  4A3C J;  4JKZ A;  1F36 A;  2P81 A;  2OPT A;  3KKD A;  3Q0U A;  3PO2 J;  5F0F A;  2CQX A;  1JTX A;  2W48 A;  5C4X J;  2WUI A;  3BJB A;  5K7Z A;  2DMP A;  2VKV A;  1JKP C;  4D5C A;  4JYK A;  2ZCN A;  1U9O A;  2NVX J;  4C3I J;  4IHV A;  2HXI A;  1BL0 A;  3C2B A;  2YVE A;  1JKR C;  4A3D J;  1ZKG A;  2WV1 A;  1MBG A;  4NEL A;  2DG8 A;  3LWJ A;  3VVZ A;  2Y2Z A;  4W1U A;  1UI5 A;  3CRJ A;  3BG5 A;  3LOC A;  2Y9Z A;  4XRS G;  3MVP A;  3ZOB A;  3Q0V A;  4QSH A;  3DEW A;  4NDL A;  1FIP A;  3JRB A;  4GCK A;  1MNM C;  3ON4 A;  3HGG A;  5FMP A;  3KZ9 A;  2HKU A;  2DA5 A;  1YRN A;  3VW2 A;  2NVQ J;  2TRT A;  1EF4 A;  2X6O A;  1B8I B;  2GFN A;  2MSY A;  4JX5 A;  2NX4 A;  2CU7 A;  3IV5 A;  2KDZ A;  5EFY A;  4AC0 A;  1QVT A;  4QIW N;  3I4M J;  1O4X A;  1OFC X;  1Z0X A;  2DA1 A;  3HBL A;  1JT6 A;  2L9R A;  1QRY A;  3H3V K;  3BR2 A;  3BR5 A;  3BNI A;  3BG3 A;  3V6G A;  3I4N J;  3Q3S A;  3RQI A;  5FGL A;  3PPB A;  3BTJ A;  3VPR A;  5GPC A;  4M3G A;  4DZP A;  2NVY J;  1FJL A;  2COB A;  2OF7 A;  5EEA A;  4UUS B;  4IHW A;  3LSG A;  1ENH A;  3JSJ A;  2DA3 A;  2VKE A;  2XGE A;  5F0C A;  1YRN B;  3A01 B;  2R92 J;  2DN0 A;  2AO9 A;  3VVY A;  1I3Q J;  3RZD J;  4BKX A;  4X6A J;  5JLW A;  1IRZ A;  5F08 A;  5IOZ A;  3OOU A;  2PZ9 A;  3BT9 A;  4D7M A;  1GVD A;  3HTH A;  1GDT A;  4CGR A;  3ZQI A;  3FIW A;  1Y1W J;  4DW6 A;  2KT0 A;  2WB1 N;  1UHS A;  1CQT A;  3S2D J;  3G1L A;  3BR1 A;  3WHC A;  4FE7 A;  3CDL A;  5EG0 A;  4MXM A;  5EGO A;  4B3A A;  1WH7 A;  1OJL A;  2NS7 A;  2O7O A;  1PUF B;  4M3F A;  5D18 A;  5F1J A;  5K7F A;  3TW6 A;  2JA8 J;  1ZR2 A;  3A01 A;  2CRG A;  4MFD A;  2QF7 A;  3Q0W A;  2HOA A;  4A93 J;  1LFU P;  5IPA A;  3F0C A;  2ELK A;  4X1E A;  4YZE A;  1RES A;  1ZGW A;  1T33 A;  2X48 A;  2L0K A;  3G1O A;  3JRG A;  2DMQ A;  4UUT A;  5E3N A;  1Y1V J;  2IEK A;  3NPI A;  2K9N A;  4BBR J;  4V2F A;  1ORK A;  3GTJ J;  2QKO A;  2ID3 A;  3S2H J;  4AC6 A;  3VP5 A;  4FIS A;  2NS8 A;  2Y31 A;  3S17 J;  4RDU A;  4M3E A;  1PUF A;  1G2H A;  4GFL A;  3HGY A;  5C44 J;  1Z77 A;  2MG4 A;  3O60 A;  1B72 B;  2D6Y A;  5EF6 A;  2HXO A;  1XS9 A;  3BTI A;  4IEJ A;  2HYJ A;  1HLV A;  1HF0 A;  3BQY A;  3NAR A;  1AKH A;  3VVX A;  1MSF C;  2XGD A;  1TC3 C;  3HKZ N;  5EZH A;  1IDY A;  5EG0 B;  1HOM A;  3G56 A;  2VI6 A;  3E7Q A;  2X9D A;  1ZTR A;  4AUX A;  5J1Y A;  2G7G A;  1U8B A;  2LR8 A;  1P7J A;  3ZQG A;  1R9T J;  3S5R A;  3O8G A;  1SFO J;  2RAS A;  3AQT A;  2JJ7 A;  1U9N A;  3GTP J;  4L62 A;  3BR6 A;  1JJ8 C;  3MNL A;  3RH2 A;  2NP5 A;  1ITY A; 
#chains in the Genus database with same CATH topology
 3VSL A;  3P9C A;  4ZYA A;  1MMG A;  1MZB A;  3V8L A;  2ZNZ A;  3M1C A;  3OOP A;  5M3F J;  1JE8 A;  2IS4 A;  1NTC A;  1R1V A;  2AQF A;  2HYG D;  3HTI A;  1XD7 A;  1FOX A;  4UUV A;  5CVR A;  2FE3 A;  2XPW A;  4AIH A;  3PO3 J;  2D2W A;  1VQ4 I;  3OYF A;  4BQA A;  2WTE A;  3MMY B;  3ZMS A;  2JA7 J;  4V2G A;  2DLL A;  2HPI A;  3ABK H;  4HF0 A;  4V19 K;  2G7U A;  1KYW A;  2H94 A;  4AWX B;  2MLK A;  3IWZ A;  4U88 A;  1P92 A;  2WBM A;  4JX4 A;  4XK4 A;  1D0Y A;  3PSF A;  1B9M A;  4BYY A;  3E6C C;  1D0X A;  5D8K B;  3IAM 2;  1LFP A;  1OCR H;  1K78 A;  2ME0 A;  2F4M B;  5JVG F;  4A5M A;  2BY3 A;  3ZXS A;  3CCE I;  3RPU A;  2IVM A;  2MGQ A;  3NAU A;  2HVR A;  2CW0 F;  3DCF A;  3KE2 A;  5C3E J;  5FB2 A;  1YW9 A;  4UHT A;  2CGP A;  3I59 B;  2ZO4 A;  2KZV A;  3QOP A;  2QIB A;  2JRT A;  5KHD A;  4HX4 A;  2A69 F;  2E5Z A;  2DK8 A;  2HDW A;  2V1X A;  3F6V A;  4FX0 A;  3TQN A;  4KNY A;  2XKP A;  1SFK A;  1VFC A;  1YQA A;  3K2A A;  4IJA A;  4JK1 X;  1BR4 A;  2NVU B;  3QAH A;  3BP8 A;  2AXL A;  3F22 A;  1J59 A;  2Y48 A;  2QBY B;  5F6F A;  2EA4 A;  2ELJ A;  4DBQ A;  4BE1 A;  2DDA A;  5CVJ A;  3JRD A;  1JGG A;  2JTV A;  4ZJZ A;  3CCY A;  2A68 F;  2XDV A;  3W3C A;  2R0Q C;  3LL7 A;  3QYB A;  4RB1 A;  2G0E A;  3IP4 B;  3HOY J;  4UY8 I;  2UXI A;  4ZDP A;  3GCM A;  3PFY A;  5HSZ A;  4AID A;  2JA6 J;  2BZT A;  1V5F A;  4B47 A;  3BHQ A;  3WOD F;  3ZR8 X;  1B4A A;  4F3Q A;  2DA7 A;  3K4L A;  3BTC A;  3IAS 2;  3PIP F;  4KT5 C;  3LST A;  5HDN A;  3BCG A;  1J09 A;  2ME6 A;  5JHF A;  1Y56 A;  3WU1 B;  4TV7 A;  5B66 C;  1PDN C;  4B09 A;  3PM1 A;  3LAJ A;  2ESN A;  5EJC A;  3LHQ A;  1G6N A;  3ZN1 A;  2B0L A;  2DOF A;  2X1E A;  1TWH J;  3FKJ A;  5E20 A;  3HOW J;  4BY7 J;  4A3E J;  1FEX A;  3DWL E;  4B4C A;  3REO A;  1WRJ A;  4HQE A;  3HUG B;  2ZJP F;  3ABT A;  2CUJ A;  4QLC U;  1J0R A;  2L4M A;  1KQ9 A;  3RJP A;  2LKX A;  4KYW A;  1BR2 A;  1IN5 A;  4Z6Y A;  5FLM J;  2DOA A;  1KA8 A;  3EUH C;  2PMH A;  1T39 A;  1KU7 A;  2E1N A;  1WGX A;  3IWF A;  4IRH A;  4IO9 F;  1PYV A;  1X4P A;  2LYC A;  5BQT A;  3ZRG A;  1MW7 A;  3GXO A;  3QPL A;  1XDS A;  1U2W A;  2Y69 H;  1QZY A;  1LPQ A;  2GZW A;  1W0U A;  2Z5U A;  4ZYD A;  3CF5 F;  2EFW A;  3CC2 I;  2REK A;  2IGK A;  3DPL C;  2GXG A;  3GVA A;  3CLQ A;  4RAG A;  3K6G A;  1S7E A;  4BJ6 C;  2I5U A;  2A3S A;  2Y9Y A;  2O6G E;  4DYR A;  1W36 D;  2EZH A;  1TWA J;  1MBE A;  3BC8 A;  2M45 A;  3LA7 A;  3M1E A;  2QQ8 A;  1Z21 A;  4E7H A;  4MQV A;  5JHU A;  3JR9 A;  3NNR A;  3TW7 A;  2EV6 A;  5ERI A;  1S7A A;  2FXA A;  1WWX A;  1J9I A;  5KNL A;  2JPC A;  4Y7N J;  3ECO A;  3I53 A;  5H6R A;  4HBL A;  1QZZ A;  2H6C A;  2WY8 Q;  5B1A H;  1TNS A;  2LLK A;  5LGN A;  1REP C;  1XCV A;  2DQR A;  4B43 A;  1WJA A;  4WXH A;  3RKX A;  5IYB J;  1ZR4 A;  1T8I A;  3IKV A;  3I0T A;  4RGS A;  2G7L A;  2L5Q A;  3LSJ A;  4PJM A;  4CO8 A;  1I5Z A;  2NXN B;  1XSX A;  1V54 H;  1ZQ3 P;  3HOV J;  4C2M J;  4D7N A;  4U7D A;  2WB1 A;  4Q48 A;  3I4P A;  1XGO A;  3ABL H;  4M9S A;  3ZQC A;  1X19 A;  4PSW A;  4A2U A;  2G9W A;  2GWR A;  4AF5 A;  1UAA A;  2RGV A;  4Y52 J;  1VND A;  3S3O A;  1TL8 A;  1D0Z A;  4P55 A;  3PUF A;  2PMU A;  1BI1 A;  3C1D A;  3MKL A;  3EET A;  1FNN A;  2OD5 A;  4JQF A;  4P9U A;  1HST A;  2CQK A;  1OCO H;  3VYS B;  4OMY A;  2HQA A;  4RGU A;  4UV9 A;  2DG7 A;  3E0J B;  1QZE A;  4IXA A;  3OS2 A;  1Y0N A;  1Z05 A;  4X0G A;  4MEX F;  2CV1 A;  2OBP A;  2JA2 A;  3HDD A;  4MTD A;  3P5J A;  5DS9 A;  1RPW A;  2R7T A;  4LK0 F;  3WU2 C;  1LDD A;  2R7W A;  4HRI A;  2HI3 A;  2RAE A;  3HIF A;  4GRI A;  3LSH A;  2JA5 J;  4KWA A;  4FTH A;  2GOX B;  5ICE A;  1ZG1 A;  2AHQ A;  3ANP A;  3F21 A;  2FNP A;  3GFI A;  1LNW A;  2RKH A;  4HKU A;  2ZKZ A;  2VPL A;  3L2V A;  1OQY A;  4WF2 A;  1RR8 C;  4EM2 A;  2KJC A;  4MNU A;  1IV6 A;  5CXG A;  3F3X A;  3H9J A;  1IV8 A;  2RDP A;  3SFI A;  2JPB A;  2XSD C;  2UZK A;  2CQ7 A;  3WE2 A;  4HEA 2;  5BS6 A;  1ZRC A;  5DD8 A;  1W4M A;  1TWC J;  2WAQ A;  4E4H A;  4HSR A;  2O5R A;  3IUV A;  4XLE A;  4HNU A;  4HX8 A;  1FC3 A;  4N4O B;  2GM4 A;  1VQ5 I;  3SZG A;  3M8F A;  3HTS B;  5J6X A;  3QWL A;  3SZP A;  2UXX A;  2E5N A;  2Q2E A;  1TQM A;  1RIO H;  2KMU A;  2OCE A;  4XQF A;  2HU9 A;  1L3L A;  2VC1 A;  2LY2 A;  1FP1 D;  4P9F A;  3NS4 A;  4ZYG A;  3QQA A;  5KK1 A;  2EZL A;  4F93 B;  2LD5 A;  3LWF A;  3HIM A;  1QPI A;  2BY1 A;  3OYH A;  5IP7 J;  3TL4 X;  4GCT A;  3JRA A;  1FBS A;  4AIK A;  4PUS A;  3GFM A;  4YIR X;  1VI0 A;  2K9M A;  1BC8 C;  3RSN A;  2GQQ A;  4KJZ A;  2NS0 A;  3VW1 A;  2Q24 A;  3ZP5 A;  1X1D A;  2M4K A;  3H36 A;  3H3Z A;  3K10 A;  4BAY A;  2VPR A;  3I9V 2;  4LG0 B;  1IXS B;  3LSP A;  1UEL B;  1MSE C;  1IDZ A;  1QBJ A;  2LRD A;  4I0A A;  4CDG A;  4KIS A;  2DJN A;  2PMZ N;  4A6D A;  2R5Y B;  1B8I A;  3ECH A;  1W7P A;  3V78 A;  2E19 A;  4ON0 A;  3HUG A;  4FX4 A;  3U2R A;  1AU7 A;  1IG7 A;  1IGN A;  5D19 A;  3VYR B;  3ASN H;  5CW8 A;  1FIA A;  5H9T A;  2G7H A;  5TIS C;  2JSC A;  2P81 A;  2W1O A;  3Q0U A;  3Q5F A;  2CQX A;  1JTX A;  3BJB A;  2HPM A;  1JHH A;  2VKV A;  1JKP C;  4WXD A;  3HJE A;  4JYK A;  2ZCN A;  1SC7 A;  1H9G A;  4HST A;  3RDI A;  4XLP F;  2HXI A;  3C2B A;  3P7N A;  4XOR A;  2CYY A;  4DIQ A;  1JKR C;  2ZFU A;  3CCQ I;  1K7A A;  2KRH A;  4E7S A;  2OA4 A;  3MVP A;  3RKY A;  3ZOB A;  1HW5 A;  3Q0V A;  4LFU A;  4QSH A;  4C2U A;  4OIO F;  3KZZ A;  3HGG A;  2XAQ A;  2IGN A;  3QU3 A;  3HSE A;  5DUI A;  3HZJ A;  1S9H A;  2NVQ J;  2X6O A;  1ULY A;  2QKL B;  4JX5 A;  2DK5 A;  1I39 A;  2ELH A;  4F7Z A;  2MC3 A;  1QVT A;  4PJN A;  3OYL A;  2OV7 A;  3CCV I;  1O7F A;  1MMA A;  1Z0X A;  5A2Q K;  2CQN A;  3BR2 A;  3BR5 A;  1KU9 A;  5CVI A;  3EQL F;  2KQR A;  3RYP A;  4RB2 C;  1RRJ A;  2Z33 A;  3FBI B;  3RQI A;  4J00 A;  3E97 A;  2F5D A;  3VPR A;  5GPC A;  2RNG A;  4HDU A;  4M3G A;  1N78 A;  4M71 A;  4ZTJ A;  1FJL A;  2OF7 A;  4UUS B;  2KIS A;  5TRD A;  3JTG A;  1OLT A;  2FA5 A;  2XGE A;  5F0C A;  4WK8 F;  3H92 A;  1YRN B;  3A01 B;  2AO9 A;  4HA8 A;  2KIQ A;  4BKX A;  4L0Y B;  4I09 A;  5JLW A;  6PAX A;  5F08 A;  1IRZ A;  2A6T A;  1MMD A;  3OOU A;  2PZ9 A;  2KIU A;  4D7M A;  1GVD A;  3TO7 A;  2YX7 A;  3KEY A;  4ZTF A;  2HKO A;  3DPT A;  3FIW A;  3FF5 A;  2E35 A;  4B44 A;  3LAP A;  3M9A A;  3DEU A;  4KIT B;  3DU6 A;  3HL2 A;  4I02 A;  1Y8R B;  3BR1 A;  3FBN B;  1QQI A;  3L09 A;  1G3S A;  4IOA F;  1DUX C;  4ZDL A;  4N4N B;  1T98 A;  5FO5 A;  3BDD A;  2QF7 A;  1Z6R A;  2BYV E;  3PNY A;  2DFH A;  5IPA A;  5FLX K;  2QSH X;  3E6D A;  4X1E A;  1XSD A;  1RES A;  2FUG 2;  1ZGW A;  2LMD A;  3VFZ A;  1T33 A;  2AQE A;  2X48 A;  1LEA A;  3G1O A;  1DPR A;  1FSH A;  3LFU A;  4HAM A;  2K9N A;  4ESJ A;  4Z2Y A;  2ADU A;  4AC6 A;  3OYC A;  4BDZ A;  5K5Q A;  1ZYR F;  3G2B A;  3S17 J;  3GZ5 A;  4RDU A;  1G2H A;  4IQJ A;  1Z77 A;  2O0Y A;  1B72 B;  3DTE A;  2QKM B;  5EF6 A;  2HXO A;  2ZJR F;  4EGZ A;  3C2G A;  2HYJ A;  3ULQ B;  3NAR A;  2DT7 B;  1ZAO A;  2KP6 A;  4LGW A;  4DJA A;  1MSF C;  2DYS H;  4HPQ A;  2XGD A;  3HKZ N;  1FP2 A;  3WGI A;  3RQ4 A;  2VI6 A;  3FZV A;  2X9D A;  2ZME C;  1W5S A;  5J1Y A;  2R7U A;  1R1U A;  2O3F A;  3O8G A;  4AVP A;  2JJ7 A;  3MZH A;  1U9N A;  4MGR A;  3E5Q A;  3VSK A;  2HEO A;  1JJ8 C;  2VOP A;  1YIO A;  2EIM H;  2K9L A;  1UG0 A;  1ITY A;  4AIJ A;  5E3O A;  3GME A;  1UST A;  2CO5 A;  2ZC2 A;  4L9V A;  1H8A C;  3V42 A;  1YO5 C;  1OMI A;  2XAH A;  1MD0 A;  4EJV A;  2KIM A;  4ETS A;  3CJN A;  1YFH A;  3CMY A;  3DU5 A;  1APL C;  3HM5 A;  4XKW A;  5J4V A;  3A4C A;  2L01 A;  4YFX F;  4HV6 A;  2M1B A;  1S29 A;  3VOK A;  1K79 A;  2LG4 A;  2LKS A;  3ASO H;  1P4X A;  1YE9 A;  4CCO A;  3DFG A;  1Q1V A;  1YIJ I;  1PP8 F;  3CDH A;  1BIB A;  1BR1 A;  1USS A;  1XGN A;  1W5C C;  1MBJ A;  5BOX A;  1NK3 P;  2Y0S N;  4R8H A;  4Y33 A;  2Z1D A;  2Z9O A;  2HOS A;  2CW7 A;  4XIC A;  2ZB9 A;  5J40 A;  1XDU A;  2OQR A;  2KL4 A;  2K3F A;  5HAW A;  5GTI C;  1ZLJ A;  1TWF J;  1WQ2 A;  3ONQ A;  1JJ6 C;  2H8R A;  3FMQ A;  1ZLK A;  2M4G A;  2V26 A;  1R4M B;  3KP4 A;  1D3Y A;  2L7F P;  5CVU A;  3OSG A;  1JT0 A;  3VOD A;  5DYM A;  3ZMD A;  1RR7 A;  2M5W A;  1T2K A;  3GEU A;  2QWW A;  2XDN A;  1X2N A;  4A3J J;  2FMY A;  3LSI A;  3BY6 A;  4XR6 A;  5DUK A;  2NVT J;  4A69 C;  5L3E A;  3J81 K;  1TWG J;  3FXR A;  4PXI A;  5CKT A;  3PAS A;  3LSR A;  2BVM A;  1MH3 A;  3LA3 A;  1C0W A;  2CUZ A;  2OER A;  2FF4 A;  4GFK A;  2LBF B;  1MBF A;  4GFB A;  3LQQ A;  4CA0 A;  4XOT A;  3FHZ A;  4WIB A;  3PNT A;  1BOA A;  1ZK8 A;  1F1Z A;  2EQR A;  1YLF A;  2XF5 A;  2L9S A;  3W6V A;  3WTY C;  2CJJ A;  3S16 J;  1IO2 A;  4KIC A;  4I0B A;  2W25 A;  4KIB A;  1SFU A;  2GA1 A;  3VYT B;  4NQW A;  3J7A Y;  4KIG A;  3DBR B;  3LMM A;  4G9Y A;  4XID A;  1GT0 C;  1XC5 A;  2DXI A;  3WTS C;  3EUK L;  2LY9 A;  4B8X A;  1SFE A;  3R61 A;  2BHY A;  1VQP I;  5J8C A;  4QPO A;  1HC8 A;  2QWT A;  1T0F A;  1DGR M;  1HA8 A;  2WV0 A;  2HQ5 A;  4R79 A;  1XMK A;  2IGM A;  1W1W E;  1DU0 A;  1MND A;  1FWZ A;  3M8J A;  1LJ9 A;  1R5G A;  2BV6 A;  2COM A;  2ZCX A;  1B72 A;  1NHA A;  3V7R A;  4XON A;  4ACI A;  3H3U A;  2LDU A;  1O3R A;  4PGG A;  2JMW A;  4M6V A;  4FT8 A;  3V7C A;  4E6K G;  2D1H A;  3HOS A;  3RPU D;  5FKM A;  2E2I J;  3CQZ J;  3QYE A;  4L0Z B;  3E6B A;  4ZC3 A;  2R5Z B;  3NEU A;  3SDG A;  5DCM B;  3K4B A;  1IF1 A;  4O3M A;  2QEN A;  3QU6 A;  3OYA A;  3CCL I;  4JBA A;  2V1D A;  1ZGJ A;  3T0Y A;  1WCM J;  4PGH A;  1G8X A;  2VUM J;  4QTR A;  2N8G A;  2RV8 A;  3RYR A;  4DNC A;  2Y75 A;  3AG2 H;  3CP2 A;  2NNN A;  5GP9 A;  3VIB A;  1MH4 A;  4LIT A;  2VC0 A;  5TJJ A;  3E1S A;  1VQ9 I;  1GV2 A;  1BI3 A;  1E0E A;  2M34 A;  2ZFW A;  3M3Y J;  2DDB A;  4YII A;  1QHH D;  5FKK A;  4JX6 A;  2F5C A;  2XPU A;  3DKX A;  1J5Y A;  3K4J A;  1CGP A;  4OIP F;  5ILS A;  2QEX I;  1MMS A;  3NXC A;  1I6X A;  1HDD C;  2F4O B;  2PQ8 A;  3F72 A;  4IVN A;  4ME9 A;  1W7P B;  2EH3 A;  5HNH A;  2D5V A;  2OU2 A;  1I1S A;  1VQL I;  4LOC A;  2V1N A;  3R0A A;  1HSJ A;  5K5O A;  5IOY A;  1UI6 A;  1BW5 A;  2LFB A;  3CWR A;  2DMT A;  1Q1H A;  2ZCW A;  5HLH A;  2BOL A;  4UDS A;  1BM9 A;  2KPM A;  4YFN F;  1K4S A;  1S7O A;  4I01 A;  1LUJ B;  1ETK A;  1Y6I A;  3DBH B;  3MN2 A;  1E3O C;  5CVV A;  3AG4 H;  3HTA A;  2M8G X;  4D1Q A;  4S0H B;  1X2M A;  4RLQ A;  2OTL I;  4RGX A;  1A35 A;  1XGM A;  2C6Y A;  3K1P A;  3OL3 A;  2PG4 A;  4DYQ A;  5D5V B;  2ECC A;  4FE4 A;  5EDN A;  2RN7 A;  1SD6 A;  1A6Q A;  1QPM A;  2WAF A;  3EUP A;  2X6Y A;  3I54 A;  2BW3 B;  4GCL A;  1EV7 A;  2LY1 A;  3H1C A;  5FGM A;  3MAJ A;  4BEH A;  2R7V A;  1WH5 A;  3VOX A;  1WSU A;  1FYL A;  1BJZ A;  1UFM A;  3NQO A;  3PSI A;  3AFH A;  1R4N B;  2EFQ A;  2A07 F;  2FX0 A;  4PCQ A;  2H27 A;  3SZT A;  3CTA A;  2CG4 A;  2K40 A;  3LSK A;  5FRM A;  2ID6 A;  3BR0 A;  1AA7 A;  5DDG A;  5JI6 A;  4BJT A;  3Q9S A;  2HQN A;  4IX7 A;  2BEO A;  4C2M A;  3W2A A;  2YUS A;  5LFA A;  1HDP A;  1YW8 A;  5K58 A;  3DLL F;  1GVJ A;  3FK7 A;  1JXS A;  4C3H J;  1WI3 A;  2PBX A;  4M6X A;  3LSM A;  5HVQ C;  1T56 A;  1FMW A;  1H9T A;  4LG0 A;  4KN4 X;  5GAG J;  1IJW C;  2LBF A;  2E1O A;  4L9T A;  4BQO A;  5HOD A;  3EYI A;  4BJ5 C;  3FXK A;  1F9N A;  1YYV A;  4M6Y A;  5FLV A;  2R3S A;  3GTL J;  1W36 C;  4E7J A;  1D1C A;  5LRR A;  1IZ1 A;  4A0Z A;  3EUH A;  4OAZ A;  1GLN A;  2L2O A;  3LFK A;  2LVS A;  3D5S C;  2GXA A;  1NH3 A;  2QQA A;  4JL3 A;  1X3W B;  1K4T A;  3KP2 A;  2B7E A;  5F64 A;  3W2W A;  4LB6 B;  1JTY A;  2STT A;  2JRM A;  2L02 A;  3KKC A;  1BIA A;  2Q2E B;  2W4S A;  3QPH A;  2P6T A;  3MZY A;  5J1R A;  3VW0 A;  4FET A;  4HW0 A;  2KIF A;  1R22 A;  3OYN A;  3PQJ A;  3T8R A;  1JKO C;  1SAN A;  2K4B A;  3HG9 A;  3O2P E;  2L7M P;  3P9I A;  5E79 C;  4G7Z F;  3I55 I;  4OIN F;  3KYL A;  3DKY A;  3CUQ A;  1O3Q A;  3I3L A;  3VDX A;  1I6H J;  5D5U B;  3OIP A;  3FXQ A;  4MK6 A;  3GLX A;  4NBQ A;  2HZT A;  2ZBK A;  4D9J A;  1E2X A;  3D1N I;  1ZRD A;  3J81 Z;  3KP5 A;  3OYE A;  3KLN A;  2E71 A;  1PUE E;  2CUF A;  3FX3 A;  1WJF A;  1KU3 A;  2DT5 A;  2W57 A;  3IRR A;  1Z7L A;  4S04 A;  2HR3 A;  1P7I A;  5C4J J;  3CJR B;  4RAF A;  4GYG A;  1SMT A;  1RKT A;  1MJB A;  2W85 A;  2M7B A;  4BE2 A;  5LHH A;  4CCM A;  3PJR A;  2R93 J;  3O3K A;  1FYM A;  2EWN A;  2DAO A;  2VB6 A;  3DV8 A;  4JP0 A;  4BS9 A;  3I71 A;  1YW7 A;  2IU5 A;  3L2U A;  1MDM A;  3J80 Z;  5LRS A;  2YR2 A;  4G12 A;  3JRC A;  1STZ A;  3GW2 A;  1UMQ A;  1SAU A;  3KLO A;  4HV5 A;  2QGU A;  5M3M J;  4NC7 A;  1MGT A;  1SD7 A;  1U0J A;  2R7X A;  2M0M A;  1RUN A;  1S5L C;  5CQE A;  1WKM A;  2CQQ A;  1G3T A;  2VLA A;  5F0H A;  1QU3 A;  3C07 A;  2XAJ A;  2QQ9 A;  1F36 A;  5LGT A;  4EJT A;  3KKD A;  3GLL A;  3NWT A;  1Z67 A;  5F0F A;  2W48 A;  1OPC A;  2ZJQ F;  3J7A O;  5C4X J;  1Z1D A;  1R5H A;  4IHV A;  1BL0 A;  2IRF G;  2YVE A;  2DPD A;  4A3D J;  1ZKG A;  2FU4 A;  1MBG A;  3KET A;  2F5F A;  4YG2 F;  1T0F C;  3EDP A;  3HRT A;  3H9G A;  3DEW A;  4XN3 A;  2HGC A;  4GCK A;  2CWE A;  1TBX A;  3KZ9 A;  2W7N A;  1YRN A;  3VW2 A;  1EF4 A;  3L9F A;  4AM3 A;  4G8X A;  5GAE J;  2R7S A;  1BJA A;  2KDZ A;  2LRE A;  4O6J A;  2LNB A;  2VJI A;  4AC0 A;  4BHC A;  4PFO A;  5E8G A;  2IA1 A;  5CQG A;  4R1H A;  2L9R A;  3BNI A;  3AG1 H;  4H4K C;  3OYI A;  4RM2 A;  1U5T B;  2OAZ A;  3BG3 A;  2NNY A;  3G73 A;  3FXJ A;  3GFJ A;  2HOE A;  2LF7 A;  4HLX A;  2VT3 A;  5FRO A;  1DGW Y;  4GCV A;  1Z7U A;  2DA3 A;  3F6O A;  3HPH A;  1R58 A;  1VQO I;  3HRS A;  2DN0 A;  3KP3 A;  5LBQ A;  4BQN A;  1I3Q J;  4OD5 A;  1XN7 A;  2K02 A;  4BL0 B;  1FOW A;  2ZJ2 A;  2XF6 A;  1UB9 A;  1ODD A;  1ZG3 A;  3AL0 B;  2VXZ A;  2Z99 A;  4U7B A;  2P8T A;  3FMR A;  3NWS A;  3OIQ A;  1RNL A;  3ZQI A;  4YEJ A;  1IRG A;  1KQ0 A;  4IHS A;  3VTI A;  3F23 A;  4XOP A;  2PJR B;  1EJ9 A;  2IW5 A;  1HQC A;  3ZPL A;  3FWE A;  3CDL A;  1R00 A;  3CUO A;  5EG0 A;  3VYU B;  1X4O A;  4PJL A;  1V5E A;  2E1M B;  4BDY A;  1PUF B;  4M3F A;  4M73 A;  2L7K A;  5CJ9 A;  5K7F A;  2J5O A;  1DQU A;  2D1V A;  3IUO A;  3Q0W A;  2JUG A;  2XUB A;  4A93 J;  3N4M A;  1LFU P;  5KCM A;  2ELK A;  2VJ5 A;  3GFL A;  2L0K A;  3FM3 A;  3JRG A;  2DMQ A;  3A1Y A;  4UUT A;  2IP2 A;  1YI2 I;  2IEK A;  3SHF A;  3NPI A;  4V2F A;  2XHK A;  2ID3 A;  3IC7 A;  1A36 A;  3VP5 A;  4FIS A;  4I7H A;  3I58 A;  1PUF A;  3HGY A;  4FQG A;  2H09 A;  2MG4 A;  3HYI A;  2F6C A;  3L2Q A;  3MEX A;  3O60 A;  2D6Y A;  4OOI A;  3BTI A;  4IEJ A;  3W6J B;  4KMF A;  3WTW C;  3K70 C;  2QUF A;  1TC3 C;  1OYY A;  4KUM A;  5EG0 B;  1WZ2 A;  1HOM A;  2DYR H;  1ZTR A;  4HDV A;  4Q5S F;  2OC6 A;  2DFF A;  1LEB A;  5DM7 F;  3S93 A;  2G7G A;  5E8I A;  3WTX C;  2M3A A;  4XLN F;  4WXC A;  2DO7 A;  1SFO J;  2RAS A;  4LIU A;  1F5T A;  2H1L A;  2VBZ A;  1U5T C;  2E7W A;  3BR6 A;  2H8W A;  4L62 A;  2QZ8 A;  3GYH X;  1X1P A;  1TQP A;  3CCJ I;  3OYM A;  2BXY A;  2HTJ A;  2IAI A;  1FPQ A;  3ERE D;  5E17 F;  4HNV A;  3JTH A;  1FOK A;  4OWR B;  3QOE A;  2X51 A;  4G6Q A;  1OCZ H;  2DMU A;  5E1Z B;  4Y17 A;  1S72 I;  3BCB A;  3OS1 A;  2MH9 A;  2IGO A;  3CLO A;  2HTS A;  4GYI A;  3ML6 A;  4DQ2 A;  2G7S A;  2Y0S A;  3TGN A;  3CUQ C;  4BH9 A;  3E6M A;  2ZSI B;  5FD5 A;  3S2W A;  5IYC J;  1YJN I;  2JSP A;  4L5I A;  3HRU A;  3UNG C;  2OZU A;  5HLG A;  4A12 A;  2O7T A;  4ZYE A;  3NRG A;  2UUZ A;  3HOU J;  2E1M C;  1ZHF A;  2WC2 A;  4OU0 A;  1TLH B;  5M5Y J;  3GZ6 A;  1FT9 A;  4BU2 A;  2EV0 A;  3FMS A;  3FXU A;  4A3K J;  4M3D A;  1A04 A;  1XMA A;  3BOQ A;  2M7A A;  1ZGA A;  4B3X A;  2K9S A;  4J19 A;  3QP6 A;  1AHD P;  3CP8 A;  2HYT A;  2HVS A;  3SDB A;  1ONV A;  3F1B A;  3SWH A;  1XG1 A;  3LQR A;  1H88 C;  4BNC A;  3WTT C;  1I27 A;  5FFZ A;  3HOZ J;  4F55 A;  4IKF A;  4AYB A;  1QVU A;  2VBX A;  5B5E C;  2VOD A;  2JN6 A;  3GF2 A;  1IUY A;  2FSW A;  4HF2 A;  4G6T B;  3N05 A;  4EJU A;  4A3F J;  2DJI A;  4IRG A;  4A3B J;  2Z3Y A;  5F04 A;  4CCJ A;  2XAS A;  2F4I A;  5IY5 H;  1V4R A;  4L18 B;  3HRM A;  1F43 A;  4NN1 A;  4HYE A;  4I76 A;  1EA3 A;  3S15 J;  1O7L A;  2V6E A;  2L3D A;  2XGX A;  3CO6 C;  3OSF A;  3GTO J;  3MKZ A;  1TW3 A;  2XAU A;  5E3M A;  4HZF A;  2VOO A;  1H89 C;  2E2H J;  3TP0 A;  2L54 A;  4I6Z A;  2QSG X;  3S1Q J;  3CC7 I;  5AQC A;  5D4S A;  3OY9 A;  3QYF A;  1GV5 A;  5KAF C;  2LH9 A;  3KIO A;  4KFC A;  1FOY A;  4RAZ A;  3H0G J;  1X3U A;  3ZMU A;  5GPA A;  1CF7 A;  4E7L A;  4UVC A;  3O6B B;  3TDU C;  2QCO A;  1QGP A;  1P9Q C;  2DTZ A;  3BQZ A;  3HE0 A;  1BW6 A;  3CME I;  4BEH B;  3H0D A;  4IPA A;  3CC4 I;  1S6L A;  5CXI A;  2JWT A;  2WAD A;  1SD4 A;  4NC6 A;  1HKQ A;  4B1R A;  1FBU A;  1QO0 D;  2EA2 A;  2HWV A;  3D5R C;  2NP3 A;  5LGU A;  4GO1 A;  3PIO F;  2QOP A;  1WVR A;  3U21 A;  3L2R A;  1A31 A;  4A3M J;  1OCT C;  2MH2 A;  2LF8 A;  3ZN0 A;  1J75 A;  3RD3 A;  2OCC H;  4XLC A;  3WGH A;  4QPQ A;  2XV4 S;  3MFK A;  3E7L A;  2EZI A;  4EV0 A;  1CF7 B;  3T6N A;  3X2Q H;  3TBI A;  1RZ4 A;  4RM3 A;  3OYG A;  2ZCM A;  2VJ4 A;  5DCF A;  1YS6 A;  4YEL A;  4CCL A;  1WJE A;  1KZH A;  4A0Y A;  4ASN A;  4CSW A;  5D6F A;  3NI7 A;  2L9V A;  2EFP A;  3WTZ A;  2IA0 A;  2P4W A;  4XLH A;  3KX2 A;  5FJ8 J;  1WPK A;  2ZXI A;  5LHG A;  1OR7 C;  3AKZ A;  3QPS A;  3OYB A;  1W0T A;  1JGS A;  1XB4 A;  1NG7 A;  3DTI A;  2HS5 A;  2CS3 A;  3WHB A;  2VE8 A;  3GZI A;  5IT9 Z;  2DA2 A;  4FCY A;  4LIV A;  2DCE A;  2QA4 I;  5J3L A;  2YVH A;  2GAU A;  3PUB A;  2GXB A;  5AON A;  2XRN A;  3UR3 C;  1TT0 A;  3IH4 A;  4KT6 A;  1T38 A;  4M74 A;  3M8E A;  5BNG A;  2MA3 A;  2MW8 A;  2HZD A;  5HS8 A;  3GTQ J;  5FKL A;  4JOM A;  1R23 A;  3LNQ A;  2L4A A;  2UXN A;  3C7J A;  1WJC A;  2ZNY A;  2FML A;  1P2F A;  2HVQ A;  3FHN A;  4A5N A;  4M72 A;  4OAY A;  1K6Y A;  4XRM A;  3GTM J;  4AYB N;  3CCS I;  5EEH A;  2R7R A;  4F52 A;  3HKZ A;  1YJW I;  1WJD A;  4DVY P;  3P9K A;  4NB5 A;  1R71 A;  2HOT A;  2K3P A;  1D1B A;  2ZXH A;  4EMS A;  2V9K A;  4EQQ A;  3B6A A;  5D1R A;  4C3J J;  2B1E A;  5IP6 A;  3F8B A;  2PI0 A;  1UJ8 A;  4KMU X;  1ZAR A;  4AD9 A;  2ZOZ A;  2DOE A;  4XLA A;  1R5I D;  3DPJ A;  1B1B A;  3ABM H;  1JUP A;  2GIZ A;  4EM0 B;  3K69 A;  4QWQ A;  3EYY A;  5J1U A;  3D5L A;  4DZJ A;  2DA6 A;  4D0P A;  1DP3 A;  2M0C A;  2CH0 A;  3BPV A;  1K83 J;  1VF9 A;  1YG2 A;  3MWM A;  1U6G A;  2ECB A;  3KP6 A;  3TDZ C;  3HTJ A;  4I99 C;  2LK2 A;  5HS9 A;  1Z6T A;  2M2E A;  4ITV A;  4MEY F;  2D45 A;  4ABZ A;  5DCM A;  1Y39 A;  2RVC A;  2MFZ A;  1UG2 A;  1DP7 P;  1U5T A;  2BHZ A;  2VIX A;  5F27 A;  1S3J A;  2VN2 A;  2F07 A;  2V1U A;  2FJ1 A;  5ED4 A;  1SVL A;  5D5X B;  1J7K A;  4E7K A;  5K5R A;  1VZ0 A;  3WTV C;  1PP7 U;  4FHT A;  4HQM A;  2CW8 A;  4UXN A;  2I8D A;  5LEJ A;  1JKQ C;  1IN6 A;  5D8L B;  1AOY A;  5FKN A;  5M5W J;  4BXX J;  2OZ6 A;  5DEQ A;  2VBW A;  2E1C A;  3BZK A;  2VQG A;  1GXP A;  3PNV A;  2P5L C;  1X1A A;  4B48 A;  5HBU A;  3L1P A;  3JCU C;  2K7L A;  2O03 A;  1G3W A;  3Q9V A;  2RC4 A;  3H5R A;  3EGQ A;  1I1G A;  3LA2 A;  2W53 A;  2V57 A;  2MAB A;  4CHU A;  3W6K B;  2K9Q A;  2ZXJ A;  4M9X A;  1XPX A;  2E36 A;  1G4D A;  2JQ7 A;  3OS0 A;  2XC7 A;  3TMO A;  2PX9 A;  1MBK A;  1UHM A;  3C2H A;  3FKI J;  2CSO A;  3SEZ A;  4XKV A;  1W5T A;  2GA2 A;  2NOG A;  4I98 B;  1ETY A;  2YU9 J;  1UZC A;  1IN7 A;  4ZZL A;  1T08 B;  3KFW X;  3OL4 A;  4CH7 A;  1X1C A;  2HYF A;  1MDM B;  1SMY F;  3F9K A;  3RKQ A;  3M07 A;  3MZ8 A;  1AKH B;  3KEO A;  2HDD A;  3B81 A;  3ABU A;  2M8E A;  2YPR A;  2A6H F;  3HHG A;  2WAE A;  2OTJ I;  3BCA A;  4XL9 A;  1K61 A;  4GDF A;  1EH8 A;  2BY0 A;  2ZSH B;  2UXU A;  2IS2 A;  5DM6 F;  2IT0 A;  3HSF A;  4MFE A;  3V8K A;  1LE8 A;  3KNW A;  3SQN A;  5IYD J;  2MC4 A;  2YS9 A;  2BGC A;  3L00 A;  3BLY A;  3GWZ A;  2R5Y A;  4M3B A;  1JHF A;  2FOK A;  2JVG A;  4CUG A;  1LVK A;  1ZRE A;  4RB3 C;  3RTR A;  2BVL A;  5FFX A;  2EIN H;  1IC8 A;  2PEX A;  5EEG A;  5C4Y A;  4G6D A;  2QM3 A;  3BG7 A;  4ENM A;  3G7R A;  1RKW A;  2A05 A;  2VKH A;  2ZY9 A;  5HDG A;  1Z91 A;  3I5U A;  4N9I A;  2IJL A;  2XKO A;  3S8P A;  2OJE D;  2QSF X;  2XPV A;  2J5P A;  4PFP A;  2UXP A;  4LLN A;  3BZC A;  3R0J A;  2DMN A;  2DBB A;  1W7P D;  2NRA C;  1ZEL A;  1RET A;  3SYT A;  2H1K A;  4A3C J;  4CGZ A;  4G7H F;  2OPT A;  5JVT A;  3F8F A;  3HC7 A;  3PO2 J;  4U0W A;  3RCO A;  3G3Z A;  2NVX J;  4C3I J;  3K4C A;  1RI7 A;  4Y4R A;  2WV1 A;  1FX7 A;  4NEL A;  2DFE A;  2DG8 A;  1YTY A;  3LWJ A;  3VVZ A;  2Y2Z A;  4N0B A;  1UI5 A;  2PLY A;  3CRJ A;  4ZYH A;  2Y9Z A;  2FJI 1;  4XRS G;  5HS7 A;  3K1M A;  1FIP A;  3QPT A;  1MNM C;  5F1R A;  3K0L A;  2VQH A;  2V6C A;  4BUP A;  3H5A A;  2BBY A;  1YX5 A;  2TRT A;  4NHJ A;  1PJR A;  2MSY A;  2NX4 A;  3IV5 A;  1O57 A;  2DFI A;  2UWM A;  1YJ9 I;  5EFY A;  1B9N A;  5H2F C;  4CIC A;  3VOE A;  1EH7 A;  4BXU A;  2O61 A;  5FLX Z;  3CZ6 A;  5D5W B;  1TQI A;  1KON A;  3IKT A;  3Q3S A;  1VQM I;  4PSX A;  3PPB A;  1RC9 A;  2NVY J;  1Y8Q B;  4N9H A;  3TKY A;  2VE9 A;  5EEA A;  1HKS A;  3HPG A;  4AU7 A;  5L3C A;  3K4K A;  4IHW A;  3E3V A;  2DQL A;  2NYX A;  4IRV A;  3RZD J;  2OUM A;  5BMZ A;  3T5X A;  2VBY A;  1HW2 A;  4BGD A;  3H5N A;  3HTH A;  1VQK I;  1L0O C;  1KYZ A;  3JSO A;  1Y1W J;  2A5Y B;  1ERD A;  3V8J A;  1UHS A;  3S2D J;  3HHH A;  2X1D A;  3G1L A;  2YX4 A;  3WHC A;  2KKO A;  4EVI A;  2WWY A;  5EGO A;  1OJL A;  1WH7 A;  2NS7 A;  1VQ6 I;  1LKX A;  4E7I A;  2JA8 J;  2ESH A;  1ZR2 A;  3A01 A;  2ICW G;  5FD6 A;  2RQQ A;  1V5G A;  3L2W A;  3MD2 A;  4UNO A;  4L9N A;  3ZQQ A;  5A2Q Z;  4OIR F;  3SEQ A;  1SEU A;  3QRF F;  2IA2 A;  5E3N A;  1OR7 A;  2F5E A;  4KIF A;  4BBR J;  2VAS A;  1ORK A;  3GTJ J;  3WTU C;  3S2H J;  2QKO A;  5ILU A;  4XLF A;  2NS8 A;  4RB0 A;  4CZC A;  4HNT A;  3PQK A;  1DDN A;  3MCZ A;  4M3E A;  4Q4Z F;  1IRF A;  5GAD J;  5IT3 A;  3DXJ F;  2IXS A;  3MKY B;  2Q8K A;  4XKC A;  2A61 A;  3G71 I;  1GXQ A;  5TGT A;  3DPU A;  3TOA A;  1HF0 A;  5KVR A;  2M87 A;  3FXM A;  3G4S I;  3VVX A;  3L7W A;  5EZH A;  3B02 A;  3G6E I;  2XRO A;  4C2T A;  4CXF A;  3E7Q A;  4RA2 A;  4AUX A;  3M7G A;  3GX4 X;  3FM5 A;  1MJ9 A;  2LR8 A;  4NNJ A;  5HLI A;  3J7Z I;  2KLO A;  4YFK F;  1U8B A;  3A2K A;  1R9T J;  1BI0 A;  4G7O F;  3AL0 C;  2Y0M A;  5GTH C;  3AQT A;  2KRC A;  3JW4 A;  2JT1 A;  3A0H C;  3DKW A;  3MNL A;  2NP5 A;  1G3Y A;  1I3A A;  2XSJ C;  1NG6 A;  2M30 A;  1LQ1 A;  2DOD A;  2ETH A;  2XB5 A;  3K4N A;  5CPR B;  1Z3Y A;  3ZGK A;  2BE5 F;  4OD4 A;  1WHU A;  2HNH A;  3O8H A;  1DPU A;  2VXD A;  1R36 A;  4O5V A;  3IHU A;  1BI2 A;  2W82 A;  1ZN2 A;  2PFV A;  9ANT A;  1ZRF A;  3MQ0 A;  4PJJ A;  2XAG A;  2GEN A;  2F48 A;  1HCR A;  4LMY A;  1U8R A;  3GEZ A;  1U3E M;  1IXC A;  1KGS A;  3A03 A;  1TZL A;  5H6Q A;  1BC7 C;  3HB9 A;  2P0W A;  2MLG A;  2QYO A;  3HOT A;  2O8K A;  1OCP A;  2LKP A;  3UKG A;  2GUH A;  5FKO A;  3CCM I;  1GHC A;  4KA4 A;  3QBM A;  1ETX A;  1BBY A;  5EYR A;  4DYC A;  1QHG A;  2MBF A;  1LB2 A;  5ICF A;  2XRL A;  1JUS A;  1T6S A;  3B6C A;  1OCC H;  4ESB A;  1ACI A;  2ISY A;  1VQN I;  3P9T A;  3E5X A;  4Y15 A;  4G94 A;  4RS8 A;  3JRE A;  2DTR A;  4BY1 J;  3TED A;  5DAJ A;  1TNT A;  1XMX A;  1MKM A;  1K78 B;  3BRU A;  3IH3 A;  2IS6 A;  4K2E A;  2A6E F;  5L3F A;  4MHG A;  4II2 A;  4BBS J;  5JLX A;  1BOB A;  4U0Y A;  4NC8 A;  3K7A J;  4PJ0 C;  2QLZ A;  4LB5 A;  3IH2 A;  4CZZ A;  3TO9 A;  4RLF A;  3S32 A;  2DPU A;  1IUF A;  2K27 A;  1IAW A;  3QKX A;  2WAQ N;  3ISP A;  3K9T A;  4UB6 C;  5HOO A;  4I2O A;  2CV2 A;  2FD5 A;  3DTK A;  1NK2 P;  3CJD A;  2PFB A;  1VQ8 I;  4U9L A;  1R7J A;  1MIJ A;  1MNE A;  3SJM A;  4ENK A;  2OQG A;  4A3I J;  1D8K A;  2LSO A;  4MTE A;  3CCR I;  2E60 A;  4A6E A;  2JZY A;  1DU6 A;  2JK3 A;  1LVA A;  1B59 A;  2XGC A;  1ETV A;  5H20 A;  4IRI A;  3V4G A;  2FBH A;  2EIL H;  3OYK A;  1LE8 B;  3BR3 A;  1SAX A;  2R7Z J;  3IRQ A;  2K4J A;  2UV1 A;  4HOB A;  4IL6 C;  1Z9C A;  3COL A;  3OIO A;  2KHM A;  1FYK A;  3ZQ7 A;  2TDX A;  2KFD A;  3U9G A;  2F2E A;  2FEZ A;  4NQW B;  1P4A A;  3CF2 A;  4L5E A;  4L9J A;  3HOX J;  2BXZ A;  4S05 A;  3F8C A;  3T1B A;  4ZDO A;  3OMY A;  3TOB A;  2CV0 A;  1HKT A;  2RNJ A;  4EM1 A;  5E3L A;  2VL8 A;  1YX3 A;  3S1M J;  3PL8 A;  3A02 A;  5D4R A;  5BPD A;  2DI3 A;  2KJB A;  2P7V B;  3TP3 A;  2STW A;  2LC2 A;  2ZOY A;  1SFX A;  4M9Z A;  4LG3 A;  5B1B H;  4BAC A;  1D5Y A;  1LFB A;  3AQS A;  2CMP A;  2W84 A;  5IP9 J;  1P4W A;  2YU3 A;  3BJO A;  4XRS A;  5EZG A;  2EB7 A;  4A0X A;  1POG A;  4RBO A;  2RHA A;  3GTK J;  1OKR A;  2G3B A;  2FNA A;  2EZK A;  3F8N A;  5D6E A;  4BE0 A;  1D1A A;  2EFN A;  1A5J A;  3TO6 A;  3WU0 A;  2X6W A;  3DQV C;  1EKE A;  1FMV A;  3S1R J;  4DBR A;  4ESF A;  1TW2 A;  2V7F A;  4MLO A;  2B9S A;  3GBG A;  3S3M A;  5FHP A;  2K86 A;  4Y13 A;  4C9Y A;  3ANG A;  3SFZ A;  2DT6 A;  4DOZ A;  1YOV B;  3SXY A;  2L9N A;  4KDP A;  3M4O J;  2XAF A;  2V9P A;  2PMZ A;  3IL2 A;  2QTQ A;  4WCG A;  2V9V A;  4E7Z A;  5KAI C;  1ETQ A;  2JUC A;  2MD0 A;  3L2C A;  2Y30 A;  2P5V A;  1IN4 A;  4XMY A;  4D5F A;  1WJB A;  4XSZ F;  4CYC B;  3U1D A;  1E3H A;  1XCB A;  2E7X A;  1QA6 A;  2WY7 Q;  4AVZ A;  3ZMT A;  3T8T A;  3KEQ A;  3DLA A;  3ZMV A;  3DP7 A;  4PZJ A;  1D5V A;  3AAF A;  2LTP A;  1XSV A;  2EPF A;  3KYC B;  5J4Y A;  2DW4 A;  1I50 J;  1IRX A;  2EIJ H;  4XM3 A;  2UXO A;  3JRH A;  3I64 A;  4NUB A;  3N97 A;  3VUQ A;  4BHB A;  4CCK A;  1SVO A;  1ZG5 A;  3WG9 A;  4IHT A;  1O3S A;  1MBH A;  3FK6 A;  4MQ9 F;  1FTT A;  2EIK H;  2IBD A;  4JNN A;  2E2J J;  2WGB A;  2RQP A;  3ELK A;  5JFR A;  3JRF A;  1B6A A;  1XGS A;  4IZZ A;  3S1N J;  2H6B A;  4J01 A;  3OYD A;  3FRQ A;  4IQ4 A;  2CUE A;  2B63 J;  5AIP A;  1FSE A;  2B3W A;  5LLQ A;  2HDC A;  3RZO J;  1KQ8 A;  3VB2 A;  2A2F X;  1R1T A;  4Q47 A;  3K8P C;  3K70 D;  2GBY A;  4LK1 F;  4XNF A;  1LDJ A;  1A6I A;  2ACJ A;  1V3F A;  4RMN A;  4XSX F;  5HDK A;  1G59 A;  3HTU A;  2IS1 A;  4ENJ A;  2TCT A;  2ZME B;  2R7O A;  5ILV A;  1HBX G;  4A3L J;  2BW3 A;  4EJO A;  1JUM A;  2EV5 A;  3BG6 A;  3JSP A;  2XIG A;  3FDY A;  2ISZ A;  2Z2S B;  3ZQF A;  2FQ4 A;  2Q0O A;  4DGW B;  3G1M A;  5CYV A;  5HLT A;  2P7C B;  5L3B A;  1SGM A;  2Q1Z B;  2BY2 A;  2NAZ A;  3CJQ B;  3RIR A;  4E70 A;  2I10 A;  5HNF A;  2XB0 X;  3BRO A;  3U1K A;  2OI8 A;  4LLG F;  4YRV A;  3FXL A;  1N75 A;  2A5W A;  1BN5 A;  1X58 A;  2X1C A;  3CUQ B;  2KZG A;  3K2Z A;  4Y3O A;  4ANJ A;  3GTG J;  2DA4 A;  3LJL A;  3QP5 A;  5DTD A;  4P5O A;  4RAY A;  1GUU A;  5DD4 A;  2LP0 A;  4EAT A;  5J8F A;  2L7Z A;  3DBL B;  1PVE A;  3CJT B;  5BPI A;  4F92 B;  4A3G J;  2GOM A;  3OYJ A;  2LOO A;  2K5C A;  4OMZ A;  3JAM Z;  2VKD A;  2DU9 A;  2PN6 A;  1QNT A;  4U0V A;  3BG9 A;  4RGR A;  3K4M A;  1HW1 A;  1YS7 A;  3S3N A;  2W24 A;  5B3S H;  4ZZD A;  4MIM A;  3JAM K;  3OWT A;  2P5K A;  1U78 A;  3W2V A;  5LD2 C;  1SD5 A;  2O9L A;  3HEF A;  2GLO A;  1UCR A;  5L3D A;  3ZQL A;  2HKX A;  1EH6 A;  1FLI A;  3BPX A;  5K7H A;  1R49 A;  2EBI A;  1OIS A;  5LEK A;  3FXO A;  2QQB A;  3CES A;  4EJW A;  1S8N A;  4LJZ F;  4IHX A;  1SVM A;  2EJR A;  3QOD A;  2VJJ A;  1HXD A;  2R5Z A;  1FTZ A;  4H0E A;  3NRV A;  4MO7 A;  3MKW B;  1BA5 A;  2M9H A;  2K85 A;  2IPQ X;  2FRH A;  1E17 A;  1T95 A;  2W00 A;  3KP7 A;  1WFX A;  3ESW B;  4PK4 A;  4UVB A;  1ETW A;  4EEF G;  3ON2 A;  4UUS A;  4PDK A;  4UV8 A;  4W97 A;  1MJA A;  5L3G A;  3VWB A;  1K6O A;  1IXR C;  1R6R A;  3WG7 H;  3K1N A;  3R60 A;  3DEE A;  2UXH A;  3RPQ A;  4ENN A;  3WE3 A;  1YIT I;  4P1W A;  4ICH A;  2R7Q A;  2YSR A;  3KCC A;  4GXO A;  3BZ6 A;  3CCU I;  4IHY A;  1M1E B;  2X4H A;  4U87 A;  5E1X A;  3OR1 C;  4XN0 A;  1VQ7 I;  3JRI A;  3FIS A;  1RUO A;  4CYC A;  5EGO B;  3R4K A;  2FOW A;  4GGG A;  2FBQ A;  1ETO A;  3BTL A;  3OV8 A;  5FRN A;  1OYW A;  3ZQH A;  3S14 J;  1ON1 A;  5M5X J;  4CYD A;  4JKZ A;  3EUA A;  5AIQ A;  1LDK B;  1WI9 A;  2HQR A;  4L5J A;  1IN8 A;  3RI4 A;  1TTY A;  3KZY A;  2HFH A;  2WUI A;  2KRF A;  2CFX A;  5K7Z A;  2VON A;  2DMP A;  4D5C A;  3RKW A;  1U9O A;  1TT5 B;  3A0B C;  3HSR A;  1AWC A;  1Y0U A;  5ICG A;  4EGY A;  3CMM A;  2XVC A;  2R7D A;  3C18 A;  2R7F A;  2MYS A;  1Z3X A;  3H35 A;  4W1U A;  2VT2 A;  2ZME A;  3BG5 A;  3LOC A;  5DV5 A;  2XF7 A;  4NDL A;  3JRB A;  3H9Q A;  1N77 A;  3ON4 A;  4UVA A;  5FMP A;  2VQL A;  3I59 A;  2HKU A;  2DA5 A;  5K1Y A;  1IW7 F;  1B8I B;  2GFN A;  2CU7 A;  3I56 I;  3GUD A;  2F5V A;  2JVH A;  5CLS A;  3ERM A;  5E1W A;  3HXL A;  4QIW N;  3I4M J;  1O4X A;  1OFC X;  2DA1 A;  3HBL A;  1JT6 A;  2O8X A;  2FBI A;  3KZI C;  3OR2 C;  1QRY A;  3H3V K;  4IOC F;  5E18 F;  1O3T A;  4OIQ F;  2NOJ B;  3V6G A;  4CCN A;  3I4N J;  3ZCO A;  1WJ5 A;  2MD5 A;  5FGL A;  4UB8 C;  3BTJ A;  2EK5 A;  3GZN B;  1ON2 A;  4DZP A;  2COB A;  2ZXW H;  3CD6 I;  1MMN A;  2X85 A;  3BWG A;  3LSG A;  1ENH A;  2WA0 A;  3JSJ A;  2VKE A;  3VVY A;  2V79 A;  3D0S A;  1OYI A;  3BJ6 A;  2RRE A;  2R92 J;  3BJA A;  4X6A J;  4ZH4 F;  5IOZ A;  2CFO A;  4KN7 X;  4HLY A;  3BT9 A;  2V4J C;  2VQC A;  4XKB A;  1GDT A;  3R6S A;  1KU2 A;  4WX9 A;  2AS5 F;  4CGR A;  1N25 A;  4DW6 A;  2KT0 A;  2E34 A;  4HF1 A;  2WB1 N;  2PBI A;  2Z16 A;  1CQT A;  3J7Y J;  2QBY A;  5J47 A;  3DF8 A;  4FE7 A;  3ROU A;  2P6S A;  4MXM A;  4B3A A;  2O7O A;  3CO7 C;  2YVX A;  1TP4 A;  3CDI A;  3GO5 A;  5F1J A;  3VEP A;  1YHQ I;  1D8J A;  5D18 A;  2KDO A;  2QVO A;  3TW6 A;  3EPZ A;  2R4G A;  2CRG A;  3AG3 H;  3C3W A;  4MFD A;  4P96 A;  1F4K A;  1VTN C;  4LD5 A;  1E3P A;  5JR3 A;  1X3Z B;  1X1B A;  2HOA A;  1FZP B;  3F0C A;  4II3 A;  4YZE A;  4F91 B;  1V55 H;  1H0M A;  1Y1V J;  1UHW A;  4HG2 A;  4IF4 A;  2FQ3 A;  4C30 A;  3PFI A;  2Y31 A;  5ICC A;  1FY7 A;  4YIF A;  2AXT C;  3KYD B;  3ZMZ A;  4GFL A;  5C44 J;  4FAS D;  5GAH J;  5LHI A;  1P6R A;  2GIV A;  3F8M A;  3WGG A;  1ZH5 A;  1XS9 A;  4XBF A;  1HLV A;  4BQQ A;  3BQY A;  3V7S A;  1AKH A;  1JI8 A;  2PJR A;  3B73 A;  1IDY A;  2FBK A;  3G56 A;  4HX7 A;  1XX5 A;  4XRF A;  1J2X A;  2EFO A;  1P7J A;  3ZQG A;  2X0L A;  2X6X A;  3E5U A;  3S5R A;  4BHP A;  4BXF A;  5IT9 K;  3KPH A;  4U9N A;  3J80 K;  4WWC A;  1XTA A;  3COA C;  3GTP J;  3RH2 A;  4LLL A;  3CMA I;  1FBQ A;  2PJP A; 
#chains in the Genus database with same CATH homology
 2XB5 A;  2IAI A;  5E3O A;  4HNV A;  5M3F J;  3O8H A;  2DMU A;  1NTC A;  1H8A C;  3HTI A;  9ANT A;  3CMY A;  2G7S A;  2XPW A;  1APL C;  3HM5 A;  3PO3 J;  2GEN A;  1HCR A;  3A03 A;  2JA7 J;  4V2G A;  5IYC J;  3VOK A;  2O7T A;  3HB9 A;  3NRG A;  3HOU J;  4JX4 A;  2O8K A;  4XK4 A;  1OCP A;  5M5Y J;  1Q1V A;  3UKG A;  2GUH A;  5FKO A;  4A3K J;  4M3D A;  2ME0 A;  1MBJ A;  3QBM A;  1ETX A;  2K9S A;  5EYR A;  4DYC A;  4J19 A;  2Y0S N;  1AHD P;  1NK3 P;  2XRL A;  2HOS A;  2HYT A;  1JUS A;  4XIC A;  3F1B A;  3B6C A;  2MGQ A;  1XG1 A;  2ZB9 A;  3NAU A;  5HAW A;  1H88 C;  3DCF A;  3P9T A;  1TWF J;  1JJ6 C;  2H8R A;  5C3E J;  3JRE A;  5DAJ A;  4BY1 J;  3TED A;  3HOZ J;  3BRU A;  2L7F P;  1QVU A;  3OSG A;  1JT0 A;  2QIB A;  2JN6 A;  3IH3 A;  1RR7 A;  3GEU A;  2XDN A;  1X2N A;  4A3F J;  4A3J J;  4BBS J;  5JLX A;  1VFC A;  4A3B J;  3K2A A;  3K7A J;  5F04 A;  2NVT J;  4A69 C;  3IH2 A;  1TWG J;  4PXI A;  3PAS A;  3LSR A;  1MH3 A;  1IUF A;  1F43 A;  3QKX A;  4NN1 A;  2OER A;  2WAQ N;  4I76 A;  3S15 J;  4GFK A;  1MBF A;  4GFB A;  2FD5 A;  1NK2 P;  3CJD A;  3OSF A;  3GTO J;  1ZK8 A;  1JGG A;  3JRD A;  3CCY A;  5E3M A;  2EQR A;  3SJM A;  4A3I J;  1H89 C;  2E2H J;  3TP0 A;  3W6V A;  2R0Q C;  2CJJ A;  3S16 J;  4I6Z A;  2G0E A;  3S1Q J;  5AQC A;  3HOY J;  2UXI A;  1DU6 A;  2JK3 A;  1GV5 A;  2XGC A;  5HSZ A;  1ETV A;  2JA6 J;  4XID A;  1GT0 C;  1LE8 B;  1XC5 A;  3BR3 A;  2LY9 A;  2R7Z J;  3BHQ A;  3H0G J;  2DA7 A;  3BTC A;  5GPA A;  3COL A;  3OIO A;  2QWT A;  3BCG A;  2ME6 A;  2HQ5 A;  2QCO A;  1DU0 A;  4L5E A;  3HOX J;  2DTZ A;  3BQZ A;  2ZCX A;  3PM1 A;  3HE0 A;  1BW6 A;  1B72 A;  3LHQ A;  4ACI A;  1TWH J;  5CXI A;  2JWT A;  4B1R A;  2NP3 A;  5E3L A;  2JMW A;  4M6V A;  2QOP A;  3HOW J;  3S1M J;  3A02 A;  4BY7 J;  5FKM A;  4A3E J;  1FEX A;  3TP3 A;  4A3M J;  3CQZ J;  2E2I J;  4B4C A;  1OCT C;  2ZOY A;  3RD3 A;  2R5Z B;  3SDG A;  2LKX A;  1D5Y A;  3E7L A;  1LFB A;  2EZI A;  3AQS A;  3T6N A;  5IP9 J;  2ZCM A;  5FLM J;  4XRS A;  5EZG A;  4RBO A;  2RHA A;  1POG A;  3GTK J;  1WCM J;  2G3B A;  2EZK A;  1WGX A;  2VUM J;  3NI7 A;  4QTR A;  2N8G A;  1A5J A;  5FJ8 J;  3S1R J;  3QPL A;  5GP9 A;  1WPK A;  4MLO A;  3VIB A;  1MH4 A;  3GBG A;  3QPS A;  1W0T A;  5FHP A;  3ANG A;  3WHB A;  1GV2 A;  1W0U A;  3GZI A;  2REK A;  2DA2 A;  2M34 A;  4FCY A;  3M3Y J;  3M4O J;  5J3L A;  2YVH A;  5FKK A;  4JX6 A;  2XPU A;  2QTQ A;  1S7E A;  1ETQ A;  3NXC A;  2Y30 A;  1HDD C;  3IH4 A;  2Y9Y A;  4D5F A;  4DYR A;  2EH3 A;  2D5V A;  4ME9 A;  2EZH A;  5BNG A;  1TWA J;  4CYC B;  2MW8 A;  1MBE A;  4LOC A;  3GTQ J;  5FKL A;  5IOY A;  3LNQ A;  1UI6 A;  1BW5 A;  2LFB A;  3CWR A;  2DMT A;  4UDS A;  2LTP A;  3JR9 A;  3NNR A;  3TW7 A;  1E3O C;  1ETK A;  3MN2 A;  3HTA A;  3ON2 A;  1I50 J;  2UXO A;  2M8G X;  4XRM A;  4S0H B;  3JRH A;  3GTM J;  4AYB N;  1X2M A;  4Y7N J;  3VUQ A;  2HOT A;  4DYQ A;  2ECC A;  4FE4 A;  3B6A A;  5D1R A;  5EDN A;  4C3J J;  1MBH A;  5IP6 A;  3EUP A;  3FK6 A;  1FTT A;  2LLK A;  2IBD A;  4JNN A;  2E2J J;  2WGB A;  2ZOZ A;  4GCL A;  3JRF A;  3S1N J;  3DPJ A;  1ZR4 A;  5IYB J;  3FRQ A;  1JUP A;  2CUE A;  2B63 J;  1WH5 A;  3VOX A;  5J1U A;  2G7L A;  4DZJ A;  3LSJ A;  2DA6 A;  2M0C A;  3RZO J;  1BJZ A;  1K83 J;  1VF9 A;  1ZQ3 P;  3HOV J;  4C2M J;  2ECB A;  4D7N A;  2FX0 A;  2GBY A;  2K40 A;  1A6I A;  2ID6 A;  3BR0 A;  3HTJ A;  3ZQC A;  2LK2 A;  2M2E A;  4ABZ A;  4AF5 A;  2YUS A;  1UG2 A;  1HDP A;  5K58 A;  2TCT A;  4Y52 J;  1VND A;  5F27 A;  3FK7 A;  4A3L J;  4C3H J;  1WI3 A;  2F07 A;  2PBX A;  3MKL A;  1JUM A;  2FJ1 A;  1T56 A;  2DG7 A;  3ZQF A;  2FQ4 A;  3G1M A;  3HDD A;  5DS9 A;  1JKQ C;  1SGM A;  1RPW A;  1IJW C;  2E1O A;  2I10 A;  5HOD A;  5FKN A;  5M5W J;  4BXX J;  5FLV A;  2HI3 A;  2RAE A;  3GTL J;  2XB0 X;  2JA5 J;  4KWA A;  2OI8 A;  4FTH A;  1X58 A;  2LVS A;  3GTG J;  2DA4 A;  3LJL A;  3L1P A;  5HBU A;  2AHQ A;  3ANP A;  5DTD A;  4JL3 A;  1GUU A;  2LP0 A;  3EGQ A;  4HKU A;  2W53 A;  2L7Z A;  2V57 A;  1JTY A;  4A3G J;  3KKC A;  2K9Q A;  1IV6 A;  5CXG A;  5J1R A;  3VW0 A;  3SFI A;  3BG9 A;  2XSD C;  1MBK A;  4MIM A;  3FKI J;  1JKO C;  1SAN A;  1U78 A;  1TWC J;  2L7M P;  2NOG A;  1ETY A;  3IUV A;  2O9L A;  2YU9 J;  3HEF A;  2GLO A;  1I6H J;  3ZQL A;  4MK6 A;  2GM4 A;  5K7H A;  2EBI A;  3D1N I;  4IHX A;  2R5Z A;  3RKQ A;  1FTZ A;  2CUF A;  1AKH B;  4MO7 A;  2HDD A;  1BA5 A;  2M9H A;  3B81 A;  2UXU A;  1K61 A;  1P7I A;  5C4J J;  3QQA A;  4EEF G;  1ETW A;  2EZL A;  4MFE A;  1LE8 A;  3KNW A;  1RKT A;  4UUS A;  2LD5 A;  5IYD J;  4W97 A;  3HIM A;  2YS9 A;  1QPI A;  5IP7 J;  4GCT A;  2R93 J;  3JRA A;  2R5Y A;  4M3B A;  4JP0 A;  1VI0 A;  2UXH A;  2IU5 A;  3VW1 A;  2Q24 A;  1IC8 A;  5C4Y A;  2VPR A;  4ICH A;  3LSP A;  4G12 A;  3JRC A;  1MSE C;  1IDZ A;  1UMQ A;  3G7R A;  1RKW A;  5M3M J;  2DJN A;  4IHY A;  2PMZ N;  2R5Y B;  1B8I A;  3JRI A;  3FIS A;  3V78 A;  4CYC A;  5EGO B;  2CQQ A;  2E19 A;  2XPV A;  1AU7 A;  5D19 A;  2FBQ A;  2UXP A;  1IG7 A;  1IGN A;  1ETO A;  3BTL A;  2DMN A;  3ZQH A;  5CW8 A;  5F0H A;  3C07 A;  3S14 J;  1FIA A;  1RET A;  5H9T A;  5M5X J;  2H1K A;  4A3C J;  4JKZ A;  1F36 A;  2P81 A;  2OPT A;  3KKD A;  3Q0U A;  3PO2 J;  5F0F A;  2CQX A;  1JTX A;  2W48 A;  5C4X J;  2WUI A;  3BJB A;  5K7Z A;  2DMP A;  2VKV A;  1JKP C;  4D5C A;  4JYK A;  2ZCN A;  1U9O A;  2NVX J;  4C3I J;  4IHV A;  2HXI A;  1BL0 A;  3C2B A;  2YVE A;  1JKR C;  4A3D J;  1ZKG A;  2WV1 A;  1MBG A;  4NEL A;  2DG8 A;  3LWJ A;  3VVZ A;  2Y2Z A;  4W1U A;  1UI5 A;  3CRJ A;  3BG5 A;  3LOC A;  2Y9Z A;  4XRS G;  3MVP A;  3ZOB A;  3Q0V A;  4QSH A;  3DEW A;  4NDL A;  1FIP A;  3JRB A;  4GCK A;  1MNM C;  3ON4 A;  3HGG A;  5FMP A;  3KZ9 A;  2HKU A;  2DA5 A;  1YRN A;  3VW2 A;  2NVQ J;  2TRT A;  1EF4 A;  2X6O A;  1B8I B;  2GFN A;  2MSY A;  4JX5 A;  2NX4 A;  2CU7 A;  3IV5 A;  2KDZ A;  5EFY A;  4AC0 A;  1QVT A;  4QIW N;  3I4M J;  1O4X A;  1OFC X;  1Z0X A;  2DA1 A;  3HBL A;  1JT6 A;  2L9R A;  1QRY A;  3H3V K;  3BR2 A;  3BR5 A;  3BNI A;  3BG3 A;  3V6G A;  3I4N J;  3Q3S A;  3RQI A;  5FGL A;  3PPB A;  3BTJ A;  3VPR A;  5GPC A;  4M3G A;  4DZP A;  2NVY J;  1FJL A;  2COB A;  2OF7 A;  5EEA A;  4UUS B;  4IHW A;  3LSG A;  1ENH A;  3JSJ A;  2DA3 A;  2VKE A;  2XGE A;  5F0C A;  1YRN B;  3A01 B;  2R92 J;  2DN0 A;  2AO9 A;  3VVY A;  1I3Q J;  3RZD J;  4BKX A;  4X6A J;  5JLW A;  1IRZ A;  5F08 A;  5IOZ A;  3OOU A;  2PZ9 A;  3BT9 A;  4D7M A;  1GVD A;  3HTH A;  1GDT A;  4CGR A;  3ZQI A;  3FIW A;  1Y1W J;  4DW6 A;  2KT0 A;  2WB1 N;  1UHS A;  1CQT A;  3S2D J;  3G1L A;  3BR1 A;  3WHC A;  4FE7 A;  3CDL A;  5EG0 A;  4MXM A;  5EGO A;  4B3A A;  1WH7 A;  1OJL A;  2NS7 A;  2O7O A;  1PUF B;  4M3F A;  5D18 A;  5F1J A;  5K7F A;  3TW6 A;  2JA8 J;  1ZR2 A;  3A01 A;  2CRG A;  4MFD A;  2QF7 A;  3Q0W A;  2HOA A;  4A93 J;  1LFU P;  5IPA A;  3F0C A;  2ELK A;  4X1E A;  4YZE A;  1RES A;  1ZGW A;  1T33 A;  2X48 A;  2L0K A;  3G1O A;  3JRG A;  2DMQ A;  4UUT A;  5E3N A;  1Y1V J;  2IEK A;  3NPI A;  2K9N A;  4BBR J;  4V2F A;  1ORK A;  3GTJ J;  2QKO A;  2ID3 A;  3S2H J;  4AC6 A;  3VP5 A;  4FIS A;  2NS8 A;  2Y31 A;  3S17 J;  4RDU A;  4M3E A;  1PUF A;  1G2H A;  4GFL A;  3HGY A;  5C44 J;  1Z77 A;  2MG4 A;  3O60 A;  1B72 B;  2D6Y A;  5EF6 A;  2HXO A;  1XS9 A;  3BTI A;  4IEJ A;  2HYJ A;  1HLV A;  1HF0 A;  3BQY A;  3NAR A;  1AKH A;  3VVX A;  1MSF C;  2XGD A;  1TC3 C;  3HKZ N;  5EZH A;  1IDY A;  5EG0 B;  1HOM A;  3G56 A;  2VI6 A;  3E7Q A;  2X9D A;  1ZTR A;  4AUX A;  5J1Y A;  2G7G A;  1U8B A;  2LR8 A;  1P7J A;  3ZQG A;  1R9T J;  3S5R A;  3O8G A;  1SFO J;  2RAS A;  3AQT A;  2JJ7 A;  1U9N A;  3GTP J;  4L62 A;  3BR6 A;  1JJ8 C;  3MNL A;  3RH2 A;  2NP5 A;  1ITY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...