1JT0A

Crystal structure of a cooperative qacr-dna complex
Total Genus 69
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
69
sequence length
188
structure length
188
Chain Sequence
NLKDKILGVAKELFIKNGYNATTTGEIVKLSESSKGNLYYHFKTKENLFLEILNIEESKWQEQWKKEQIKAKTNREKFYLYNELSLTTEYYYPLQNAIIEFYTEYYKTNSINEKMNKLENKYIDAYHVIFKEGNLNGEWSINDVNAVSKIAANAVNGIVTFTHEQNINERIKLMNKFSQIFLNGLSKH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords QACA operator
publication title Structural basis for cooperative DNA binding by two dimers of the multidrug-binding protein QacR.
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Transcription/dna
total genus 69
structure length 188
sequence length 188
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2001-08-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00440 TetR_N Bacterial regulatory proteins, tetR family
A PF08360 TetR_C_5 QacR-like protein, C-terminal region
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 1jt0A01
1.10.357.10 Mainly Alpha Orthogonal Bundle Tetracycline Repressor; domain 2 Tetracycline Repressor, domain 2 1jt0A02
1LFBA 1GV5A 2D5VA 1JTXA 2LFBA 2WB1N 3EUPA 5F08A 3RH2A 4A69C 2M34A 1ETKA 4A3KJ 1ITYA 2MW8A 4Y7NJ 1JUSA 5K7ZA 3IUVA 1IJWC 4A3EJ 3KKCA 4NDLA 3GTMJ 5H9TA 2QWTA 3BR0A 3VVYA 1MBFA 2YVEA 2DG8A 3JRIA 2CU7A 3G1OA 5E3MA 4J19A 5CXGA 2OI8A 1EF4A 5IPAA 2OPTA 2Y0SN 3CRJA 5J1UA 3V6GA 2I10A 2ZCNA 5JLXA 2DA5A 5EG0A 3ZQLA 1ETXA 3BG3A 3ANPA 4ME9A 5K58A 1DU6A 2O7TA 5HSZA 2K9SA 5JLWA 2R5ZB 2XPVA 1YRNB 2K9QA 3BNIA 2L0KA 2O7OA 4IHXA 3P9TA 5IP9J 2DG7A 3FK6A 2M2EA 1ZK8A 2TCTA 1UI6A 5IOZA 3IH4A 2GLOA 4AC6A 1HCRA 4GCLA 4MXMA 3MKLA 1RKWA 5FKKA 2ZOZA 3KNWA 1ETOA 3BTJA 3BTLA 3LSJA 5IYBJ 4BY1J 1U9OA 1JKPC 2MSYA 2F07A 1WGXA 4S0HB 1JKRC 3CWRA 3JR9A 5C3EJ 3OSGA 3D1NI 2H8RA 3HTHA 3A01B 1K83J 4NELA 2NS7A 3BRUA 4DW6A 3OSFA 4M3BA 3ZQIA 1OJLA 1F36A 2NX4A 3GTJJ 4AYBN 4JYKA 4YZEA 1WCMJ 2DMTA 4B1RA 1PUFA 2HXIA 3HOXJ 2R5ZA 2VKEA 3JRCA 2GBYA 3HIMA 2WGBA 3CQZJ 5HODA 1YRNA 3G7RA 2HOSA 1IDZA 1JT6A 1IC8A 2M8GX 5HBUA 1JKQC 1FJLA 2YUSA 3BR3A 5F1JA 2CUFA 1X58A 2XGDA 2CQQA 1X2MA 2CJJA 2MG4A 4QTRA 2W53A 2YVHA 1T56A 4GCTA 1IGNA 4MIMA 1Y1VJ 5F27A 3JSJA 5IP7J 5FKNA 3SJMA 1H89C 3HOVJ 3FISA 1Z0XA 1APLC 4G12A 1VF9A 5FLMJ 3JRGA 1HLVA 2XPWA 2NVXJ 2IBDA 1AKHB 4DYRA 3L1PA 3CMYA 2R5YB 1FIAA 4AUXA 4A3CJ 2EZLA 3A01A 5EYRA 2E2JJ 1SANA 2ID6A 2LR8A 4QIWN 2NP5A 1B8IB 1W0TA 1ETWA 3C07A 1RESA 3I4NJ 1MBKA 5F0FA 3VVZA 4A3DJ 3WHCA 1JT0A 3BR1A 3H0GJ 1BJZA 2EZIA 2E2HJ 2L7ZA 1BA5A 2ECCA 3S15J 1MH3A 4QSHA 4BKXA 4JX5A 1Y1WJ 3JRFA 1I3QJ 2UXUA 4V2FA 3GTQJ 3FIWA 4M3GA 2XRLA 4C3HJ 3BCGA 2LP0A 1JJ6C 1IDYA 1HF0A 2HYJA 2NS8A 2DMNA 1R9TJ 2ME0A 3S14J 4AF5A 2DA3A 3RZDJ 3TW6A 4B3AA 2FJ1A 1FTTA 4HKUA 2ZB9A 5AQCA 3MNLA 2GFNA 3JRBA 1P7IA 5D1RA 4CYCB 4ABZA 2EZKA 4C3JJ 2KT0A 4V2GA 5K7HA 4A3GJ 3QKXA 4XRSG 2FQ4A 3S1MJ 2Q24A 3NARA 4B4CA 3ZQGA 2M0CA 3ZQHA 1NK3P 4IHVA 2YS9A 3A03A 4M3FA 1AKHA 3BT9A 3Q0UA 1ETYA 2R5YA 2VPRA 4GFBA 4JL3A 4ICHA 4DYQA 2DMPA 3CDLA 2RASA 1MBEA 2L7FP 2R7ZJ 5BNGA 4CGRA 3GTKJ 3ON4A 3S1NJ 4FE4A 4M3EA 4UUSB 1B8IA 2DA2A 3LWJA 4MK6A 1VNDA 3B6AA 2DMUA 4LOCA 3JRAA 5J1RA 2QIBA 3O8GA 3S2DJ 2UXHA 4GFKA 1B72B 3UKGA 1ETQA 3VVXA 3BTIA 2DJNA 3HDDA 1MBJA 3ANGA 4UUTA 1XG1A 3H3VK 4BXXJ 2HQ5A 3E7LA 2HOAA 3GTLJ 3F1BA 2CRGA 5CW8A 2RAEA 1LFUP 5D19A 4JP0A 2HKUA 3G1MA 4D7NA 3HTAA 3FKIJ 1GVDA 2LK2A 3FRQA 3PASA 4MLOA 3ON2A 1K61A 2XGCA 2DTZA 2Y2ZA 3W6VA 4CYCA 3NI7A 3S16J 3PPBA 3RKQA 1WH5A 2XB0X 2KDZA 2HYTA 1JTYA 2IAIA 3BQYA 4D7MA 1HDPA 3LSPA 1MSEC 2B63J 3G1LA 1TWGJ 1ZGWA 1IRZA 3Q0VA 2JA5J 2E19A 1ZR2A 3K2AA 1TWCJ 4UUSA 4X6AJ 3TW7A 3M3YJ 4XICA 5EEAA 2R93J 1Z77A 2M9HA 1QPIA 2G7GA 2QTQA 3HB9A 4MFDA 3LSGA 3ZQFA 3RQIA 2YU9J 4L62A 2IEKA 5K7FA 1BW6A 3BQZA 4IEJA 3HOWJ 3LNQA 3ZOBA 2Y9ZA 4AC0A 1B72A 1MH4A 2ECBA 2LTPA 5IYDJ 1WPKA 2ZOYA 2FD5A 2QF7A 2O8KA 4JX4A 2UXIA 5D18A 1AHDP 1A6IA 1U78A 2NP3A 3IV5A 3BHQA 2Y31A 5M3FJ 1I6HJ 3NAUA 1H88C 5GPAA 1XS9A 2E2IJ 3NXCA 2PBXA 1JUPA 4FE7A 2EQRA 5DTDA 1ENHA 2MGQA 1MBGA 5FKLA 4ACIA 1P7JA 3NNRA 1OCTC 3Q3SA 2D6YA 1HOMA 1U9NA 1IV6A 3PM1A 4A3JJ 2QKOA 2DN0A 3GTPJ 3BR2A 4XRMA 3E7QA 2NVQJ 2AHQA 1MBHA 4HNVA 5FLVA 5J3LA 1VFCA 1QVTA 3AQTA 1RKTA 2LY9A 1I50J 2QCOA 2DA1A 3HOZJ 4UDSA 3VOKA 4M6VA 1TC3C 4BY7J 3LHQA 3RZOJ 3A02A 2DA4A 4A93J 2ELKA 5C4XJ 3NPIA 2W48A 3O60A 2EZHA 2CQXA 1GT0C 5FJ8J 1GDTA 3IH2A 2TRTA 1ETVA 4IHWA 3WHBA 4C3IJ 3Q0WA 4I6ZA 4D5FA 3OOUA 1IG7A 5C4YA 3HE0A 5M3MJ 3COLA 2X9DA 1ZTRA 5EZGA 1JJ8C 1NTCA 3K7AJ 4FISA 5EF6A 5FMPA 2CUEA 4BBSJ 3JRHA 2COBA 1JKOC 4C2MJ 2LD5A 3HGGA 1VI0A 2DA7A 4XIDA 3HEFA 1NK2P 3I4MJ 3LSRA 2REKA 5M5WJ 4RDUA 5FGLA 1CQTA 3AQSA 2JJ7A 2JK3A 3V78A 5IP6A 2UXPA 3LOCA 2HXOA 5EZHA 3VW0A 2AO9A 5DS9A 5IOYA 2JA6J 1OFCX 3RD3A 4FCYA 1UI5A 3CCYA 1UHSA 2X48A 5FKMA 2XSDC 3S5RA 2H1KA 1U8BA 9ANTA 1W0UA 3VW2A 3TEDA 2DA6A 1G2HA 3KKDA 1DU0A 4D5CA 1D5YA 2GM4A 5C44J 4Y52J 5DAJA 1GUUA 3QBMA 1Q1VA 2XPUA 1JGGA 1JUMA 3IH3A 5E3LA 3BTCA 1XC5A 3QQAA 3JRDA 4MO7A 1LE8B 3HBLA 2VI6A 2G3BA 1RETA 3HOYJ 1ZQ3P 1FTZA 1BL0A 2JA7J 5HAWA 1SFOJ 3MN2A 4PXIA 1FEXA 1POGA 1PUFB 2ME6A 2E1OA 2IU5A 4DYCA 3LJLA 4RBOA 3EGQA 2HI3A 2K9NA 2DMQA 2WV1A 2RHAA 3BR6A 3S1QJ 2ZCMA 2LKXA 4A3LJ 3GTOJ 2WAQN 2LVSA 5IYCJ 1ZKGA 3O8HA 1HDDC 1QVUA 1RR7A 3VIBA 4XRSA 2EH3A 3VP5A 3TP3A 5E3OA 2ID3A 4KWAA 2FBQA 1IUFA 3DCFA 5EFYA 5EGOB 3G56A 3OIOA 2NVYJ 2EBIA 1TWFJ 2G7SA 3QPSA 5F0HA 3HTIA 1UG2A 2L9RA 3GBGA 3GTGJ 3CJDA 2Y30A 4IHYA 1E3OC 2GUHA 1QRYA 1O4XA 4W97A 2FX0A 1TWHJ 1RPWA 2PMZN 1MSFC 2NVTJ 2PZ9A 4M3DA 2OERA 4JX6A 1MNMC 2O9LA 3KZ9A 3GEUA 3HKZN 4EEFG 1LE8A 4X1EA 2VUMJ 4DZJA 3HTJA 1FIPA 2N8GA 3T6NA 5E3NA 4DZPA 2HDDA 4GCKA 2R92J 3S17J 3B6CA 4JNNA 2K40A 3B81A 3PO2J 1UMQA 3HGYA 3VOXA 5F0CA 3VW1A 4A3FJ 3SFIA 2GENA 2WUIA 3BR5A 3M4OJ 2JMWA 2XDNA 4I76A 3S2HJ 3HOUJ 1SGMA 3DEWA 1ZR4A 1X2NA 5F04A 4W1UA 4BBRJ 5GP9A 4NN1A 5CXIA 1WI3A 4JKZA 5GPCA 3NRGA 1WH7A 5C4JJ 5EGOA 3F0CA 3GZIA 2X6OA 5J1YA 4A3MJ 3MVPA 1OCPA 2VKVA 2XGEA 2JWTA 3SDGA 2G0EA 2P81A 4FTHA 2HOTA 4L5EA 3BG9A 3PO3J 3DPJA 4MFEA 2OF7A 2XB5A 4GFLA 4XK4A 5EG0B 1S7EA 2V57A 1A5JA 1T33A 1ORKA 2R0QC 3JREA 1GV2A 3QPLA 5M5XJ 4A3IJ 2QOPA 2JA8J 1BW5A 1TWAJ 5FHPA 2NOGA 3BJBA 1F43A 1AU7A 3ZQCA 3FK7A 5EDNA 2LLKA 4A3BJ 2JN6A 3S1RJ 3TP0A 5M5YJ 2UXOA 3C2BA 2L7MP 3VUQA 3BG5A 2Y9YA 3HM5A 3VPRA 1H8AC 2G7LA 2ZCXA 5FKOA
chains in the Genus database with same CATH superfamily
2EK5A 5ED4A 2YSRA 3K1NA 4KN4X 2V1UA 5J40A 5FROA 1OMIA 3A0HC 3DBHB 1ETKA 4A3KJ 2YU3A 4HDUA 2A6TA 3OIPA 2MW8A 4FX4A 1QQIA 4PJNA 2HTJA 4JBAA 3FXUA 2FNAA 4A3EJ 3P5JA 4WXDA 4CSWA 5D4RA 4NC6A 5H9TA 2EB7A 2VC1A 3VVYA 1MBFA 5DCMA 4C9YA 3TQNA 3CCEI 3MKZA 2DG8A 2YVEA 1I39A 1I6XA 3T0YA 1OYYA 5LBQA 1YITI 2HPMA 5LHGA 4UVAA 3KCCA 2HZDA 3KETA 1Z7LA 1YG2A 1MD0A 4UHTA 4E7ZA 1KU3A 2Y0SN 3F8CA 2I10A 1R1UA 2IGNA 2R4GA 3KYLA 1XDSA 2DA5A 2VODA 4IXAA 2D45A 1T39A 1ETXA 1UHWA 5K58A 1U5TA 1FOYA 1SMTA 2K9SA 2XPVA 3OYCA 2MC4A 4HOBA 4CO8A 1R5ID 3OYEA 1WHUA 4B47A 1ZARA 4RB1A 3FXOA 2HU9A 5IP9J 2DG7A 2LSOA 2IXSA 3V7RA 1J2XA 2FEZA 4Q5SF 2DT6A 3ZXSA 5IOZA 2GLOA 2MH2A 4I98B 1OCOH 3RPUD 3QWLA 3MKLA 4BNCA 2ZOZA 2LYCA 1ETOA 4ENNA 4LG3A 2DLLA 1P4WA 1MNEA 2L54A 3BTLA 2O3FA 1FC3A 3EQLF 3LSJA 3QAHA 4YEJA 3OS0A 5TRDA 1N77A 1U9OA 1ZRDA 1JKPC 4BHPA 1HSTA 2F07A 2QSFX 2ELJA 2HR3A 2RQQA 3JR9A 3FKJA 3ZP5A 2M87A 4G94A 3D1NI 2VKHA 3CO6C 4HQEA 3CJQB 1TQIA 4RM2A 1IRFA 2ADUA 1UZCA 2LC2A 1OJLA 1F36A 2FBKA 3DKYA 4FHTA 2NX4A 3GTJJ 1R1VA 4JYKA 1LFPA 4YIFA 1WCMJ 3GXOA 1D8KA 1G6NA 2HXIA 4HLXA 4MTDA 2FMLA 2VKEA 2GWRA 4OIPF 4X0GA 3U1KA 3HUGB 1YRNA 2WGBA 1JT6A 4LITA 2M8GX 4RA2A 3FXQA 5E1XA 3LL7A 2YUSA 4CDGA 5ILUA 3ABUA 1J0RA 3GW2A 3SZGA 3EUKL 1J9IA 3R6SA 2XF6A 1X58A 2GOMA 2XAFA 2CJJA 4IF4A 2VOPA 5IT9K 5DV5A 4MIMA 4N9HA 2F4MB 2VBZA 1XMXA 3WU0A 1BBYA 5FKNA 2A6EF 2GIZA 3HOVJ 1QGPA 2QUFA 3S3OA 2OCCH 2R7SA 3ZR8X 4DNCA 2QENA 4YFNF 4UY8I 2EFWA 4M9SA 3L1PA 3CMYA 2R5YB 1XSXA 4AUXA 4A3CJ 1IN5A 5HNFA 1SANA 2M7AA 2Y75A 2VQHA 1B9MA 3DFGA 3HJEA 2HVRA 3C07A 3GCMA 3VVZA 2VN2A 2B9SA 1BJZA 2IGKA 1P2FA 4P96A 1FYLA 1OKRA 3KX2A 2L7ZA 3S15J 3LFKA 4BKXA 4HX8A 4OOIA 4CA0A 4BDZA 3MCZA 3FIWA 2VT3A 3KIOA 1HF0A 2F4OB 3ZMDA 2EJRA 3S14J 2ZXHA 3VB2A 1T0FC 3MFKA 3LSIA 1IUYA 4L9VA 4B3AA 3W3CA 1FTTA 2BHYA 2LOOA 3LSMA 3R4KA 1XMAA 5DEQA 2KT0A 2NXNB 4A3GJ 5J4YA 2BBYA 3OS2A 3SFZA 4XKVA 4B3XA 3ZRGA 3C2GA 5AIQA 4KNYA 3A03A 1DGRM 5F6FA 4IQJA 2KP6A 1ETYA 5BMZA 2KISA 4GFBA 1LDJA 4ICHA 1HSJA 3CDLA 3ZN0A 1HW5A 1MBEA 2K86A 5BNGA 3HSFA 3S1NJ 3W6KB 4UUSB 3RPUA 3OYJA 2DA2A 2KL4A 1B8IA 1VTNC 3QRFF 2KRCA 1IF1A 2A5YB 3L00A 2O5RA 3GLLA 1XB4A 2H09A 3FXKA 3O6BB 3OYAA 6PAXA 5J1RA 1X4OA 2LF8A 3PQKA 4AVPA 2UXHA 5HDGA 3FBNB 2XC7A 1TTYA 4HPQA 4RLFA 1TT0A 3ANGA 3E7LA 3E0JB 2YX7A 1YS7A 1IXCA 2CQ7A 4E7IA 1OYIA 1RNLA 3IWZA 3PUFA 3F6OA 3GF2A 1SFXA 2VPLA 3FKIJ 3TO7A 3ONQA 4KMFA 3PASA 3MD2A 1K61A 1KU7A 2DTZA 3W6VA 4CYCA 2G7UA 2L2OA 1MJ9A 3S16J 3OV8A 1FYKA 2CQKA 3T1BA 5HLTA 3RPQA 3LWFA 2B63J 4LB5A 3TO6A 3GYHX 2FBHA 2K3PA 1XGOA 4X6AJ 1Y8QB 1O7FA 2IGMA 2BEOA 2R93J 2M9HA 1YJWI 2QTQA 2Z5UA 1HBXG 3FHZA 4HSTA 2HQRA 2W57A 5HDNA 2BY2A 3BDDA 4WXHA 1R7JA 5GAEJ 1X3ZB 1W7PA 1S6LA 2ECBA 5DUKA 3R0AA 1WPKA 2DQLA 4NHJA 5KK1A 5D18A 1B4AA 1AHDP 2M5WA 2NP3A 3IV5A 1MMSA 4PGHA 2ZFUA 1I6HJ 3MZYA 2L4AA 2IT0A 1IRGA 4BUPA 2E71A 1X19A 1XDUA 4ACIA 3NWTA 3MZHA 3NNRA 2RDPA 2D6YA 1STZA 1HOMA 5CKTA 2QKOA 4XRMA 3E7QA 3JW4A 1QO0D 5J3LA 1DPUA 1JHHA 4YFXF 1T2KA 1QVTA 3AQTA 2LY9A 1LEAA 1I50J 1DP7P 3HOZJ 1KONA 4RLQA 3VOKA 4M6VA 3L7WA 5K5OA 2ZKZA 3EDPA 4DBQA 3RZOJ 3A02A 2DA4A 4A93J 4PUSA 3ZMZA 5J8CA 2A6HF 5LGUA 1MGTA 2KJCA 4M6XA 3EYIA 5C4XJ 2EZHA 4I7HA 5FJ8J 3IH2A 2MLKA 2LRDA 2AXTC 4IHWA 3C18A 1B59A 2WADA 3HE0A 1R49A 4ZYGA 2LREA 5FMPA 2QQ8A 4PCQA 3F8BA 4C2MJ 4E7SA 1VI0A 3KP7A 1NK2P 2XAJA 2HQNA 2FUG2 2GOXB 2QQBA 4RDUA 3MKYB 5M5WJ 4MQ9F 3P9CA 4WXCA 4IX7A 2AQFA 2F5EA 3OL4A 2XAQA 4B48A 1LB2A 4F93B 5IP6A 3LSTA 4XMYA 1PP8F 3VW0A 3SEQA 1YW9A 2JA6J 1OFCX 4P5OA 3RD3A 2NYXA 3KLOA 3FMSA 1ZYRF 5CYVA 4J01A 2XSDC 2KHMA 1U8BA 1H0MA 3VSKA 3HKZA 1TBXA 1M1EB 2V9VA 1FOWA 5HLHA 4RB0A 5DAJA 1KQ8A 2XRNA 1Q1VA 3EYYA 3C1DA 1JUMA 1QBJA 2QSGX 3I53A 3QQAA 3CDHA 2V79A 2K9LA 4L5JA 5LLQA 2K02A 2LDUA 1RETA 4HA8A 2BOLA 5HAWA 1SFOJ 3JSPA 3L2QA 3DPUA 1PUFB 1CF7A 2IU5A 3FX3A 4ITVA 2IA0A 4DYCA 4RBOA 4WF2A 2M0MA 2DMQA 2V7FA 2IS4A 3S1QJ 1P92A 3FZVA 5KAIC 2W82A 2YVXA 2DQRA 4ZJZA 4A3LJ 3GTOJ 5IYCJ 2X6WA 3O8HA 4EJUA 5F64A 1RR7A 5D6EA 1K79A 3DXJF 5E3OA 1ZGAA 3OR1C 2VL8A 4UV8A 5H2FC 5IT3A 5E18F 5H6RA 1UG2A 4MTEA 4XLHA 2L9RA 3AL0C 1XGSA 3GBGA 1HC8A 3IWFA 2AQEA 2Y30A 2ELHA 3CJDA 1QHGA 1F5TA 1QRYA 4I0AA 3MWMA 3E97A 3CCUI 1TWHJ 1YX3A 1S72I 3DBLB 4IRVA 3EUAA 3RI4A 5HLGA 4G9YA 2XF7A 4JX6A 1MNMC 2O9LA 4UXNA 4XL9A 4L0ZB 3CC2I 4MNUA 2QA4I 4X1EA 1JE8A 2K9MA 3TL4X 3Q5FA 3HTJA 1UB9A 4IL6C 2N8GA 3T6NA 1MW7A 2HDDA 4JNNA 3HGYA 4U7BA 3VOXA 2ESHA 2IVMA 3VW1A 2E7XA 2BXYA 1BM9A 5CQGA 1BC8C 2WUIA 1Z67A 2ICWG 2HDWA 4BDYA 3BR5A 4C2MA 1EH6A 1JXSA 4NBQA 2JMWA 4BJTA 2Q2EB 4EM2A 1Q1HA 2VIXA 3FXRA 2PG4A 3HOUJ 4BS9A 2D2WA 4BQOA 2DDBA 1A36A 2ZMEB 5F04A 3D0SA 4W1UA 5FFZA 5GP9A 4NN1A 3K4JA 5CXIA 2EIMH 3NRGA 3VWBA 3GX4X 2IS6A 3L2UA 5C4JJ 4OAYA 1FOKA 2NVUB 3IKVA 5J1YA 1K78A 2OQRA 2GIVA 2ZBKA 3CLOA 3BJOA 4XK4A 1MDMA 4Z2YA 3K4MA 4N4OB 1BI1A 2V57A 2F5DA 5B3SH 2MA3A 3ZMUA 3ZPLA 2QOPA 2JA8J 1TWAJ 1KYZA 3BJBA 2V26A 2JTVA 4GGGA 3S1RJ 4A3BJ 4XLPF 5M5YJ 2PI0A 4ZDLA 2BY0A 2L7MP 3VUQA 1X1BA 3BG5A 3VPRA 2G7LA 1ONVA 2OU2A 2W85A 1GV5A 2D5VA 3E5XA 2VE9A 3DP7A 2WB1N 3EUPA 5F08A 2E5NA 2M34A 4BH9A 1I5ZA 4XSZF 1WWXA 5H20A 1ITYA 2P7VB 1TQMA 1W5TA 2KZVA 4RB3C 5K7ZA 1OR7C 3ZGKA 1ULYA 2VQLA 1IJWC 5L3CA 4NUBA 2QWTA 2MH9A 3GZNB 2HOEA 4NC8A 2CU7A 2QGUA 3CCQI 4J19A 1V5FA 1DDNA 3WU1B 1R4MB 3QODA 1BIBA 5B5EC 1ZG3A 4QWQA 1RZ4A 1K4TA 4CH7A 3V6GA 1E3HA 5KNLA 5AONA 2XV4S 1KZHA 2Z9OA 5EG0A 1XGMA 3BG3A 4ME9A 1DU6A 4P1WA 2O7TA 3HG9A 2EV5A 5JLWA 4AIDA 2K9QA 2L0KA 1HW1A 2F5CA 2O7OA 2WY7Q 2Y48A 3HOSA 1V4RA 2ZJRF 1D1CA 3FK6A 3L09A 4O3MA 2TCTA 1UI6A 3ASNH 1PVEA 2KQRA 2NAZA 3IH4A 3PL8A 5J47A 4AC6A 1IN8A 4YELA 1TNTA 2OTJI 2NNYA 1RRJA 1SVMA 1BR1A 3CUQC 2L9VA 3BTJA 3F72A 3F3XA 5DD4A 2Q1ZB 5ERIA 4ZYDA 3CZ6A 4BE2A 2DFHA 1JKRC 3A2KA 4G6QA 4XNFA 4KDPA 2UXXA 3SZPA 2H8RA 2B0LA 3A01B 2VLAA 2BY3A 2COMA 1WJBA 3WTZA 1W5CC 4EJOA 3D5RC 3ZQIA 4HEA2 3B02A 2JZYA 2P6SA 4EGZA 1Z3XA 2MYSA 4NQWB 1WJDA 2Z99A 3TOBA 5LRSA 1YO5C 4B1RA 4IRHA 5B1BH 4PJMA 4KN7X 3JRCA 4HV5A 2GBYA 3G7RA 2E34A 3ABKH 1IDZA 4II2A 2EIKH 4BAYA 2QM3A 4KIFA 4ZZDA 2E5ZA 3BG7A 3I55I 3AKZA 1KGSA 4AD9A 2Z1DA 5F1JA 3BP8A 2DYSH 2XGDA 2CQQA 4DJAA 3UNGC 4QTRA 3G4SI 3G3ZA 1T56A 1IGNA 1Y1VJ 1G59A 4B8XA 2K5CA 3EUHA 1BOAA 1X3WB 2WC2A 3SJMA 2DO7A 2C6YA 2PJRB 1Z0XA 1APLC 2OV7A 2F4IA 1WVRA 1VF9A 3IHUA 4G12A 3SHFA 1U8RA 5FLMJ 3JRGA 1T8IA 1LDDA 2XPWA 4ZYAA 1AKHB 2NVXJ 4DYRA 2VQCA 2DOFA 3PNVA 1D1AA 1MZBA 2V1NA 2X51A 3G2BA 4MQVA 3RTRA 2AS5F 1LUJB 3VOEA 4EJWA 3W2AA 1W0TA 1ETWA 5HLIA 1MBKA 1XX5A 4A3DJ 1YI2I 3GZ5A 5CVRA 2BHZA 2STWA 5FLXK 2ZJ2A 3H0GJ 5CQEA 4XONA 2ZXJA 2EINH 5H6QA 2E2HJ 2OC6A 1P9QC 2XIGA 4IO9F 1Y1WJ 4ZH4F 3HUGA 3GTQJ 2DPUA 4C3HJ 3BCGA 2JRTA 1SVOA 3I58A 2ZY9A 2LP0A 1JJ6C 1PP7U 2LG4A 3IRRA 2ACJA 3CO7C 3H5RA 2NS8A 1LEBA 2XROA 1BI0A 2L01A 2XGXA 3TW6A 3X2QH 3K70D 2FJ1A 4IRIA 3U1DA 5E8IA 2ZB9A 5AQCA 1A04A 3MNLA 2EILH 4AIJA 1R1TA 2FA5A 2CG4A 1VQPI 3S1MJ 3WTXC 2HQAA 3NARA 4B4CA 2M0CA 3ZQHA 2YS9A 4XKWA 2BY1A 2M8EA 4PSWA 5FO5A 2A2FX 5LEJA 5D5XB 2R5YA 4EGYA 2QZ8A 3LSHA 4ZC3A 2DTRA 2CO5A 4HX4A 4JL3A 1MJAA 2CW7A 3TOAA 1MMAA 3TBIA 5J6XA 3OYGA 4CGRA 3TKYA 2HKXA 4U0WA 2Z33A 4MK6A 1BC7C 2DMUA 4BJ6C 4CCLA 1O3QA 3E5UA 4M73A 3S2DJ 4GFKA 2IS2A 1LVKA 1GXQA 2XKPA 2MD5A 4BQQA 1B72B 3JSOA 4U7DA 4GYGA 4YG2F 1WZ2A 4ZDOA 5CVVA 3H3VK 2HQ5A 3I54A 2HOAA 4JK1X 2WWYA 2JSPA 3WGHA 2RAEA 3ELKA 4RGXA 5D19A 1WJ5A 3K0LA 3I64A 3NRVA 3TDUC 1FBSA 4WWCA 4YRVA 3BWGA 2JVHA 4N9IA 1MJBA 2FJI1 2XGCA 4J00A 3B73A 3CDIA 4D9JA 2P0WA 3RKQA 1WH5A 2XB0X 4N0BA 2WAFA 5K5RA 3ZN1A 1HDPA 4S05A 3G1LA 4A0XA 3I0TA 2IP2A 3L2CA 2HGCA 1JGSA 3Q0VA 2JA5J 5ICCA 2E19A 3PIPF 5BPIA 5TGTA 1ZR2A 3Q9SA 4A2UA 4CZCA 5JI6A 3J80Z 5E17F 4UUSA 3TW7A 3M3YJ 4XICA 2FQ3A 5EEAA 4U0YA 1S29A 2G7GA 1FP2A 2JPBA 1X1DA 2OBPA 3ZQFA 2X1EA 4L62A 5K7FA 1BW6A 4HF2A 4V19K 5KAFC 4OMZA 3HOWJ 2YX4A 4M9ZA 3ZOBA 5FRNA 4XRFA 4AC0A 3E6BA 3AG3H 4U9LA 4B43A 2UZKA 2FD5A 1NG6A 3JAMK 4JX4A 2O8KA 3HRTA 2UXIA 3F6VA 5FGMA 4XN3A 3BHQA 2HPIA 2MD0A 4XBFA 5GPAA 3DU6A 3M8JA 1XS9A 2E2IJ 2E36A 5GAHJ 2PBXA 1JUPA 1W7PD 1YYVA 4FE7A 1W36D 1UFMA 2XKOA 3COAC 1MBGA 2CYYA 3OYDA 1DQUA 1OCTC 3WTWC 1U9NA 4ZYEA 5TJJA 3GZ6A 1KU9A 3OL3A 4XQFA 4A3JJ 3K10A 4KJZA 3ML6A 3HPGA 1ZRCA 4XM3A 5FLVA 2Z16A 1O3RA 1VFCA 1RKTA 1YOVB 2L9SA 2CV2A 3RQ4A 2DA1A 3BJ6A 4XKBA 2DCEA 4UDSA 2VQGA 3BG6A 2WA0A 3GFIA 3LHQA 3MZ8A 4OD4A 4UB8C 3RYRA 2QKLB 2W48A 3FWEA 4DOZA 5JHUA 1EJ9A 2WAQA 2KDOA 3PNYA 2ESNA 3WHBA 1E2XA 3K4BA 1IG7A 3L2VA 5M3MJ 4FISA 3K7AJ 1IN7A 3LMMA 4E7KA 4JOMA 3CMAI 1JKOC 2M4KA 2DA7A 5IYBJ 1Z21A 3DPLC 4XIDA 2ETHA 2IPQX 4XLNF 1FYMA 5BOXA 2CGPA 5FGLA 1CQTA 3V78A 4G6DA 2J5OA 3GWZA 3LOCA 5KHDA 4P9UA 1O7LA 4HG2A 5DYMA 5IOYA 4Y15A 2QYOA 3DLAA 1BI3A 3I5UA 3I4PA 1JHFA 3P9KA 2RV8A 1F9NA 3KEYA 4O5VA 2WBMA 1SAUA 3VYRB 1JI8A 4RM3A 3VW2A 1J75A 2BVLA 3GVAA 2V1XA 3CC7I 3KE2A 1D5YA 2PBIA 5CVJA 1JGGA 2QBYA 1UELB 2CW0F 5E3LA 3BTCA 1KA8A 1R22A 3WU2C 1LE8B 3HBLA 4BE1A 2VBWA 1XPXA 2KRHA 1W4MA 1BL0A 4LLNA 2JA7J 2DPDA 5J4VA 2E1OA 2XASA 2ZFWA 1QZEA 4AWXB 1YJNI 2R3SA 2HI3A 2VOOA 3EGQA 2WV1A 2B3WA 3BR6A 2ZCMA 2K4JA 3IAS2 3C7JA 3CESA 1D0ZA 2P4WA 3R0JA 4ENMA 3OYHA 1HDDC 3VIBA 3P9IA 1REPC 1EKEA 3QOPA 2ID3A 1O3SA 2LBFB 1GXPA 2FBQA 4KWAA 4G7OF 2VONA 5ILSA 5EFYA 2OZ6A 2NVYJ 3OIOA 1J7KA 1TWFJ 2G7SA 3BC8A 3QPSA 5LD2C 1U5TC 1OISA 1V55H 4PFPA 4BACA 1HW2A 4XORA 1BIAA 1O4XA 1YJ9I 1MSFC 2NVTJ 2OERA 4C30A 2OQGA 3KZ9A 2H94A 3V4GA 2G7HA 3HKZN 4EEFG 4OD5A 4DZJA 2R7VA 1FIPA 3K4LA 1SD5A 5GTHC 5E3NA 4DZPA 4IHTA 4M74A 2K40A 3B81A 5GAGJ 4CCMA 1UMQA 3IUOA 4DQ2A 3TDZC 4A3FJ 2GENA 4IZZA 3GO5A 3CTAA 3AG2H 2VJ5A 1ERDA 1VQ9I 4XLEA 2A61A 4I76A 3FXLA 1SGMA 3V7SA 5CVUA 2W7NA 3CF2A 2A69F 2D1VA 2KZGA 3DBRB 1YW8A 4JKZA 2W1OA 3QOEA 3DU5A 2XSJC 4HNTA 4KYWA 3F0CA 1FNNA 3GZIA 3CCSI 4HYEA 1ON1A 5GTIC 1T95A 2W24A 4LJZF 3RJPA 4KT5C 2G0EA 2BXZA 2P81A 1ZG5A 2HOTA 4L5EA 2E1NA 2FNPA 4MFEA 1V3FA 4HDVA 2LH9A 4GFLA 4UB6C 2VXZA 3SQNA 1ZELA 2IRFG 1T33A 3DTEA 2IA1A 1I1SA 2R0QC 3JREA 2GAUA 4XLCA 3J81K 1KU2A 3HSEA 1J09A 4E4HA 1BW5A 4EMSA 2FOWA 1H9GA 1F43A 3S2WA 3CC4I 3MAJA 2LLKA 1OCCH 1R5GA 2JN6A 5EEHA 1WSUA 4UUVA 2UXOA 5JVGF 5BPDA 2CMPA 2PX9A 3KP2A 1QA6A 3KYCB 3HM5A 1H8AC 1RI7A 3MQ0A 4YIIA 2FBIA 5L3GA 1XMKA 5EJCA 3WODF 3RH2A 2Z2SB 3EETA 2Q2EA 4D0PA 5HOOA 3HYIA 4BJ5C 2CS3A 4NNJA 1RC9A 2VKDA 2R7QA 1ZHFA 2VJ4A 1FMVA 5E1WA 2ZMEA 2HYGD 3IUVA 4F92B 3KKCA 1WQ2A 4EJVA 1F4KA 2R7DA 2P8TA 4AYBA 4PJJA 2XAGA 4EM0B 5CPRB 2OI8A 2R7TA 1U0JA 3ABTA 4LMYA 5IPAA 4RMNA 2KIQA 4I09A 4IPAA 3E6MA 5J1UA 3K70C 1ZN2A 3I71A 3LQRA 1TT5B 3U21A 2PMHA 3ZQLA 1S7OA 2H6BA 1SC7A 2CSOA 2R5ZB 1LPQA 4C2UA 1S3JA 2CQNA 1YTYA 3K1MA 4PZJA 3NS4A 2HZTA 2DU9A 2ZXIA 3R61A 1YLFA 3S93A 3C3WA 5K1YA 4H0EA 3E6CC 2NRAC 1HCRA 1GLNA 4GCLA 4NB5A 2XAHA 3L9FA 1RKWA 5FKKA 3DLLF 1WKMA 2RKHA 3GEZA 1XD7A 4BY1J 3NQOA 2H6CA 4P55A 4AIKA 4PFOA 2MSYA 3V7CA 5LHHA 2FSWA 3QPTA 2FE3A 5C3EJ 3OSGA 3HTHA 4QPOA 1ZG1A 1K83J 2DOAA 4NELA 3KZYA 3LFUA 2KKOA 4RAGA 2DT5A 4XLAA 5A2QZ 4ANJA 2NS7A 2X6YA 4GDFA 1KQ0A 4DW6A 3OSFA 4I2OA 2CFXA 1L0OC 3OYMA 2A68F 2EPFA 2OCEA 5L3FA 2DMTA 2KFDA 3ZMVA 2UUZA 2DT7B 5FB2A 4BHBA 1Y39A 2Z3YA 4H4KC 3HIMA 5HODA 2L4MA 1YHQI 3A0BC 2HOSA 4IHSA 2EWNA 1R00A 5HBUA 1V54H 1ZLJA 1FJLA 2K85A 3BR3A 1RUNA 1ZGJA 4O6JA 3SYTA 3VYUB 2ISZA 2CUFA 3ECOA 2MG4A 1T38A 2YVHA 1I3AA 3U9GA 1OPCA 1VQ4I 5F27A 2E1MC 5IP7J 1H89C 2V9PA 3HOTA 2A05A 3FISA 2X4HA 4FETA 1USSA 1TP4A 2BGCA 3CCLI 3BZ6A 3H9GA 4IJAA 2GZWA 3DKWA 4BQNA 3CUQB 4E7JA 2EZLA 3A01A 2JSCA 5EYRA 2ID6A 4A0ZA 4QIWN 3PIOF 4KMUX 2Y0MA 3G71I 2NP5A 4I0BA 3QU3A 1W36C 3J7YJ 5DD8A 3WHCA 1JT0A 3BR1A 4NQWA 3ERED 1Y56A 3MKWB 1YFHA 2O61A 1BA5A 1MH3A 3D5LA 3OYLA 2H27A 2OTLI 3PUBA 3JRFA 4YFKF 4GO1A 4ENKA 1K6OA 4M3GA 4KA4A 1R4NB 1VQ5I 2J5PA 2FF4A 4LB6B 3H9JA 2DMNA 1R9TJ 1LQ1A 4G7ZF 2M1BA 3Q9VA 3RZDJ 2BYVE 4PJLA 3F23A 4HKUA 2IJLA 3LSKA 3JRBA 1P7IA 3BPVA 5D1RA 2RREA 2EZKA 5E1ZB 3KFWX 1W1WE 4ABZA 4C3JJ 3DEUA 4V2GA 4RGUA 4F3QA 2FQ4A 2PJRA 2Q24A 2X6XA 4XN0A 3ZQGA 4IHVA 1KYWA 4Y33A 4M3FA 1AKHA 3ABLH 1VQMI 3Q0UA 2O0YA 3J7ZI 1QNTA 3WTVC 2RGVA 4B09A 2BW3B 1XSVA 2DMPA 3GLXA 4A5NA 4DYQA 2RASA 2R7ZJ 1XCBA 4FE4A 2LKPA 2JQ7A 4BEHB 2X0LA 3B6AA 4LOCA 1FPQA 5HS7A 1PYVA 2QIBA 4HSRA 3O8GA 4TV7A 1B6AA 3ECHA 3OYIA 4AVZA 1XGNA 4AIHA 3UKGA 1Z6RA 3OMYA 1UHMA 4MEXF 4U87A 2DI3A 2X85A 4UUTA 4YIRX 1G4DA 2CRGA 5CW8A 1IXSB 5CVIA 5E20A 3OR2C 2WTEA 1A6QA 4JP0A 3G1MA 4R1HA 4D7NA 3FHNA 1UCRA 3S3MA 3HTAA 4F55A 4A0YA 1CGPA 3RYPA 2LK2A 5FRMA 5HDKA 3DQVC 2R7UA 3J80K 4LK1F 2OA4A 3DEEA 3KYDB 4ZTFA 4L9NA 4A5MA 4CZZA 2KDZA 3FDYA 5KCMA 2IAIA 3KEOA 1L3LA 1MSEC 1FLIA 1ZGWA 1IRZA 3M1EA 2DFEA 1G3TA 3OYFA 1Y8RB 1E0EA 1BR4A 4IRGA 4BHCA 3I59B 1TWCJ 4N4NB 3QP6A 1ON2A 3HHGA 1WJEA 4LFUA 1YIJI 1QPIA 3AG1H 4MFDA 3LA2A 1K7AA 1MNDA 2LY2A 3RQIA 2VC0A 2IEKA 4RS8A 3WG7H 2PJPA 3BQZA 3KP3A 1G8XA 4LIVA 2Y9ZA 1B72A 2K3FA 4LG0B 1QZYA 5IYDJ 1XCVA 2ZOYA 3FXMA 2PQ8A 5LFAA 1U78A 3SWHA 2HTSA 4G8XA 2Y31A 2DW4A 1H88C 4D1QA 1Z05A 3K4KA 3NXCA 4Y17A 3J7AY 2CFOA 2EQRA 2ZCWA 4LIUA 2W4SA 5DTDA 3ZCOA 1A35A 5FKLA 1P7JA 3IKTA 5LRRA 3K4CA 5K5QA 1SD4A 2DK5A 2IGOA 2CUZA 1GVJA 1RUOA 3OYKA 1T0FA 2DN0A 2P5LC 3BR2A 1V5EA 4KFCA 1I1GA 2AHQA 1MBHA 3PFYA 4HNVA 3K69A 4HV6A 3TGNA 4RGRA 1YQAA 1WI9A 3CD6I 1TL8A 1FY7A 1HXDA 3VDXA 3ABMH 3H0DA 3CJNA 2NNNA 1F1ZA 4CUGA 4BY7J 3ISPA 3N97A 4NC7A 4EQQA 2ELKA 3NPIA 2DAOA 1MKMA 3HRSA 1GT0C 2TRTA 1T6SA 1AA7A 5D5WB 5TISC 4RAYA 2A3SA 1XTAA 5C4YA 3V8JA 4CHUA 1YE9A 2OZUA 2LMDA 1ZTRA 3RDIA 4R79A 5DUIA 3COLA 3V8LA 5EF6A 2VBXA 2CUEA 4BBSJ 3JRHA 2W00A 3VYSB 1VQ7I 2K4BA 3N05A 3HGGA 4P9FA 3HEFA 1FP1D 3I4MJ 3G73A 1X3UA 2E60A 3LSRA 3ROUA 3V42A 3ASOH 3AQSA 1U6GA 2JJ7A 4QPQA 2LY1A 2UXPA 2HXOA 5EZHA 1EA3A 1VQLI 2AO9A 3DV8A 3TMOA 5DS9A 2ISYA 3SZTA 4FCYA 1D5VA 4DIQA 4OU0A 1UI5A 1HKSA 2E1CA 1OLTA 2ZNZA 4I99C 1SEUA 2H1KA 3HRUA 9ANTA 1MMDA 3TEDA 1G2HA 1MIJA 1Z7UA 3KKDA 3PSIA 1QHHD 1T98A 3E3VA 1DU0A 2GM4A 2R7WA 1WRJA 1R5HA 4L5IA 4Y52J 1U3EM 3QBMA 3F21A 2F48A 2QEXI 3VEPA 3L2WA 1YS6A 3ZMSA 1XC5A 2TDXA 1T08B 2HS5A 2VI6A 3HOYJ 5L3EA 3A1YA 1HKQA 1ZQ3P 2P7CB 3MN2A 1FEXA 1POGA 2ME6A 2DK8A 3M07A 3W6JB 2RVCA 2VB6A 3LJLA 5EEGA 2UWMA 2K9NA 2PLYA 5LGTA 2VE8A 2LKXA 4B44A 3JTHA 2WAQN 4ZYHA 1ZKGA 3KZZA 3FM3A 4E7LA 1QVUA 4XR6A 2DOEA 2EH3A 3GMEA 3TP3A 3PQJA 4CYDA 1VQNI 3DPTA 5HS9A 1FMWA 1QZZA 3DCFA 5L3BA 2F5VA 5EGOB 3G56A 2QWWA 2EBIA 4CCJA 2HYFA 1VQOI 3F8FA 5F0HA 3AAFA 3GTGJ 4IHYA 2LNBA 1ZLKA 3FF5A 1E3OC 4BGDA 2GUHA 1O57A 2FX0A 2HWVA 2PMZN 1RPWA 3UR3C 2V9KA 4M3DA 3BRUA 5IY5H 4HW0A 5B1AH 2QQ9A 3KP6A 5FD6A 3S8PA 5D6FA 1OCZH 1LE8A 4ZZLA 2VUMJ 3S32A 3QU6A 2HVQA 5KVRA 4AU7A 5J8FA 4U0VA 2O6GE 3KPHA 4GCKA 2A5WA 2JA2A 1J5YA 3PO2J 2EFOA 1X1CA 5JHFA 5JR3A 1R71A 3SFIA 3OOPA 4MGRA 3M4OJ 2QLZA 1TLHB 5F1RA 2XDNA 1YX5A 4ZDPA 5AIPA 4HNUA 3S2HJ 2OJED 3RSNA 1LNWA 1ZR4A 3T8RA 1YW7A 1XN7A 3REOA 1BOBA 3N4MA 4BBRJ 4I02A 2KJBA 1ZREA 2LBFA 2Y0SA 5DCMB 3E1SA 4ETSA 1WH7A 4EVIA 1WJFA 2OD5A 4PJ0C 3MVPA 1IXRC 1OCPA 1S8NA 1QPMA 2JWTA 3QP5A 3SDGA 2RN7A 3M8EA 1FZPB 3BG9A 3PO3J 3DPJA 3CP2A 3DF8A 2R7RA 4OINF 3H92A 1S7EA 4CXFA 3VSLA 2PFBA 4F52A 1U5TB 3K9TA 1GV2A 3T5XA 2X1CA 2JPCA 3PJRA 2NOGA 1OYWA 3ZQCA 3FK7A 5EDNA 3J7AO 4A6EA 4OWRB 3C2BA 4G7HF 3RKWA 3EUHC 2ZSHB 2STTA 1S9HA 1X1PA 5FKOA 1I27A 1LFBA 5ILVA 1JTXA 2LFBA 4HF0A 1FSEA 1FBUA 3DWLE 2EA4A 4A69C 1TNSA 3JTGA 2CV0A 2PMZA 1IN4A 4ENJA 4Y7NJ 1JUSA 4PSXA 4FQGA 5FLXZ 1Z1DA 2JT1A 3HSRA 3QYFA 4LK0F 3FMQA 4WK8F 4NDLA 3GTMJ 2R7OA 3BZCA 3BR0A 4XKCA 3ZMTA 2FXAA 4KISA 3CCJI 3ZQ7A 2CW8A 3JRIA 1LJ9A 3G1OA 5E3MA 1G3SA 5CXGA 3CLQA 2KLOA 4FT8A 5JVTA 3G6EI 1EF4A 2L7KA 2OPTA 3W2VA 3WGGA 3E6DA 1TQPA 2XVCA 3CRJA 2DDAA 4BYYA 2ZCNA 5JLXA 2I8DA 3I56I 1SD7A 3ANPA 2D1HA 3NEUA 5HSZA 1NG7A 3H1CA 1R23A 3M1CA 1YRNB 1D0YA 3HXLA 2Q0OA 1FOXA 4M9XA 3BNIA 2KIUA 2QSHX 4ESFA 4IHXA 3P9TA 1G3YA 3QPHA 1HKTA 2M2EA 5D4SA 1ZK8A 2K27A 4M72A 3GFMA 1Y0UA 3OS1A 3FM5A 1RIOH 1SMYF 5FD5A 4MXMA 2DYRH 3L2RA 1Z6TA 1BI2A 5JFRA 3KNWA 5A2QK 1TW2A 5LGNA 3DTKA 1FBQA 2HDCA 2XF5A 4BE0A 2HNHA 3CJRB 1WGXA 4S0HB 3CWRA 2M3AA 1SFKA 4CGZA 3C2HA 3O3KA 4FX0A 5CLSA 5D8KB 1K6YA 3LQQA 2EFPA 2O8XA 4K2EA 4L9JA 4M3BA 2RQPA 4XSXF 3RKYA 4OIQF 3I9V2 1EV7A 5LHIA 4AYBN 4KITB 3WGIA 2FOKA 2ZJPF 4YZEA 1FSHA 4IOAF 2PFVA 1PUFA 2FRHA 3HOXJ 2R5ZA 2OAZA 3U2RA 3CQZJ 2RNGA 5LEKA 1Y6IA 2CUJA 1IC8A 4EJTA 2KRFA 1JKQC 4PK4A 1TW3A 3CP8A 3H36A 1EH8A 1OQYA 2K7LA 2L3DA 3BPXA 2V6EA 1UG0A 1X2MA 3KZIC 2DODA 2FU4A 2P5VA 4M71A 4A6DA 2W53A 4GCTA 4HAMA 3JSJA 1G3WA 4HRIA 2P5KA 4RGSA 2BV6A 4HBLA 4IVNA 2P6TA 3JCUC 3LAPA 5BS6A 4F91B 2NS0A 4L18B 3HTUA 3KP4A 1VZ0A 1MMNA 3LA3A 1HLVA 1XSDA 2IBDA 4HX7A 3S3NA 1FIAA 1YIOA 1ACIA 4ON0A 2RNJA 3JAMZ 5IT9Z 2AXLA 2E2JJ 1OR7A 5FFXA 4II3A 3E5QA 3HPHA 3AL0B 2LR8A 1Z91A 4LLLA 3BZKA 3I3LA 3OIQA 4PDKA 1R58A 1ZAOA 3W2WA 3WTTC 2NOJB 1B8IB 4UNOA 1RESA 1WJAA 2VJJA 5F0FA 5E8GA 1FWZA 3I4NJ 5L3DA 3WTSC 2QBYB 5D5UB 2JRMA 3VODA 1H9TA 3NWSA 2EZIA 2A07F 2ECCA 1VQ6I 4QSHA 3HHHA 4JX5A 5B66C 1I3QJ 2UXUA 3M7GA 4V2FA 3CCRI 3VFZA 2XRLA 1IDYA 2HYJA 4EM1A 3F8NA 3T8TA 2ME0A 3CJTB 3LAJA 3WE3A 4AF5A 2DA3A 1BR2A 1USTA 4Y13A 2W25A 3FMRA 1FT9A 2GFNA 4ASNA 1AWCA 1D1BA 4CYCB 1X1AA 5DDGA 1U2WA 2ZSIB 5K7HA 3ESWB 2IS1A 3QKXA 4XRSG 4CICA 3DKXA 1NK3P 2E1MB 4Y3OA 2E35A 1IO2A 2HVSA 3BT9A 3CUQA 2R7FA 2JUCA 2EFQA 2VPRA 3KEQA 4KUMA 3WTUC 1N78A 2L7FP 1S5LC 3GTKJ 3ON4A 4M3EA 1X4PA 2VJIA 4GCVA 4EATA 3LWJA 1R6RA 3OWTA 3DTIA 2JVGA 2O03A 1VNDA 2Y69H 3H35A 3JRAA 3FBIB 2EA2A 1IZ1A 3O2PE 4A12A 1B1BA 2LF7A 1EH7A 1ETQA 1W7PB 3K6GA 3VVXA 2VXDA 3BTIA 2DJNA 1J59A 3HIFA 1MBJA 1PDNC 3HDDA 3F22A 2VBYA 1OCRH 1XG1A 5ICEA 2E7WA 2UV1A 1IRXA 1BN5A 3GTLJ 4BXXJ 3F1BA 2M4GA 2V1DA 3K2ZA 4BL0B 1LFUP 2HKUA 2XDVA 2I5UA 1V5GA 2VASA 3IP4B 2KIFA 3BY6A 1WFXA 2M45A 1GVDA 3HZJA 2CV1A 1SD6A 1VQ8I 4MLOA 3FRQA 3ON2A 4DBRA 2GQQA 2Y2ZA 4GRIA 4Z6YA 3OY9A 3NI7A 3QYEA 1K4SA 3SEZA 3PPBA 3SDBA 3H9QA 1S7AA 1IAWA 2HYTA 1JTYA 1D0XA 2B7EA 3BQYA 4D7MA 5DM6F 3LSPA 2EIJH 1TWGJ 1ODDA 1SFEA 2MLGA 3ERMA 3MEXA 2HFHA 2MC3A 2BW3A 4OAZA 2CWEA 3K2AA 4WX9A 5CJ9A 2R7XA 1GHCA 2EFNA 3BOQA 1Z77A 2UXNA 4CCOA 3TO9A 4E6KG 4BEHA 2FMYA 2QKMB 3HB9A 4RAFA 3LSGA 2GXBA 2YU9J 3PFIA 4ZTJA 4XOTA 1Z3YA 3R60A 4IEJA 2Q8KA 3LNQA 3F9KA 3IC7A 1MH4A 2LTPA 2H8WA 5DCFA 4XLFA 3IL2A 2QF7A 4HLYA 3BLYA 1A6IA 4WIBA 1DPRA 3K1PA 3WG9A 5M3FJ 3RIRA 3NAUA 1DGWY 2G9WA 1DUXC 1E17A 1QU3A 1R36A 2QVOA 3OYBA 3CMMA 3CCVI 4DVYP 3GFLA 1ENHA 2MGQA 4ESJA 4FASD 1W5SA 3Q3SA 2WV0A 4E7HA 1IV6A 3PM1A 2DXIA 3GTPJ 1LKXA 1PJRA 1BJAA 2NVQJ 5D8LB 3EPZA 2QCOA 4UVBA 2QQAA 4GXOA 3VYTB 3BCAA 2F6CA 1TC3C 1P4XA 4MHGA 2PMUA 4GYIA 3RCOA 1ZH5A 4CCKA 2XAUA 3I59A 2CH0A 4ESBA 1UJ8A 3BJAA 3O60A 4Q48A 2CQXA 4LGWA 1GDTA 2YPRA 4L0YB 1CF7B 1ETVA 4C3IJ 4C2TA 3Q0WA 1IW7F 4D5FA 3OOUA 4I6ZA 3H5AA 2X9DA 5EZGA 4LG0A 1JJ8C 1AOYA 1NTCA 2KPMA 2WY8Q 1LDKB 1DP3A 2L9NA 2M7BA 2COBA 4CCNA 3HRMA 4Y4RA 2LD5A 3CMEI 2X1DA 2HKOA 4RB2C 2REKA 3M9AA 2DFFA 2LKSA 3K4NA 3CCMI 1O3TA 2JK3A 1N75A 4DGWB 3J81Z 2WAEA 3V8KA 1SAXA 1WJCA 5D5VB 2GXAA 3CCYA 2BE5F 2M30A 1UHSA 2X48A 5FKMA 5ICFA 5HVQC 4HF1A 3S5RA 1VQKI 1Y0NA 1W0UA 2DA6A 4AM3A 4D5CA 5C44J 1NH3A 1GUUA 5GADJ 2XPUA 1P6RA 3IH3A 4EV0A 2GA2A 2MABA 4OIOF 3JRDA 2EV0A 2IA2A 1MMGA 2L02A 4MO7A 3IRQA 5E79C 1PUEE 2G3BA 1FTZA 2RC4A 4PXIA 3F8MA 3H3ZA 2DJIA 3ZQQA 2YR2A 3AFHA 3ULQB 3AG4H 4RAZA 2ZMEC 4KIBA 4QLCU 2GA1A 3HL2A 2KMUA 2RHAA 2BVMA 4OIRF 1IN6A 2LVSA 2VT2A 4UV9A 2ZC2A 3LA7A 3H3UA 2ZO4A 4XRSA 3VP5A 4BXUA 5DM7F 2W84A 1UAAA 3PSFA 1IUFA 3RKXA 2MBFA 2MFZA 3SXYA 1E3PA 3OYNA 3VTIA 4UVCA 1K78B 4KICA 1C0WA 2XUBA 3D5SC 4G6TB 3HTIA 1Z9CA 4LD5A 2KIMA 4OMYA 5HNHA 1B9NA 3KLNA 1ZRFA 4IOCF 1P4AA 1MDMB 4W97A 3IAM2 2PZ9A 1SVLA 3QYBA 1D3YA 3PNTA 1KQ9A 4KT6A 3GEUA 2BZTA 4IQ4A 2WB1A 3GFJA 2DBBA 4BU2A 2ZXWH 4R8HA 4XOPA 4E70A 3WE2A 4BQAA 3HC7A 3B6CA 3BCBA 5HS8A 4WCGA 2R92J 3S17J 3CUOA 3H5NA 5F0CA 4HQMA 4Q4ZF 2JUGA 2OUMA 3KP5A 4I01A 1NHAA 3DEWA 3CF5F 3FXJA 2EV6A 1X2NA 1A31A 1TZLA 1FX7A 3A4CA 1LVAA 1WI3A 4L9TA 2PN6A 4M6YA 5GPCA 2IW5A 2F2EA 3BROA 3HTSB 1HA8A 1SFUA 2XHKA 5EGOA 4U88A 3M8FA 2X6OA 4A3MJ 4BXFA 2VKVA 2XGEA 3K8PC 1IV8A 4PGGA 4S04A 2ZJQF 1D8JA 3GUDA 4FTHA 2HEOA 4HZFA 5ICGA 3MMYB 2OF7A 2XB5A 4MEYF 1HQCA 5BQTA 4U9NA 5EG0B 3WTYC 1A5JA 1ORKA 3QPLA 4LLGF 5M5XJ 4A3IJ 2V6CA 1RR8C 2PEXA 5FHPA 2GXGA 2V4JC 1N25A 4F7ZA 2F5FA 4JQFA 4KIGA 2DFIA 1AU7A 3TP0A 4Q47A 4IKFA 2H1LA 2B1EA 2ZNYA 3P7NA 2Y9YA 2L5QA 2ZCXA
chains in the Genus database with same CATH topology
1LFBA 1GV5A 2D5VA 1JTXA 2LFBA 2WB1N 3EUPA 5F08A 3RH2A 4A69C 2M34A 1ETKA 4A3KJ 1ITYA 2MW8A 4Y7NJ 1JUSA 5K7ZA 3IUVA 1IJWC 4A3EJ 3KKCA 4NDLA 3GTMJ 5H9TA 2QWTA 3BR0A 3VVYA 1MBFA 2YVEA 2DG8A 3JRIA 2CU7A 3G1OA 5E3MA 4J19A 5CXGA 2OI8A 1EF4A 5IPAA 2OPTA 2Y0SN 3CRJA 5J1UA 3V6GA 2I10A 2ZCNA 5JLXA 2DA5A 5EG0A 3ZQLA 1ETXA 3BG3A 3ANPA 4ME9A 5K58A 1DU6A 2O7TA 5HSZA 2K9SA 5JLWA 2R5ZB 2XPVA 1YRNB 2K9QA 3BNIA 2L0KA 2O7OA 4IHXA 3P9TA 5IP9J 2DG7A 3FK6A 2M2EA 1ZK8A 2TCTA 1UI6A 5IOZA 3IH4A 2GLOA 4AC6A 1HCRA 4GCLA 4MXMA 3MKLA 1RKWA 5FKKA 2ZOZA 3KNWA 1ETOA 3BTJA 3BTLA 3LSJA 5IYBJ 4BY1J 1U9OA 1JKPC 2MSYA 2F07A 1WGXA 4S0HB 1JKRC 3CWRA 3JR9A 5C3EJ 3OSGA 3D1NI 2H8RA 3HTHA 3A01B 1K83J 4NELA 2NS7A 3BRUA 4DW6A 3OSFA 4M3BA 3ZQIA 1OJLA 1F36A 2NX4A 3GTJJ 4AYBN 4JYKA 4YZEA 1WCMJ 2DMTA 4B1RA 1PUFA 2HXIA 3HOXJ 2R5ZA 2VKEA 3JRCA 2GBYA 3HIMA 2WGBA 3CQZJ 5HODA 1YRNA 3G7RA 2HOSA 1IDZA 1JT6A 1IC8A 2M8GX 5HBUA 1JKQC 1FJLA 2YUSA 3BR3A 5F1JA 2CUFA 1X58A 2XGDA 2CQQA 1X2MA 2CJJA 2MG4A 4QTRA 2W53A 2YVHA 1T56A 4GCTA 1IGNA 4MIMA 1Y1VJ 5F27A 3JSJA 5IP7J 5FKNA 3SJMA 1H89C 3HOVJ 3FISA 1Z0XA 1APLC 4G12A 1VF9A 5FLMJ 3JRGA 1HLVA 2XPWA 2NVXJ 2IBDA 1AKHB 4DYRA 3L1PA 3CMYA 2R5YB 1FIAA 4AUXA 4A3CJ 2EZLA 3A01A 5EYRA 2E2JJ 1SANA 2ID6A 2LR8A 4QIWN 2NP5A 1B8IB 1W0TA 1ETWA 3C07A 1RESA 3I4NJ 1MBKA 5F0FA 3VVZA 4A3DJ 3WHCA 1JT0A 3BR1A 3H0GJ 1BJZA 2EZIA 2E2HJ 2L7ZA 1BA5A 2ECCA 3S15J 1MH3A 4QSHA 4BKXA 4JX5A 1Y1WJ 3JRFA 1I3QJ 2UXUA 4V2FA 3GTQJ 3FIWA 4M3GA 2XRLA 4C3HJ 3BCGA 2LP0A 1JJ6C 1IDYA 1HF0A 2HYJA 2NS8A 2DMNA 1R9TJ 2ME0A 3S14J 4AF5A 2DA3A 3RZDJ 3TW6A 4B3AA 2FJ1A 1FTTA 4HKUA 2ZB9A 5AQCA 3MNLA 2GFNA 3JRBA 1P7IA 5D1RA 4CYCB 4ABZA 2EZKA 4C3JJ 2KT0A 4V2GA 5K7HA 4A3GJ 3QKXA 4XRSG 2FQ4A 3S1MJ 2Q24A 3NARA 4B4CA 3ZQGA 2M0CA 3ZQHA 1NK3P 4IHVA 2YS9A 3A03A 4M3FA 1AKHA 3BT9A 3Q0UA 1ETYA 2R5YA 2VPRA 4GFBA 4JL3A 4ICHA 4DYQA 2DMPA 3CDLA 2RASA 1MBEA 2L7FP 2R7ZJ 5BNGA 4CGRA 3GTKJ 3ON4A 3S1NJ 4FE4A 4M3EA 4UUSB 1B8IA 2DA2A 3LWJA 4MK6A 1VNDA 3B6AA 2DMUA 4LOCA 3JRAA 5J1RA 2QIBA 3O8GA 3S2DJ 2UXHA 4GFKA 1B72B 3UKGA 1ETQA 3VVXA 3BTIA 2DJNA 3HDDA 1MBJA 3ANGA 4UUTA 1XG1A 3H3VK 4BXXJ 2HQ5A 3E7LA 2HOAA 3GTLJ 3F1BA 2CRGA 5CW8A 2RAEA 1LFUP 5D19A 4JP0A 2HKUA 3G1MA 4D7NA 3HTAA 3FKIJ 1GVDA 2LK2A 3FRQA 3PASA 4MLOA 3ON2A 1K61A 2XGCA 2DTZA 2Y2ZA 3W6VA 4CYCA 3NI7A 3S16J 3PPBA 3RKQA 1WH5A 2XB0X 2KDZA 2HYTA 1JTYA 2IAIA 3BQYA 4D7MA 1HDPA 3LSPA 1MSEC 2B63J 3G1LA 1TWGJ 1ZGWA 1IRZA 3Q0VA 2JA5J 2E19A 1ZR2A 3K2AA 1TWCJ 4UUSA 4X6AJ 3TW7A 3M3YJ 4XICA 5EEAA 2R93J 1Z77A 2M9HA 1QPIA 2G7GA 2QTQA 3HB9A 4MFDA 3LSGA 3ZQFA 3RQIA 2YU9J 4L62A 2IEKA 5K7FA 1BW6A 3BQZA 4IEJA 3HOWJ 3LNQA 3ZOBA 2Y9ZA 4AC0A 1B72A 1MH4A 2ECBA 2LTPA 5IYDJ 1WPKA 2ZOYA 2FD5A 2QF7A 2O8KA 4JX4A 2UXIA 5D18A 1AHDP 1A6IA 1U78A 2NP3A 3IV5A 3BHQA 2Y31A 5M3FJ 1I6HJ 3NAUA 1H88C 5GPAA 1XS9A 2E2IJ 3NXCA 2PBXA 1JUPA 4FE7A 2EQRA 5DTDA 1ENHA 2MGQA 1MBGA 5FKLA 4ACIA 1P7JA 3NNRA 1OCTC 3Q3SA 2D6YA 1HOMA 1U9NA 1IV6A 3PM1A 4A3JJ 2QKOA 2DN0A 3GTPJ 3BR2A 4XRMA 3E7QA 2NVQJ 2AHQA 1MBHA 4HNVA 5FLVA 5J3LA 1VFCA 1QVTA 3AQTA 1RKTA 2LY9A 1I50J 2QCOA 2DA1A 3HOZJ 4UDSA 3VOKA 4M6VA 1TC3C 4BY7J 3LHQA 3RZOJ 3A02A 2DA4A 4A93J 2ELKA 5C4XJ 3NPIA 2W48A 3O60A 2EZHA 2CQXA 1GT0C 5FJ8J 1GDTA 3IH2A 2TRTA 1ETVA 4IHWA 3WHBA 4C3IJ 3Q0WA 4I6ZA 4D5FA 3OOUA 1IG7A 5C4YA 3HE0A 5M3MJ 3COLA 2X9DA 1ZTRA 5EZGA 1JJ8C 1NTCA 3K7AJ 4FISA 5EF6A 5FMPA 2CUEA 4BBSJ 3JRHA 2COBA 1JKOC 4C2MJ 2LD5A 3HGGA 1VI0A 2DA7A 4XIDA 3HEFA 1NK2P 3I4MJ 3LSRA 2REKA 5M5WJ 4RDUA 5FGLA 1CQTA 3AQSA 2JJ7A 2JK3A 3V78A 5IP6A 2UXPA 3LOCA 2HXOA 5EZHA 3VW0A 2AO9A 5DS9A 5IOYA 2JA6J 1OFCX 3RD3A 4FCYA 1UI5A 3CCYA 1UHSA 2X48A 5FKMA 2XSDC 3S5RA 2H1KA 1U8BA 9ANTA 1W0UA 3VW2A 3TEDA 2DA6A 1G2HA 3KKDA 1DU0A 4D5CA 1D5YA 2GM4A 5C44J 4Y52J 5DAJA 1GUUA 3QBMA 1Q1VA 2XPUA 1JGGA 1JUMA 3IH3A 5E3LA 3BTCA 1XC5A 3QQAA 3JRDA 4MO7A 1LE8B 3HBLA 2VI6A 2G3BA 1RETA 3HOYJ 1ZQ3P 1FTZA 1BL0A 2JA7J 5HAWA 1SFOJ 3MN2A 4PXIA 1FEXA 1POGA 1PUFB 2ME6A 2E1OA 2IU5A 4DYCA 3LJLA 4RBOA 3EGQA 2HI3A 2K9NA 2DMQA 2WV1A 2RHAA 3BR6A 3S1QJ 2ZCMA 2LKXA 4A3LJ 3GTOJ 2WAQN 2LVSA 5IYCJ 1ZKGA 3O8HA 1HDDC 1QVUA 1RR7A 3VIBA 4XRSA 2EH3A 3VP5A 3TP3A 5E3OA 2ID3A 4KWAA 2FBQA 1IUFA 3DCFA 5EFYA 5EGOB 3G56A 3OIOA 2NVYJ 2EBIA 1TWFJ 2G7SA 3QPSA 5F0HA 3HTIA 1UG2A 2L9RA 3GBGA 3GTGJ 3CJDA 2Y30A 4IHYA 1E3OC 2GUHA 1QRYA 1O4XA 4W97A 2FX0A 1TWHJ 1RPWA 2PMZN 1MSFC 2NVTJ 2PZ9A 4M3DA 2OERA 4JX6A 1MNMC 2O9LA 3KZ9A 3GEUA 3HKZN 4EEFG 1LE8A 4X1EA 2VUMJ 4DZJA 3HTJA 1FIPA 2N8GA 3T6NA 5E3NA 4DZPA 2HDDA 4GCKA 2R92J 3S17J 3B6CA 4JNNA 2K40A 3B81A 3PO2J 1UMQA 3HGYA 3VOXA 5F0CA 3VW1A 4A3FJ 3SFIA 2GENA 2WUIA 3BR5A 3M4OJ 2JMWA 2XDNA 4I76A 3S2HJ 3HOUJ 1SGMA 3DEWA 1ZR4A 1X2NA 5F04A 4W1UA 4BBRJ 5GP9A 4NN1A 5CXIA 1WI3A 4JKZA 5GPCA 3NRGA 1WH7A 5C4JJ 5EGOA 3F0CA 3GZIA 2X6OA 5J1YA 4A3MJ 3MVPA 1OCPA 2VKVA 2XGEA 2JWTA 3SDGA 2G0EA 2P81A 4FTHA 2HOTA 4L5EA 3BG9A 3PO3J 3DPJA 4MFEA 2OF7A 2XB5A 4GFLA 4XK4A 5EG0B 1S7EA 2V57A 1A5JA 1T33A 1ORKA 2R0QC 3JREA 1GV2A 3QPLA 5M5XJ 4A3IJ 2QOPA 2JA8J 1BW5A 1TWAJ 5FHPA 2NOGA 3BJBA 1F43A 1AU7A 3ZQCA 3FK7A 5EDNA 2LLKA 4A3BJ 2JN6A 3S1RJ 3TP0A 5M5YJ 2UXOA 3C2BA 2L7MP 3VUQA 3BG5A 2Y9YA 3HM5A 3VPRA 1H8AC 2G7LA 2ZCXA 5FKOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1LFB A;  1GV5 A;  2D5V A;  1JTX A;  2LFB A;  2WB1 N;  3EUP A;  5F08 A;  3RH2 A;  4A69 C;  2M34 A;  1ETK A;  4A3K J;  1ITY A;  2MW8 A;  4Y7N J;  1JUS A;  5K7Z A;  3IUV A;  1IJW C;  4A3E J;  3KKC A;  4NDL A;  3GTM J;  5H9T A;  2QWT A;  3BR0 A;  3VVY A;  1MBF A;  2YVE A;  2DG8 A;  3JRI A;  2CU7 A;  3G1O A;  5E3M A;  4J19 A;  5CXG A;  2OI8 A;  1EF4 A;  5IPA A;  2OPT A;  2Y0S N;  3CRJ A;  5J1U A;  3V6G A;  2I10 A;  2ZCN A;  5JLX A;  2DA5 A;  5EG0 A;  3ZQL A;  1ETX A;  3BG3 A;  3ANP A;  4ME9 A;  5K58 A;  1DU6 A;  2O7T A;  5HSZ A;  2K9S A;  5JLW A;  2R5Z B;  2XPV A;  1YRN B;  2K9Q A;  3BNI A;  2L0K A;  2O7O A;  4IHX A;  3P9T A;  5IP9 J;  2DG7 A;  3FK6 A;  2M2E A;  1ZK8 A;  2TCT A;  1UI6 A;  5IOZ A;  3IH4 A;  2GLO A;  4AC6 A;  1HCR A;  4GCL A;  4MXM A;  3MKL A;  1RKW A;  5FKK A;  2ZOZ A;  3KNW A;  1ETO A;  3BTJ A;  3BTL A;  3LSJ A;  5IYB J;  4BY1 J;  1U9O A;  1JKP C;  2MSY A;  2F07 A;  1WGX A;  4S0H B;  1JKR C;  3CWR A;  3JR9 A;  5C3E J;  3OSG A;  3D1N I;  2H8R A;  3HTH A;  3A01 B;  1K83 J;  4NEL A;  2NS7 A;  3BRU A;  4DW6 A;  3OSF A;  4M3B A;  3ZQI A;  1OJL A;  1F36 A;  2NX4 A;  3GTJ J;  4AYB N;  4JYK A;  4YZE A;  1WCM J;  2DMT A;  4B1R A;  1PUF A;  2HXI A;  3HOX J;  2R5Z A;  2VKE A;  3JRC A;  2GBY A;  3HIM A;  2WGB A;  3CQZ J;  5HOD A;  1YRN A;  3G7R A;  2HOS A;  1IDZ A;  1JT6 A;  1IC8 A;  2M8G X;  5HBU A;  1JKQ C;  1FJL A;  2YUS A;  3BR3 A;  5F1J A;  2CUF A;  1X58 A;  2XGD A;  2CQQ A;  1X2M A;  2CJJ A;  2MG4 A;  4QTR A;  2W53 A;  2YVH A;  1T56 A;  4GCT A;  1IGN A;  4MIM A;  1Y1V J;  5F27 A;  3JSJ A;  5IP7 J;  5FKN A;  3SJM A;  1H89 C;  3HOV J;  3FIS A;  1Z0X A;  1APL C;  4G12 A;  1VF9 A;  5FLM J;  3JRG A;  1HLV A;  2XPW A;  2NVX J;  2IBD A;  1AKH B;  4DYR A;  3L1P A;  3CMY A;  2R5Y B;  1FIA A;  4AUX A;  4A3C J;  2EZL A;  3A01 A;  5EYR A;  2E2J J;  1SAN A;  2ID6 A;  2LR8 A;  4QIW N;  2NP5 A;  1B8I B;  1W0T A;  1ETW A;  3C07 A;  1RES A;  3I4N J;  1MBK A;  5F0F A;  3VVZ A;  4A3D J;  3WHC A;  1JT0 A;  3BR1 A;  3H0G J;  1BJZ A;  2EZI A;  2E2H J;  2L7Z A;  1BA5 A;  2ECC A;  3S15 J;  1MH3 A;  4QSH A;  4BKX A;  4JX5 A;  1Y1W J;  3JRF A;  1I3Q J;  2UXU A;  4V2F A;  3GTQ J;  3FIW A;  4M3G A;  2XRL A;  4C3H J;  3BCG A;  2LP0 A;  1JJ6 C;  1IDY A;  1HF0 A;  2HYJ A;  2NS8 A;  2DMN A;  1R9T J;  2ME0 A;  3S14 J;  4AF5 A;  2DA3 A;  3RZD J;  3TW6 A;  4B3A A;  2FJ1 A;  1FTT A;  4HKU A;  2ZB9 A;  5AQC A;  3MNL A;  2GFN A;  3JRB A;  1P7I A;  5D1R A;  4CYC B;  4ABZ A;  2EZK A;  4C3J J;  2KT0 A;  4V2G A;  5K7H A;  4A3G J;  3QKX A;  4XRS G;  2FQ4 A;  3S1M J;  2Q24 A;  3NAR A;  4B4C A;  3ZQG A;  2M0C A;  3ZQH A;  1NK3 P;  4IHV A;  2YS9 A;  3A03 A;  4M3F A;  1AKH A;  3BT9 A;  3Q0U A;  1ETY A;  2R5Y A;  2VPR A;  4GFB A;  4JL3 A;  4ICH A;  4DYQ A;  2DMP A;  3CDL A;  2RAS A;  1MBE A;  2L7F P;  2R7Z J;  5BNG A;  4CGR A;  3GTK J;  3ON4 A;  3S1N J;  4FE4 A;  4M3E A;  4UUS B;  1B8I A;  2DA2 A;  3LWJ A;  4MK6 A;  1VND A;  3B6A A;  2DMU A;  4LOC A;  3JRA A;  5J1R A;  2QIB A;  3O8G A;  3S2D J;  2UXH A;  4GFK A;  1B72 B;  3UKG A;  1ETQ A;  3VVX A;  3BTI A;  2DJN A;  3HDD A;  1MBJ A;  3ANG A;  4UUT A;  1XG1 A;  3H3V K;  4BXX J;  2HQ5 A;  3E7L A;  2HOA A;  3GTL J;  3F1B A;  2CRG A;  5CW8 A;  2RAE A;  1LFU P;  5D19 A;  4JP0 A;  2HKU A;  3G1M A;  4D7N A;  3HTA A;  3FKI J;  1GVD A;  2LK2 A;  3FRQ A;  3PAS A;  4MLO A;  3ON2 A;  1K61 A;  2XGC A;  2DTZ A;  2Y2Z A;  3W6V A;  4CYC A;  3NI7 A;  3S16 J;  3PPB A;  3RKQ A;  1WH5 A;  2XB0 X;  2KDZ A;  2HYT A;  1JTY A;  2IAI A;  3BQY A;  4D7M A;  1HDP A;  3LSP A;  1MSE C;  2B63 J;  3G1L A;  1TWG J;  1ZGW A;  1IRZ A;  3Q0V A;  2JA5 J;  2E19 A;  1ZR2 A;  3K2A A;  1TWC J;  4UUS A;  4X6A J;  3TW7 A;  3M3Y J;  4XIC A;  5EEA A;  2R93 J;  1Z77 A;  2M9H A;  1QPI A;  2G7G A;  2QTQ A;  3HB9 A;  4MFD A;  3LSG A;  3ZQF A;  3RQI A;  2YU9 J;  4L62 A;  2IEK A;  5K7F A;  1BW6 A;  3BQZ A;  4IEJ A;  3HOW J;  3LNQ A;  3ZOB A;  2Y9Z A;  4AC0 A;  1B72 A;  1MH4 A;  2ECB A;  2LTP A;  5IYD J;  1WPK A;  2ZOY A;  2FD5 A;  2QF7 A;  2O8K A;  4JX4 A;  2UXI A;  5D18 A;  1AHD P;  1A6I A;  1U78 A;  2NP3 A;  3IV5 A;  3BHQ A;  2Y31 A;  5M3F J;  1I6H J;  3NAU A;  1H88 C;  5GPA A;  1XS9 A;  2E2I J;  3NXC A;  2PBX A;  1JUP A;  4FE7 A;  2EQR A;  5DTD A;  1ENH A;  2MGQ A;  1MBG A;  5FKL A;  4ACI A;  1P7J A;  3NNR A;  1OCT C;  3Q3S A;  2D6Y A;  1HOM A;  1U9N A;  1IV6 A;  3PM1 A;  4A3J J;  2QKO A;  2DN0 A;  3GTP J;  3BR2 A;  4XRM A;  3E7Q A;  2NVQ J;  2AHQ A;  1MBH A;  4HNV A;  5FLV A;  5J3L A;  1VFC A;  1QVT A;  3AQT A;  1RKT A;  2LY9 A;  1I50 J;  2QCO A;  2DA1 A;  3HOZ J;  4UDS A;  3VOK A;  4M6V A;  1TC3 C;  4BY7 J;  3LHQ A;  3RZO J;  3A02 A;  2DA4 A;  4A93 J;  2ELK A;  5C4X J;  3NPI A;  2W48 A;  3O60 A;  2EZH A;  2CQX A;  1GT0 C;  5FJ8 J;  1GDT A;  3IH2 A;  2TRT A;  1ETV A;  4IHW A;  3WHB A;  4C3I J;  3Q0W A;  4I6Z A;  4D5F A;  3OOU A;  1IG7 A;  5C4Y A;  3HE0 A;  5M3M J;  3COL A;  2X9D A;  1ZTR A;  5EZG A;  1JJ8 C;  1NTC A;  3K7A J;  4FIS A;  5EF6 A;  5FMP A;  2CUE A;  4BBS J;  3JRH A;  2COB A;  1JKO C;  4C2M J;  2LD5 A;  3HGG A;  1VI0 A;  2DA7 A;  4XID A;  3HEF A;  1NK2 P;  3I4M J;  3LSR A;  2REK A;  5M5W J;  4RDU A;  5FGL A;  1CQT A;  3AQS A;  2JJ7 A;  2JK3 A;  3V78 A;  5IP6 A;  2UXP A;  3LOC A;  2HXO A;  5EZH A;  3VW0 A;  2AO9 A;  5DS9 A;  5IOY A;  2JA6 J;  1OFC X;  3RD3 A;  4FCY A;  1UI5 A;  3CCY A;  1UHS A;  2X48 A;  5FKM A;  2XSD C;  3S5R A;  2H1K A;  1U8B A;  9ANT A;  1W0U A;  3VW2 A;  3TED A;  2DA6 A;  1G2H A;  3KKD A;  1DU0 A;  4D5C A;  1D5Y A;  2GM4 A;  5C44 J;  4Y52 J;  5DAJ A;  1GUU A;  3QBM A;  1Q1V A;  2XPU A;  1JGG A;  1JUM A;  3IH3 A;  5E3L A;  3BTC A;  1XC5 A;  3QQA A;  3JRD A;  4MO7 A;  1LE8 B;  3HBL A;  2VI6 A;  2G3B A;  1RET A;  3HOY J;  1ZQ3 P;  1FTZ A;  1BL0 A;  2JA7 J;  5HAW A;  1SFO J;  3MN2 A;  4PXI A;  1FEX A;  1POG A;  1PUF B;  2ME6 A;  2E1O A;  2IU5 A;  4DYC A;  3LJL A;  4RBO A;  3EGQ A;  2HI3 A;  2K9N A;  2DMQ A;  2WV1 A;  2RHA A;  3BR6 A;  3S1Q J;  2ZCM A;  2LKX A;  4A3L J;  3GTO J;  2WAQ N;  2LVS A;  5IYC J;  1ZKG A;  3O8H A;  1HDD C;  1QVU A;  1RR7 A;  3VIB A;  4XRS A;  2EH3 A;  3VP5 A;  3TP3 A;  5E3O A;  2ID3 A;  4KWA A;  2FBQ A;  1IUF A;  3DCF A;  5EFY A;  5EGO B;  3G56 A;  3OIO A;  2NVY J;  2EBI A;  1TWF J;  2G7S A;  3QPS A;  5F0H A;  3HTI A;  1UG2 A;  2L9R A;  3GBG A;  3GTG J;  3CJD A;  2Y30 A;  4IHY A;  1E3O C;  2GUH A;  1QRY A;  1O4X A;  4W97 A;  2FX0 A;  1TWH J;  1RPW A;  2PMZ N;  1MSF C;  2NVT J;  2PZ9 A;  4M3D A;  2OER A;  4JX6 A;  1MNM C;  2O9L A;  3KZ9 A;  3GEU A;  3HKZ N;  4EEF G;  1LE8 A;  4X1E A;  2VUM J;  4DZJ A;  3HTJ A;  1FIP A;  2N8G A;  3T6N A;  5E3N A;  4DZP A;  2HDD A;  4GCK A;  2R92 J;  3S17 J;  3B6C A;  4JNN A;  2K40 A;  3B81 A;  3PO2 J;  1UMQ A;  3HGY A;  3VOX A;  5F0C A;  3VW1 A;  4A3F J;  3SFI A;  2GEN A;  2WUI A;  3BR5 A;  3M4O J;  2JMW A;  2XDN A;  4I76 A;  3S2H J;  3HOU J;  1SGM A;  3DEW A;  1ZR4 A;  1X2N A;  5F04 A;  4W1U A;  4BBR J;  5GP9 A;  4NN1 A;  5CXI A;  1WI3 A;  4JKZ A;  5GPC A;  3NRG A;  1WH7 A;  5C4J J;  5EGO A;  3F0C A;  3GZI A;  2X6O A;  5J1Y A;  4A3M J;  3MVP A;  1OCP A;  2VKV A;  2XGE A;  2JWT A;  3SDG A;  2G0E A;  2P81 A;  4FTH A;  2HOT A;  4L5E A;  3BG9 A;  3PO3 J;  3DPJ A;  4MFE A;  2OF7 A;  2XB5 A;  4GFL A;  4XK4 A;  5EG0 B;  1S7E A;  2V57 A;  1A5J A;  1T33 A;  1ORK A;  2R0Q C;  3JRE A;  1GV2 A;  3QPL A;  5M5X J;  4A3I J;  2QOP A;  2JA8 J;  1BW5 A;  1TWA J;  5FHP A;  2NOG A;  3BJB A;  1F43 A;  1AU7 A;  3ZQC A;  3FK7 A;  5EDN A;  2LLK A;  4A3B J;  2JN6 A;  3S1R J;  3TP0 A;  5M5Y J;  2UXO A;  3C2B A;  2L7M P;  3VUQ A;  3BG5 A;  2Y9Y A;  3HM5 A;  3VPR A;  1H8A C;  2G7L A;  2ZCX A;  5FKO A; 
#chains in the Genus database with same CATH topology
 2EK5 A;  5ED4 A;  2YSR A;  3K1N A;  4KN4 X;  2V1U A;  5J40 A;  5FRO A;  1OMI A;  3A0H C;  3DBH B;  1ETK A;  4A3K J;  2YU3 A;  4HDU A;  2A6T A;  3OIP A;  2MW8 A;  4FX4 A;  1QQI A;  4PJN A;  2HTJ A;  4JBA A;  3FXU A;  2FNA A;  4A3E J;  3P5J A;  4WXD A;  4CSW A;  5D4R A;  4NC6 A;  5H9T A;  2EB7 A;  2VC1 A;  3VVY A;  1MBF A;  5DCM A;  4C9Y A;  3TQN A;  3CCE I;  3MKZ A;  2DG8 A;  2YVE A;  1I39 A;  1I6X A;  3T0Y A;  1OYY A;  5LBQ A;  1YIT I;  2HPM A;  5LHG A;  4UVA A;  3KCC A;  2HZD A;  3KET A;  1Z7L A;  1YG2 A;  1MD0 A;  4UHT A;  4E7Z A;  1KU3 A;  2Y0S N;  3F8C A;  2I10 A;  1R1U A;  2IGN A;  2R4G A;  3KYL A;  1XDS A;  2DA5 A;  2VOD A;  4IXA A;  2D45 A;  1T39 A;  1ETX A;  1UHW A;  5K58 A;  1U5T A;  1FOY A;  1SMT A;  2K9S A;  2XPV A;  3OYC A;  2MC4 A;  4HOB A;  4CO8 A;  1R5I D;  3OYE A;  1WHU A;  4B47 A;  1ZAR A;  4RB1 A;  3FXO A;  2HU9 A;  5IP9 J;  2DG7 A;  2LSO A;  2IXS A;  3V7R A;  1J2X A;  2FEZ A;  4Q5S F;  2DT6 A;  3ZXS A;  5IOZ A;  2GLO A;  2MH2 A;  4I98 B;  1OCO H;  3RPU D;  3QWL A;  3MKL A;  4BNC A;  2ZOZ A;  2LYC A;  1ETO A;  4ENN A;  4LG3 A;  2DLL A;  1P4W A;  1MNE A;  2L54 A;  3BTL A;  2O3F A;  1FC3 A;  3EQL F;  3LSJ A;  3QAH A;  4YEJ A;  3OS0 A;  5TRD A;  1N77 A;  1U9O A;  1ZRD A;  1JKP C;  4BHP A;  1HST A;  2F07 A;  2QSF X;  2ELJ A;  2HR3 A;  2RQQ A;  3JR9 A;  3FKJ A;  3ZP5 A;  2M87 A;  4G94 A;  3D1N I;  2VKH A;  3CO6 C;  4HQE A;  3CJQ B;  1TQI A;  4RM2 A;  1IRF A;  2ADU A;  1UZC A;  2LC2 A;  1OJL A;  1F36 A;  2FBK A;  3DKY A;  4FHT A;  2NX4 A;  3GTJ J;  1R1V A;  4JYK A;  1LFP A;  4YIF A;  1WCM J;  3GXO A;  1D8K A;  1G6N A;  2HXI A;  4HLX A;  4MTD A;  2FML A;  2VKE A;  2GWR A;  4OIP F;  4X0G A;  3U1K A;  3HUG B;  1YRN A;  2WGB A;  1JT6 A;  4LIT A;  2M8G X;  4RA2 A;  3FXQ A;  5E1X A;  3LL7 A;  2YUS A;  4CDG A;  5ILU A;  3ABU A;  1J0R A;  3GW2 A;  3SZG A;  3EUK L;  1J9I A;  3R6S A;  2XF6 A;  1X58 A;  2GOM A;  2XAF A;  2CJJ A;  4IF4 A;  2VOP A;  5IT9 K;  5DV5 A;  4MIM A;  4N9H A;  2F4M B;  2VBZ A;  1XMX A;  3WU0 A;  1BBY A;  5FKN A;  2A6E F;  2GIZ A;  3HOV J;  1QGP A;  2QUF A;  3S3O A;  2OCC H;  2R7S A;  3ZR8 X;  4DNC A;  2QEN A;  4YFN F;  4UY8 I;  2EFW A;  4M9S A;  3L1P A;  3CMY A;  2R5Y B;  1XSX A;  4AUX A;  4A3C J;  1IN5 A;  5HNF A;  1SAN A;  2M7A A;  2Y75 A;  2VQH A;  1B9M A;  3DFG A;  3HJE A;  2HVR A;  3C07 A;  3GCM A;  3VVZ A;  2VN2 A;  2B9S A;  1BJZ A;  2IGK A;  1P2F A;  4P96 A;  1FYL A;  1OKR A;  3KX2 A;  2L7Z A;  3S15 J;  3LFK A;  4BKX A;  4HX8 A;  4OOI A;  4CA0 A;  4BDZ A;  3MCZ A;  3FIW A;  2VT3 A;  3KIO A;  1HF0 A;  2F4O B;  3ZMD A;  2EJR A;  3S14 J;  2ZXH A;  3VB2 A;  1T0F C;  3MFK A;  3LSI A;  1IUY A;  4L9V A;  4B3A A;  3W3C A;  1FTT A;  2BHY A;  2LOO A;  3LSM A;  3R4K A;  1XMA A;  5DEQ A;  2KT0 A;  2NXN B;  4A3G J;  5J4Y A;  2BBY A;  3OS2 A;  3SFZ A;  4XKV A;  4B3X A;  3ZRG A;  3C2G A;  5AIQ A;  4KNY A;  3A03 A;  1DGR M;  5F6F A;  4IQJ A;  2KP6 A;  1ETY A;  5BMZ A;  2KIS A;  4GFB A;  1LDJ A;  4ICH A;  1HSJ A;  3CDL A;  3ZN0 A;  1HW5 A;  1MBE A;  2K86 A;  5BNG A;  3HSF A;  3S1N J;  3W6K B;  4UUS B;  3RPU A;  3OYJ A;  2DA2 A;  2KL4 A;  1B8I A;  1VTN C;  3QRF F;  2KRC A;  1IF1 A;  2A5Y B;  3L00 A;  2O5R A;  3GLL A;  1XB4 A;  2H09 A;  3FXK A;  3O6B B;  3OYA A;  6PAX A;  5J1R A;  1X4O A;  2LF8 A;  3PQK A;  4AVP A;  2UXH A;  5HDG A;  3FBN B;  2XC7 A;  1TTY A;  4HPQ A;  4RLF A;  1TT0 A;  3ANG A;  3E7L A;  3E0J B;  2YX7 A;  1YS7 A;  1IXC A;  2CQ7 A;  4E7I A;  1OYI A;  1RNL A;  3IWZ A;  3PUF A;  3F6O A;  3GF2 A;  1SFX A;  2VPL A;  3FKI J;  3TO7 A;  3ONQ A;  4KMF A;  3PAS A;  3MD2 A;  1K61 A;  1KU7 A;  2DTZ A;  3W6V A;  4CYC A;  2G7U A;  2L2O A;  1MJ9 A;  3S16 J;  3OV8 A;  1FYK A;  2CQK A;  3T1B A;  5HLT A;  3RPQ A;  3LWF A;  2B63 J;  4LB5 A;  3TO6 A;  3GYH X;  2FBH A;  2K3P A;  1XGO A;  4X6A J;  1Y8Q B;  1O7F A;  2IGM A;  2BEO A;  2R93 J;  2M9H A;  1YJW I;  2QTQ A;  2Z5U A;  1HBX G;  3FHZ A;  4HST A;  2HQR A;  2W57 A;  5HDN A;  2BY2 A;  3BDD A;  4WXH A;  1R7J A;  5GAE J;  1X3Z B;  1W7P A;  1S6L A;  2ECB A;  5DUK A;  3R0A A;  1WPK A;  2DQL A;  4NHJ A;  5KK1 A;  5D18 A;  1B4A A;  1AHD P;  2M5W A;  2NP3 A;  3IV5 A;  1MMS A;  4PGH A;  2ZFU A;  1I6H J;  3MZY A;  2L4A A;  2IT0 A;  1IRG A;  4BUP A;  2E71 A;  1X19 A;  1XDU A;  4ACI A;  3NWT A;  3MZH A;  3NNR A;  2RDP A;  2D6Y A;  1STZ A;  1HOM A;  5CKT A;  2QKO A;  4XRM A;  3E7Q A;  3JW4 A;  1QO0 D;  5J3L A;  1DPU A;  1JHH A;  4YFX F;  1T2K A;  1QVT A;  3AQT A;  2LY9 A;  1LEA A;  1I50 J;  1DP7 P;  3HOZ J;  1KON A;  4RLQ A;  3VOK A;  4M6V A;  3L7W A;  5K5O A;  2ZKZ A;  3EDP A;  4DBQ A;  3RZO J;  3A02 A;  2DA4 A;  4A93 J;  4PUS A;  3ZMZ A;  5J8C A;  2A6H F;  5LGU A;  1MGT A;  2KJC A;  4M6X A;  3EYI A;  5C4X J;  2EZH A;  4I7H A;  5FJ8 J;  3IH2 A;  2MLK A;  2LRD A;  2AXT C;  4IHW A;  3C18 A;  1B59 A;  2WAD A;  3HE0 A;  1R49 A;  4ZYG A;  2LRE A;  5FMP A;  2QQ8 A;  4PCQ A;  3F8B A;  4C2M J;  4E7S A;  1VI0 A;  3KP7 A;  1NK2 P;  2XAJ A;  2HQN A;  2FUG 2;  2GOX B;  2QQB A;  4RDU A;  3MKY B;  5M5W J;  4MQ9 F;  3P9C A;  4WXC A;  4IX7 A;  2AQF A;  2F5E A;  3OL4 A;  2XAQ A;  4B48 A;  1LB2 A;  4F93 B;  5IP6 A;  3LST A;  4XMY A;  1PP8 F;  3VW0 A;  3SEQ A;  1YW9 A;  2JA6 J;  1OFC X;  4P5O A;  3RD3 A;  2NYX A;  3KLO A;  3FMS A;  1ZYR F;  5CYV A;  4J01 A;  2XSD C;  2KHM A;  1U8B A;  1H0M A;  3VSK A;  3HKZ A;  1TBX A;  1M1E B;  2V9V A;  1FOW A;  5HLH A;  4RB0 A;  5DAJ A;  1KQ8 A;  2XRN A;  1Q1V A;  3EYY A;  3C1D A;  1JUM A;  1QBJ A;  2QSG X;  3I53 A;  3QQA A;  3CDH A;  2V79 A;  2K9L A;  4L5J A;  5LLQ A;  2K02 A;  2LDU A;  1RET A;  4HA8 A;  2BOL A;  5HAW A;  1SFO J;  3JSP A;  3L2Q A;  3DPU A;  1PUF B;  1CF7 A;  2IU5 A;  3FX3 A;  4ITV A;  2IA0 A;  4DYC A;  4RBO A;  4WF2 A;  2M0M A;  2DMQ A;  2V7F A;  2IS4 A;  3S1Q J;  1P92 A;  3FZV A;  5KAI C;  2W82 A;  2YVX A;  2DQR A;  4ZJZ A;  4A3L J;  3GTO J;  5IYC J;  2X6W A;  3O8H A;  4EJU A;  5F64 A;  1RR7 A;  5D6E A;  1K79 A;  3DXJ F;  5E3O A;  1ZGA A;  3OR1 C;  2VL8 A;  4UV8 A;  5H2F C;  5IT3 A;  5E18 F;  5H6R A;  1UG2 A;  4MTE A;  4XLH A;  2L9R A;  3AL0 C;  1XGS A;  3GBG A;  1HC8 A;  3IWF A;  2AQE A;  2Y30 A;  2ELH A;  3CJD A;  1QHG A;  1F5T A;  1QRY A;  4I0A A;  3MWM A;  3E97 A;  3CCU I;  1TWH J;  1YX3 A;  1S72 I;  3DBL B;  4IRV A;  3EUA A;  3RI4 A;  5HLG A;  4G9Y A;  2XF7 A;  4JX6 A;  1MNM C;  2O9L A;  4UXN A;  4XL9 A;  4L0Z B;  3CC2 I;  4MNU A;  2QA4 I;  4X1E A;  1JE8 A;  2K9M A;  3TL4 X;  3Q5F A;  3HTJ A;  1UB9 A;  4IL6 C;  2N8G A;  3T6N A;  1MW7 A;  2HDD A;  4JNN A;  3HGY A;  4U7B A;  3VOX A;  2ESH A;  2IVM A;  3VW1 A;  2E7X A;  2BXY A;  1BM9 A;  5CQG A;  1BC8 C;  2WUI A;  1Z67 A;  2ICW G;  2HDW A;  4BDY A;  3BR5 A;  4C2M A;  1EH6 A;  1JXS A;  4NBQ A;  2JMW A;  4BJT A;  2Q2E B;  4EM2 A;  1Q1H A;  2VIX A;  3FXR A;  2PG4 A;  3HOU J;  4BS9 A;  2D2W A;  4BQO A;  2DDB A;  1A36 A;  2ZME B;  5F04 A;  3D0S A;  4W1U A;  5FFZ A;  5GP9 A;  4NN1 A;  3K4J A;  5CXI A;  2EIM H;  3NRG A;  3VWB A;  3GX4 X;  2IS6 A;  3L2U A;  5C4J J;  4OAY A;  1FOK A;  2NVU B;  3IKV A;  5J1Y A;  1K78 A;  2OQR A;  2GIV A;  2ZBK A;  3CLO A;  3BJO A;  4XK4 A;  1MDM A;  4Z2Y A;  3K4M A;  4N4O B;  1BI1 A;  2V57 A;  2F5D A;  5B3S H;  2MA3 A;  3ZMU A;  3ZPL A;  2QOP A;  2JA8 J;  1TWA J;  1KYZ A;  3BJB A;  2V26 A;  2JTV A;  4GGG A;  3S1R J;  4A3B J;  4XLP F;  5M5Y J;  2PI0 A;  4ZDL A;  2BY0 A;  2L7M P;  3VUQ A;  1X1B A;  3BG5 A;  3VPR A;  2G7L A;  1ONV A;  2OU2 A;  2W85 A;  1GV5 A;  2D5V A;  3E5X A;  2VE9 A;  3DP7 A;  2WB1 N;  3EUP A;  5F08 A;  2E5N A;  2M34 A;  4BH9 A;  1I5Z A;  4XSZ F;  1WWX A;  5H20 A;  1ITY A;  2P7V B;  1TQM A;  1W5T A;  2KZV A;  4RB3 C;  5K7Z A;  1OR7 C;  3ZGK A;  1ULY A;  2VQL A;  1IJW C;  5L3C A;  4NUB A;  2QWT A;  2MH9 A;  3GZN B;  2HOE A;  4NC8 A;  2CU7 A;  2QGU A;  3CCQ I;  4J19 A;  1V5F A;  1DDN A;  3WU1 B;  1R4M B;  3QOD A;  1BIB A;  5B5E C;  1ZG3 A;  4QWQ A;  1RZ4 A;  1K4T A;  4CH7 A;  3V6G A;  1E3H A;  5KNL A;  5AON A;  2XV4 S;  1KZH A;  2Z9O A;  5EG0 A;  1XGM A;  3BG3 A;  4ME9 A;  1DU6 A;  4P1W A;  2O7T A;  3HG9 A;  2EV5 A;  5JLW A;  4AID A;  2K9Q A;  2L0K A;  1HW1 A;  2F5C A;  2O7O A;  2WY7 Q;  2Y48 A;  3HOS A;  1V4R A;  2ZJR F;  1D1C A;  3FK6 A;  3L09 A;  4O3M A;  2TCT A;  1UI6 A;  3ASN H;  1PVE A;  2KQR A;  2NAZ A;  3IH4 A;  3PL8 A;  5J47 A;  4AC6 A;  1IN8 A;  4YEL A;  1TNT A;  2OTJ I;  2NNY A;  1RRJ A;  1SVM A;  1BR1 A;  3CUQ C;  2L9V A;  3BTJ A;  3F72 A;  3F3X A;  5DD4 A;  2Q1Z B;  5ERI A;  4ZYD A;  3CZ6 A;  4BE2 A;  2DFH A;  1JKR C;  3A2K A;  4G6Q A;  4XNF A;  4KDP A;  2UXX A;  3SZP A;  2H8R A;  2B0L A;  3A01 B;  2VLA A;  2BY3 A;  2COM A;  1WJB A;  3WTZ A;  1W5C C;  4EJO A;  3D5R C;  3ZQI A;  4HEA 2;  3B02 A;  2JZY A;  2P6S A;  4EGZ A;  1Z3X A;  2MYS A;  4NQW B;  1WJD A;  2Z99 A;  3TOB A;  5LRS A;  1YO5 C;  4B1R A;  4IRH A;  5B1B H;  4PJM A;  4KN7 X;  3JRC A;  4HV5 A;  2GBY A;  3G7R A;  2E34 A;  3ABK H;  1IDZ A;  4II2 A;  2EIK H;  4BAY A;  2QM3 A;  4KIF A;  4ZZD A;  2E5Z A;  3BG7 A;  3I55 I;  3AKZ A;  1KGS A;  4AD9 A;  2Z1D A;  5F1J A;  3BP8 A;  2DYS H;  2XGD A;  2CQQ A;  4DJA A;  3UNG C;  4QTR A;  3G4S I;  3G3Z A;  1T56 A;  1IGN A;  1Y1V J;  1G59 A;  4B8X A;  2K5C A;  3EUH A;  1BOA A;  1X3W B;  2WC2 A;  3SJM A;  2DO7 A;  2C6Y A;  2PJR B;  1Z0X A;  1APL C;  2OV7 A;  2F4I A;  1WVR A;  1VF9 A;  3IHU A;  4G12 A;  3SHF A;  1U8R A;  5FLM J;  3JRG A;  1T8I A;  1LDD A;  2XPW A;  4ZYA A;  1AKH B;  2NVX J;  4DYR A;  2VQC A;  2DOF A;  3PNV A;  1D1A A;  1MZB A;  2V1N A;  2X51 A;  3G2B A;  4MQV A;  3RTR A;  2AS5 F;  1LUJ B;  3VOE A;  4EJW A;  3W2A A;  1W0T A;  1ETW A;  5HLI A;  1MBK A;  1XX5 A;  4A3D J;  1YI2 I;  3GZ5 A;  5CVR A;  2BHZ A;  2STW A;  5FLX K;  2ZJ2 A;  3H0G J;  5CQE A;  4XON A;  2ZXJ A;  2EIN H;  5H6Q A;  2E2H J;  2OC6 A;  1P9Q C;  2XIG A;  4IO9 F;  1Y1W J;  4ZH4 F;  3HUG A;  3GTQ J;  2DPU A;  4C3H J;  3BCG A;  2JRT A;  1SVO A;  3I58 A;  2ZY9 A;  2LP0 A;  1JJ6 C;  1PP7 U;  2LG4 A;  3IRR A;  2ACJ A;  3CO7 C;  3H5R A;  2NS8 A;  1LEB A;  2XRO A;  1BI0 A;  2L01 A;  2XGX A;  3TW6 A;  3X2Q H;  3K70 D;  2FJ1 A;  4IRI A;  3U1D A;  5E8I A;  2ZB9 A;  5AQC A;  1A04 A;  3MNL A;  2EIL H;  4AIJ A;  1R1T A;  2FA5 A;  2CG4 A;  1VQP I;  3S1M J;  3WTX C;  2HQA A;  3NAR A;  4B4C A;  2M0C A;  3ZQH A;  2YS9 A;  4XKW A;  2BY1 A;  2M8E A;  4PSW A;  5FO5 A;  2A2F X;  5LEJ A;  5D5X B;  2R5Y A;  4EGY A;  2QZ8 A;  3LSH A;  4ZC3 A;  2DTR A;  2CO5 A;  4HX4 A;  4JL3 A;  1MJA A;  2CW7 A;  3TOA A;  1MMA A;  3TBI A;  5J6X A;  3OYG A;  4CGR A;  3TKY A;  2HKX A;  4U0W A;  2Z33 A;  4MK6 A;  1BC7 C;  2DMU A;  4BJ6 C;  4CCL A;  1O3Q A;  3E5U A;  4M73 A;  3S2D J;  4GFK A;  2IS2 A;  1LVK A;  1GXQ A;  2XKP A;  2MD5 A;  4BQQ A;  1B72 B;  3JSO A;  4U7D A;  4GYG A;  4YG2 F;  1WZ2 A;  4ZDO A;  5CVV A;  3H3V K;  2HQ5 A;  3I54 A;  2HOA A;  4JK1 X;  2WWY A;  2JSP A;  3WGH A;  2RAE A;  3ELK A;  4RGX A;  5D19 A;  1WJ5 A;  3K0L A;  3I64 A;  3NRV A;  3TDU C;  1FBS A;  4WWC A;  4YRV A;  3BWG A;  2JVH A;  4N9I A;  1MJB A;  2FJI 1;  2XGC A;  4J00 A;  3B73 A;  3CDI A;  4D9J A;  2P0W A;  3RKQ A;  1WH5 A;  2XB0 X;  4N0B A;  2WAF A;  5K5R A;  3ZN1 A;  1HDP A;  4S05 A;  3G1L A;  4A0X A;  3I0T A;  2IP2 A;  3L2C A;  2HGC A;  1JGS A;  3Q0V A;  2JA5 J;  5ICC A;  2E19 A;  3PIP F;  5BPI A;  5TGT A;  1ZR2 A;  3Q9S A;  4A2U A;  4CZC A;  5JI6 A;  3J80 Z;  5E17 F;  4UUS A;  3TW7 A;  3M3Y J;  4XIC A;  2FQ3 A;  5EEA A;  4U0Y A;  1S29 A;  2G7G A;  1FP2 A;  2JPB A;  1X1D A;  2OBP A;  3ZQF A;  2X1E A;  4L62 A;  5K7F A;  1BW6 A;  4HF2 A;  4V19 K;  5KAF C;  4OMZ A;  3HOW J;  2YX4 A;  4M9Z A;  3ZOB A;  5FRN A;  4XRF A;  4AC0 A;  3E6B A;  3AG3 H;  4U9L A;  4B43 A;  2UZK A;  2FD5 A;  1NG6 A;  3JAM K;  4JX4 A;  2O8K A;  3HRT A;  2UXI A;  3F6V A;  5FGM A;  4XN3 A;  3BHQ A;  2HPI A;  2MD0 A;  4XBF A;  5GPA A;  3DU6 A;  3M8J A;  1XS9 A;  2E2I J;  2E36 A;  5GAH J;  2PBX A;  1JUP A;  1W7P D;  1YYV A;  4FE7 A;  1W36 D;  1UFM A;  2XKO A;  3COA C;  1MBG A;  2CYY A;  3OYD A;  1DQU A;  1OCT C;  3WTW C;  1U9N A;  4ZYE A;  5TJJ A;  3GZ6 A;  1KU9 A;  3OL3 A;  4XQF A;  4A3J J;  3K10 A;  4KJZ A;  3ML6 A;  3HPG A;  1ZRC A;  4XM3 A;  5FLV A;  2Z16 A;  1O3R A;  1VFC A;  1RKT A;  1YOV B;  2L9S A;  2CV2 A;  3RQ4 A;  2DA1 A;  3BJ6 A;  4XKB A;  2DCE A;  4UDS A;  2VQG A;  3BG6 A;  2WA0 A;  3GFI A;  3LHQ A;  3MZ8 A;  4OD4 A;  4UB8 C;  3RYR A;  2QKL B;  2W48 A;  3FWE A;  4DOZ A;  5JHU A;  1EJ9 A;  2WAQ A;  2KDO A;  3PNY A;  2ESN A;  3WHB A;  1E2X A;  3K4B A;  1IG7 A;  3L2V A;  5M3M J;  4FIS A;  3K7A J;  1IN7 A;  3LMM A;  4E7K A;  4JOM A;  3CMA I;  1JKO C;  2M4K A;  2DA7 A;  5IYB J;  1Z21 A;  3DPL C;  4XID A;  2ETH A;  2IPQ X;  4XLN F;  1FYM A;  5BOX A;  2CGP A;  5FGL A;  1CQT A;  3V78 A;  4G6D A;  2J5O A;  3GWZ A;  3LOC A;  5KHD A;  4P9U A;  1O7L A;  4HG2 A;  5DYM A;  5IOY A;  4Y15 A;  2QYO A;  3DLA A;  1BI3 A;  3I5U A;  3I4P A;  1JHF A;  3P9K A;  2RV8 A;  1F9N A;  3KEY A;  4O5V A;  2WBM A;  1SAU A;  3VYR B;  1JI8 A;  4RM3 A;  3VW2 A;  1J75 A;  2BVL A;  3GVA A;  2V1X A;  3CC7 I;  3KE2 A;  1D5Y A;  2PBI A;  5CVJ A;  1JGG A;  2QBY A;  1UEL B;  2CW0 F;  5E3L A;  3BTC A;  1KA8 A;  1R22 A;  3WU2 C;  1LE8 B;  3HBL A;  4BE1 A;  2VBW A;  1XPX A;  2KRH A;  1W4M A;  1BL0 A;  4LLN A;  2JA7 J;  2DPD A;  5J4V A;  2E1O A;  2XAS A;  2ZFW A;  1QZE A;  4AWX B;  1YJN I;  2R3S A;  2HI3 A;  2VOO A;  3EGQ A;  2WV1 A;  2B3W A;  3BR6 A;  2ZCM A;  2K4J A;  3IAS 2;  3C7J A;  3CES A;  1D0Z A;  2P4W A;  3R0J A;  4ENM A;  3OYH A;  1HDD C;  3VIB A;  3P9I A;  1REP C;  1EKE A;  3QOP A;  2ID3 A;  1O3S A;  2LBF B;  1GXP A;  2FBQ A;  4KWA A;  4G7O F;  2VON A;  5ILS A;  5EFY A;  2OZ6 A;  2NVY J;  3OIO A;  1J7K A;  1TWF J;  2G7S A;  3BC8 A;  3QPS A;  5LD2 C;  1U5T C;  1OIS A;  1V55 H;  4PFP A;  4BAC A;  1HW2 A;  4XOR A;  1BIA A;  1O4X A;  1YJ9 I;  1MSF C;  2NVT J;  2OER A;  4C30 A;  2OQG A;  3KZ9 A;  2H94 A;  3V4G A;  2G7H A;  3HKZ N;  4EEF G;  4OD5 A;  4DZJ A;  2R7V A;  1FIP A;  3K4L A;  1SD5 A;  5GTH C;  5E3N A;  4DZP A;  4IHT A;  4M74 A;  2K40 A;  3B81 A;  5GAG J;  4CCM A;  1UMQ A;  3IUO A;  4DQ2 A;  3TDZ C;  4A3F J;  2GEN A;  4IZZ A;  3GO5 A;  3CTA A;  3AG2 H;  2VJ5 A;  1ERD A;  1VQ9 I;  4XLE A;  2A61 A;  4I76 A;  3FXL A;  1SGM A;  3V7S A;  5CVU A;  2W7N A;  3CF2 A;  2A69 F;  2D1V A;  2KZG A;  3DBR B;  1YW8 A;  4JKZ A;  2W1O A;  3QOE A;  3DU5 A;  2XSJ C;  4HNT A;  4KYW A;  3F0C A;  1FNN A;  3GZI A;  3CCS I;  4HYE A;  1ON1 A;  5GTI C;  1T95 A;  2W24 A;  4LJZ F;  3RJP A;  4KT5 C;  2G0E A;  2BXZ A;  2P81 A;  1ZG5 A;  2HOT A;  4L5E A;  2E1N A;  2FNP A;  4MFE A;  1V3F A;  4HDV A;  2LH9 A;  4GFL A;  4UB6 C;  2VXZ A;  3SQN A;  1ZEL A;  2IRF G;  1T33 A;  3DTE A;  2IA1 A;  1I1S A;  2R0Q C;  3JRE A;  2GAU A;  4XLC A;  3J81 K;  1KU2 A;  3HSE A;  1J09 A;  4E4H A;  1BW5 A;  4EMS A;  2FOW A;  1H9G A;  1F43 A;  3S2W A;  3CC4 I;  3MAJ A;  2LLK A;  1OCC H;  1R5G A;  2JN6 A;  5EEH A;  1WSU A;  4UUV A;  2UXO A;  5JVG F;  5BPD A;  2CMP A;  2PX9 A;  3KP2 A;  1QA6 A;  3KYC B;  3HM5 A;  1H8A C;  1RI7 A;  3MQ0 A;  4YII A;  2FBI A;  5L3G A;  1XMK A;  5EJC A;  3WOD F;  3RH2 A;  2Z2S B;  3EET A;  2Q2E A;  4D0P A;  5HOO A;  3HYI A;  4BJ5 C;  2CS3 A;  4NNJ A;  1RC9 A;  2VKD A;  2R7Q A;  1ZHF A;  2VJ4 A;  1FMV A;  5E1W A;  2ZME A;  2HYG D;  3IUV A;  4F92 B;  3KKC A;  1WQ2 A;  4EJV A;  1F4K A;  2R7D A;  2P8T A;  4AYB A;  4PJJ A;  2XAG A;  4EM0 B;  5CPR B;  2OI8 A;  2R7T A;  1U0J A;  3ABT A;  4LMY A;  5IPA A;  4RMN A;  2KIQ A;  4I09 A;  4IPA A;  3E6M A;  5J1U A;  3K70 C;  1ZN2 A;  3I71 A;  3LQR A;  1TT5 B;  3U21 A;  2PMH A;  3ZQL A;  1S7O A;  2H6B A;  1SC7 A;  2CSO A;  2R5Z B;  1LPQ A;  4C2U A;  1S3J A;  2CQN A;  1YTY A;  3K1M A;  4PZJ A;  3NS4 A;  2HZT A;  2DU9 A;  2ZXI A;  3R61 A;  1YLF A;  3S93 A;  3C3W A;  5K1Y A;  4H0E A;  3E6C C;  2NRA C;  1HCR A;  1GLN A;  4GCL A;  4NB5 A;  2XAH A;  3L9F A;  1RKW A;  5FKK A;  3DLL F;  1WKM A;  2RKH A;  3GEZ A;  1XD7 A;  4BY1 J;  3NQO A;  2H6C A;  4P55 A;  4AIK A;  4PFO A;  2MSY A;  3V7C A;  5LHH A;  2FSW A;  3QPT A;  2FE3 A;  5C3E J;  3OSG A;  3HTH A;  4QPO A;  1ZG1 A;  1K83 J;  2DOA A;  4NEL A;  3KZY A;  3LFU A;  2KKO A;  4RAG A;  2DT5 A;  4XLA A;  5A2Q Z;  4ANJ A;  2NS7 A;  2X6Y A;  4GDF A;  1KQ0 A;  4DW6 A;  3OSF A;  4I2O A;  2CFX A;  1L0O C;  3OYM A;  2A68 F;  2EPF A;  2OCE A;  5L3F A;  2DMT A;  2KFD A;  3ZMV A;  2UUZ A;  2DT7 B;  5FB2 A;  4BHB A;  1Y39 A;  2Z3Y A;  4H4K C;  3HIM A;  5HOD A;  2L4M A;  1YHQ I;  3A0B C;  2HOS A;  4IHS A;  2EWN A;  1R00 A;  5HBU A;  1V54 H;  1ZLJ A;  1FJL A;  2K85 A;  3BR3 A;  1RUN A;  1ZGJ A;  4O6J A;  3SYT A;  3VYU B;  2ISZ A;  2CUF A;  3ECO A;  2MG4 A;  1T38 A;  2YVH A;  1I3A A;  3U9G A;  1OPC A;  1VQ4 I;  5F27 A;  2E1M C;  5IP7 J;  1H89 C;  2V9P A;  3HOT A;  2A05 A;  3FIS A;  2X4H A;  4FET A;  1USS A;  1TP4 A;  2BGC A;  3CCL I;  3BZ6 A;  3H9G A;  4IJA A;  2GZW A;  3DKW A;  4BQN A;  3CUQ B;  4E7J A;  2EZL A;  3A01 A;  2JSC A;  5EYR A;  2ID6 A;  4A0Z A;  4QIW N;  3PIO F;  4KMU X;  2Y0M A;  3G71 I;  2NP5 A;  4I0B A;  3QU3 A;  1W36 C;  3J7Y J;  5DD8 A;  3WHC A;  1JT0 A;  3BR1 A;  4NQW A;  3ERE D;  1Y56 A;  3MKW B;  1YFH A;  2O61 A;  1BA5 A;  1MH3 A;  3D5L A;  3OYL A;  2H27 A;  2OTL I;  3PUB A;  3JRF A;  4YFK F;  4GO1 A;  4ENK A;  1K6O A;  4M3G A;  4KA4 A;  1R4N B;  1VQ5 I;  2J5P A;  2FF4 A;  4LB6 B;  3H9J A;  2DMN A;  1R9T J;  1LQ1 A;  4G7Z F;  2M1B A;  3Q9V A;  3RZD J;  2BYV E;  4PJL A;  3F23 A;  4HKU A;  2IJL A;  3LSK A;  3JRB A;  1P7I A;  3BPV A;  5D1R A;  2RRE A;  2EZK A;  5E1Z B;  3KFW X;  1W1W E;  4ABZ A;  4C3J J;  3DEU A;  4V2G A;  4RGU A;  4F3Q A;  2FQ4 A;  2PJR A;  2Q24 A;  2X6X A;  4XN0 A;  3ZQG A;  4IHV A;  1KYW A;  4Y33 A;  4M3F A;  1AKH A;  3ABL H;  1VQM I;  3Q0U A;  2O0Y A;  3J7Z I;  1QNT A;  3WTV C;  2RGV A;  4B09 A;  2BW3 B;  1XSV A;  2DMP A;  3GLX A;  4A5N A;  4DYQ A;  2RAS A;  2R7Z J;  1XCB A;  4FE4 A;  2LKP A;  2JQ7 A;  4BEH B;  2X0L A;  3B6A A;  4LOC A;  1FPQ A;  5HS7 A;  1PYV A;  2QIB A;  4HSR A;  3O8G A;  4TV7 A;  1B6A A;  3ECH A;  3OYI A;  4AVZ A;  1XGN A;  4AIH A;  3UKG A;  1Z6R A;  3OMY A;  1UHM A;  4MEX F;  4U87 A;  2DI3 A;  2X85 A;  4UUT A;  4YIR X;  1G4D A;  2CRG A;  5CW8 A;  1IXS B;  5CVI A;  5E20 A;  3OR2 C;  2WTE A;  1A6Q A;  4JP0 A;  3G1M A;  4R1H A;  4D7N A;  3FHN A;  1UCR A;  3S3M A;  3HTA A;  4F55 A;  4A0Y A;  1CGP A;  3RYP A;  2LK2 A;  5FRM A;  5HDK A;  3DQV C;  2R7U A;  3J80 K;  4LK1 F;  2OA4 A;  3DEE A;  3KYD B;  4ZTF A;  4L9N A;  4A5M A;  4CZZ A;  2KDZ A;  3FDY A;  5KCM A;  2IAI A;  3KEO A;  1L3L A;  1MSE C;  1FLI A;  1ZGW A;  1IRZ A;  3M1E A;  2DFE A;  1G3T A;  3OYF A;  1Y8R B;  1E0E A;  1BR4 A;  4IRG A;  4BHC A;  3I59 B;  1TWC J;  4N4N B;  3QP6 A;  1ON2 A;  3HHG A;  1WJE A;  4LFU A;  1YIJ I;  1QPI A;  3AG1 H;  4MFD A;  3LA2 A;  1K7A A;  1MND A;  2LY2 A;  3RQI A;  2VC0 A;  2IEK A;  4RS8 A;  3WG7 H;  2PJP A;  3BQZ A;  3KP3 A;  1G8X A;  4LIV A;  2Y9Z A;  1B72 A;  2K3F A;  4LG0 B;  1QZY A;  5IYD J;  1XCV A;  2ZOY A;  3FXM A;  2PQ8 A;  5LFA A;  1U78 A;  3SWH A;  2HTS A;  4G8X A;  2Y31 A;  2DW4 A;  1H88 C;  4D1Q A;  1Z05 A;  3K4K A;  3NXC A;  4Y17 A;  3J7A Y;  2CFO A;  2EQR A;  2ZCW A;  4LIU A;  2W4S A;  5DTD A;  3ZCO A;  1A35 A;  5FKL A;  1P7J A;  3IKT A;  5LRR A;  3K4C A;  5K5Q A;  1SD4 A;  2DK5 A;  2IGO A;  2CUZ A;  1GVJ A;  1RUO A;  3OYK A;  1T0F A;  2DN0 A;  2P5L C;  3BR2 A;  1V5E A;  4KFC A;  1I1G A;  2AHQ A;  1MBH A;  3PFY A;  4HNV A;  3K69 A;  4HV6 A;  3TGN A;  4RGR A;  1YQA A;  1WI9 A;  3CD6 I;  1TL8 A;  1FY7 A;  1HXD A;  3VDX A;  3ABM H;  3H0D A;  3CJN A;  2NNN A;  1F1Z A;  4CUG A;  4BY7 J;  3ISP A;  3N97 A;  4NC7 A;  4EQQ A;  2ELK A;  3NPI A;  2DAO A;  1MKM A;  3HRS A;  1GT0 C;  2TRT A;  1T6S A;  1AA7 A;  5D5W B;  5TIS C;  4RAY A;  2A3S A;  1XTA A;  5C4Y A;  3V8J A;  4CHU A;  1YE9 A;  2OZU A;  2LMD A;  1ZTR A;  3RDI A;  4R79 A;  5DUI A;  3COL A;  3V8L A;  5EF6 A;  2VBX A;  2CUE A;  4BBS J;  3JRH A;  2W00 A;  3VYS B;  1VQ7 I;  2K4B A;  3N05 A;  3HGG A;  4P9F A;  3HEF A;  1FP1 D;  3I4M J;  3G73 A;  1X3U A;  2E60 A;  3LSR A;  3ROU A;  3V42 A;  3ASO H;  3AQS A;  1U6G A;  2JJ7 A;  4QPQ A;  2LY1 A;  2UXP A;  2HXO A;  5EZH A;  1EA3 A;  1VQL I;  2AO9 A;  3DV8 A;  3TMO A;  5DS9 A;  2ISY A;  3SZT A;  4FCY A;  1D5V A;  4DIQ A;  4OU0 A;  1UI5 A;  1HKS A;  2E1C A;  1OLT A;  2ZNZ A;  4I99 C;  1SEU A;  2H1K A;  3HRU A;  9ANT A;  1MMD A;  3TED A;  1G2H A;  1MIJ A;  1Z7U A;  3KKD A;  3PSI A;  1QHH D;  1T98 A;  3E3V A;  1DU0 A;  2GM4 A;  2R7W A;  1WRJ A;  1R5H A;  4L5I A;  4Y52 J;  1U3E M;  3QBM A;  3F21 A;  2F48 A;  2QEX I;  3VEP A;  3L2W A;  1YS6 A;  3ZMS A;  1XC5 A;  2TDX A;  1T08 B;  2HS5 A;  2VI6 A;  3HOY J;  5L3E A;  3A1Y A;  1HKQ A;  1ZQ3 P;  2P7C B;  3MN2 A;  1FEX A;  1POG A;  2ME6 A;  2DK8 A;  3M07 A;  3W6J B;  2RVC A;  2VB6 A;  3LJL A;  5EEG A;  2UWM A;  2K9N A;  2PLY A;  5LGT A;  2VE8 A;  2LKX A;  4B44 A;  3JTH A;  2WAQ N;  4ZYH A;  1ZKG A;  3KZZ A;  3FM3 A;  4E7L A;  1QVU A;  4XR6 A;  2DOE A;  2EH3 A;  3GME A;  3TP3 A;  3PQJ A;  4CYD A;  1VQN I;  3DPT A;  5HS9 A;  1FMW A;  1QZZ A;  3DCF A;  5L3B A;  2F5V A;  5EGO B;  3G56 A;  2QWW A;  2EBI A;  4CCJ A;  2HYF A;  1VQO I;  3F8F A;  5F0H A;  3AAF A;  3GTG J;  4IHY A;  2LNB A;  1ZLK A;  3FF5 A;  1E3O C;  4BGD A;  2GUH A;  1O57 A;  2FX0 A;  2HWV A;  2PMZ N;  1RPW A;  3UR3 C;  2V9K A;  4M3D A;  3BRU A;  5IY5 H;  4HW0 A;  5B1A H;  2QQ9 A;  3KP6 A;  5FD6 A;  3S8P A;  5D6F A;  1OCZ H;  1LE8 A;  4ZZL A;  2VUM J;  3S32 A;  3QU6 A;  2HVQ A;  5KVR A;  4AU7 A;  5J8F A;  4U0V A;  2O6G E;  3KPH A;  4GCK A;  2A5W A;  2JA2 A;  1J5Y A;  3PO2 J;  2EFO A;  1X1C A;  5JHF A;  5JR3 A;  1R71 A;  3SFI A;  3OOP A;  4MGR A;  3M4O J;  2QLZ A;  1TLH B;  5F1R A;  2XDN A;  1YX5 A;  4ZDP A;  5AIP A;  4HNU A;  3S2H J;  2OJE D;  3RSN A;  1LNW A;  1ZR4 A;  3T8R A;  1YW7 A;  1XN7 A;  3REO A;  1BOB A;  3N4M A;  4BBR J;  4I02 A;  2KJB A;  1ZRE A;  2LBF A;  2Y0S A;  5DCM B;  3E1S A;  4ETS A;  1WH7 A;  4EVI A;  1WJF A;  2OD5 A;  4PJ0 C;  3MVP A;  1IXR C;  1OCP A;  1S8N A;  1QPM A;  2JWT A;  3QP5 A;  3SDG A;  2RN7 A;  3M8E A;  1FZP B;  3BG9 A;  3PO3 J;  3DPJ A;  3CP2 A;  3DF8 A;  2R7R A;  4OIN F;  3H92 A;  1S7E A;  4CXF A;  3VSL A;  2PFB A;  4F52 A;  1U5T B;  3K9T A;  1GV2 A;  3T5X A;  2X1C A;  2JPC A;  3PJR A;  2NOG A;  1OYW A;  3ZQC A;  3FK7 A;  5EDN A;  3J7A O;  4A6E A;  4OWR B;  3C2B A;  4G7H F;  3RKW A;  3EUH C;  2ZSH B;  2STT A;  1S9H A;  1X1P A;  5FKO A;  1I27 A;  1LFB A;  5ILV A;  1JTX A;  2LFB A;  4HF0 A;  1FSE A;  1FBU A;  3DWL E;  2EA4 A;  4A69 C;  1TNS A;  3JTG A;  2CV0 A;  2PMZ A;  1IN4 A;  4ENJ A;  4Y7N J;  1JUS A;  4PSX A;  4FQG A;  5FLX Z;  1Z1D A;  2JT1 A;  3HSR A;  3QYF A;  4LK0 F;  3FMQ A;  4WK8 F;  4NDL A;  3GTM J;  2R7O A;  3BZC A;  3BR0 A;  4XKC A;  3ZMT A;  2FXA A;  4KIS A;  3CCJ I;  3ZQ7 A;  2CW8 A;  3JRI A;  1LJ9 A;  3G1O A;  5E3M A;  1G3S A;  5CXG A;  3CLQ A;  2KLO A;  4FT8 A;  5JVT A;  3G6E I;  1EF4 A;  2L7K A;  2OPT A;  3W2V A;  3WGG A;  3E6D A;  1TQP A;  2XVC A;  3CRJ A;  2DDA A;  4BYY A;  2ZCN A;  5JLX A;  2I8D A;  3I56 I;  1SD7 A;  3ANP A;  2D1H A;  3NEU A;  5HSZ A;  1NG7 A;  3H1C A;  1R23 A;  3M1C A;  1YRN B;  1D0Y A;  3HXL A;  2Q0O A;  1FOX A;  4M9X A;  3BNI A;  2KIU A;  2QSH X;  4ESF A;  4IHX A;  3P9T A;  1G3Y A;  3QPH A;  1HKT A;  2M2E A;  5D4S A;  1ZK8 A;  2K27 A;  4M72 A;  3GFM A;  1Y0U A;  3OS1 A;  3FM5 A;  1RIO H;  1SMY F;  5FD5 A;  4MXM A;  2DYR H;  3L2R A;  1Z6T A;  1BI2 A;  5JFR A;  3KNW A;  5A2Q K;  1TW2 A;  5LGN A;  3DTK A;  1FBQ A;  2HDC A;  2XF5 A;  4BE0 A;  2HNH A;  3CJR B;  1WGX A;  4S0H B;  3CWR A;  2M3A A;  1SFK A;  4CGZ A;  3C2H A;  3O3K A;  4FX0 A;  5CLS A;  5D8K B;  1K6Y A;  3LQQ A;  2EFP A;  2O8X A;  4K2E A;  4L9J A;  4M3B A;  2RQP A;  4XSX F;  3RKY A;  4OIQ F;  3I9V 2;  1EV7 A;  5LHI A;  4AYB N;  4KIT B;  3WGI A;  2FOK A;  2ZJP F;  4YZE A;  1FSH A;  4IOA F;  2PFV A;  1PUF A;  2FRH A;  3HOX J;  2R5Z A;  2OAZ A;  3U2R A;  3CQZ J;  2RNG A;  5LEK A;  1Y6I A;  2CUJ A;  1IC8 A;  4EJT A;  2KRF A;  1JKQ C;  4PK4 A;  1TW3 A;  3CP8 A;  3H36 A;  1EH8 A;  1OQY A;  2K7L A;  2L3D A;  3BPX A;  2V6E A;  1UG0 A;  1X2M A;  3KZI C;  2DOD A;  2FU4 A;  2P5V A;  4M71 A;  4A6D A;  2W53 A;  4GCT A;  4HAM A;  3JSJ A;  1G3W A;  4HRI A;  2P5K A;  4RGS A;  2BV6 A;  4HBL A;  4IVN A;  2P6T A;  3JCU C;  3LAP A;  5BS6 A;  4F91 B;  2NS0 A;  4L18 B;  3HTU A;  3KP4 A;  1VZ0 A;  1MMN A;  3LA3 A;  1HLV A;  1XSD A;  2IBD A;  4HX7 A;  3S3N A;  1FIA A;  1YIO A;  1ACI A;  4ON0 A;  2RNJ A;  3JAM Z;  5IT9 Z;  2AXL A;  2E2J J;  1OR7 A;  5FFX A;  4II3 A;  3E5Q A;  3HPH A;  3AL0 B;  2LR8 A;  1Z91 A;  4LLL A;  3BZK A;  3I3L A;  3OIQ A;  4PDK A;  1R58 A;  1ZAO A;  3W2W A;  3WTT C;  2NOJ B;  1B8I B;  4UNO A;  1RES A;  1WJA A;  2VJJ A;  5F0F A;  5E8G A;  1FWZ A;  3I4N J;  5L3D A;  3WTS C;  2QBY B;  5D5U B;  2JRM A;  3VOD A;  1H9T A;  3NWS A;  2EZI A;  2A07 F;  2ECC A;  1VQ6 I;  4QSH A;  3HHH A;  4JX5 A;  5B66 C;  1I3Q J;  2UXU A;  3M7G A;  4V2F A;  3CCR I;  3VFZ A;  2XRL A;  1IDY A;  2HYJ A;  4EM1 A;  3F8N A;  3T8T A;  2ME0 A;  3CJT B;  3LAJ A;  3WE3 A;  4AF5 A;  2DA3 A;  1BR2 A;  1UST A;  4Y13 A;  2W25 A;  3FMR A;  1FT9 A;  2GFN A;  4ASN A;  1AWC A;  1D1B A;  4CYC B;  1X1A A;  5DDG A;  1U2W A;  2ZSI B;  5K7H A;  3ESW B;  2IS1 A;  3QKX A;  4XRS G;  4CIC A;  3DKX A;  1NK3 P;  2E1M B;  4Y3O A;  2E35 A;  1IO2 A;  2HVS A;  3BT9 A;  3CUQ A;  2R7F A;  2JUC A;  2EFQ A;  2VPR A;  3KEQ A;  4KUM A;  3WTU C;  1N78 A;  2L7F P;  1S5L C;  3GTK J;  3ON4 A;  4M3E A;  1X4P A;  2VJI A;  4GCV A;  4EAT A;  3LWJ A;  1R6R A;  3OWT A;  3DTI A;  2JVG A;  2O03 A;  1VND A;  2Y69 H;  3H35 A;  3JRA A;  3FBI B;  2EA2 A;  1IZ1 A;  3O2P E;  4A12 A;  1B1B A;  2LF7 A;  1EH7 A;  1ETQ A;  1W7P B;  3K6G A;  3VVX A;  2VXD A;  3BTI A;  2DJN A;  1J59 A;  3HIF A;  1MBJ A;  1PDN C;  3HDD A;  3F22 A;  2VBY A;  1OCR H;  1XG1 A;  5ICE A;  2E7W A;  2UV1 A;  1IRX A;  1BN5 A;  3GTL J;  4BXX J;  3F1B A;  2M4G A;  2V1D A;  3K2Z A;  4BL0 B;  1LFU P;  2HKU A;  2XDV A;  2I5U A;  1V5G A;  2VAS A;  3IP4 B;  2KIF A;  3BY6 A;  1WFX A;  2M45 A;  1GVD A;  3HZJ A;  2CV1 A;  1SD6 A;  1VQ8 I;  4MLO A;  3FRQ A;  3ON2 A;  4DBR A;  2GQQ A;  2Y2Z A;  4GRI A;  4Z6Y A;  3OY9 A;  3NI7 A;  3QYE A;  1K4S A;  3SEZ A;  3PPB A;  3SDB A;  3H9Q A;  1S7A A;  1IAW A;  2HYT A;  1JTY A;  1D0X A;  2B7E A;  3BQY A;  4D7M A;  5DM6 F;  3LSP A;  2EIJ H;  1TWG J;  1ODD A;  1SFE A;  2MLG A;  3ERM A;  3MEX A;  2HFH A;  2MC3 A;  2BW3 A;  4OAZ A;  2CWE A;  3K2A A;  4WX9 A;  5CJ9 A;  2R7X A;  1GHC A;  2EFN A;  3BOQ A;  1Z77 A;  2UXN A;  4CCO A;  3TO9 A;  4E6K G;  4BEH A;  2FMY A;  2QKM B;  3HB9 A;  4RAF A;  3LSG A;  2GXB A;  2YU9 J;  3PFI A;  4ZTJ A;  4XOT A;  1Z3Y A;  3R60 A;  4IEJ A;  2Q8K A;  3LNQ A;  3F9K A;  3IC7 A;  1MH4 A;  2LTP A;  2H8W A;  5DCF A;  4XLF A;  3IL2 A;  2QF7 A;  4HLY A;  3BLY A;  1A6I A;  4WIB A;  1DPR A;  3K1P A;  3WG9 A;  5M3F J;  3RIR A;  3NAU A;  1DGW Y;  2G9W A;  1DUX C;  1E17 A;  1QU3 A;  1R36 A;  2QVO A;  3OYB A;  3CMM A;  3CCV I;  4DVY P;  3GFL A;  1ENH A;  2MGQ A;  4ESJ A;  4FAS D;  1W5S A;  3Q3S A;  2WV0 A;  4E7H A;  1IV6 A;  3PM1 A;  2DXI A;  3GTP J;  1LKX A;  1PJR A;  1BJA A;  2NVQ J;  5D8L B;  3EPZ A;  2QCO A;  4UVB A;  2QQA A;  4GXO A;  3VYT B;  3BCA A;  2F6C A;  1TC3 C;  1P4X A;  4MHG A;  2PMU A;  4GYI A;  3RCO A;  1ZH5 A;  4CCK A;  2XAU A;  3I59 A;  2CH0 A;  4ESB A;  1UJ8 A;  3BJA A;  3O60 A;  4Q48 A;  2CQX A;  4LGW A;  1GDT A;  2YPR A;  4L0Y B;  1CF7 B;  1ETV A;  4C3I J;  4C2T A;  3Q0W A;  1IW7 F;  4D5F A;  3OOU A;  4I6Z A;  3H5A A;  2X9D A;  5EZG A;  4LG0 A;  1JJ8 C;  1AOY A;  1NTC A;  2KPM A;  2WY8 Q;  1LDK B;  1DP3 A;  2L9N A;  2M7B A;  2COB A;  4CCN A;  3HRM A;  4Y4R A;  2LD5 A;  3CME I;  2X1D A;  2HKO A;  4RB2 C;  2REK A;  3M9A A;  2DFF A;  2LKS A;  3K4N A;  3CCM I;  1O3T A;  2JK3 A;  1N75 A;  4DGW B;  3J81 Z;  2WAE A;  3V8K A;  1SAX A;  1WJC A;  5D5V B;  2GXA A;  3CCY A;  2BE5 F;  2M30 A;  1UHS A;  2X48 A;  5FKM A;  5ICF A;  5HVQ C;  4HF1 A;  3S5R A;  1VQK I;  1Y0N A;  1W0U A;  2DA6 A;  4AM3 A;  4D5C A;  5C44 J;  1NH3 A;  1GUU A;  5GAD J;  2XPU A;  1P6R A;  3IH3 A;  4EV0 A;  2GA2 A;  2MAB A;  4OIO F;  3JRD A;  2EV0 A;  2IA2 A;  1MMG A;  2L02 A;  4MO7 A;  3IRQ A;  5E79 C;  1PUE E;  2G3B A;  1FTZ A;  2RC4 A;  4PXI A;  3F8M A;  3H3Z A;  2DJI A;  3ZQQ A;  2YR2 A;  3AFH A;  3ULQ B;  3AG4 H;  4RAZ A;  2ZME C;  4KIB A;  4QLC U;  2GA1 A;  3HL2 A;  2KMU A;  2RHA A;  2BVM A;  4OIR F;  1IN6 A;  2LVS A;  2VT2 A;  4UV9 A;  2ZC2 A;  3LA7 A;  3H3U A;  2ZO4 A;  4XRS A;  3VP5 A;  4BXU A;  5DM7 F;  2W84 A;  1UAA A;  3PSF A;  1IUF A;  3RKX A;  2MBF A;  2MFZ A;  3SXY A;  1E3P A;  3OYN A;  3VTI A;  4UVC A;  1K78 B;  4KIC A;  1C0W A;  2XUB A;  3D5S C;  4G6T B;  3HTI A;  1Z9C A;  4LD5 A;  2KIM A;  4OMY A;  5HNH A;  1B9N A;  3KLN A;  1ZRF A;  4IOC F;  1P4A A;  1MDM B;  4W97 A;  3IAM 2;  2PZ9 A;  1SVL A;  3QYB A;  1D3Y A;  3PNT A;  1KQ9 A;  4KT6 A;  3GEU A;  2BZT A;  4IQ4 A;  2WB1 A;  3GFJ A;  2DBB A;  4BU2 A;  2ZXW H;  4R8H A;  4XOP A;  4E70 A;  3WE2 A;  4BQA A;  3HC7 A;  3B6C A;  3BCB A;  5HS8 A;  4WCG A;  2R92 J;  3S17 J;  3CUO A;  3H5N A;  5F0C A;  4HQM A;  4Q4Z F;  2JUG A;  2OUM A;  3KP5 A;  4I01 A;  1NHA A;  3DEW A;  3CF5 F;  3FXJ A;  2EV6 A;  1X2N A;  1A31 A;  1TZL A;  1FX7 A;  3A4C A;  1LVA A;  1WI3 A;  4L9T A;  2PN6 A;  4M6Y A;  5GPC A;  2IW5 A;  2F2E A;  3BRO A;  3HTS B;  1HA8 A;  1SFU A;  2XHK A;  5EGO A;  4U88 A;  3M8F A;  2X6O A;  4A3M J;  4BXF A;  2VKV A;  2XGE A;  3K8P C;  1IV8 A;  4PGG A;  4S04 A;  2ZJQ F;  1D8J A;  3GUD A;  4FTH A;  2HEO A;  4HZF A;  5ICG A;  3MMY B;  2OF7 A;  2XB5 A;  4MEY F;  1HQC A;  5BQT A;  4U9N A;  5EG0 B;  3WTY C;  1A5J A;  1ORK A;  3QPL A;  4LLG F;  5M5X J;  4A3I J;  2V6C A;  1RR8 C;  2PEX A;  5FHP A;  2GXG A;  2V4J C;  1N25 A;  4F7Z A;  2F5F A;  4JQF A;  4KIG A;  2DFI A;  1AU7 A;  3TP0 A;  4Q47 A;  4IKF A;  2H1L A;  2B1E A;  2ZNY A;  3P7N A;  2Y9Y A;  2L5Q A;  2ZCX A; 
#chains in the Genus database with same CATH homology
 1LFB A;  1GV5 A;  2D5V A;  1JTX A;  2LFB A;  2WB1 N;  3EUP A;  5F08 A;  3RH2 A;  4A69 C;  2M34 A;  1ETK A;  4A3K J;  1ITY A;  2MW8 A;  4Y7N J;  1JUS A;  5K7Z A;  3IUV A;  1IJW C;  4A3E J;  3KKC A;  4NDL A;  3GTM J;  5H9T A;  2QWT A;  3BR0 A;  3VVY A;  1MBF A;  2YVE A;  2DG8 A;  3JRI A;  2CU7 A;  3G1O A;  5E3M A;  4J19 A;  5CXG A;  2OI8 A;  1EF4 A;  5IPA A;  2OPT A;  2Y0S N;  3CRJ A;  5J1U A;  3V6G A;  2I10 A;  2ZCN A;  5JLX A;  2DA5 A;  5EG0 A;  3ZQL A;  1ETX A;  3BG3 A;  3ANP A;  4ME9 A;  5K58 A;  1DU6 A;  2O7T A;  5HSZ A;  2K9S A;  5JLW A;  2R5Z B;  2XPV A;  1YRN B;  2K9Q A;  3BNI A;  2L0K A;  2O7O A;  4IHX A;  3P9T A;  5IP9 J;  2DG7 A;  3FK6 A;  2M2E A;  1ZK8 A;  2TCT A;  1UI6 A;  5IOZ A;  3IH4 A;  2GLO A;  4AC6 A;  1HCR A;  4GCL A;  4MXM A;  3MKL A;  1RKW A;  5FKK A;  2ZOZ A;  3KNW A;  1ETO A;  3BTJ A;  3BTL A;  3LSJ A;  5IYB J;  4BY1 J;  1U9O A;  1JKP C;  2MSY A;  2F07 A;  1WGX A;  4S0H B;  1JKR C;  3CWR A;  3JR9 A;  5C3E J;  3OSG A;  3D1N I;  2H8R A;  3HTH A;  3A01 B;  1K83 J;  4NEL A;  2NS7 A;  3BRU A;  4DW6 A;  3OSF A;  4M3B A;  3ZQI A;  1OJL A;  1F36 A;  2NX4 A;  3GTJ J;  4AYB N;  4JYK A;  4YZE A;  1WCM J;  2DMT A;  4B1R A;  1PUF A;  2HXI A;  3HOX J;  2R5Z A;  2VKE A;  3JRC A;  2GBY A;  3HIM A;  2WGB A;  3CQZ J;  5HOD A;  1YRN A;  3G7R A;  2HOS A;  1IDZ A;  1JT6 A;  1IC8 A;  2M8G X;  5HBU A;  1JKQ C;  1FJL A;  2YUS A;  3BR3 A;  5F1J A;  2CUF A;  1X58 A;  2XGD A;  2CQQ A;  1X2M A;  2CJJ A;  2MG4 A;  4QTR A;  2W53 A;  2YVH A;  1T56 A;  4GCT A;  1IGN A;  4MIM A;  1Y1V J;  5F27 A;  3JSJ A;  5IP7 J;  5FKN A;  3SJM A;  1H89 C;  3HOV J;  3FIS A;  1Z0X A;  1APL C;  4G12 A;  1VF9 A;  5FLM J;  3JRG A;  1HLV A;  2XPW A;  2NVX J;  2IBD A;  1AKH B;  4DYR A;  3L1P A;  3CMY A;  2R5Y B;  1FIA A;  4AUX A;  4A3C J;  2EZL A;  3A01 A;  5EYR A;  2E2J J;  1SAN A;  2ID6 A;  2LR8 A;  4QIW N;  2NP5 A;  1B8I B;  1W0T A;  1ETW A;  3C07 A;  1RES A;  3I4N J;  1MBK A;  5F0F A;  3VVZ A;  4A3D J;  3WHC A;  1JT0 A;  3BR1 A;  3H0G J;  1BJZ A;  2EZI A;  2E2H J;  2L7Z A;  1BA5 A;  2ECC A;  3S15 J;  1MH3 A;  4QSH A;  4BKX A;  4JX5 A;  1Y1W J;  3JRF A;  1I3Q J;  2UXU A;  4V2F A;  3GTQ J;  3FIW A;  4M3G A;  2XRL A;  4C3H J;  3BCG A;  2LP0 A;  1JJ6 C;  1IDY A;  1HF0 A;  2HYJ A;  2NS8 A;  2DMN A;  1R9T J;  2ME0 A;  3S14 J;  4AF5 A;  2DA3 A;  3RZD J;  3TW6 A;  4B3A A;  2FJ1 A;  1FTT A;  4HKU A;  2ZB9 A;  5AQC A;  3MNL A;  2GFN A;  3JRB A;  1P7I A;  5D1R A;  4CYC B;  4ABZ A;  2EZK A;  4C3J J;  2KT0 A;  4V2G A;  5K7H A;  4A3G J;  3QKX A;  4XRS G;  2FQ4 A;  3S1M J;  2Q24 A;  3NAR A;  4B4C A;  3ZQG A;  2M0C A;  3ZQH A;  1NK3 P;  4IHV A;  2YS9 A;  3A03 A;  4M3F A;  1AKH A;  3BT9 A;  3Q0U A;  1ETY A;  2R5Y A;  2VPR A;  4GFB A;  4JL3 A;  4ICH A;  4DYQ A;  2DMP A;  3CDL A;  2RAS A;  1MBE A;  2L7F P;  2R7Z J;  5BNG A;  4CGR A;  3GTK J;  3ON4 A;  3S1N J;  4FE4 A;  4M3E A;  4UUS B;  1B8I A;  2DA2 A;  3LWJ A;  4MK6 A;  1VND A;  3B6A A;  2DMU A;  4LOC A;  3JRA A;  5J1R A;  2QIB A;  3O8G A;  3S2D J;  2UXH A;  4GFK A;  1B72 B;  3UKG A;  1ETQ A;  3VVX A;  3BTI A;  2DJN A;  3HDD A;  1MBJ A;  3ANG A;  4UUT A;  1XG1 A;  3H3V K;  4BXX J;  2HQ5 A;  3E7L A;  2HOA A;  3GTL J;  3F1B A;  2CRG A;  5CW8 A;  2RAE A;  1LFU P;  5D19 A;  4JP0 A;  2HKU A;  3G1M A;  4D7N A;  3HTA A;  3FKI J;  1GVD A;  2LK2 A;  3FRQ A;  3PAS A;  4MLO A;  3ON2 A;  1K61 A;  2XGC A;  2DTZ A;  2Y2Z A;  3W6V A;  4CYC A;  3NI7 A;  3S16 J;  3PPB A;  3RKQ A;  1WH5 A;  2XB0 X;  2KDZ A;  2HYT A;  1JTY A;  2IAI A;  3BQY A;  4D7M A;  1HDP A;  3LSP A;  1MSE C;  2B63 J;  3G1L A;  1TWG J;  1ZGW A;  1IRZ A;  3Q0V A;  2JA5 J;  2E19 A;  1ZR2 A;  3K2A A;  1TWC J;  4UUS A;  4X6A J;  3TW7 A;  3M3Y J;  4XIC A;  5EEA A;  2R93 J;  1Z77 A;  2M9H A;  1QPI A;  2G7G A;  2QTQ A;  3HB9 A;  4MFD A;  3LSG A;  3ZQF A;  3RQI A;  2YU9 J;  4L62 A;  2IEK A;  5K7F A;  1BW6 A;  3BQZ A;  4IEJ A;  3HOW J;  3LNQ A;  3ZOB A;  2Y9Z A;  4AC0 A;  1B72 A;  1MH4 A;  2ECB A;  2LTP A;  5IYD J;  1WPK A;  2ZOY A;  2FD5 A;  2QF7 A;  2O8K A;  4JX4 A;  2UXI A;  5D18 A;  1AHD P;  1A6I A;  1U78 A;  2NP3 A;  3IV5 A;  3BHQ A;  2Y31 A;  5M3F J;  1I6H J;  3NAU A;  1H88 C;  5GPA A;  1XS9 A;  2E2I J;  3NXC A;  2PBX A;  1JUP A;  4FE7 A;  2EQR A;  5DTD A;  1ENH A;  2MGQ A;  1MBG A;  5FKL A;  4ACI A;  1P7J A;  3NNR A;  1OCT C;  3Q3S A;  2D6Y A;  1HOM A;  1U9N A;  1IV6 A;  3PM1 A;  4A3J J;  2QKO A;  2DN0 A;  3GTP J;  3BR2 A;  4XRM A;  3E7Q A;  2NVQ J;  2AHQ A;  1MBH A;  4HNV A;  5FLV A;  5J3L A;  1VFC A;  1QVT A;  3AQT A;  1RKT A;  2LY9 A;  1I50 J;  2QCO A;  2DA1 A;  3HOZ J;  4UDS A;  3VOK A;  4M6V A;  1TC3 C;  4BY7 J;  3LHQ A;  3RZO J;  3A02 A;  2DA4 A;  4A93 J;  2ELK A;  5C4X J;  3NPI A;  2W48 A;  3O60 A;  2EZH A;  2CQX A;  1GT0 C;  5FJ8 J;  1GDT A;  3IH2 A;  2TRT A;  1ETV A;  4IHW A;  3WHB A;  4C3I J;  3Q0W A;  4I6Z A;  4D5F A;  3OOU A;  1IG7 A;  5C4Y A;  3HE0 A;  5M3M J;  3COL A;  2X9D A;  1ZTR A;  5EZG A;  1JJ8 C;  1NTC A;  3K7A J;  4FIS A;  5EF6 A;  5FMP A;  2CUE A;  4BBS J;  3JRH A;  2COB A;  1JKO C;  4C2M J;  2LD5 A;  3HGG A;  1VI0 A;  2DA7 A;  4XID A;  3HEF A;  1NK2 P;  3I4M J;  3LSR A;  2REK A;  5M5W J;  4RDU A;  5FGL A;  1CQT A;  3AQS A;  2JJ7 A;  2JK3 A;  3V78 A;  5IP6 A;  2UXP A;  3LOC A;  2HXO A;  5EZH A;  3VW0 A;  2AO9 A;  5DS9 A;  5IOY A;  2JA6 J;  1OFC X;  3RD3 A;  4FCY A;  1UI5 A;  3CCY A;  1UHS A;  2X48 A;  5FKM A;  2XSD C;  3S5R A;  2H1K A;  1U8B A;  9ANT A;  1W0U A;  3VW2 A;  3TED A;  2DA6 A;  1G2H A;  3KKD A;  1DU0 A;  4D5C A;  1D5Y A;  2GM4 A;  5C44 J;  4Y52 J;  5DAJ A;  1GUU A;  3QBM A;  1Q1V A;  2XPU A;  1JGG A;  1JUM A;  3IH3 A;  5E3L A;  3BTC A;  1XC5 A;  3QQA A;  3JRD A;  4MO7 A;  1LE8 B;  3HBL A;  2VI6 A;  2G3B A;  1RET A;  3HOY J;  1ZQ3 P;  1FTZ A;  1BL0 A;  2JA7 J;  5HAW A;  1SFO J;  3MN2 A;  4PXI A;  1FEX A;  1POG A;  1PUF B;  2ME6 A;  2E1O A;  2IU5 A;  4DYC A;  3LJL A;  4RBO A;  3EGQ A;  2HI3 A;  2K9N A;  2DMQ A;  2WV1 A;  2RHA A;  3BR6 A;  3S1Q J;  2ZCM A;  2LKX A;  4A3L J;  3GTO J;  2WAQ N;  2LVS A;  5IYC J;  1ZKG A;  3O8H A;  1HDD C;  1QVU A;  1RR7 A;  3VIB A;  4XRS A;  2EH3 A;  3VP5 A;  3TP3 A;  5E3O A;  2ID3 A;  4KWA A;  2FBQ A;  1IUF A;  3DCF A;  5EFY A;  5EGO B;  3G56 A;  3OIO A;  2NVY J;  2EBI A;  1TWF J;  2G7S A;  3QPS A;  5F0H A;  3HTI A;  1UG2 A;  2L9R A;  3GBG A;  3GTG J;  3CJD A;  2Y30 A;  4IHY A;  1E3O C;  2GUH A;  1QRY A;  1O4X A;  4W97 A;  2FX0 A;  1TWH J;  1RPW A;  2PMZ N;  1MSF C;  2NVT J;  2PZ9 A;  4M3D A;  2OER A;  4JX6 A;  1MNM C;  2O9L A;  3KZ9 A;  3GEU A;  3HKZ N;  4EEF G;  1LE8 A;  4X1E A;  2VUM J;  4DZJ A;  3HTJ A;  1FIP A;  2N8G A;  3T6N A;  5E3N A;  4DZP A;  2HDD A;  4GCK A;  2R92 J;  3S17 J;  3B6C A;  4JNN A;  2K40 A;  3B81 A;  3PO2 J;  1UMQ A;  3HGY A;  3VOX A;  5F0C A;  3VW1 A;  4A3F J;  3SFI A;  2GEN A;  2WUI A;  3BR5 A;  3M4O J;  2JMW A;  2XDN A;  4I76 A;  3S2H J;  3HOU J;  1SGM A;  3DEW A;  1ZR4 A;  1X2N A;  5F04 A;  4W1U A;  4BBR J;  5GP9 A;  4NN1 A;  5CXI A;  1WI3 A;  4JKZ A;  5GPC A;  3NRG A;  1WH7 A;  5C4J J;  5EGO A;  3F0C A;  3GZI A;  2X6O A;  5J1Y A;  4A3M J;  3MVP A;  1OCP A;  2VKV A;  2XGE A;  2JWT A;  3SDG A;  2G0E A;  2P81 A;  4FTH A;  2HOT A;  4L5E A;  3BG9 A;  3PO3 J;  3DPJ A;  4MFE A;  2OF7 A;  2XB5 A;  4GFL A;  4XK4 A;  5EG0 B;  1S7E A;  2V57 A;  1A5J A;  1T33 A;  1ORK A;  2R0Q C;  3JRE A;  1GV2 A;  3QPL A;  5M5X J;  4A3I J;  2QOP A;  2JA8 J;  1BW5 A;  1TWA J;  5FHP A;  2NOG A;  3BJB A;  1F43 A;  1AU7 A;  3ZQC A;  3FK7 A;  5EDN A;  2LLK A;  4A3B J;  2JN6 A;  3S1R J;  3TP0 A;  5M5Y J;  2UXO A;  3C2B A;  2L7M P;  3VUQ A;  3BG5 A;  2Y9Y A;  3HM5 A;  3VPR A;  1H8A C;  2G7L A;  2ZCX A;  5FKO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...