1JT0A

Crystal structure of a cooperative qacr-dna complex
Total Genus 69
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
69
sequence length
188
structure length
188
Chain Sequence
NLKDKILGVAKELFIKNGYNATTTGEIVKLSESSKGNLYYHFKTKENLFLEILNIEESKWQEQWKKEQIKAKTNREKFYLYNELSLTTEYYYPLQNAIIEFYTEYYKTNSINEKMNKLENKYIDAYHVIFKEGNLNGEWSINDVNAVSKIAANAVNGIVTFTHEQNINERIKLMNKFSQIFLNGLSKH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis for cooperative DNA binding by two dimers of the multidrug-binding protein QacR.
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Transcription/dna
molecule keywords QACA operator
total genus 69
structure length 188
sequence length 188
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2001-08-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00440 TetR_N Bacterial regulatory proteins, tetR family
A PF08360 TetR_C_5 QacR-like protein, C-terminal region
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 1jt0A01
1.10.357.10 Mainly Alpha Orthogonal Bundle Tetracycline Repressor; domain 2 Tetracycline Repressor, domain 2 1jt0A02
1JTXA 3VPRA 4B3AA 5HAWA 1JT0A 5DS9A 2IAIA 1JJ8C 4X6AJ 5F1JA 2YUSA 1GVDA 4ICHA 5GPAA 4C2MJ 1U9NA 1JTYA 3HE0A 2NS7A 2ELKA 1MBHA 2LY9A 3QQAA 5EF6A 4BXXJ 4J19A 1MSFC 3B6CA 2LKXA 2RAEA 1Z77A 1UI5A 2CQXA 1EF4A 4BBRJ 2DMUA 4A3LJ 2XDNA 2Y9ZA 5CW8A 3JRBA 2DA5A 3C07A 2EBIA 3GTLJ 1TWCJ 5EDNA 1Y1VJ 3BQYA 5FJ8J 2ID6A 4QSHA 1HOMA 3V78A 4A3BJ 2Y2ZA 3S1RJ 2R5ZA 3PPBA 3QBMA 1B8IA 2LVSA 1AU7A 1GV5A 4GCLA 2VPRA 5F0HA 5J1YA 2K9QA 1ITYA 2NVXJ 2XPUA 3FISA 5H9TA 3RZDJ 2PZ9A 4MO7A 3ZOBA 2TRTA 3S14J 4BKXA 1AHDP 3AQSA 4IHXA 2KT0A 1X2MA 2CQQA 2DA3A 3G1MA 5EYRA 2M34A 2XB5A 2O9LA 3HOVJ 4A3JJ 3MNLA 4ME9A 3OIOA 2ECCA 3BQZA 4B1RA 3PO2J 3L1PA 3S1QJ 3CWRA 3JRHA 4AF5A 4A3KJ 1B72A 5IP9J 5EG0B 4FE4A 2O7TA 5FLVA 1QVTA 3LSRA 2IEKA 5AQCA 5D18A 2RHAA 2OF7A 4AYBN 1ETWA 1A5JA 2GM4A 2JA6J 2X48A 2D5VA 1WH5A 3A01A 3KNWA 2LD5A 4A3IJ 1FJLA 4AUXA 2DMNA 2DMQA 2ZCNA 5D1RA 1R9TJ 3NI7A 2NP5A 3FRQA 1ETOA 1NTCA 5K58A 3S17J 3HEFA 3VIBA 2YVHA 4XRSG 4D7MA 3KKDA 3MKLA 4GFKA 2D6YA 4V2GA 4JNNA 3T6NA 2NX4A 4A69C 3V6GA 3GTQJ 3PASA 2R92J 2R5YB 4GFLA 1JUPA 3BJBA 4UUTA 3F1BA 5CXGA 4FISA 3BR0A 3VOKA 1VNDA 1PUFB 3JRGA 3VVYA 2FQ4A 1U8BA 3IH4A 5EZGA 4ACIA 1TWFJ 1TWGJ 2EZHA 3QPLA 4UDSA 2FX0A 3TP0A 2IU5A 2VKVA 3COLA 2LR8A 2N8GA 5C4JJ 2R0QC 5IPAA 4M3GA 1MNMC 2GENA 1BW6A 1BW5A 3M4OJ 1Q1VA 3RQIA 2M2EA 2LK2A 4HNVA 2I10A 3BT9A 3ZQCA 3VW1A 4MK6A 1RKWA 3EGQA 5EGOA 2G7GA 2DA6A 2R5YA 1G2HA 4I76A 2NOGA 3BR6A 2DG7A 3HM5A 2K40A 4FCYA 3BRUA 3GTJJ 3TW7A 2CUFA 2DA7A 3CQZJ 1JKQC 4L62A 1ZK8A 1GUUA 5IP7J 4D7NA 2JK3A 3LOCA 3HOZJ 3JRCA 3BHQA 2WV1A 1JKRC 1JJ6C 3LSGA 5FKKA 3D1NI 3VUQA 1SGMA 3HTAA 3E7LA 3S2DJ 5E3NA 4A3DJ 3RZOJ 1GT0C 5F0CA 5M5YJ 3E7QA 5FGLA 5GP9A 4DZJA 3BTLA 1IC8A 1MH3A 5FKMA 1UI6A 2Q24A 1NK2P 5FKNA 1IDYA 4GCTA 3OSFA 3AQTA 2OERA 2L7FP 3JRDA 4JP0A 4D5FA 5IYBJ 1Z0XA 2AHQA 5JLWA 1TC3C 3MVPA 4V2FA 1AKHB 1HDDC 1B72B 2GLOA 2NP3A 1WGXA 3W6VA 4IHVA 3GTKJ 2WGBA 3VVZA 3CDLA 3DEWA 1NK3P 2TCTA 4C3IJ 4RBOA 1HF0A 2CU7A 5IP6A 4A93J 2NVTJ 2FJ1A 3SFIA 3ZQFA 5IOZA 2DG8A 2G3BA 2W53A 3JSJA 5K7ZA 2LP0A 3S5RA 2ME0A 3A01B 2F07A 3BCGA 2GBYA 3JRFA 2UXIA 2ZB9A 3H3VK 1S7EA 2UXOA 4S0HB 3MN2A 5BNGA 1ETXA 2X9DA 1F43A 2XSDC 1JT6A 3VW2A 2QF7A 3FK6A 5HBUA 2NVYJ 9ANTA 2DA1A 2ME6A 3NXCA 3BG9A 5M3FJ 2HYTA 2M0CA 1XG1A 2Y30A 3ZQLA 1OFCX 4DW6A 1MBJA 3BTJA 3ZQHA 3HTHA 1JKPC 2JA7J 4M6VA 3O8HA 4MFDA 2ID3A 1IGNA 4Y7NJ 4BY1J 3HBLA 1BL0A 3HTJA 3LWJA 3G1OA 1LE8B 2CUEA 4M3FA 1OCTC 2EH3A 3C2BA 5DTDA 3HOXJ 3M3YJ 2XB0X 1FTTA 3BG3A 3DPJA 2CJJA 2HQ5A 5F04A 2DMTA 2NVQJ 4CYCA 1XS9A 1WI3A 4XICA 4IHYA 1QVUA 4DYQA 1IV6A 1P7IA 4GFBA 2HOAA 1CQTA 1I50J 3NAUA 5M3MJ 2JA8J 3HOUJ 4M3EA 1WPKA 2XGDA 4CYCB 1GDTA 5E3MA 4JL3A 3CMYA 3B81A 4JX4A 5J3LA 4A3CJ 3FK7A 2WUIA 2QTQA 1FTZA 1ETQA 3BR1A 4C3HJ 3ON2A 1JKOC 1A6IA 1WH7A 2K9SA 1UMQA 2M9HA 3LJLA 3LSJA 2DA4A 4FE7A 3GEUA 5JLXA 1X58A 2K9NA 5D19A 4HKUA 4G12A 1U78A 4JKZA 4M3BA 1BJZA 4W97A 1W0UA 1ZGWA 1ZTRA 3I4NJ 1ZR4A 4YZEA 3VOXA 2Y9YA 2E2JJ 3GTGJ 4BBSJ 3BR3A 2JN6A 3Q0WA 4RDUA 2FBQA 2MG4A 3BR2A 1ETKA 4A3GJ 1TWAJ 3P9TA 2XPVA 3S16J 3IH3A 2VI6A 3ANPA 1RR7A 4UUSB 2VUMJ 4GCKA 1PUFA 1SANA 3BR5A 2PBXA 2HXIA 2FD5A 2MGQA 1LFUP 2RASA 1H89C 1W0TA 2EZLA 4DZPA 1ZKGA 3FIWA 3G56A 1RPWA 1VF9A 3ZQIA 1DU6A 2JJ7A 5J1UA 5E3OA 4I6ZA 2YS9A 1I6HJ 1APLC 3HIMA 1K83J 2ZCMA 2DTZA 1IJWC 1SFOJ 2UXUA 2GFNA 2ZCXA 2HKUA 4XRSA 1VI0A 3G1LA 2HOSA 4A3MJ 2G7SA 1FIPA 2QCOA 1ZQ3P 1MBFA 1WCMJ 3Q3SA 4QTRA 3A02A 5C4XJ 4X1EA 2QOPA 3S1MJ 4MIMA 4JYKA 5IYDJ 3A03A 2P81A 1TWHJ 3TEDA 3CJDA 2R7ZJ 3BTCA 2VKEA 3K2AA 3HB9A 2ZOYA 5C4YA 2JA5J 2DN0A 2R93J 3KKCA 1FEXA 2XPWA 1IDZA 5F08A 1ETYA 3IUVA 1RETA 1P7JA 2MSYA 3NARA 3TW6A 3CRJA 4Y52J 3RKQA 1MBKA 1XC5A 2O8KA 4A3FJ 3BNIA 2LTPA 2CRGA 3NRGA 4CGRA 1GV2A 4L5EA 5EZHA 2KDZA 1ZR2A 3NNRA 3Q0VA 1E3OC 3HDDA 3BG5A 3EUPA 1I3QJ 1O4XA 3WHCA 2E19A 4IHWA 2W48A 2EZIA 5EGOB 2Y0SN 1U9OA 3RD3A 2G7LA 3LHQA 1AKHA 5FLMJ 1H88C 4AC0A 5FHPA 2Y31A 2L9RA 2G0EA 1ORKA 5K7FA 1B8IB 4JX5A 1H8AC 2O7OA 5J1RA 4NELA 3DCFA 3SDGA 4C3JJ 3LSPA 2E2IJ 5K7HA 1UHSA 4W1UA 2XGEA 3IV5A 2H1KA 2ECBA 3TP3A 1MBGA 5EG0A 1QRYA 1JUMA 3QKXA 2EZKA 2DMPA 2LLKA 2V57A 1MH4A 5E3LA 1T56A 1X2NA 1D5YA 3GTPJ 1DU0A 4PXIA 5CXIA 3S2HJ 2QWTA 3JRAA 2WAQN 3KZ9A 5M5XJ 5M5WJ 1HCRA 4IEJA 3SJMA 1IUFA 4FTHA 2ZOZA 3UKGA 5HSZA 3I4MJ 4NDLA 5IYCJ 4LOCA 3GTMJ 2HYJA 1JGGA 2PMZN 3K7AJ 2OI8A 4UUSA 2M8GX 2L7MP 4XK4A 4DYRA 3O60A 3PM1A 4MLOA 2HXOA 3QPSA 1ETVA 2DJNA 2LFBA 2YVEA 2UXPA 4BY7J 4XIDA 1HDPA 2HI3A 1Y1WJ 3IH2A 3F0CA 3HGGA 3FKIJ 4JX6A 3GZIA 2XGCA 3H0GJ 2EQRA 3S15J 2UXHA 2QKOA 3JREA 1F36A 2OPTA 3JRIA 4D5CA 1RESA 4KWAA 3JR9A 3VVXA 2X6OA 3ZQGA 3S1NJ 3GBGA 1HLVA 2AO9A 1IG7A 1OJLA 2DA2A 3B6AA 1YRNA 1QPIA 3O8GA 3PO3J 5EFYA 3BTIA 5FKLA 4M3DA 5GPCA 1T33A 3LNQA 5F27A 2HDDA 1ENHA 2HOTA 3Q0UA 4DYCA 5C3EJ 2QIBA 2REKA 4MXMA 3RH2A 3G7RA 4A3EJ 2E2HJ 1MBEA 2XRLA 1BA5A 3NPIA 5IOYA 3HTIA 1RKTA 1IRZA 2E1OA 4MFEA 4EEFG 4XRMA 1VFCA 2R5ZB 5F0FA 3HGYA 2YU9J 2GUHA 5DAJA 3VP5A 4AC6A 1YRNB 3ANGA 4B4CA 2JMWA 3CCYA 2H8RA 4ABZA 3HKZN 3GTOJ 3OSGA 2L7ZA 1OCPA 1JUSA 2B63J 2JWTA 2IBDA 1LE8A 3OOUA 3WHBA 5HODA 3HOYJ 1UG2A 3VW0A 5FKOA 1K61A 4QIWN 2L0KA 3HOWJ 2MW8A 2NS8A 1MSEC 1LFBA 4NN1A 2COBA 5FMPA 5C44J 1POGA 2WB1N 5EEAA 3ON4A 1FIAA
chains in the Genus database with same CATH superfamily
2JZYA 4N9HA 2FNPA 3BY6A 1JT0A 5H6RA 3C7JA 4DNCA 4X6AJ 1P92A 1UHWA 3JAMZ 2MA3A 1GVDA 3F9KA 4I02A 4PJLA 2JT1A 1H9GA 1YI2I 1MIJA 2FJI1 2NS7A 2R7QA 3QOEA 3AG3H 5DD4A 2Y0SA 4KT6A 3HSEA 3P9IA 2RAEA 4L18B 3S32A 2CQXA 3E6CC 5L3FA 2DMUA 4A3LJ 4RLQA 4BAYA 3A2KA 4UHTA 3WE2A 2QSFX 1F4KA 2P7CB 2VQHA 3DEEA 3TMOA 2IW5A 1SD5A 1Z21A 4WIBA 2EBIA 4DJAA 1TWCJ 3W2WA 3BQYA 3PJRA 4LB6B 5J4VA 2ID6A 1KU7A 2JSPA 1BIBA 3LFKA 4A3BJ 3M9AA 2Y2ZA 3V4GA 5ICGA 1VQ5I 3QBMA 1AU7A 2F4IA 1XDUA 2LF8A 2O3FA 3K2ZA 4ZH4F 2Z16A 3BC8A 4LLGF 3IRRA 2E7XA 2DLLA 3NWTA 4BQOA 2NVXJ 2XUBA 3CC2I 4PJ0C 4G7ZF 1UZCA 3LFUA 3ULQB 3V7SA 4MQVA 1WVRA 2GXAA 3CLOA 1X2MA 2CQQA 3CJNA 3VYTB 5ICFA 3OYAA 5LHGA 5CVUA 2WA0A 2FOKA 5EYRA 4KIFA 4B8XA 4A0YA 2EK5A 4BXFA 5K1YA 4EJUA 2F48A 1MMDA 1X1CA 2HQRA 3NRVA 4B1RA 3S1QJ 2CFOA 4Y13A 1OCOH 4CDGA 2HPMA 3CWRA 1W5CC 3BJ6A 4FE4A 1QQIA 5FLVA 2EWNA 1QVTA 2M4GA 1O7FA 3KEYA 3FXOA 2O6GE 2L7KA 2RHAA 2OF7A 3KZZA 1ETWA 4L9TA 4AYBN 3HL2A 1XTAA 4OD4A 3CO7C 2JA6J 3GF2A 1GXQA 3KNWA 4XONA 2A3SA 1FJLA 4AUXA 3ZN0A 3J80Z 1TLHB 3S8PA 2CQKA 2LRDA 4RB3C 1QHGA 2Y0MA 1GHCA 3K8PC 3BG7A 1FNNA 4DQ2A 3CUQB 3H9GA 1WJBA 4DVYP 4XRSG 3JTGA 3S3OA 1I5ZA 2VXDA 4JNNA 2DDBA 4A69C 1RC9A 3CUQA 3PASA 4R1HA 3VSKA 2XAFA 2ESNA 2R5YB 3BJBA 3F1BA 2P6SA 3DEUA 1N75A 3BR0A 3T0YA 3VVYA 1KQ0A 5HS9A 5EZGA 3U1KA 2CFXA 4ACIA 2EZHA 1TWGJ 2V4JC 4F93B 2FUG2 3S93A 5HDKA 2FX0A 3OWTA 1HW5A 1BR1A 2IA0A 1VZ0A 2I8DA 2LR8A 1OR7C 2ZO4A 4L9NA 2GENA 1BW6A 3M4OJ 5E17F 2M2EA 3BT9A 3FWEA 3K1MA 1BR4A 3RYPA 5D4SA 4MK6A 1RKWA 4MEYF 1X4OA 2K5CA 2NOGA 1O7LA 1JHHA 1HKQA 3L2QA 3BRUA 3GTJJ 3K4LA 3VTIA 2WV0A 2M3AA 1ZK8A 1S6LA 1J75A 2OV7A 3LOCA 3GLLA 5E1XA 3JRCA 1W7PA 3VUQA 5DCMB 2L4AA 4OINF 1LQ1A 4UNOA 5TJJA 2AXLA 4KA4A 5E3NA 4X0GA 3LSIA 3N4MA 5F0CA 1GT0C 5FGLA 5JVGF 4DZJA 1R6RA 1XGNA 3G6EI 2WY7Q 3NS4A 4I98B 4ZYAA 4NC6A 2QKLB 3ABMH 3MKWB 2ZSHB 4BHPA 3WTSC 2OERA 2L7FP 3JRDA 4D5FA 5L3GA 2FU4A 1O57A 1Z0XA 2AHQA 3GX4X 5IY5H 1TC3C 2CV2A 4A12A 4BHCA 4V2FA 1ZELA 3G3ZA 4O6JA 3I59B 3CCLI 1ZLJA 4EGYA 2WGBA 5HDGA 3DEWA 2TCTA 4C3IJ 1W7PD 1E3HA 5E1WA 3ZQFA 4ENMA 2W53A 4IVNA 5FO5A 4MNUA 3FXJA 4CCMA 3F6VA 4CH7A 1SAUA 5GTIC 2ME0A 2HTJA 3MEXA 3BCGA 2H8WA 4XLEA 2V6CA 2ZB9A 4JK1X 5ICEA 2QENA 1S5LC 4E7LA 3KCCA 2X9DA 1Y8QB 4HW0A 5E18F 2QF7A 2GOMA 3NXCA 2DODA 3BG9A 1XG1A 1ZRDA 5DM6F 1OFCX 3ZQHA 4MGRA 3HTHA 1R23A 4E7JA 1D1CA 3ZQQA 2ID3A 1PUEE 4BY1J 4IKFA 2QA4I 4FASD 3LWJA 3G1OA 5IT9Z 1UJ8A 2BYVE 4AU7A 3HOXJ 2A5WA 1U6GA 3FKJA 3PQJA 4AIJA 2E71A 3G2BA 3WTXC 2FQ3A 1B1BA 3KP3A 1MGTA 5LRSA 4DYQA 2AS5F 3KYLA 5HS7A 1LEAA 1W5SA 1CQTA 4E7ZA 4B09A 1HC8A 1WPKA 2K7LA 3I5UA 1X3ZB 1R5GA 3K4MA 4NNJA 1TQMA 3RDIA 3ON2A 3GZNB 2Q0OA 3LAPA 2K9SA 4HEA2 5DDGA 1V54H 3QU3A 4PCQA 2DA4A 4FE7A 4HKUA 2JVGA 4G6TB 1BJZA 2PEXA 4W97A 4AWXB 1ZGWA 3KEOA 4RAFA 4E7KA 3VOXA 1NG6A 3GTGJ 4BBSJ 2FBQA 2DT5A 3L00A 2ETHA 2MG4A 1XX5A 3ERED 3P9TA 3SZPA 3S16J 2EFWA 2Y48A 4GCKA 1SVOA 4MQ9F 1PUFA 1SANA 3BR5A 3BG6A 3SZTA 1VQLI 2PBXA 1H89C 4EGZA 2V79A 2V1DA 3F8NA 5LHIA 2L3DA 2ZMEA 3W2VA 2GA1A 3NWSA 3MWMA 4ZZDA 2BXZA 5J1UA 4B48A 5LGNA 4BNCA 1YX5A 4MTEA 3ZMUA 2EPFA 1APLC 2IS4A 2K9LA 3LSMA 1K83J 2RC4A 2ZMEB 4H4KC 2ZCMA 3RPQA 3AAFA 2F5CA 2R7DA 4XRSA 1U8RA 4BEHB 3G1LA 2HOSA 2MD0A 2HFHA 2G7SA 1WKMA 4F3QA 1FIPA 1ZQ3P 1MBFA 1R5ID 2KFDA 2UUZA 4G6DA 4WX9A 2NNYA 3PUBA 4WXDA 4KDPA 2BV6A 2LY1A 3L2CA 3I71A 2F4OB 3A03A 3OYLA 2P81A 1D0YA 3HJEA 2VKEA 3TO7A 3KIOA 2JA5J 2DN0A 2MLKA 1YX3A 2QLZA 2VQCA 4CXFA 2IGNA 2VOPA 5AIQA 4UVAA 2DAOA 2CUZA 3NARA 3WTYC 2OTJI 4Y52J 2L01A 3RKQA 2R7VA 1XC5A 2O8KA 1YQAA 2X0LA 1TL8A 2LTPA 1ZN2A 1E0EA 1SAXA 1GV2A 2WAEA 5EZHA 2KDZA 3GCMA 3Q0VA 3HDDA 2B0LA 2ZXJA 1I3QJ 2GAUA 2DCEA 2E19A 5L3CA 2EZIA 5EGOB 1E2XA 4J00A 1T38A 1DP7P 3RKYA 2G7LA 3LHQA 3G73A 2KIQA 2QSHX 1BOBA 4HRIA 2WC2A 2EIMH 4ESBA 2G0EA 3FXMA 1R71A 1A6QA 3OYKA 2XF7A 1B9MA 2W82A 3F6OA 5J1RA 2X1DA 2E2IJ 3ZN1A 2LG4A 3M8EA 4W1UA 2XGEA 3IV5A 1FYKA 3MFKA 5EG0A 3K10A 1Z91A 1K6YA 4P5OA 1MH4A 1T56A 3J81Z 1X2NA 4M9XA 5FRMA 2DJIA 5CVRA 2BY0A 1XD7A 1JI8A 1FY7A 1YFHA 2QWTA 2QQBA 2F6CA 1Y56A 4RB0A 3K69A 3KZ9A 2FMLA 4UVCA 1IUFA 4FTHA 2BHYA 1YJ9I 2HZTA 1VQPI 2M45A 3DV8A 3V8JA 3GTMJ 2HYJA 1I39A 2PMHA 2PMZN 1JGGA 4P1WA 2OI8A 3WTZA 2RNJA 2M8GX 2L7MP 1SVLA 2XIGA 4EJWA 2X1CA 2FF4A 3OYFA 3L2RA 3FXQA 2UXPA 3DLLF 1HDPA 2HI3A 2D2WA 2IP2A 1R5HA 3EYYA 3F0CA 4EMSA 3T8RA 2V1UA 1JXSA 3KZYA 2HYFA 2RVCA 3O6BB 3H3ZA 4BJ6C 3DPUA 4XQFA 2ZSIB 3QP6A 1T8IA 3DFGA 1RIOH 5DCFA 4KWAA 2E35A 3JR9A 2F4MB 4B47A 1P4WA 3CD6I 1HLVA 3TOBA 1CGPA 3JW4A 5EFYA 1IO2A 2M7AA 3J80K 3OV8A 3RKXA 2E1MB 2WWYA 5GPCA 4Y17A 1MW7A 5LRRA 3A1YA 5C3EJ 2QIBA 3RH2A 4A3EJ 4BGDA 2E2HJ 1MBEA 1YIJI 2W00A 2VT3A 3IHUA 4QPOA 1T0FC 4RGXA 3WU0A 4MFEA 1IXSB 3TKYA 2Z99A 3R0AA 1Z3XA 4XRMA 3MMYB 1QZZA 3GFMA 1VFCA 2NS0A 2PJRB 1L3LA 3HGYA 2GUHA 1STZA 1TW3A 3CTAA 1BI3A 2JMWA 3CCYA 3T8TA 2GOXB 2LNBA 1G6NA 2BE5F 2BVMA 1EKEA 3JSPA 2KPMA 4XKCA 3FXLA 2LSOA 1UG2A 1AWCA 3VW0A 2W85A 1FOXA 2HOEA 4QIWN 4YG2F 2LH9A 2HVQA 2MW8A 3TOAA 1OMIA 2COBA 1O3QA 3Q9VA 3BJAA 1MJBA 2YX7A 2XAJA 5C44J 2YPRA 2VL8A 5TRDA 4IO9F 4HLYA 4CZZA 1FIAA 2F2EA 1ZRCA 1NG7A 1LKXA 4B3AA 1VQNI 5DS9A 2IAIA 3WTWC 2XGXA 3DU5A 1LVKA 3EPZA 3K1NA 1TP4A 1U9NA 5JI6A 3ZGKA 3HE0A 4PFOA 1MBHA 3QQAA 4GYGA 3HRSA 4XLPF 4EVIA 3QYEA 3P5JA 1AA7A 3B6CA 4C9YA 2LKXA 4XBFA 1T98A 3GWZA 3E0JB 3E6DA 3B73A 2EV6A 2XDNA 4QPQA 2CW8A 3KX2A 2HQAA 4BL0B 5L3BA 5F6FA 4E4HA 3VYRB 2DA5A 1CF7A 3SXYA 4PSWA 3IRQA 1WJ5A 1Y1VJ 2HS5A 4QSHA 3RI4A 3SFZA 2X6WA 3I53A 4O3MA 3V78A 1OQYA 3KLNA 3PPBA 1B8IA 2LVSA 3RQ4A 4OAZA 1ZH5A 4A0ZA 3AL0B 1I27A 3BDDA 3V42A 3FISA 1ON2A 1E17A 2Q1ZB 4BJTA 3RZDJ 2PZ9A 4MO7A 2PG4A 4BKXA 3HHHA 4CO8A 3FDYA 2KT0A 2A68F 2R7WA 4JOMA 2DA3A 2WBMA 3G1MA 5BMZA 1DDNA 5EEGA 3DTKA 2DQLA 3ZMSA 4ME9A 3BQZA 1WFXA 4ZYEA 3RSNA 3D5SC 5H2FC 2V6EA 4AF5A 4M74A 5IP9J 5EG0B 1OR7A 1SFUA 2B7EA 2IEKA 4XKVA 3RKWA 1USSA 3E5XA 4HF0A 4KN4X 1R1VA 3HOSA 1T39A 2GM4A 2W57A 3HG9A 2J5OA 3OYBA 4PUSA 3U21A 4A3IJ 1WRJA 2ZCNA 2OJED 4GXOA 3SDBA 2DYRH 4PFPA 1FOYA 3C2HA 3FRQA 4YEJA 3SYTA 2IGKA 1S7OA 3MKLA 3AG2H 2ZFUA 4GFKA 2D6YA 3CESA 2Z3YA 4EATA 2HR3A 4AIDA 3ZMVA 4DGWB 2R3SA 2A6EF 2OU2A 1JUPA 2V1XA 3FXUA 3GLXA 2PI0A 1ZRFA 4G9YA 4FISA 2W84A 4HV6A 1VNDA 1RUOA 3JRGA 1Z9CA 3PIOF 4BQQA 2VBYA 1WJCA 2EFQA 1WWXA 3TP0A 2UXNA 1D0ZA 2IU5A 2JRMA 2VKVA 5F64A 1LEBA 2N8GA 5C4JJ 5IT9K 4M3GA 2M4KA 2Q2EB 1Q1VA 4KJZA 5J6XA 2ICWG 3DXJF 2I10A 4XOTA 5GAGJ 4HNVA 3ZQCA 2ISYA 1V3FA 2CQ7A 2FA5A 4YFKF 1TNSA 3H5AA 1FC3A 1V4RA 3J7ZI 1FMVA 2YR2A 3E5UA 3OYHA 3BR6A 2DG7A 4FCYA 2QQ8A 2GWRA 2CUFA 4BU2A 4XLAA 1JKQC 4KISA 3FMQA 4D7NA 1IZ1A 2P0WA 1JKRC 3LSGA 5FKKA 3K9TA 3GZ5A 3F8CA 2K85A 3S2DJ 3RZOJ 3E7QA 4AIHA 1F5TA 5GP9A 1VQ7I 1WI9A 3H5RA 3D5LA 3MCZA 3SEQA 1J09A 4LG3A 3RPUD 3V7RA 1BBYA 2H27A 2KZGA 5LHHA 3VODA 1NK2P 2B3WA 3HIMA 3KP5A 1BI2A 1IDYA 4OOIA 4ZDPA 4GCTA 3LQRA 2QBYB 3WTVC 1L0OC 1W36D 5FLXK 4IRVA 1XCBA 5K5RA 3GUDA 2ZNZA 3TDUC 2GLOA 2NP3A 1V5FA 3FX3A 2DOFA 3OYMA 1HF0A 4LD5A 1KGSA 4J01A 4DBRA 5J8FA 5IOZA 2DG8A 1Y0UA 2G3BA 3JSJA 3S3MA 1D5VA 3E1SA 1KQ9A 3BP8A 5HS8A 3M1EA 2E5ZA 4ZDLA 3ASOH 2UXOA 1FMWA 4KYWA 4GCVA 5FB2A 2LREA 2XSDC 3KP4A 2NVYJ 1IW7F 2ME6A 1S7AA 2Y75A 4L5JA 3V8KA 2HYTA 3GFIA 2X6XA 3VYSB 4UB6C 2COMA 4DW6A 3ZQLA 2IT0A 2KRCA 3BTJA 4IJAA 1WJEA 4H0EA 1Y39A 1JKPC 2JA7J 3O8HA 2VQGA 4WK8F 1P4XA 2EV5A 4ITVA 3HBLA 1BL0A 2AXTC 3HTJA 5HNHA 1CF7B 1OCZH 3ESWB 4M3FA 4BS9A 1N78A 2DI3A 2XB0X 1DGWY 1OYYA 2CYYA 3KLOA 3HPHA 2DMTA 2DT7B 2Z2SB 2NVQJ 4N4NB 1R00A 4XICA 1FWZA 4IHYA 1J5YA 1P7IA 2P8TA 4GFBA 3D5RC 5B1BH 1IXCA 1I50J 3NAUA 4E7SA 2JA8J 3HOUJ 1ACIA 3PSFA 4MTDA 5E3MA 2VJ4A 2KHMA 4XR6A 2K4JA 4A3CJ 3FK7A 2WUIA 2QTQA 1FTZA 4R79A 2JUGA 3BR1A 3OS1A 2EIKH 3J7AO 2IPQX 5L3DA 1UMQA 3LSJA 1YJNI 3T5XA 1UCRA 5JLXA 4RB2C 3L9FA 4XLFA 3DPTA 2ZY9A 2ZKZA 2M5WA 1Y0NA 2O0YA 1HKTA 3TBIA 4UXNA 4JKZA 2BZTA 2O8XA 1TNTA 2EJRA 4UV8A 3I4NJ 4YZEA 4HV5A 2Y9YA 3Q0WA 2OAZA 3E3VA 3MKZA 3BR2A 4HX4A 1ETKA 1SEUA 3HOTA 2XAQA 2ZJ2A 2XPVA 4IRHA 2VBZA 4XLCA 1K78B 2VUMJ 1VQ4I 3LMMA 3OL3A 2V9KA 2HXIA 2GIVA 3K4JA 4LLLA 2BHZA 5H6QA 3R60A 1ZKGA 5DEQA 2QSGX 4O5VA 2VE8A 3RYRA 3QYBA 1VF9A 4I0AA 3S2WA 4FHTA 3KETA 2JJ7A 3COAC 1Y6IA 2H94A 4EJOA 1S72I 4RM3A 5E3OA 2IS2A 3C1DA 5JHUA 1NHAA 4EM1A 1O3RA 1SFOJ 2HDWA 4LK1F 2UXUA 2GFNA 2ZCXA 2HKUA 1I3AA 1HA8A 3ZMZA 1KONA 1BI0A 2ZCWA 1LUJB 2QCOA 4XKBA 1WCMJ 2LMDA 3Q3SA 4M72A 4QTRA 2B1EA 4HPQA 1P2FA 2CW0F 4HQEA 2JSCA 3FHZA 3ECHA 2DK8A 1A36A 2EA4A 4FX0A 1OKRA 1FBSA 3CJTB 5CVVA 3S1MJ 5IYDJ 3OYJA 2Z9OA 3E97A 4S04A 3BTCA 5CQGA 3K2AA 1PP7U 3U2RA 1WJAA 2WB1A 2MFZA 1ETYA 3HUGB 1RETA 2ISZA 3CCMI 2PJRA 1OCRH 3WTUC 2PFBA 2V26A 3BLYA 1UELB 3BNIA 3NRGA 1FP2A 2FEZA 5FD5A 2RQPA 3ECOA 1ZR2A 2P7VB 1E3OC 3M8FA 3LA7A 3BG5A 3DKXA 3TO9A 3EUPA 4E7IA 3WHCA 2CO5A 1IXRC 2EIJH 4IHWA 3E6BA 2Y0SN 2P6TA 4FX4A 4EQQA 4HNUA 5FLMJ 4AC0A 5FHPA 2Y31A 1REPC 2RQQA 3IC7A 2CMPA 3WGHA 2GZWA 4I2OA 1VQ6I 3C3WA 2O7OA 2M0MA 2UV1A 1F1ZA 1P6RA 2QWWA 2QBYA 3H3UA 1EH7A 5LLQA 3LSPA 1H0MA 4YRVA 1IN8A 1UHSA 4P9UA 2DOEA 2FNAA 3EUHC 4U7BA 1E3PA 3HXLA 3V7CA 1QRYA 4YIIA 4RGSA 3QKXA 2HU9A 3ABTA 2C6YA 2WAFA 1YHQI 4PXIA 3DBRB 1OYWA 2VQLA 3S2HJ 3GO5A 4EJTA 5B3SH 3HYIA 2E5NA 2WAQN 5M5XJ 5M5WJ 3K70C 2HEOA 4CCLA 5HSZA 2L9SA 4NDLA 2KISA 2MC4A 3I9V2 1RZ4A 3PFYA 1YTYA 4AVPA 3ASNH 1UAAA 2FSWA 2K3FA 4BYYA 2JA2A 3CF2A 4CUGA 4NC8A 2LBFB 3PM1A 2MABA 1X1DA 1B59A 1FP1D 2LFBA 2A6TA 2F5VA 2MYSA 1N77A 1QA6A 1X1PA 1SFEA 4XOPA 1Y1WJ 1DQUA 3PSIA 2BXYA 5EJCA 4XSXF 3QAHA 1BN5A 2XGCA 2YVXA 3H0GJ 3S15J 4M9SA 4BHBA 4S05A 2DTRA 2EILH 1FX7A 2QGUA 3JREA 1RESA 2VLAA 1QO0D 2YU3A 2KIFA 2KJCA 4XN0A 3VVXA 4A2UA 1BI1A 3SEZA 3B6AA 2QUFA 1BM9A 2VKHA 4GO1A 1YRNA 5ED4A 1QPIA 2K02A 3W3CA 2GIZA 3QODA 1XMXA 4CHUA 1G59A 3OR2C 4A6DA 1U5TC 3DQVC 4M3DA 1R1UA 2MH9A 5F27A 1D3YA 2XSJC 2HOTA 4DYCA 3H35A 1ZAOA 2VJIA 1ZYRF 2KLOA 3I3LA 3MZHA 1BA5A 3NPIA 2HZDA 1OYIA 1PYVA 3HTIA 2QM3A 3EQLF 1IRZA 1W4MA 4OIOF 4PJNA 4EEFG 3L2WA 3OYDA 1W1WE 3OS0A 2PX9A 4RGUA 2R5ZB 1YW9A 2YU9J 5DAJA 2VE9A 2PQ8A 1TT5B 4XORA 2XKPA 2HDCA 3NEUA 1OISA 3WGGA 1D8KA 2L7ZA 3ZCOA 3HRUA 1R1TA 1JUSA 1LFPA 1LE8A 1ZARA 2RDPA 4KIGA 5HODA 2B9SA 3HOYJ 2F5FA 2UWMA 3CP8A 1IN5A 3H92A 4HAMA 4I0BA 4ZTFA 1G8XA 2IA1A 1M1EB 5HLIA 1FLIA 1R7JA 5FMPA 1POGA 4Y4RA 4BE1A 1RNLA 1HSJA 5EEAA 1JTXA 3VPRA 1USTA 1VQ9I 1HKSA 2XAHA 3R0JA 2L9NA 4LITA 1KA8A 2YUSA 4ICHA 1T2KA 3K1PA 1D8JA 4C2MJ 2XROA 3RIRA 1JTYA 5BOXA 3BWGA 2ELKA 5EF6A 2A69F 3M8JA 5HOOA 1PVEA 4J19A 5LFAA 1MSFC 1MJAA 3A0HC 2Q2EA 1UI5A 1EF4A 4GYIA 5JFRA 3REOA 2ZFWA 2VT2A 4PZJA 3BZKA 3UNGC 3TO6A 3TQNA 4YFNF 4ESJA 2VJJA 5DM7F 3K4BA 1DP3A 2R4GA 5CW8A 2R7SA 2A61A 1D0XA 1Z1DA 1EH8A 3C07A 1G3WA 3I59A 3PNYA 3CP2A 3A4CA 2NXNB 3ZMDA 4MEXF 1HOMA 4XM3A 2RN7A 2DT6A 4XN3A 5D8LB 3S1RJ 4V19K 4RGRA 1FYMA 6PAXA 1GV5A 5D6FA 5EEHA 1LB2A 2VONA 1XPXA 1J9IA 2K9QA 1G4DA 2OUMA 4L0ZB 2XPUA 2FE3A 3UR3C 3S14J 3DU6A 3GFLA 3O2PE 3AQSA 2IVMA 4HQMA 2M34A 3JCUC 2O9LA 5E8GA 2A5YB 3OIOA 3F8FA 3PO2J 4A3KJ 2DPDA 4LIVA 2O7TA 4IX7A 3LSRA 2TDXA 2HGCA 3OR1C 4II2A 3GZ6A 5AQCA 3IAS2 5D18A 3B02A 2XASA 4LMYA 3MKYB 2W7NA 2PLYA 1A5JA 3EUAA 4EM0B 2ACJA 4HDVA 5HLTA 4EM2A 1D1AA 4P9FA 2BEOA 3CUOA 2JUCA 4LB5A 5K5OA 2LD5A 3D0SA 5CVIA 2DMNA 2DMQA 1W5TA 3R61A 5LGUA 2W24A 4XKWA 4OIPF 3NI7A 1BJAA 1ETOA 1NTCA 4UVBA 3OYGA 3S17J 3HEFA 5K58A 3H9JA 2V9VA 2K3PA 4ZYDA 5DCMA 4ZYGA 4RS8A 2BVLA 4N9IA 3MAJA 3I0TA 3T6NA 3BCAA 2EFNA 3V6GA 3KP6A 2YX4A 3I64A 1IN7A 4IHSA 1HSTA 2O61A 3VOKA 1FSHA 3WU1B 2DK5A 2FQ4A 1TWFJ 3HPGA 5J47A 2L54A 4OAYA 3HKZA 1YO5C 2E34A 1I1GA 2R0QC 5IPAA 1MNMC 1K79A 2LK2A 3EYIA 3EETA 3CJQB 4RAYA 3EGQA 2Z33A 5BPDA 2BW3A 5EGOA 4WXCA 1A04A 1Z05A 1ULYA 4CA0A 2DA6A 3BZCA 5ILUA 5LEKA 1J0RA 2R5YA 4I76A 1J59A 2HYGD 4E7HA 2K40A 2PN6A 3BROA 3CDHA 4ESFA 4ZC3A 5HNFA 3TW7A 3IKTA 1XN7A 4LLNA 1X1BA 3AKZA 4L62A 1GUUA 2VB6A 3BHQA 2WV1A 4Q47A 1MZBA 3I55I 3D1NI 5FROA 2BOLA 2ZXWH 3HTAA 3E7LA 4CCOA 4YELA 2D1VA 3DBLB 1BOAA 1GVJA 5M5YJ 3K70D 4LG0A 3BTLA 5A2QK 1MH3A 3IWFA 5FKMA 3W6JB 1IC8A 1UI6A 2Q24A 1MMNA 2CV0A 3HTSB 4N0BA 3F8MA 3LAJA 2DOAA 4XLHA 2V7FA 2OQGA 2QYOA 4CZCA 4WCGA 2FBIA 1YG2A 2DFIA 2FXAA 5CLSA 5IYBJ 1ONVA 5JLWA 3JSOA 3EUHA 1AKHB 1HDDC 5FD6A 1MJ9A 1B72B 3W6VA 3LSKA 3CCJI 4ZTJA 2Z1DA 5HLGA 3GTKJ 3VVZA 3CDLA 1T08B 1NK3P 4RBOA 3OIQA 1YITI 1BR2A 3ONQA 4CGZA 2DW4A 4A93J 2FJ1A 2W25A 3SFIA 4A6EA 2DO7A 1OPCA 4G94A 3TDZC 3S5RA 4I09A 1XMAA 3CUQC 4Q4ZF 5D8KB 3A01B 2F07A 1Z67A 2GBYA 2UXIA 5KHDA 1QZEA 1S7EA 5BNGA 3MN2A 2F5DA 4C2MA 5H20A 2KJBA 3SZGA 1B6AA 3AG4H 3FK6A 4Q48A 5AONA 4G7HF 2DA1A 9ANTA 4HNTA 2XVCA 4L9VA 4L5IA 3H9QA 5CPRB 4PGHA 1MBJA 5DUKA 2HWVA 1R4MB 4M6VA 1S29A 3ZR8X 2FBKA 3BPXA 4HLXA 4Y7NJ 1O3SA 1BIAA 3FXRA 1LJ9A 4AYBA 1SC7A 1OCCH 1KU3A 1SFXA 1A31A 3FM3A 1OCTC 2Y69H 3C2BA 5DTDA 1FTTA 1R4NB 3BG3A 3DPJA 2CJJA 5F04A 4HX8A 1EJ9A 1GLNA 1MDMA 3MQ0A 2NNNA 1EV7A 1ZHFA 4Y3OA 1XS9A 4HDUA 1QVUA 1T6SA 5J8CA 2HOAA 3I56I 3MD2A 4DBQA 4B44A 2XRNA 1GDTA 4JL3A 3RCOA 3VB2A 3B81A 5CVJA 4JX4A 2OBPA 1UG0A 5DV5A 5J3LA 2NVUB 4AVZA 5D6EA 4HA8A 5FFXA 1A6IA 2M9HA 5LGTA 2HVRA 2ESHA 3LJLA 2GXBA 2QKMB 2OQRA 2GA2A 3L2VA 1X58A 1IF1A 4G12A 1KU2A 1U78A 4NB5A 2H09A 4M3BA 5LBQA 1W0UA 1HW2A 2E1MC 4UUVA 1SVMA 1SMTA 2JTVA 2QZ8A 4CCJA 1KU9A 3BZ6A 3ZP5A 1TWAJ 3C18A 3IH3A 2XAUA 2MC3A 3HTUA 2VI6A 3OS2A 1FSEA 1U0JA 1X3UA 2FD5A 2MGQA 5D5XB 2EZLA 1IN6A 4DZPA 1N25A 3VWBA 3H1CA 1R36A 3PUFA 2L5QA 1W7PB 1DU6A 2VOOA 1TT0A 3W2AA 2HKOA 2QQAA 1G3YA 2L2OA 4BJ5C 3L2UA 4ENNA 1I6HJ 4QLCU 4OMZA 4XLNF 2OD5A 3KFWX 4UY8I 2JRTA 2L9VA 2OCCH 4KICA 2R7RA 2AQEA 1WJFA 3A02A 5D4RA 1EA3A 4X1EA 5ILVA 4KN7X 4WXHA 3E6MA 2QOPA 1G3SA 1I1SA 3FBIB 4KT5C 4MIMA 3F22A 3FMSA 4HX7A 1HBXG 2R7ZJ 2MBFA 1V5GA 3HB9A 2ZOYA 2M87A 5FLXZ 2R93J 3KKCA 3IUVA 2H6CA 3KYDB 2MSYA 3K6GA 3TW6A 3CRJA 3OMYA 3QP5A 4HBLA 2HKXA 3S3NA 4ETSA 2CRGA 2DFFA 1R58A 1Z7UA 4YFXF 1RI7A 1O4XA 2ZXIA 2E60A 2W48A 5GADJ 4YIRX 3ISPA 3RD3A 4E70A 1AKHA 2VC1A 4ZJZA 3W6KB 3K4NA 2KIMA 5K7FA 4D1QA 5TISC 2KRFA 4JX5A 1H8AC 3BCBA 4KNYA 4F7ZA 4NELA 3WODF 2I5UA 3DCFA 4GRIA 4C3JJ 2W4SA 1K7AA 1G3TA 3ERMA 3JTHA 5K7HA 2G7UA 2H1KA 2ECBA 4ZZLA 3TP3A 1MBGA 3U9GA 3FMRA 1JGSA 2X6YA 2EZKA 3DKYA 3G71I 4F92B 2XAGA 2V57A 4KUMA 3VOEA 2HQNA 5ILSA 3GTPJ 5CXIA 2LOOA 3MZYA 3KPHA 2XF6A 1SD6A 1P9QC 1B4AA 4I99C 1P4AA 5CJ9A 2D45A 1K4TA 3L7WA 3SJMA 4M6YA 4C2TA 3UKGA 2O03A 1H9TA 1J2XA 1QHHD 2ADUA 4R8HA 4UUSA 1LDKB 4HYEA 4XK4A 5E79C 3QYFA 4AM3A 2KIUA 2VXZA 3V8LA 5HLHA 2HXOA 2KP6A 4IRGA 3M07A 3F21A 1W36C 2DJNA 2W1OA 4BY7J 1HW1A 1RUNA 3IH2A 3HGGA 4RAGA 2ZNYA 1VTNC 4M9ZA 3FKIJ 3HUGA 2X51A 3GZIA 4C30A 3F3XA 2EQRA 2QQ9A 3FZVA 1Z3YA 2QKOA 2KDOA 1RRJA 2OPTA 3OL4A 4IQ4A 3KP2A 1BC7C 1B9NA 2MLGA 2PJPA 3CC4I 2Z5UA 3SHFA 3ZQGA 4DIQA 3GBGA 3IUOA 1OJLA 1QNTA 4RAZA 3PO3J 3O8GA 1TBXA 1LVAA 1RR8C 3BTIA 2DBBA 4U0VA 5FKLA 1T33A 1IRXA 3LNQA 1ENHA 3FBNB 2X4HA 3Q0UA 5FFZA 2DXIA 2VBWA 4PK4A 3ZRGA 3TGNA 1MMGA 2REKA 4MXMA 3RJPA 2A07F 5J40A 3OOPA 4YIFA 3R6SA 1RKTA 2VIXA 2VC0A 1VQ8I 1YW8A 1VQOI 5D5VB 2BBYA 3EDPA 1Y8RB 5F0FA 3VP5A 2M8EA 4B4CA 2H8RA 1XGOA 4ABZA 3P9CA 1LDDA 2VPLA 2KMUA 1SFKA 2KQRA 1Z6RA 2XC7A 1R49A 4PJJA 3AG1H 1MNDA 2JWTA 2LBFA 2IBDA 5HDNA 1MNEA 2IXSA 2IGMA 3H5NA 1FOKA 4LGWA 3OOUA 3WHBA 1QGPA 1WQ2A 3MZ8A 5HVQC 3VEPA 1ZG3A 4F91B 3T1BA 5E8IA 3HOWJ 3L09A 2NS8A 2K9MA 1LFBA 3QU6A 3VFZA 4U9NA 2ZMEC 2DU9A 1QPMA 4RB1A 3LL7A 1SMYF 4A0XA 2MH2A 4FETA 4I7HA 1OCPA 4NBQA 3VYUB 5LEJA 2DYSH 4F55A 1YS7A 4LIUA 5B1AH 5HAWA 4UB8C 5LD2C 2JPCA 1SD4A 1JJ8C 3ABUA 3QWLA 5F1JA 1WSUA 2F5EA 3J7AY 1Z7LA 1ON1A 5GPAA 1ZREA 2LY9A 3KE2A 1BC8C 3F8BA 3F72A 3K4KA 5CKTA 1TW2A 1MMAA 2XDVA 4BXXJ 1LDJA 4MHGA 3A0BC 1Z77A 2BY1A 4BBRJ 2HNHA 2Y9ZA 1HXDA 4BH9A 1XSXA 2EFPA 3JRBA 4L0YB 2E1NA 3GTLJ 3CCUI 5EDNA 2A2FX 1V5EA 5FJ8J 4K2EA 1U5TB 4CSWA 3EUKL 2R5ZA 1IAWA 2PMUA 4U87A 3VSLA 4IOAF 1XDSA 4NQWA 4GCLA 2VPRA 2DFHA 5F0HA 5J1YA 4P55A 5F1RA 4BQNA 1ITYA 2OZ6A 4BE0A 3CCQI 2DDAA 5H9TA 1Q1HA 1YJWI 4G6QA 3ZOBA 4U0WA 2TRTA 1K78A 2K27A 1DUXC 1AHDP 1YE9A 4IHXA 4D0PA 2E36A 2PMZA 4I01A 2OZUA 2XB5A 5TGTA 3HOVJ 1TQPA 2ZJRF 3CCVI 4A3JJ 4G7OF 4PGGA 1IV8A 3MNLA 2ECCA 4NC7A 1UB9A 3WTTC 3L1PA 2FOWA 1TTYA 4M6XA 4KMFA 4U7DA 3JRHA 2CS3A 4A5NA 3K0LA 1B72A 2P5VA 3DTEA 3ABKH 2GQQA 2LKSA 3WE3A 3OYCA 3E5QA 1V55H 5CQEA 5AIPA 1LNWA 1K6OA 4WWCA 2AQFA 3PFIA 1FBQA 3WGIA 2X48A 3Q9SA 2D5VA 1WH5A 5JR3A 3A01A 4F52A 4BE2A 3J7YJ 5D1RA 1R9TJ 5DUIA 4LK0F 3SWHA 1TZLA 2FRHA 2NP5A 4L9JA 4BDZA 4RM2A 4BQAA 2IS1A 1XGMA 3VIBA 2YVHA 2WY8Q 3DLAA 4U88A 4D7MA 3KKDA 3CC7I 2KZVA 4V2GA 2NX4A 3DP7A 1IRFA 3GTQJ 3CZ6A 2R92J 3PNVA 4GFLA 1S9HA 4UUTA 5IT3A 4HZFA 1ZGAA 5CXGA 1NH3A 4TV7A 1PUFB 1U8BA 3IH4A 3QPLA 2IRFG 4UDSA 4CCNA 5KK1A 3COLA 3ZQ7A 2H6BA 2IS6A 3HRMA 2G7HA 2ZC2A 3ELKA 3CCEI 2OTLI 1BW5A 2BGCA 3RQIA 2CH0A 2P4WA 3VW1A 5D5WB 2CWEA 1XSVA 2RREA 2XV4S 2G7GA 3KZIC 1G2HA 5E1ZB 2X85A 3HM5A 4BUPA 2ELHA 1X4PA 1KZHA 1YW7A 2DA7A 4Y33A 3CQZJ 3GFJA 5IP7J 2EA2A 2JK3A 3NQOA 3HOZJ 3DKWA 1JJ6C 2CQNA 3KEQA 1SGMA 2CV1A 2ZJQF 5KNLA 4HOBA 4XMYA 3RTRA 4A3DJ 3LSTA 2VBXA 3ZXSA 2DPUA 5B66C 4RLFA 3HSFA 3CO6C 4IXAA 3DWLE 2ZXHA 5FKNA 3DF8A 4OWRB 4PSXA 3OSFA 1ZLKA 3AQTA 5JHFA 1LPQA 3IWZA 4JP0A 3IAM2 2LF7A 1OLTA 2STWA 1Z6TA 1ODDA 4C2UA 2G9WA 1QU3A 3MVPA 4FQGA 3H0DA 4OMYA 1JE8A 1T95A 4PJMA 2RGVA 1WGXA 3LSHA 4XNFA 4IHVA 2ZBKA 3LA3A 1WJDA 2IJLA 2WADA 4ANJA 4GGGA 2O5RA 2VODA 2CU7A 2XKOA 1JHFA 5IP6A 2NVTJ 4P96A 1IN4A 5K7ZA 2LP0A 3GW2A 3H36A 4IL6C 4XL9A 3JRFA 4HF2A 3GMEA 3PL8A 3KYCB 3RPUA 3H3VK 1MDMB 3GEZA 2KRHA 4S0HB 4BXUA 2K86A 1ETXA 1F43A 2BW3B 5K5QA 1JT6A 3P9KA 5DD8A 3VW2A 5HBUA 3DBHB 2MD5A 2HVSA 1S8NA 3C2GA 5M3FJ 2M0CA 3P7NA 1YOVB 2Y30A 2CW7A 3J81K 4HSTA 2KL4A 2XF5A 3CCSI 3HSRA 4MFDA 2EFOA 1IGNA 3Q5FA 3BOQA 3CMMA 2CGPA 1LE8B 2CUEA 3ZMTA 2EH3A 4NHJA 1ZG1A 4IQJA 3M3YJ 4WF2A 2UZKA 1YIOA 1S3JA 2HQ5A 3CF5F 2H1LA 3KP7A 3OYIA 4HG2A 1DPUA 2STTA 2WAQA 2JPBA 4CYCA 1WI3A 4N4OB 1J7KA 3CLQA 1IV6A 1PJRA 2FBHA 4KIBA 2HTSA 5M3MJ 3BJOA 4M3EA 5DYMA 2XGDA 4CYCB 1FBUA 3CMYA 4BACA 1QZYA 1XCVA 3GXOA 4BDYA 4IRIA 4B3XA 1ETQA 4C3HJ 3AL0C 1JKOC 1WH7A 5KCMA 5FGMA 3GEUA 4IHTA 2K9NA 5D19A 3G4SI 1ZTRA 1FZPB 1ZR4A 2FMYA 2ZJPF 2E2JJ 3PQKA 3BR3A 2JN6A 2OC6A 1SD7A 3LA2A 1DPRA 4IF4A 4RDUA 4IZZA 1YLFA 3HHGA 4A3GJ 2A6HF 3R4KA 2R7XA 3AFHA 2L02A 4RA2A 2V9PA 3ANPA 2EB7A 1RR7A 2LYCA 4JQFA 4II3A 4PDKA 4UUSB 1C0WA 3M1CA 1AOYA 2R7FA 4ZDOA 4OU0A 4RMNA 4ENJA 1LFUP 4JBAA 1I6XA 4GDFA 5FRNA 2RASA 1W0TA 3CCRI 1F9NA 3FIWA 2PFVA 3G56A 1RPWA 1VQKI 2P5KA 3ABLH 2WTEA 3ZQIA 1ZGJA 2K4BA 5BS6A 3PNTA 4I6ZA 2YS9A 2DTZA 3O3KA 1IJWC 2IA2A 3M7GA 5GAEJ 3OYNA 1VI0A 2P5LC 3TL4X 3I4MJ 4A3MJ 1GXPA 1KYZA 2EINH 4EV0A 2R7OA 3QOPA 1DGRM 1TQIA 2JVHA 3CJRB 4AIKA 5JVTA 5C4XJ 1XMKA 2LKPA 2L4MA 2QVOA 3FHNA 4NUBA 1X19A 4FT8A 1VQMI 4JYKA 1TWHJ 3TEDA 2D1HA 3CJDA 3BPVA 3LWFA 5C4YA 4LG0B 2LY2A 4ASNA 3WG7H 1FEXA 2XPWA 1IDZA 5F08A 3IKVA 1WHUA 4D9JA 5ICCA 3FF5A 1P7JA 3IP4B 1MBKA 2A05A 2NOJB 4A3FJ 3U1DA 3X2QH 5B5EC 5BQTA 1U2WA 4CGRA 4L5EA 3CMAI 2HPIA 2QEXI 3NNRA 2E7WA 4DOZA 3ROUA 2RKHA 1YYVA 1T0FA 2BY3A 1IUYA 4HF1A 3LQQA 1FT9A 1U9OA 4KMUX 5GAHJ 5D5UB 3QPTA 1H88C 2X1EA 2L9RA 1MKMA 1ORKA 1B8IB 4AD9A 2JQ7A 1HQCA 3HRTA 4OIQF 1X1AA 3GYHX 4IOCF 3SDGA 2OCEA 3QRFF 2E1CA 4LFUA 1FYLA 2RV8A 1JUMA 3I54A 2DMPA 2LLKA 2DFEA 3F23A 4U9LA 1XB4A 2CSOA 2LC2A 5E3LA 4EJVA 3I58A 1D5YA 4CCKA 1DU0A 2GXGA 1WZ2A 1UFMA 4QWQA 3N97A 3FM5A 4Y15A 3JRAA 4ENKA 1HCRA 4IEJA 2EV0A 2ZOZA 2J5PA 5IYCJ 1IRGA 2NAZA 4UV9A 4LOCA 4ON0A 3K7AJ 1KYWA 2XHKA 4M71A 3HIFA 3O60A 4DYRA 4MLOA 1XGSA 3GVAA 4NQWB 4XRFA 4Z6YA 3QPSA 1ETVA 2YVEA 4XIDA 4KITB 4IPAA 1U5TA 2LDUA 1ERDA 4JX6A 2Q8KA 1XSDA 4OD5A 3HZJA 5KAFC 2OA4A 2UXHA 2CG4A 1PP8F 1F36A 3I4PA 4D5CA 3JRIA 2IGOA 4BEHA 1A35A 1QBJA 3N05A 2X6OA 3ZPLA 3S1NJ 1U3EM 1IG7A 2AO9A 2ELJA 2M1BA 4LJZF 2NYXA 4E6KG 2DA2A 5GTHC 2R7TA 2PBIA 3DTIA 1PDNC 1ZG5A 4KFCA 3FXKA 4HSRA 5A2QZ 2R7UA 2VKDA 4XSZF 4Z2YA 3OYEA 2HDDA 1YS6A 1MD0A 1KQ8A 2V1NA 4CICA 3WU2C 5CYVA 4ZYHA 1FPQA 3CDIA 3OIPA 3G7RA 2VN2A 3IL2A 2XRLA 4U0YA 5KAIC 2M30A 5IOYA 1D1BA 3JAMK 2YSRA 5ERIA 2E1OA 2KKOA 3WG9A 5BPIA 4Q5SF 3VDXA 1EH6A 4M73A 5L3EA 2DQRA 3DPLC 5E20A 3OY9A 3CMEI 4AC6A 1YRNB 3ANGA 2UXXA 2BY2A 3HC7A 3SQNA 3HKZN 3GTOJ 3OSGA 2RNGA 1K4SA 2B63J 2M7BA 3PIPF 1UHMA 1O3TA 4B43A 1MMSA 2VJ5A 3ML6A 4CYDA 5FKOA 3K4CA 5KVRA 4OIRF 1K61A 4A5MA 2L0KA 4G8XA 2NRAC 1FOWA 1MSEC 4NN1A 1R22A 2VASA 2WB1N 1X3WB 3ON4A 3QPHA 5J4YA 2CUJA
chains in the Genus database with same CATH topology
1JTXA 3VPRA 4B3AA 5HAWA 1JT0A 5DS9A 2IAIA 1JJ8C 4X6AJ 5F1JA 2YUSA 1GVDA 4ICHA 5GPAA 4C2MJ 1U9NA 1JTYA 3HE0A 2NS7A 2ELKA 1MBHA 2LY9A 3QQAA 5EF6A 4BXXJ 4J19A 1MSFC 3B6CA 2LKXA 2RAEA 1Z77A 1UI5A 2CQXA 1EF4A 4BBRJ 2DMUA 4A3LJ 2XDNA 2Y9ZA 5CW8A 3JRBA 2DA5A 3C07A 2EBIA 3GTLJ 1TWCJ 5EDNA 1Y1VJ 3BQYA 5FJ8J 2ID6A 4QSHA 1HOMA 3V78A 4A3BJ 2Y2ZA 3S1RJ 2R5ZA 3PPBA 3QBMA 1B8IA 2LVSA 1AU7A 1GV5A 4GCLA 2VPRA 5F0HA 5J1YA 2K9QA 1ITYA 2NVXJ 2XPUA 3FISA 5H9TA 3RZDJ 2PZ9A 4MO7A 3ZOBA 2TRTA 3S14J 4BKXA 1AHDP 3AQSA 4IHXA 2KT0A 1X2MA 2CQQA 2DA3A 3G1MA 5EYRA 2M34A 2XB5A 2O9LA 3HOVJ 4A3JJ 3MNLA 4ME9A 3OIOA 2ECCA 3BQZA 4B1RA 3PO2J 3L1PA 3S1QJ 3CWRA 3JRHA 4AF5A 4A3KJ 1B72A 5IP9J 5EG0B 4FE4A 2O7TA 5FLVA 1QVTA 3LSRA 2IEKA 5AQCA 5D18A 2RHAA 2OF7A 4AYBN 1ETWA 1A5JA 2GM4A 2JA6J 2X48A 2D5VA 1WH5A 3A01A 3KNWA 2LD5A 4A3IJ 1FJLA 4AUXA 2DMNA 2DMQA 2ZCNA 5D1RA 1R9TJ 3NI7A 2NP5A 3FRQA 1ETOA 1NTCA 5K58A 3S17J 3HEFA 3VIBA 2YVHA 4XRSG 4D7MA 3KKDA 3MKLA 4GFKA 2D6YA 4V2GA 4JNNA 3T6NA 2NX4A 4A69C 3V6GA 3GTQJ 3PASA 2R92J 2R5YB 4GFLA 1JUPA 3BJBA 4UUTA 3F1BA 5CXGA 4FISA 3BR0A 3VOKA 1VNDA 1PUFB 3JRGA 3VVYA 2FQ4A 1U8BA 3IH4A 5EZGA 4ACIA 1TWFJ 1TWGJ 2EZHA 3QPLA 4UDSA 2FX0A 3TP0A 2IU5A 2VKVA 3COLA 2LR8A 2N8GA 5C4JJ 2R0QC 5IPAA 4M3GA 1MNMC 2GENA 1BW6A 1BW5A 3M4OJ 1Q1VA 3RQIA 2M2EA 2LK2A 4HNVA 2I10A 3BT9A 3ZQCA 3VW1A 4MK6A 1RKWA 3EGQA 5EGOA 2G7GA 2DA6A 2R5YA 1G2HA 4I76A 2NOGA 3BR6A 2DG7A 3HM5A 2K40A 4FCYA 3BRUA 3GTJJ 3TW7A 2CUFA 2DA7A 3CQZJ 1JKQC 4L62A 1ZK8A 1GUUA 5IP7J 4D7NA 2JK3A 3LOCA 3HOZJ 3JRCA 3BHQA 2WV1A 1JKRC 1JJ6C 3LSGA 5FKKA 3D1NI 3VUQA 1SGMA 3HTAA 3E7LA 3S2DJ 5E3NA 4A3DJ 3RZOJ 1GT0C 5F0CA 5M5YJ 3E7QA 5FGLA 5GP9A 4DZJA 3BTLA 1IC8A 1MH3A 5FKMA 1UI6A 2Q24A 1NK2P 5FKNA 1IDYA 4GCTA 3OSFA 3AQTA 2OERA 2L7FP 3JRDA 4JP0A 4D5FA 5IYBJ 1Z0XA 2AHQA 5JLWA 1TC3C 3MVPA 4V2FA 1AKHB 1HDDC 1B72B 2GLOA 2NP3A 1WGXA 3W6VA 4IHVA 3GTKJ 2WGBA 3VVZA 3CDLA 3DEWA 1NK3P 2TCTA 4C3IJ 4RBOA 1HF0A 2CU7A 5IP6A 4A93J 2NVTJ 2FJ1A 3SFIA 3ZQFA 5IOZA 2DG8A 2G3BA 2W53A 3JSJA 5K7ZA 2LP0A 3S5RA 2ME0A 3A01B 2F07A 3BCGA 2GBYA 3JRFA 2UXIA 2ZB9A 3H3VK 1S7EA 2UXOA 4S0HB 3MN2A 5BNGA 1ETXA 2X9DA 1F43A 2XSDC 1JT6A 3VW2A 2QF7A 3FK6A 5HBUA 2NVYJ 9ANTA 2DA1A 2ME6A 3NXCA 3BG9A 5M3FJ 2HYTA 2M0CA 1XG1A 2Y30A 3ZQLA 1OFCX 4DW6A 1MBJA 3BTJA 3ZQHA 3HTHA 1JKPC 2JA7J 4M6VA 3O8HA 4MFDA 2ID3A 1IGNA 4Y7NJ 4BY1J 3HBLA 1BL0A 3HTJA 3LWJA 3G1OA 1LE8B 2CUEA 4M3FA 1OCTC 2EH3A 3C2BA 5DTDA 3HOXJ 3M3YJ 2XB0X 1FTTA 3BG3A 3DPJA 2CJJA 2HQ5A 5F04A 2DMTA 2NVQJ 4CYCA 1XS9A 1WI3A 4XICA 4IHYA 1QVUA 4DYQA 1IV6A 1P7IA 4GFBA 2HOAA 1CQTA 1I50J 3NAUA 5M3MJ 2JA8J 3HOUJ 4M3EA 1WPKA 2XGDA 4CYCB 1GDTA 5E3MA 4JL3A 3CMYA 3B81A 4JX4A 5J3LA 4A3CJ 3FK7A 2WUIA 2QTQA 1FTZA 1ETQA 3BR1A 4C3HJ 3ON2A 1JKOC 1A6IA 1WH7A 2K9SA 1UMQA 2M9HA 3LJLA 3LSJA 2DA4A 4FE7A 3GEUA 5JLXA 1X58A 2K9NA 5D19A 4HKUA 4G12A 1U78A 4JKZA 4M3BA 1BJZA 4W97A 1W0UA 1ZGWA 1ZTRA 3I4NJ 1ZR4A 4YZEA 3VOXA 2Y9YA 2E2JJ 3GTGJ 4BBSJ 3BR3A 2JN6A 3Q0WA 4RDUA 2FBQA 2MG4A 3BR2A 1ETKA 4A3GJ 1TWAJ 3P9TA 2XPVA 3S16J 3IH3A 2VI6A 3ANPA 1RR7A 4UUSB 2VUMJ 4GCKA 1PUFA 1SANA 3BR5A 2PBXA 2HXIA 2FD5A 2MGQA 1LFUP 2RASA 1H89C 1W0TA 2EZLA 4DZPA 1ZKGA 3FIWA 3G56A 1RPWA 1VF9A 3ZQIA 1DU6A 2JJ7A 5J1UA 5E3OA 4I6ZA 2YS9A 1I6HJ 1APLC 3HIMA 1K83J 2ZCMA 2DTZA 1IJWC 1SFOJ 2UXUA 2GFNA 2ZCXA 2HKUA 4XRSA 1VI0A 3G1LA 2HOSA 4A3MJ 2G7SA 1FIPA 2QCOA 1ZQ3P 1MBFA 1WCMJ 3Q3SA 4QTRA 3A02A 5C4XJ 4X1EA 2QOPA 3S1MJ 4MIMA 4JYKA 5IYDJ 3A03A 2P81A 1TWHJ 3TEDA 3CJDA 2R7ZJ 3BTCA 2VKEA 3K2AA 3HB9A 2ZOYA 5C4YA 2JA5J 2DN0A 2R93J 3KKCA 1FEXA 2XPWA 1IDZA 5F08A 1ETYA 3IUVA 1RETA 1P7JA 2MSYA 3NARA 3TW6A 3CRJA 4Y52J 3RKQA 1MBKA 1XC5A 2O8KA 4A3FJ 3BNIA 2LTPA 2CRGA 3NRGA 4CGRA 1GV2A 4L5EA 5EZHA 2KDZA 1ZR2A 3NNRA 3Q0VA 1E3OC 3HDDA 3BG5A 3EUPA 1I3QJ 1O4XA 3WHCA 2E19A 4IHWA 2W48A 2EZIA 5EGOB 2Y0SN 1U9OA 3RD3A 2G7LA 3LHQA 1AKHA 5FLMJ 1H88C 4AC0A 5FHPA 2Y31A 2L9RA 2G0EA 1ORKA 5K7FA 1B8IB 4JX5A 1H8AC 2O7OA 5J1RA 4NELA 3DCFA 3SDGA 4C3JJ 3LSPA 2E2IJ 5K7HA 1UHSA 4W1UA 2XGEA 3IV5A 2H1KA 2ECBA 3TP3A 1MBGA 5EG0A 1QRYA 1JUMA 3QKXA 2EZKA 2DMPA 2LLKA 2V57A 1MH4A 5E3LA 1T56A 1X2NA 1D5YA 3GTPJ 1DU0A 4PXIA 5CXIA 3S2HJ 2QWTA 3JRAA 2WAQN 3KZ9A 5M5XJ 5M5WJ 1HCRA 4IEJA 3SJMA 1IUFA 4FTHA 2ZOZA 3UKGA 5HSZA 3I4MJ 4NDLA 5IYCJ 4LOCA 3GTMJ 2HYJA 1JGGA 2PMZN 3K7AJ 2OI8A 4UUSA 2M8GX 2L7MP 4XK4A 4DYRA 3O60A 3PM1A 4MLOA 2HXOA 3QPSA 1ETVA 2DJNA 2LFBA 2YVEA 2UXPA 4BY7J 4XIDA 1HDPA 2HI3A 1Y1WJ 3IH2A 3F0CA 3HGGA 3FKIJ 4JX6A 3GZIA 2XGCA 3H0GJ 2EQRA 3S15J 2UXHA 2QKOA 3JREA 1F36A 2OPTA 3JRIA 4D5CA 1RESA 4KWAA 3JR9A 3VVXA 2X6OA 3ZQGA 3S1NJ 3GBGA 1HLVA 2AO9A 1IG7A 1OJLA 2DA2A 3B6AA 1YRNA 1QPIA 3O8GA 3PO3J 5EFYA 3BTIA 5FKLA 4M3DA 5GPCA 1T33A 3LNQA 5F27A 2HDDA 1ENHA 2HOTA 3Q0UA 4DYCA 5C3EJ 2QIBA 2REKA 4MXMA 3RH2A 3G7RA 4A3EJ 2E2HJ 1MBEA 2XRLA 1BA5A 3NPIA 5IOYA 3HTIA 1RKTA 1IRZA 2E1OA 4MFEA 4EEFG 4XRMA 1VFCA 2R5ZB 5F0FA 3HGYA 2YU9J 2GUHA 5DAJA 3VP5A 4AC6A 1YRNB 3ANGA 4B4CA 2JMWA 3CCYA 2H8RA 4ABZA 3HKZN 3GTOJ 3OSGA 2L7ZA 1OCPA 1JUSA 2B63J 2JWTA 2IBDA 1LE8A 3OOUA 3WHBA 5HODA 3HOYJ 1UG2A 3VW0A 5FKOA 1K61A 4QIWN 2L0KA 3HOWJ 2MW8A 2NS8A 1MSEC 1LFBA 4NN1A 2COBA 5FMPA 5C44J 1POGA 2WB1N 5EEAA 3ON4A 1FIAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1JTX A;  3VPR A;  4B3A A;  5HAW A;  1JT0 A;  5DS9 A;  2IAI A;  1JJ8 C;  4X6A J;  5F1J A;  2YUS A;  1GVD A;  4ICH A;  5GPA A;  4C2M J;  1U9N A;  1JTY A;  3HE0 A;  2NS7 A;  2ELK A;  1MBH A;  2LY9 A;  3QQA A;  5EF6 A;  4BXX J;  4J19 A;  1MSF C;  3B6C A;  2LKX A;  2RAE A;  1Z77 A;  1UI5 A;  2CQX A;  1EF4 A;  4BBR J;  2DMU A;  4A3L J;  2XDN A;  2Y9Z A;  5CW8 A;  3JRB A;  2DA5 A;  3C07 A;  2EBI A;  3GTL J;  1TWC J;  5EDN A;  1Y1V J;  3BQY A;  5FJ8 J;  2ID6 A;  4QSH A;  1HOM A;  3V78 A;  4A3B J;  2Y2Z A;  3S1R J;  2R5Z A;  3PPB A;  3QBM A;  1B8I A;  2LVS A;  1AU7 A;  1GV5 A;  4GCL A;  2VPR A;  5F0H A;  5J1Y A;  2K9Q A;  1ITY A;  2NVX J;  2XPU A;  3FIS A;  5H9T A;  3RZD J;  2PZ9 A;  4MO7 A;  3ZOB A;  2TRT A;  3S14 J;  4BKX A;  1AHD P;  3AQS A;  4IHX A;  2KT0 A;  1X2M A;  2CQQ A;  2DA3 A;  3G1M A;  5EYR A;  2M34 A;  2XB5 A;  2O9L A;  3HOV J;  4A3J J;  3MNL A;  4ME9 A;  3OIO A;  2ECC A;  3BQZ A;  4B1R A;  3PO2 J;  3L1P A;  3S1Q J;  3CWR A;  3JRH A;  4AF5 A;  4A3K J;  1B72 A;  5IP9 J;  5EG0 B;  4FE4 A;  2O7T A;  5FLV A;  1QVT A;  3LSR A;  2IEK A;  5AQC A;  5D18 A;  2RHA A;  2OF7 A;  4AYB N;  1ETW A;  1A5J A;  2GM4 A;  2JA6 J;  2X48 A;  2D5V A;  1WH5 A;  3A01 A;  3KNW A;  2LD5 A;  4A3I J;  1FJL A;  4AUX A;  2DMN A;  2DMQ A;  2ZCN A;  5D1R A;  1R9T J;  3NI7 A;  2NP5 A;  3FRQ A;  1ETO A;  1NTC A;  5K58 A;  3S17 J;  3HEF A;  3VIB A;  2YVH A;  4XRS G;  4D7M A;  3KKD A;  3MKL A;  4GFK A;  2D6Y A;  4V2G A;  4JNN A;  3T6N A;  2NX4 A;  4A69 C;  3V6G A;  3GTQ J;  3PAS A;  2R92 J;  2R5Y B;  4GFL A;  1JUP A;  3BJB A;  4UUT A;  3F1B A;  5CXG A;  4FIS A;  3BR0 A;  3VOK A;  1VND A;  1PUF B;  3JRG A;  3VVY A;  2FQ4 A;  1U8B A;  3IH4 A;  5EZG A;  4ACI A;  1TWF J;  1TWG J;  2EZH A;  3QPL A;  4UDS A;  2FX0 A;  3TP0 A;  2IU5 A;  2VKV A;  3COL A;  2LR8 A;  2N8G A;  5C4J J;  2R0Q C;  5IPA A;  4M3G A;  1MNM C;  2GEN A;  1BW6 A;  1BW5 A;  3M4O J;  1Q1V A;  3RQI A;  2M2E A;  2LK2 A;  4HNV A;  2I10 A;  3BT9 A;  3ZQC A;  3VW1 A;  4MK6 A;  1RKW A;  3EGQ A;  5EGO A;  2G7G A;  2DA6 A;  2R5Y A;  1G2H A;  4I76 A;  2NOG A;  3BR6 A;  2DG7 A;  3HM5 A;  2K40 A;  4FCY A;  3BRU A;  3GTJ J;  3TW7 A;  2CUF A;  2DA7 A;  3CQZ J;  1JKQ C;  4L62 A;  1ZK8 A;  1GUU A;  5IP7 J;  4D7N A;  2JK3 A;  3LOC A;  3HOZ J;  3JRC A;  3BHQ A;  2WV1 A;  1JKR C;  1JJ6 C;  3LSG A;  5FKK A;  3D1N I;  3VUQ A;  1SGM A;  3HTA A;  3E7L A;  3S2D J;  5E3N A;  4A3D J;  3RZO J;  1GT0 C;  5F0C A;  5M5Y J;  3E7Q A;  5FGL A;  5GP9 A;  4DZJ A;  3BTL A;  1IC8 A;  1MH3 A;  5FKM A;  1UI6 A;  2Q24 A;  1NK2 P;  5FKN A;  1IDY A;  4GCT A;  3OSF A;  3AQT A;  2OER A;  2L7F P;  3JRD A;  4JP0 A;  4D5F A;  5IYB J;  1Z0X A;  2AHQ A;  5JLW A;  1TC3 C;  3MVP A;  4V2F A;  1AKH B;  1HDD C;  1B72 B;  2GLO A;  2NP3 A;  1WGX A;  3W6V A;  4IHV A;  3GTK J;  2WGB A;  3VVZ A;  3CDL A;  3DEW A;  1NK3 P;  2TCT A;  4C3I J;  4RBO A;  1HF0 A;  2CU7 A;  5IP6 A;  4A93 J;  2NVT J;  2FJ1 A;  3SFI A;  3ZQF A;  5IOZ A;  2DG8 A;  2G3B A;  2W53 A;  3JSJ A;  5K7Z A;  2LP0 A;  3S5R A;  2ME0 A;  3A01 B;  2F07 A;  3BCG A;  2GBY A;  3JRF A;  2UXI A;  2ZB9 A;  3H3V K;  1S7E A;  2UXO A;  4S0H B;  3MN2 A;  5BNG A;  1ETX A;  2X9D A;  1F43 A;  2XSD C;  1JT6 A;  3VW2 A;  2QF7 A;  3FK6 A;  5HBU A;  2NVY J;  9ANT A;  2DA1 A;  2ME6 A;  3NXC A;  3BG9 A;  5M3F J;  2HYT A;  2M0C A;  1XG1 A;  2Y30 A;  3ZQL A;  1OFC X;  4DW6 A;  1MBJ A;  3BTJ A;  3ZQH A;  3HTH A;  1JKP C;  2JA7 J;  4M6V A;  3O8H A;  4MFD A;  2ID3 A;  1IGN A;  4Y7N J;  4BY1 J;  3HBL A;  1BL0 A;  3HTJ A;  3LWJ A;  3G1O A;  1LE8 B;  2CUE A;  4M3F A;  1OCT C;  2EH3 A;  3C2B A;  5DTD A;  3HOX J;  3M3Y J;  2XB0 X;  1FTT A;  3BG3 A;  3DPJ A;  2CJJ A;  2HQ5 A;  5F04 A;  2DMT A;  2NVQ J;  4CYC A;  1XS9 A;  1WI3 A;  4XIC A;  4IHY A;  1QVU A;  4DYQ A;  1IV6 A;  1P7I A;  4GFB A;  2HOA A;  1CQT A;  1I50 J;  3NAU A;  5M3M J;  2JA8 J;  3HOU J;  4M3E A;  1WPK A;  2XGD A;  4CYC B;  1GDT A;  5E3M A;  4JL3 A;  3CMY A;  3B81 A;  4JX4 A;  5J3L A;  4A3C J;  3FK7 A;  2WUI A;  2QTQ A;  1FTZ A;  1ETQ A;  3BR1 A;  4C3H J;  3ON2 A;  1JKO C;  1A6I A;  1WH7 A;  2K9S A;  1UMQ A;  2M9H A;  3LJL A;  3LSJ A;  2DA4 A;  4FE7 A;  3GEU A;  5JLX A;  1X58 A;  2K9N A;  5D19 A;  4HKU A;  4G12 A;  1U78 A;  4JKZ A;  4M3B A;  1BJZ A;  4W97 A;  1W0U A;  1ZGW A;  1ZTR A;  3I4N J;  1ZR4 A;  4YZE A;  3VOX A;  2Y9Y A;  2E2J J;  3GTG J;  4BBS J;  3BR3 A;  2JN6 A;  3Q0W A;  4RDU A;  2FBQ A;  2MG4 A;  3BR2 A;  1ETK A;  4A3G J;  1TWA J;  3P9T A;  2XPV A;  3S16 J;  3IH3 A;  2VI6 A;  3ANP A;  1RR7 A;  4UUS B;  2VUM J;  4GCK A;  1PUF A;  1SAN A;  3BR5 A;  2PBX A;  2HXI A;  2FD5 A;  2MGQ A;  1LFU P;  2RAS A;  1H89 C;  1W0T A;  2EZL A;  4DZP A;  1ZKG A;  3FIW A;  3G56 A;  1RPW A;  1VF9 A;  3ZQI A;  1DU6 A;  2JJ7 A;  5J1U A;  5E3O A;  4I6Z A;  2YS9 A;  1I6H J;  1APL C;  3HIM A;  1K83 J;  2ZCM A;  2DTZ A;  1IJW C;  1SFO J;  2UXU A;  2GFN A;  2ZCX A;  2HKU A;  4XRS A;  1VI0 A;  3G1L A;  2HOS A;  4A3M J;  2G7S A;  1FIP A;  2QCO A;  1ZQ3 P;  1MBF A;  1WCM J;  3Q3S A;  4QTR A;  3A02 A;  5C4X J;  4X1E A;  2QOP A;  3S1M J;  4MIM A;  4JYK A;  5IYD J;  3A03 A;  2P81 A;  1TWH J;  3TED A;  3CJD A;  2R7Z J;  3BTC A;  2VKE A;  3K2A A;  3HB9 A;  2ZOY A;  5C4Y A;  2JA5 J;  2DN0 A;  2R93 J;  3KKC A;  1FEX A;  2XPW A;  1IDZ A;  5F08 A;  1ETY A;  3IUV A;  1RET A;  1P7J A;  2MSY A;  3NAR A;  3TW6 A;  3CRJ A;  4Y52 J;  3RKQ A;  1MBK A;  1XC5 A;  2O8K A;  4A3F J;  3BNI A;  2LTP A;  2CRG A;  3NRG A;  4CGR A;  1GV2 A;  4L5E A;  5EZH A;  2KDZ A;  1ZR2 A;  3NNR A;  3Q0V A;  1E3O C;  3HDD A;  3BG5 A;  3EUP A;  1I3Q J;  1O4X A;  3WHC A;  2E19 A;  4IHW A;  2W48 A;  2EZI A;  5EGO B;  2Y0S N;  1U9O A;  3RD3 A;  2G7L A;  3LHQ A;  1AKH A;  5FLM J;  1H88 C;  4AC0 A;  5FHP A;  2Y31 A;  2L9R A;  2G0E A;  1ORK A;  5K7F A;  1B8I B;  4JX5 A;  1H8A C;  2O7O A;  5J1R A;  4NEL A;  3DCF A;  3SDG A;  4C3J J;  3LSP A;  2E2I J;  5K7H A;  1UHS A;  4W1U A;  2XGE A;  3IV5 A;  2H1K A;  2ECB A;  3TP3 A;  1MBG A;  5EG0 A;  1QRY A;  1JUM A;  3QKX A;  2EZK A;  2DMP A;  2LLK A;  2V57 A;  1MH4 A;  5E3L A;  1T56 A;  1X2N A;  1D5Y A;  3GTP J;  1DU0 A;  4PXI A;  5CXI A;  3S2H J;  2QWT A;  3JRA A;  2WAQ N;  3KZ9 A;  5M5X J;  5M5W J;  1HCR A;  4IEJ A;  3SJM A;  1IUF A;  4FTH A;  2ZOZ A;  3UKG A;  5HSZ A;  3I4M J;  4NDL A;  5IYC J;  4LOC A;  3GTM J;  2HYJ A;  1JGG A;  2PMZ N;  3K7A J;  2OI8 A;  4UUS A;  2M8G X;  2L7M P;  4XK4 A;  4DYR A;  3O60 A;  3PM1 A;  4MLO A;  2HXO A;  3QPS A;  1ETV A;  2DJN A;  2LFB A;  2YVE A;  2UXP A;  4BY7 J;  4XID A;  1HDP A;  2HI3 A;  1Y1W J;  3IH2 A;  3F0C A;  3HGG A;  3FKI J;  4JX6 A;  3GZI A;  2XGC A;  3H0G J;  2EQR A;  3S15 J;  2UXH A;  2QKO A;  3JRE A;  1F36 A;  2OPT A;  3JRI A;  4D5C A;  1RES A;  4KWA A;  3JR9 A;  3VVX A;  2X6O A;  3ZQG A;  3S1N J;  3GBG A;  1HLV A;  2AO9 A;  1IG7 A;  1OJL A;  2DA2 A;  3B6A A;  1YRN A;  1QPI A;  3O8G A;  3PO3 J;  5EFY A;  3BTI A;  5FKL A;  4M3D A;  5GPC A;  1T33 A;  3LNQ A;  5F27 A;  2HDD A;  1ENH A;  2HOT A;  3Q0U A;  4DYC A;  5C3E J;  2QIB A;  2REK A;  4MXM A;  3RH2 A;  3G7R A;  4A3E J;  2E2H J;  1MBE A;  2XRL A;  1BA5 A;  3NPI A;  5IOY A;  3HTI A;  1RKT A;  1IRZ A;  2E1O A;  4MFE A;  4EEF G;  4XRM A;  1VFC A;  2R5Z B;  5F0F A;  3HGY A;  2YU9 J;  2GUH A;  5DAJ A;  3VP5 A;  4AC6 A;  1YRN B;  3ANG A;  4B4C A;  2JMW A;  3CCY A;  2H8R A;  4ABZ A;  3HKZ N;  3GTO J;  3OSG A;  2L7Z A;  1OCP A;  1JUS A;  2B63 J;  2JWT A;  2IBD A;  1LE8 A;  3OOU A;  3WHB A;  5HOD A;  3HOY J;  1UG2 A;  3VW0 A;  5FKO A;  1K61 A;  4QIW N;  2L0K A;  3HOW J;  2MW8 A;  2NS8 A;  1MSE C;  1LFB A;  4NN1 A;  2COB A;  5FMP A;  5C44 J;  1POG A;  2WB1 N;  5EEA A;  3ON4 A;  1FIA A; 
#chains in the Genus database with same CATH topology
 2JZY A;  4N9H A;  2FNP A;  3BY6 A;  1JT0 A;  5H6R A;  3C7J A;  4DNC A;  4X6A J;  1P92 A;  1UHW A;  3JAM Z;  2MA3 A;  1GVD A;  3F9K A;  4I02 A;  4PJL A;  2JT1 A;  1H9G A;  1YI2 I;  1MIJ A;  2FJI 1;  2NS7 A;  2R7Q A;  3QOE A;  3AG3 H;  5DD4 A;  2Y0S A;  4KT6 A;  3HSE A;  3P9I A;  2RAE A;  4L18 B;  3S32 A;  2CQX A;  3E6C C;  5L3F A;  2DMU A;  4A3L J;  4RLQ A;  4BAY A;  3A2K A;  4UHT A;  3WE2 A;  2QSF X;  1F4K A;  2P7C B;  2VQH A;  3DEE A;  3TMO A;  2IW5 A;  1SD5 A;  1Z21 A;  4WIB A;  2EBI A;  4DJA A;  1TWC J;  3W2W A;  3BQY A;  3PJR A;  4LB6 B;  5J4V A;  2ID6 A;  1KU7 A;  2JSP A;  1BIB A;  3LFK A;  4A3B J;  3M9A A;  2Y2Z A;  3V4G A;  5ICG A;  1VQ5 I;  3QBM A;  1AU7 A;  2F4I A;  1XDU A;  2LF8 A;  2O3F A;  3K2Z A;  4ZH4 F;  2Z16 A;  3BC8 A;  4LLG F;  3IRR A;  2E7X A;  2DLL A;  3NWT A;  4BQO A;  2NVX J;  2XUB A;  3CC2 I;  4PJ0 C;  4G7Z F;  1UZC A;  3LFU A;  3ULQ B;  3V7S A;  4MQV A;  1WVR A;  2GXA A;  3CLO A;  1X2M A;  2CQQ A;  3CJN A;  3VYT B;  5ICF A;  3OYA A;  5LHG A;  5CVU A;  2WA0 A;  2FOK A;  5EYR A;  4KIF A;  4B8X A;  4A0Y A;  2EK5 A;  4BXF A;  5K1Y A;  4EJU A;  2F48 A;  1MMD A;  1X1C A;  2HQR A;  3NRV A;  4B1R A;  3S1Q J;  2CFO A;  4Y13 A;  1OCO H;  4CDG A;  2HPM A;  3CWR A;  1W5C C;  3BJ6 A;  4FE4 A;  1QQI A;  5FLV A;  2EWN A;  1QVT A;  2M4G A;  1O7F A;  3KEY A;  3FXO A;  2O6G E;  2L7K A;  2RHA A;  2OF7 A;  3KZZ A;  1ETW A;  4L9T A;  4AYB N;  3HL2 A;  1XTA A;  4OD4 A;  3CO7 C;  2JA6 J;  3GF2 A;  1GXQ A;  3KNW A;  4XON A;  2A3S A;  1FJL A;  4AUX A;  3ZN0 A;  3J80 Z;  1TLH B;  3S8P A;  2CQK A;  2LRD A;  4RB3 C;  1QHG A;  2Y0M A;  1GHC A;  3K8P C;  3BG7 A;  1FNN A;  4DQ2 A;  3CUQ B;  3H9G A;  1WJB A;  4DVY P;  4XRS G;  3JTG A;  3S3O A;  1I5Z A;  2VXD A;  4JNN A;  2DDB A;  4A69 C;  1RC9 A;  3CUQ A;  3PAS A;  4R1H A;  3VSK A;  2XAF A;  2ESN A;  2R5Y B;  3BJB A;  3F1B A;  2P6S A;  3DEU A;  1N75 A;  3BR0 A;  3T0Y A;  3VVY A;  1KQ0 A;  5HS9 A;  5EZG A;  3U1K A;  2CFX A;  4ACI A;  2EZH A;  1TWG J;  2V4J C;  4F93 B;  2FUG 2;  3S93 A;  5HDK A;  2FX0 A;  3OWT A;  1HW5 A;  1BR1 A;  2IA0 A;  1VZ0 A;  2I8D A;  2LR8 A;  1OR7 C;  2ZO4 A;  4L9N A;  2GEN A;  1BW6 A;  3M4O J;  5E17 F;  2M2E A;  3BT9 A;  3FWE A;  3K1M A;  1BR4 A;  3RYP A;  5D4S A;  4MK6 A;  1RKW A;  4MEY F;  1X4O A;  2K5C A;  2NOG A;  1O7L A;  1JHH A;  1HKQ A;  3L2Q A;  3BRU A;  3GTJ J;  3K4L A;  3VTI A;  2WV0 A;  2M3A A;  1ZK8 A;  1S6L A;  1J75 A;  2OV7 A;  3LOC A;  3GLL A;  5E1X A;  3JRC A;  1W7P A;  3VUQ A;  5DCM B;  2L4A A;  4OIN F;  1LQ1 A;  4UNO A;  5TJJ A;  2AXL A;  4KA4 A;  5E3N A;  4X0G A;  3LSI A;  3N4M A;  5F0C A;  1GT0 C;  5FGL A;  5JVG F;  4DZJ A;  1R6R A;  1XGN A;  3G6E I;  2WY7 Q;  3NS4 A;  4I98 B;  4ZYA A;  4NC6 A;  2QKL B;  3ABM H;  3MKW B;  2ZSH B;  4BHP A;  3WTS C;  2OER A;  2L7F P;  3JRD A;  4D5F A;  5L3G A;  2FU4 A;  1O57 A;  1Z0X A;  2AHQ A;  3GX4 X;  5IY5 H;  1TC3 C;  2CV2 A;  4A12 A;  4BHC A;  4V2F A;  1ZEL A;  3G3Z A;  4O6J A;  3I59 B;  3CCL I;  1ZLJ A;  4EGY A;  2WGB A;  5HDG A;  3DEW A;  2TCT A;  4C3I J;  1W7P D;  1E3H A;  5E1W A;  3ZQF A;  4ENM A;  2W53 A;  4IVN A;  5FO5 A;  4MNU A;  3FXJ A;  4CCM A;  3F6V A;  4CH7 A;  1SAU A;  5GTI C;  2ME0 A;  2HTJ A;  3MEX A;  3BCG A;  2H8W A;  4XLE A;  2V6C A;  2ZB9 A;  4JK1 X;  5ICE A;  2QEN A;  1S5L C;  4E7L A;  3KCC A;  2X9D A;  1Y8Q B;  4HW0 A;  5E18 F;  2QF7 A;  2GOM A;  3NXC A;  2DOD A;  3BG9 A;  1XG1 A;  1ZRD A;  5DM6 F;  1OFC X;  3ZQH A;  4MGR A;  3HTH A;  1R23 A;  4E7J A;  1D1C A;  3ZQQ A;  2ID3 A;  1PUE E;  4BY1 J;  4IKF A;  2QA4 I;  4FAS D;  3LWJ A;  3G1O A;  5IT9 Z;  1UJ8 A;  2BYV E;  4AU7 A;  3HOX J;  2A5W A;  1U6G A;  3FKJ A;  3PQJ A;  4AIJ A;  2E71 A;  3G2B A;  3WTX C;  2FQ3 A;  1B1B A;  3KP3 A;  1MGT A;  5LRS A;  4DYQ A;  2AS5 F;  3KYL A;  5HS7 A;  1LEA A;  1W5S A;  1CQT A;  4E7Z A;  4B09 A;  1HC8 A;  1WPK A;  2K7L A;  3I5U A;  1X3Z B;  1R5G A;  3K4M A;  4NNJ A;  1TQM A;  3RDI A;  3ON2 A;  3GZN B;  2Q0O A;  3LAP A;  2K9S A;  4HEA 2;  5DDG A;  1V54 H;  3QU3 A;  4PCQ A;  2DA4 A;  4FE7 A;  4HKU A;  2JVG A;  4G6T B;  1BJZ A;  2PEX A;  4W97 A;  4AWX B;  1ZGW A;  3KEO A;  4RAF A;  4E7K A;  3VOX A;  1NG6 A;  3GTG J;  4BBS J;  2FBQ A;  2DT5 A;  3L00 A;  2ETH A;  2MG4 A;  1XX5 A;  3ERE D;  3P9T A;  3SZP A;  3S16 J;  2EFW A;  2Y48 A;  4GCK A;  1SVO A;  4MQ9 F;  1PUF A;  1SAN A;  3BR5 A;  3BG6 A;  3SZT A;  1VQL I;  2PBX A;  1H89 C;  4EGZ A;  2V79 A;  2V1D A;  3F8N A;  5LHI A;  2L3D A;  2ZME A;  3W2V A;  2GA1 A;  3NWS A;  3MWM A;  4ZZD A;  2BXZ A;  5J1U A;  4B48 A;  5LGN A;  4BNC A;  1YX5 A;  4MTE A;  3ZMU A;  2EPF A;  1APL C;  2IS4 A;  2K9L A;  3LSM A;  1K83 J;  2RC4 A;  2ZME B;  4H4K C;  2ZCM A;  3RPQ A;  3AAF A;  2F5C A;  2R7D A;  4XRS A;  1U8R A;  4BEH B;  3G1L A;  2HOS A;  2MD0 A;  2HFH A;  2G7S A;  1WKM A;  4F3Q A;  1FIP A;  1ZQ3 P;  1MBF A;  1R5I D;  2KFD A;  2UUZ A;  4G6D A;  4WX9 A;  2NNY A;  3PUB A;  4WXD A;  4KDP A;  2BV6 A;  2LY1 A;  3L2C A;  3I71 A;  2F4O B;  3A03 A;  3OYL A;  2P81 A;  1D0Y A;  3HJE A;  2VKE A;  3TO7 A;  3KIO A;  2JA5 J;  2DN0 A;  2MLK A;  1YX3 A;  2QLZ A;  2VQC A;  4CXF A;  2IGN A;  2VOP A;  5AIQ A;  4UVA A;  2DAO A;  2CUZ A;  3NAR A;  3WTY C;  2OTJ I;  4Y52 J;  2L01 A;  3RKQ A;  2R7V A;  1XC5 A;  2O8K A;  1YQA A;  2X0L A;  1TL8 A;  2LTP A;  1ZN2 A;  1E0E A;  1SAX A;  1GV2 A;  2WAE A;  5EZH A;  2KDZ A;  3GCM A;  3Q0V A;  3HDD A;  2B0L A;  2ZXJ A;  1I3Q J;  2GAU A;  2DCE A;  2E19 A;  5L3C A;  2EZI A;  5EGO B;  1E2X A;  4J00 A;  1T38 A;  1DP7 P;  3RKY A;  2G7L A;  3LHQ A;  3G73 A;  2KIQ A;  2QSH X;  1BOB A;  4HRI A;  2WC2 A;  2EIM H;  4ESB A;  2G0E A;  3FXM A;  1R71 A;  1A6Q A;  3OYK A;  2XF7 A;  1B9M A;  2W82 A;  3F6O A;  5J1R A;  2X1D A;  2E2I J;  3ZN1 A;  2LG4 A;  3M8E A;  4W1U A;  2XGE A;  3IV5 A;  1FYK A;  3MFK A;  5EG0 A;  3K10 A;  1Z91 A;  1K6Y A;  4P5O A;  1MH4 A;  1T56 A;  3J81 Z;  1X2N A;  4M9X A;  5FRM A;  2DJI A;  5CVR A;  2BY0 A;  1XD7 A;  1JI8 A;  1FY7 A;  1YFH A;  2QWT A;  2QQB A;  2F6C A;  1Y56 A;  4RB0 A;  3K69 A;  3KZ9 A;  2FML A;  4UVC A;  1IUF A;  4FTH A;  2BHY A;  1YJ9 I;  2HZT A;  1VQP I;  2M45 A;  3DV8 A;  3V8J A;  3GTM J;  2HYJ A;  1I39 A;  2PMH A;  2PMZ N;  1JGG A;  4P1W A;  2OI8 A;  3WTZ A;  2RNJ A;  2M8G X;  2L7M P;  1SVL A;  2XIG A;  4EJW A;  2X1C A;  2FF4 A;  3OYF A;  3L2R A;  3FXQ A;  2UXP A;  3DLL F;  1HDP A;  2HI3 A;  2D2W A;  2IP2 A;  1R5H A;  3EYY A;  3F0C A;  4EMS A;  3T8R A;  2V1U A;  1JXS A;  3KZY A;  2HYF A;  2RVC A;  3O6B B;  3H3Z A;  4BJ6 C;  3DPU A;  4XQF A;  2ZSI B;  3QP6 A;  1T8I A;  3DFG A;  1RIO H;  5DCF A;  4KWA A;  2E35 A;  3JR9 A;  2F4M B;  4B47 A;  1P4W A;  3CD6 I;  1HLV A;  3TOB A;  1CGP A;  3JW4 A;  5EFY A;  1IO2 A;  2M7A A;  3J80 K;  3OV8 A;  3RKX A;  2E1M B;  2WWY A;  5GPC A;  4Y17 A;  1MW7 A;  5LRR A;  3A1Y A;  5C3E J;  2QIB A;  3RH2 A;  4A3E J;  4BGD A;  2E2H J;  1MBE A;  1YIJ I;  2W00 A;  2VT3 A;  3IHU A;  4QPO A;  1T0F C;  4RGX A;  3WU0 A;  4MFE A;  1IXS B;  3TKY A;  2Z99 A;  3R0A A;  1Z3X A;  4XRM A;  3MMY B;  1QZZ A;  3GFM A;  1VFC A;  2NS0 A;  2PJR B;  1L3L A;  3HGY A;  2GUH A;  1STZ A;  1TW3 A;  3CTA A;  1BI3 A;  2JMW A;  3CCY A;  3T8T A;  2GOX B;  2LNB A;  1G6N A;  2BE5 F;  2BVM A;  1EKE A;  3JSP A;  2KPM A;  4XKC A;  3FXL A;  2LSO A;  1UG2 A;  1AWC A;  3VW0 A;  2W85 A;  1FOX A;  2HOE A;  4QIW N;  4YG2 F;  2LH9 A;  2HVQ A;  2MW8 A;  3TOA A;  1OMI A;  2COB A;  1O3Q A;  3Q9V A;  3BJA A;  1MJB A;  2YX7 A;  2XAJ A;  5C44 J;  2YPR A;  2VL8 A;  5TRD A;  4IO9 F;  4HLY A;  4CZZ A;  1FIA A;  2F2E A;  1ZRC A;  1NG7 A;  1LKX A;  4B3A A;  1VQN I;  5DS9 A;  2IAI A;  3WTW C;  2XGX A;  3DU5 A;  1LVK A;  3EPZ A;  3K1N A;  1TP4 A;  1U9N A;  5JI6 A;  3ZGK A;  3HE0 A;  4PFO A;  1MBH A;  3QQA A;  4GYG A;  3HRS A;  4XLP F;  4EVI A;  3QYE A;  3P5J A;  1AA7 A;  3B6C A;  4C9Y A;  2LKX A;  4XBF A;  1T98 A;  3GWZ A;  3E0J B;  3E6D A;  3B73 A;  2EV6 A;  2XDN A;  4QPQ A;  2CW8 A;  3KX2 A;  2HQA A;  4BL0 B;  5L3B A;  5F6F A;  4E4H A;  3VYR B;  2DA5 A;  1CF7 A;  3SXY A;  4PSW A;  3IRQ A;  1WJ5 A;  1Y1V J;  2HS5 A;  4QSH A;  3RI4 A;  3SFZ A;  2X6W A;  3I53 A;  4O3M A;  3V78 A;  1OQY A;  3KLN A;  3PPB A;  1B8I A;  2LVS A;  3RQ4 A;  4OAZ A;  1ZH5 A;  4A0Z A;  3AL0 B;  1I27 A;  3BDD A;  3V42 A;  3FIS A;  1ON2 A;  1E17 A;  2Q1Z B;  4BJT A;  3RZD J;  2PZ9 A;  4MO7 A;  2PG4 A;  4BKX A;  3HHH A;  4CO8 A;  3FDY A;  2KT0 A;  2A68 F;  2R7W A;  4JOM A;  2DA3 A;  2WBM A;  3G1M A;  5BMZ A;  1DDN A;  5EEG A;  3DTK A;  2DQL A;  3ZMS A;  4ME9 A;  3BQZ A;  1WFX A;  4ZYE A;  3RSN A;  3D5S C;  5H2F C;  2V6E A;  4AF5 A;  4M74 A;  5IP9 J;  5EG0 B;  1OR7 A;  1SFU A;  2B7E A;  2IEK A;  4XKV A;  3RKW A;  1USS A;  3E5X A;  4HF0 A;  4KN4 X;  1R1V A;  3HOS A;  1T39 A;  2GM4 A;  2W57 A;  3HG9 A;  2J5O A;  3OYB A;  4PUS A;  3U21 A;  4A3I J;  1WRJ A;  2ZCN A;  2OJE D;  4GXO A;  3SDB A;  2DYR H;  4PFP A;  1FOY A;  3C2H A;  3FRQ A;  4YEJ A;  3SYT A;  2IGK A;  1S7O A;  3MKL A;  3AG2 H;  2ZFU A;  4GFK A;  2D6Y A;  3CES A;  2Z3Y A;  4EAT A;  2HR3 A;  4AID A;  3ZMV A;  4DGW B;  2R3S A;  2A6E F;  2OU2 A;  1JUP A;  2V1X A;  3FXU A;  3GLX A;  2PI0 A;  1ZRF A;  4G9Y A;  4FIS A;  2W84 A;  4HV6 A;  1VND A;  1RUO A;  3JRG A;  1Z9C A;  3PIO F;  4BQQ A;  2VBY A;  1WJC A;  2EFQ A;  1WWX A;  3TP0 A;  2UXN A;  1D0Z A;  2IU5 A;  2JRM A;  2VKV A;  5F64 A;  1LEB A;  2N8G A;  5C4J J;  5IT9 K;  4M3G A;  2M4K A;  2Q2E B;  1Q1V A;  4KJZ A;  5J6X A;  2ICW G;  3DXJ F;  2I10 A;  4XOT A;  5GAG J;  4HNV A;  3ZQC A;  2ISY A;  1V3F A;  2CQ7 A;  2FA5 A;  4YFK F;  1TNS A;  3H5A A;  1FC3 A;  1V4R A;  3J7Z I;  1FMV A;  2YR2 A;  3E5U A;  3OYH A;  3BR6 A;  2DG7 A;  4FCY A;  2QQ8 A;  2GWR A;  2CUF A;  4BU2 A;  4XLA A;  1JKQ C;  4KIS A;  3FMQ A;  4D7N A;  1IZ1 A;  2P0W A;  1JKR C;  3LSG A;  5FKK A;  3K9T A;  3GZ5 A;  3F8C A;  2K85 A;  3S2D J;  3RZO J;  3E7Q A;  4AIH A;  1F5T A;  5GP9 A;  1VQ7 I;  1WI9 A;  3H5R A;  3D5L A;  3MCZ A;  3SEQ A;  1J09 A;  4LG3 A;  3RPU D;  3V7R A;  1BBY A;  2H27 A;  2KZG A;  5LHH A;  3VOD A;  1NK2 P;  2B3W A;  3HIM A;  3KP5 A;  1BI2 A;  1IDY A;  4OOI A;  4ZDP A;  4GCT A;  3LQR A;  2QBY B;  3WTV C;  1L0O C;  1W36 D;  5FLX K;  4IRV A;  1XCB A;  5K5R A;  3GUD A;  2ZNZ A;  3TDU C;  2GLO A;  2NP3 A;  1V5F A;  3FX3 A;  2DOF A;  3OYM A;  1HF0 A;  4LD5 A;  1KGS A;  4J01 A;  4DBR A;  5J8F A;  5IOZ A;  2DG8 A;  1Y0U A;  2G3B A;  3JSJ A;  3S3M A;  1D5V A;  3E1S A;  1KQ9 A;  3BP8 A;  5HS8 A;  3M1E A;  2E5Z A;  4ZDL A;  3ASO H;  2UXO A;  1FMW A;  4KYW A;  4GCV A;  5FB2 A;  2LRE A;  2XSD C;  3KP4 A;  2NVY J;  1IW7 F;  2ME6 A;  1S7A A;  2Y75 A;  4L5J A;  3V8K A;  2HYT A;  3GFI A;  2X6X A;  3VYS B;  4UB6 C;  2COM A;  4DW6 A;  3ZQL A;  2IT0 A;  2KRC A;  3BTJ A;  4IJA A;  1WJE A;  4H0E A;  1Y39 A;  1JKP C;  2JA7 J;  3O8H A;  2VQG A;  4WK8 F;  1P4X A;  2EV5 A;  4ITV A;  3HBL A;  1BL0 A;  2AXT C;  3HTJ A;  5HNH A;  1CF7 B;  1OCZ H;  3ESW B;  4M3F A;  4BS9 A;  1N78 A;  2DI3 A;  2XB0 X;  1DGW Y;  1OYY A;  2CYY A;  3KLO A;  3HPH A;  2DMT A;  2DT7 B;  2Z2S B;  2NVQ J;  4N4N B;  1R00 A;  4XIC A;  1FWZ A;  4IHY A;  1J5Y A;  1P7I A;  2P8T A;  4GFB A;  3D5R C;  5B1B H;  1IXC A;  1I50 J;  3NAU A;  4E7S A;  2JA8 J;  3HOU J;  1ACI A;  3PSF A;  4MTD A;  5E3M A;  2VJ4 A;  2KHM A;  4XR6 A;  2K4J A;  4A3C J;  3FK7 A;  2WUI A;  2QTQ A;  1FTZ A;  4R79 A;  2JUG A;  3BR1 A;  3OS1 A;  2EIK H;  3J7A O;  2IPQ X;  5L3D A;  1UMQ A;  3LSJ A;  1YJN I;  3T5X A;  1UCR A;  5JLX A;  4RB2 C;  3L9F A;  4XLF A;  3DPT A;  2ZY9 A;  2ZKZ A;  2M5W A;  1Y0N A;  2O0Y A;  1HKT A;  3TBI A;  4UXN A;  4JKZ A;  2BZT A;  2O8X A;  1TNT A;  2EJR A;  4UV8 A;  3I4N J;  4YZE A;  4HV5 A;  2Y9Y A;  3Q0W A;  2OAZ A;  3E3V A;  3MKZ A;  3BR2 A;  4HX4 A;  1ETK A;  1SEU A;  3HOT A;  2XAQ A;  2ZJ2 A;  2XPV A;  4IRH A;  2VBZ A;  4XLC A;  1K78 B;  2VUM J;  1VQ4 I;  3LMM A;  3OL3 A;  2V9K A;  2HXI A;  2GIV A;  3K4J A;  4LLL A;  2BHZ A;  5H6Q A;  3R60 A;  1ZKG A;  5DEQ A;  2QSG X;  4O5V A;  2VE8 A;  3RYR A;  3QYB A;  1VF9 A;  4I0A A;  3S2W A;  4FHT A;  3KET A;  2JJ7 A;  3COA C;  1Y6I A;  2H94 A;  4EJO A;  1S72 I;  4RM3 A;  5E3O A;  2IS2 A;  3C1D A;  5JHU A;  1NHA A;  4EM1 A;  1O3R A;  1SFO J;  2HDW A;  4LK1 F;  2UXU A;  2GFN A;  2ZCX A;  2HKU A;  1I3A A;  1HA8 A;  3ZMZ A;  1KON A;  1BI0 A;  2ZCW A;  1LUJ B;  2QCO A;  4XKB A;  1WCM J;  2LMD A;  3Q3S A;  4M72 A;  4QTR A;  2B1E A;  4HPQ A;  1P2F A;  2CW0 F;  4HQE A;  2JSC A;  3FHZ A;  3ECH A;  2DK8 A;  1A36 A;  2EA4 A;  4FX0 A;  1OKR A;  1FBS A;  3CJT B;  5CVV A;  3S1M J;  5IYD J;  3OYJ A;  2Z9O A;  3E97 A;  4S04 A;  3BTC A;  5CQG A;  3K2A A;  1PP7 U;  3U2R A;  1WJA A;  2WB1 A;  2MFZ A;  1ETY A;  3HUG B;  1RET A;  2ISZ A;  3CCM I;  2PJR A;  1OCR H;  3WTU C;  2PFB A;  2V26 A;  3BLY A;  1UEL B;  3BNI A;  3NRG A;  1FP2 A;  2FEZ A;  5FD5 A;  2RQP A;  3ECO A;  1ZR2 A;  2P7V B;  1E3O C;  3M8F A;  3LA7 A;  3BG5 A;  3DKX A;  3TO9 A;  3EUP A;  4E7I A;  3WHC A;  2CO5 A;  1IXR C;  2EIJ H;  4IHW A;  3E6B A;  2Y0S N;  2P6T A;  4FX4 A;  4EQQ A;  4HNU A;  5FLM J;  4AC0 A;  5FHP A;  2Y31 A;  1REP C;  2RQQ A;  3IC7 A;  2CMP A;  3WGH A;  2GZW A;  4I2O A;  1VQ6 I;  3C3W A;  2O7O A;  2M0M A;  2UV1 A;  1F1Z A;  1P6R A;  2QWW A;  2QBY A;  3H3U A;  1EH7 A;  5LLQ A;  3LSP A;  1H0M A;  4YRV A;  1IN8 A;  1UHS A;  4P9U A;  2DOE A;  2FNA A;  3EUH C;  4U7B A;  1E3P A;  3HXL A;  3V7C A;  1QRY A;  4YII A;  4RGS A;  3QKX A;  2HU9 A;  3ABT A;  2C6Y A;  2WAF A;  1YHQ I;  4PXI A;  3DBR B;  1OYW A;  2VQL A;  3S2H J;  3GO5 A;  4EJT A;  5B3S H;  3HYI A;  2E5N A;  2WAQ N;  5M5X J;  5M5W J;  3K70 C;  2HEO A;  4CCL A;  5HSZ A;  2L9S A;  4NDL A;  2KIS A;  2MC4 A;  3I9V 2;  1RZ4 A;  3PFY A;  1YTY A;  4AVP A;  3ASN H;  1UAA A;  2FSW A;  2K3F A;  4BYY A;  2JA2 A;  3CF2 A;  4CUG A;  4NC8 A;  2LBF B;  3PM1 A;  2MAB A;  1X1D A;  1B59 A;  1FP1 D;  2LFB A;  2A6T A;  2F5V A;  2MYS A;  1N77 A;  1QA6 A;  1X1P A;  1SFE A;  4XOP A;  1Y1W J;  1DQU A;  3PSI A;  2BXY A;  5EJC A;  4XSX F;  3QAH A;  1BN5 A;  2XGC A;  2YVX A;  3H0G J;  3S15 J;  4M9S A;  4BHB A;  4S05 A;  2DTR A;  2EIL H;  1FX7 A;  2QGU A;  3JRE A;  1RES A;  2VLA A;  1QO0 D;  2YU3 A;  2KIF A;  2KJC A;  4XN0 A;  3VVX A;  4A2U A;  1BI1 A;  3SEZ A;  3B6A A;  2QUF A;  1BM9 A;  2VKH A;  4GO1 A;  1YRN A;  5ED4 A;  1QPI A;  2K02 A;  3W3C A;  2GIZ A;  3QOD A;  1XMX A;  4CHU A;  1G59 A;  3OR2 C;  4A6D A;  1U5T C;  3DQV C;  4M3D A;  1R1U A;  2MH9 A;  5F27 A;  1D3Y A;  2XSJ C;  2HOT A;  4DYC A;  3H35 A;  1ZAO A;  2VJI A;  1ZYR F;  2KLO A;  3I3L A;  3MZH A;  1BA5 A;  3NPI A;  2HZD A;  1OYI A;  1PYV A;  3HTI A;  2QM3 A;  3EQL F;  1IRZ A;  1W4M A;  4OIO F;  4PJN A;  4EEF G;  3L2W A;  3OYD A;  1W1W E;  3OS0 A;  2PX9 A;  4RGU A;  2R5Z B;  1YW9 A;  2YU9 J;  5DAJ A;  2VE9 A;  2PQ8 A;  1TT5 B;  4XOR A;  2XKP A;  2HDC A;  3NEU A;  1OIS A;  3WGG A;  1D8K A;  2L7Z A;  3ZCO A;  3HRU A;  1R1T A;  1JUS A;  1LFP A;  1LE8 A;  1ZAR A;  2RDP A;  4KIG A;  5HOD A;  2B9S A;  3HOY J;  2F5F A;  2UWM A;  3CP8 A;  1IN5 A;  3H92 A;  4HAM A;  4I0B A;  4ZTF A;  1G8X A;  2IA1 A;  1M1E B;  5HLI A;  1FLI A;  1R7J A;  5FMP A;  1POG A;  4Y4R A;  4BE1 A;  1RNL A;  1HSJ A;  5EEA A;  1JTX A;  3VPR A;  1UST A;  1VQ9 I;  1HKS A;  2XAH A;  3R0J A;  2L9N A;  4LIT A;  1KA8 A;  2YUS A;  4ICH A;  1T2K A;  3K1P A;  1D8J A;  4C2M J;  2XRO A;  3RIR A;  1JTY A;  5BOX A;  3BWG A;  2ELK A;  5EF6 A;  2A69 F;  3M8J A;  5HOO A;  1PVE A;  4J19 A;  5LFA A;  1MSF C;  1MJA A;  3A0H C;  2Q2E A;  1UI5 A;  1EF4 A;  4GYI A;  5JFR A;  3REO A;  2ZFW A;  2VT2 A;  4PZJ A;  3BZK A;  3UNG C;  3TO6 A;  3TQN A;  4YFN F;  4ESJ A;  2VJJ A;  5DM7 F;  3K4B A;  1DP3 A;  2R4G A;  5CW8 A;  2R7S A;  2A61 A;  1D0X A;  1Z1D A;  1EH8 A;  3C07 A;  1G3W A;  3I59 A;  3PNY A;  3CP2 A;  3A4C A;  2NXN B;  3ZMD A;  4MEX F;  1HOM A;  4XM3 A;  2RN7 A;  2DT6 A;  4XN3 A;  5D8L B;  3S1R J;  4V19 K;  4RGR A;  1FYM A;  6PAX A;  1GV5 A;  5D6F A;  5EEH A;  1LB2 A;  2VON A;  1XPX A;  1J9I A;  2K9Q A;  1G4D A;  2OUM A;  4L0Z B;  2XPU A;  2FE3 A;  3UR3 C;  3S14 J;  3DU6 A;  3GFL A;  3O2P E;  3AQS A;  2IVM A;  4HQM A;  2M34 A;  3JCU C;  2O9L A;  5E8G A;  2A5Y B;  3OIO A;  3F8F A;  3PO2 J;  4A3K J;  2DPD A;  4LIV A;  2O7T A;  4IX7 A;  3LSR A;  2TDX A;  2HGC A;  3OR1 C;  4II2 A;  3GZ6 A;  5AQC A;  3IAS 2;  5D18 A;  3B02 A;  2XAS A;  4LMY A;  3MKY B;  2W7N A;  2PLY A;  1A5J A;  3EUA A;  4EM0 B;  2ACJ A;  4HDV A;  5HLT A;  4EM2 A;  1D1A A;  4P9F A;  2BEO A;  3CUO A;  2JUC A;  4LB5 A;  5K5O A;  2LD5 A;  3D0S A;  5CVI A;  2DMN A;  2DMQ A;  1W5T A;  3R61 A;  5LGU A;  2W24 A;  4XKW A;  4OIP F;  3NI7 A;  1BJA A;  1ETO A;  1NTC A;  4UVB A;  3OYG A;  3S17 J;  3HEF A;  5K58 A;  3H9J A;  2V9V A;  2K3P A;  4ZYD A;  5DCM A;  4ZYG A;  4RS8 A;  2BVL A;  4N9I A;  3MAJ A;  3I0T A;  3T6N A;  3BCA A;  2EFN A;  3V6G A;  3KP6 A;  2YX4 A;  3I64 A;  1IN7 A;  4IHS A;  1HST A;  2O61 A;  3VOK A;  1FSH A;  3WU1 B;  2DK5 A;  2FQ4 A;  1TWF J;  3HPG A;  5J47 A;  2L54 A;  4OAY A;  3HKZ A;  1YO5 C;  2E34 A;  1I1G A;  2R0Q C;  5IPA A;  1MNM C;  1K79 A;  2LK2 A;  3EYI A;  3EET A;  3CJQ B;  4RAY A;  3EGQ A;  2Z33 A;  5BPD A;  2BW3 A;  5EGO A;  4WXC A;  1A04 A;  1Z05 A;  1ULY A;  4CA0 A;  2DA6 A;  3BZC A;  5ILU A;  5LEK A;  1J0R A;  2R5Y A;  4I76 A;  1J59 A;  2HYG D;  4E7H A;  2K40 A;  2PN6 A;  3BRO A;  3CDH A;  4ESF A;  4ZC3 A;  5HNF A;  3TW7 A;  3IKT A;  1XN7 A;  4LLN A;  1X1B A;  3AKZ A;  4L62 A;  1GUU A;  2VB6 A;  3BHQ A;  2WV1 A;  4Q47 A;  1MZB A;  3I55 I;  3D1N I;  5FRO A;  2BOL A;  2ZXW H;  3HTA A;  3E7L A;  4CCO A;  4YEL A;  2D1V A;  3DBL B;  1BOA A;  1GVJ A;  5M5Y J;  3K70 D;  4LG0 A;  3BTL A;  5A2Q K;  1MH3 A;  3IWF A;  5FKM A;  3W6J B;  1IC8 A;  1UI6 A;  2Q24 A;  1MMN A;  2CV0 A;  3HTS B;  4N0B A;  3F8M A;  3LAJ A;  2DOA A;  4XLH A;  2V7F A;  2OQG A;  2QYO A;  4CZC A;  4WCG A;  2FBI A;  1YG2 A;  2DFI A;  2FXA A;  5CLS A;  5IYB J;  1ONV A;  5JLW A;  3JSO A;  3EUH A;  1AKH B;  1HDD C;  5FD6 A;  1MJ9 A;  1B72 B;  3W6V A;  3LSK A;  3CCJ I;  4ZTJ A;  2Z1D A;  5HLG A;  3GTK J;  3VVZ A;  3CDL A;  1T08 B;  1NK3 P;  4RBO A;  3OIQ A;  1YIT I;  1BR2 A;  3ONQ A;  4CGZ A;  2DW4 A;  4A93 J;  2FJ1 A;  2W25 A;  3SFI A;  4A6E A;  2DO7 A;  1OPC A;  4G94 A;  3TDZ C;  3S5R A;  4I09 A;  1XMA A;  3CUQ C;  4Q4Z F;  5D8K B;  3A01 B;  2F07 A;  1Z67 A;  2GBY A;  2UXI A;  5KHD A;  1QZE A;  1S7E A;  5BNG A;  3MN2 A;  2F5D A;  4C2M A;  5H20 A;  2KJB A;  3SZG A;  1B6A A;  3AG4 H;  3FK6 A;  4Q48 A;  5AON A;  4G7H F;  2DA1 A;  9ANT A;  4HNT A;  2XVC A;  4L9V A;  4L5I A;  3H9Q A;  5CPR B;  4PGH A;  1MBJ A;  5DUK A;  2HWV A;  1R4M B;  4M6V A;  1S29 A;  3ZR8 X;  2FBK A;  3BPX A;  4HLX A;  4Y7N J;  1O3S A;  1BIA A;  3FXR A;  1LJ9 A;  4AYB A;  1SC7 A;  1OCC H;  1KU3 A;  1SFX A;  1A31 A;  3FM3 A;  1OCT C;  2Y69 H;  3C2B A;  5DTD A;  1FTT A;  1R4N B;  3BG3 A;  3DPJ A;  2CJJ A;  5F04 A;  4HX8 A;  1EJ9 A;  1GLN A;  1MDM A;  3MQ0 A;  2NNN A;  1EV7 A;  1ZHF A;  4Y3O A;  1XS9 A;  4HDU A;  1QVU A;  1T6S A;  5J8C A;  2HOA A;  3I56 I;  3MD2 A;  4DBQ A;  4B44 A;  2XRN A;  1GDT A;  4JL3 A;  3RCO A;  3VB2 A;  3B81 A;  5CVJ A;  4JX4 A;  2OBP A;  1UG0 A;  5DV5 A;  5J3L A;  2NVU B;  4AVZ A;  5D6E A;  4HA8 A;  5FFX A;  1A6I A;  2M9H A;  5LGT A;  2HVR A;  2ESH A;  3LJL A;  2GXB A;  2QKM B;  2OQR A;  2GA2 A;  3L2V A;  1X58 A;  1IF1 A;  4G12 A;  1KU2 A;  1U78 A;  4NB5 A;  2H09 A;  4M3B A;  5LBQ A;  1W0U A;  1HW2 A;  2E1M C;  4UUV A;  1SVM A;  1SMT A;  2JTV A;  2QZ8 A;  4CCJ A;  1KU9 A;  3BZ6 A;  3ZP5 A;  1TWA J;  3C18 A;  3IH3 A;  2XAU A;  2MC3 A;  3HTU A;  2VI6 A;  3OS2 A;  1FSE A;  1U0J A;  1X3U A;  2FD5 A;  2MGQ A;  5D5X B;  2EZL A;  1IN6 A;  4DZP A;  1N25 A;  3VWB A;  3H1C A;  1R36 A;  3PUF A;  2L5Q A;  1W7P B;  1DU6 A;  2VOO A;  1TT0 A;  3W2A A;  2HKO A;  2QQA A;  1G3Y A;  2L2O A;  4BJ5 C;  3L2U A;  4ENN A;  1I6H J;  4QLC U;  4OMZ A;  4XLN F;  2OD5 A;  3KFW X;  4UY8 I;  2JRT A;  2L9V A;  2OCC H;  4KIC A;  2R7R A;  2AQE A;  1WJF A;  3A02 A;  5D4R A;  1EA3 A;  4X1E A;  5ILV A;  4KN7 X;  4WXH A;  3E6M A;  2QOP A;  1G3S A;  1I1S A;  3FBI B;  4KT5 C;  4MIM A;  3F22 A;  3FMS A;  4HX7 A;  1HBX G;  2R7Z J;  2MBF A;  1V5G A;  3HB9 A;  2ZOY A;  2M87 A;  5FLX Z;  2R93 J;  3KKC A;  3IUV A;  2H6C A;  3KYD B;  2MSY A;  3K6G A;  3TW6 A;  3CRJ A;  3OMY A;  3QP5 A;  4HBL A;  2HKX A;  3S3N A;  4ETS A;  2CRG A;  2DFF A;  1R58 A;  1Z7U A;  4YFX F;  1RI7 A;  1O4X A;  2ZXI A;  2E60 A;  2W48 A;  5GAD J;  4YIR X;  3ISP A;  3RD3 A;  4E70 A;  1AKH A;  2VC1 A;  4ZJZ A;  3W6K B;  3K4N A;  2KIM A;  5K7F A;  4D1Q A;  5TIS C;  2KRF A;  4JX5 A;  1H8A C;  3BCB A;  4KNY A;  4F7Z A;  4NEL A;  3WOD F;  2I5U A;  3DCF A;  4GRI A;  4C3J J;  2W4S A;  1K7A A;  1G3T A;  3ERM A;  3JTH A;  5K7H A;  2G7U A;  2H1K A;  2ECB A;  4ZZL A;  3TP3 A;  1MBG A;  3U9G A;  3FMR A;  1JGS A;  2X6Y A;  2EZK A;  3DKY A;  3G71 I;  4F92 B;  2XAG A;  2V57 A;  4KUM A;  3VOE A;  2HQN A;  5ILS A;  3GTP J;  5CXI A;  2LOO A;  3MZY A;  3KPH A;  2XF6 A;  1SD6 A;  1P9Q C;  1B4A A;  4I99 C;  1P4A A;  5CJ9 A;  2D45 A;  1K4T A;  3L7W A;  3SJM A;  4M6Y A;  4C2T A;  3UKG A;  2O03 A;  1H9T A;  1J2X A;  1QHH D;  2ADU A;  4R8H A;  4UUS A;  1LDK B;  4HYE A;  4XK4 A;  5E79 C;  3QYF A;  4AM3 A;  2KIU A;  2VXZ A;  3V8L A;  5HLH A;  2HXO A;  2KP6 A;  4IRG A;  3M07 A;  3F21 A;  1W36 C;  2DJN A;  2W1O A;  4BY7 J;  1HW1 A;  1RUN A;  3IH2 A;  3HGG A;  4RAG A;  2ZNY A;  1VTN C;  4M9Z A;  3FKI J;  3HUG A;  2X51 A;  3GZI A;  4C30 A;  3F3X A;  2EQR A;  2QQ9 A;  3FZV A;  1Z3Y A;  2QKO A;  2KDO A;  1RRJ A;  2OPT A;  3OL4 A;  4IQ4 A;  3KP2 A;  1BC7 C;  1B9N A;  2MLG A;  2PJP A;  3CC4 I;  2Z5U A;  3SHF A;  3ZQG A;  4DIQ A;  3GBG A;  3IUO A;  1OJL A;  1QNT A;  4RAZ A;  3PO3 J;  3O8G A;  1TBX A;  1LVA A;  1RR8 C;  3BTI A;  2DBB A;  4U0V A;  5FKL A;  1T33 A;  1IRX A;  3LNQ A;  1ENH A;  3FBN B;  2X4H A;  3Q0U A;  5FFZ A;  2DXI A;  2VBW A;  4PK4 A;  3ZRG A;  3TGN A;  1MMG A;  2REK A;  4MXM A;  3RJP A;  2A07 F;  5J40 A;  3OOP A;  4YIF A;  3R6S A;  1RKT A;  2VIX A;  2VC0 A;  1VQ8 I;  1YW8 A;  1VQO I;  5D5V B;  2BBY A;  3EDP A;  1Y8R B;  5F0F A;  3VP5 A;  2M8E A;  4B4C A;  2H8R A;  1XGO A;  4ABZ A;  3P9C A;  1LDD A;  2VPL A;  2KMU A;  1SFK A;  2KQR A;  1Z6R A;  2XC7 A;  1R49 A;  4PJJ A;  3AG1 H;  1MND A;  2JWT A;  2LBF A;  2IBD A;  5HDN A;  1MNE A;  2IXS A;  2IGM A;  3H5N A;  1FOK A;  4LGW A;  3OOU A;  3WHB A;  1QGP A;  1WQ2 A;  3MZ8 A;  5HVQ C;  3VEP A;  1ZG3 A;  4F91 B;  3T1B A;  5E8I A;  3HOW J;  3L09 A;  2NS8 A;  2K9M A;  1LFB A;  3QU6 A;  3VFZ A;  4U9N A;  2ZME C;  2DU9 A;  1QPM A;  4RB1 A;  3LL7 A;  1SMY F;  4A0X A;  2MH2 A;  4FET A;  4I7H A;  1OCP A;  4NBQ A;  3VYU B;  5LEJ A;  2DYS H;  4F55 A;  1YS7 A;  4LIU A;  5B1A H;  5HAW A;  4UB8 C;  5LD2 C;  2JPC A;  1SD4 A;  1JJ8 C;  3ABU A;  3QWL A;  5F1J A;  1WSU A;  2F5E A;  3J7A Y;  1Z7L A;  1ON1 A;  5GPA A;  1ZRE A;  2LY9 A;  3KE2 A;  1BC8 C;  3F8B A;  3F72 A;  3K4K A;  5CKT A;  1TW2 A;  1MMA A;  2XDV A;  4BXX J;  1LDJ A;  4MHG A;  3A0B C;  1Z77 A;  2BY1 A;  4BBR J;  2HNH A;  2Y9Z A;  1HXD A;  4BH9 A;  1XSX A;  2EFP A;  3JRB A;  4L0Y B;  2E1N A;  3GTL J;  3CCU I;  5EDN A;  2A2F X;  1V5E A;  5FJ8 J;  4K2E A;  1U5T B;  4CSW A;  3EUK L;  2R5Z A;  1IAW A;  2PMU A;  4U87 A;  3VSL A;  4IOA F;  1XDS A;  4NQW A;  4GCL A;  2VPR A;  2DFH A;  5F0H A;  5J1Y A;  4P55 A;  5F1R A;  4BQN A;  1ITY A;  2OZ6 A;  4BE0 A;  3CCQ I;  2DDA A;  5H9T A;  1Q1H A;  1YJW I;  4G6Q A;  3ZOB A;  4U0W A;  2TRT A;  1K78 A;  2K27 A;  1DUX C;  1AHD P;  1YE9 A;  4IHX A;  4D0P A;  2E36 A;  2PMZ A;  4I01 A;  2OZU A;  2XB5 A;  5TGT A;  3HOV J;  1TQP A;  2ZJR F;  3CCV I;  4A3J J;  4G7O F;  4PGG A;  1IV8 A;  3MNL A;  2ECC A;  4NC7 A;  1UB9 A;  3WTT C;  3L1P A;  2FOW A;  1TTY A;  4M6X A;  4KMF A;  4U7D A;  3JRH A;  2CS3 A;  4A5N A;  3K0L A;  1B72 A;  2P5V A;  3DTE A;  3ABK H;  2GQQ A;  2LKS A;  3WE3 A;  3OYC A;  3E5Q A;  1V55 H;  5CQE A;  5AIP A;  1LNW A;  1K6O A;  4WWC A;  2AQF A;  3PFI A;  1FBQ A;  3WGI A;  2X48 A;  3Q9S A;  2D5V A;  1WH5 A;  5JR3 A;  3A01 A;  4F52 A;  4BE2 A;  3J7Y J;  5D1R A;  1R9T J;  5DUI A;  4LK0 F;  3SWH A;  1TZL A;  2FRH A;  2NP5 A;  4L9J A;  4BDZ A;  4RM2 A;  4BQA A;  2IS1 A;  1XGM A;  3VIB A;  2YVH A;  2WY8 Q;  3DLA A;  4U88 A;  4D7M A;  3KKD A;  3CC7 I;  2KZV A;  4V2G A;  2NX4 A;  3DP7 A;  1IRF A;  3GTQ J;  3CZ6 A;  2R92 J;  3PNV A;  4GFL A;  1S9H A;  4UUT A;  5IT3 A;  4HZF A;  1ZGA A;  5CXG A;  1NH3 A;  4TV7 A;  1PUF B;  1U8B A;  3IH4 A;  3QPL A;  2IRF G;  4UDS A;  4CCN A;  5KK1 A;  3COL A;  3ZQ7 A;  2H6B A;  2IS6 A;  3HRM A;  2G7H A;  2ZC2 A;  3ELK A;  3CCE I;  2OTL I;  1BW5 A;  2BGC A;  3RQI A;  2CH0 A;  2P4W A;  3VW1 A;  5D5W B;  2CWE A;  1XSV A;  2RRE A;  2XV4 S;  2G7G A;  3KZI C;  1G2H A;  5E1Z B;  2X85 A;  3HM5 A;  4BUP A;  2ELH A;  1X4P A;  1KZH A;  1YW7 A;  2DA7 A;  4Y33 A;  3CQZ J;  3GFJ A;  5IP7 J;  2EA2 A;  2JK3 A;  3NQO A;  3HOZ J;  3DKW A;  1JJ6 C;  2CQN A;  3KEQ A;  1SGM A;  2CV1 A;  2ZJQ F;  5KNL A;  4HOB A;  4XMY A;  3RTR A;  4A3D J;  3LST A;  2VBX A;  3ZXS A;  2DPU A;  5B66 C;  4RLF A;  3HSF A;  3CO6 C;  4IXA A;  3DWL E;  2ZXH A;  5FKN A;  3DF8 A;  4OWR B;  4PSX A;  3OSF A;  1ZLK A;  3AQT A;  5JHF A;  1LPQ A;  3IWZ A;  4JP0 A;  3IAM 2;  2LF7 A;  1OLT A;  2STW A;  1Z6T A;  1ODD A;  4C2U A;  2G9W A;  1QU3 A;  3MVP A;  4FQG A;  3H0D A;  4OMY A;  1JE8 A;  1T95 A;  4PJM A;  2RGV A;  1WGX A;  3LSH A;  4XNF A;  4IHV A;  2ZBK A;  3LA3 A;  1WJD A;  2IJL A;  2WAD A;  4ANJ A;  4GGG A;  2O5R A;  2VOD A;  2CU7 A;  2XKO A;  1JHF A;  5IP6 A;  2NVT J;  4P96 A;  1IN4 A;  5K7Z A;  2LP0 A;  3GW2 A;  3H36 A;  4IL6 C;  4XL9 A;  3JRF A;  4HF2 A;  3GME A;  3PL8 A;  3KYC B;  3RPU A;  3H3V K;  1MDM B;  3GEZ A;  2KRH A;  4S0H B;  4BXU A;  2K86 A;  1ETX A;  1F43 A;  2BW3 B;  5K5Q A;  1JT6 A;  3P9K A;  5DD8 A;  3VW2 A;  5HBU A;  3DBH B;  2MD5 A;  2HVS A;  1S8N A;  3C2G A;  5M3F J;  2M0C A;  3P7N A;  1YOV B;  2Y30 A;  2CW7 A;  3J81 K;  4HST A;  2KL4 A;  2XF5 A;  3CCS I;  3HSR A;  4MFD A;  2EFO A;  1IGN A;  3Q5F A;  3BOQ A;  3CMM A;  2CGP A;  1LE8 B;  2CUE A;  3ZMT A;  2EH3 A;  4NHJ A;  1ZG1 A;  4IQJ A;  3M3Y J;  4WF2 A;  2UZK A;  1YIO A;  1S3J A;  2HQ5 A;  3CF5 F;  2H1L A;  3KP7 A;  3OYI A;  4HG2 A;  1DPU A;  2STT A;  2WAQ A;  2JPB A;  4CYC A;  1WI3 A;  4N4O B;  1J7K A;  3CLQ A;  1IV6 A;  1PJR A;  2FBH A;  4KIB A;  2HTS A;  5M3M J;  3BJO A;  4M3E A;  5DYM A;  2XGD A;  4CYC B;  1FBU A;  3CMY A;  4BAC A;  1QZY A;  1XCV A;  3GXO A;  4BDY A;  4IRI A;  4B3X A;  1ETQ A;  4C3H J;  3AL0 C;  1JKO C;  1WH7 A;  5KCM A;  5FGM A;  3GEU A;  4IHT A;  2K9N A;  5D19 A;  3G4S I;  1ZTR A;  1FZP B;  1ZR4 A;  2FMY A;  2ZJP F;  2E2J J;  3PQK A;  3BR3 A;  2JN6 A;  2OC6 A;  1SD7 A;  3LA2 A;  1DPR A;  4IF4 A;  4RDU A;  4IZZ A;  1YLF A;  3HHG A;  4A3G J;  2A6H F;  3R4K A;  2R7X A;  3AFH A;  2L02 A;  4RA2 A;  2V9P A;  3ANP A;  2EB7 A;  1RR7 A;  2LYC A;  4JQF A;  4II3 A;  4PDK A;  4UUS B;  1C0W A;  3M1C A;  1AOY A;  2R7F A;  4ZDO A;  4OU0 A;  4RMN A;  4ENJ A;  1LFU P;  4JBA A;  1I6X A;  4GDF A;  5FRN A;  2RAS A;  1W0T A;  3CCR I;  1F9N A;  3FIW A;  2PFV A;  3G56 A;  1RPW A;  1VQK I;  2P5K A;  3ABL H;  2WTE A;  3ZQI A;  1ZGJ A;  2K4B A;  5BS6 A;  3PNT A;  4I6Z A;  2YS9 A;  2DTZ A;  3O3K A;  1IJW C;  2IA2 A;  3M7G A;  5GAE J;  3OYN A;  1VI0 A;  2P5L C;  3TL4 X;  3I4M J;  4A3M J;  1GXP A;  1KYZ A;  2EIN H;  4EV0 A;  2R7O A;  3QOP A;  1DGR M;  1TQI A;  2JVH A;  3CJR B;  4AIK A;  5JVT A;  5C4X J;  1XMK A;  2LKP A;  2L4M A;  2QVO A;  3FHN A;  4NUB A;  1X19 A;  4FT8 A;  1VQM I;  4JYK A;  1TWH J;  3TED A;  2D1H A;  3CJD A;  3BPV A;  3LWF A;  5C4Y A;  4LG0 B;  2LY2 A;  4ASN A;  3WG7 H;  1FEX A;  2XPW A;  1IDZ A;  5F08 A;  3IKV A;  1WHU A;  4D9J A;  5ICC A;  3FF5 A;  1P7J A;  3IP4 B;  1MBK A;  2A05 A;  2NOJ B;  4A3F J;  3U1D A;  3X2Q H;  5B5E C;  5BQT A;  1U2W A;  4CGR A;  4L5E A;  3CMA I;  2HPI A;  2QEX I;  3NNR A;  2E7W A;  4DOZ A;  3ROU A;  2RKH A;  1YYV A;  1T0F A;  2BY3 A;  1IUY A;  4HF1 A;  3LQQ A;  1FT9 A;  1U9O A;  4KMU X;  5GAH J;  5D5U B;  3QPT A;  1H88 C;  2X1E A;  2L9R A;  1MKM A;  1ORK A;  1B8I B;  4AD9 A;  2JQ7 A;  1HQC A;  3HRT A;  4OIQ F;  1X1A A;  3GYH X;  4IOC F;  3SDG A;  2OCE A;  3QRF F;  2E1C A;  4LFU A;  1FYL A;  2RV8 A;  1JUM A;  3I54 A;  2DMP A;  2LLK A;  2DFE A;  3F23 A;  4U9L A;  1XB4 A;  2CSO A;  2LC2 A;  5E3L A;  4EJV A;  3I58 A;  1D5Y A;  4CCK A;  1DU0 A;  2GXG A;  1WZ2 A;  1UFM A;  4QWQ A;  3N97 A;  3FM5 A;  4Y15 A;  3JRA A;  4ENK A;  1HCR A;  4IEJ A;  2EV0 A;  2ZOZ A;  2J5P A;  5IYC J;  1IRG A;  2NAZ A;  4UV9 A;  4LOC A;  4ON0 A;  3K7A J;  1KYW A;  2XHK A;  4M71 A;  3HIF A;  3O60 A;  4DYR A;  4MLO A;  1XGS A;  3GVA A;  4NQW B;  4XRF A;  4Z6Y A;  3QPS A;  1ETV A;  2YVE A;  4XID A;  4KIT B;  4IPA A;  1U5T A;  2LDU A;  1ERD A;  4JX6 A;  2Q8K A;  1XSD A;  4OD5 A;  3HZJ A;  5KAF C;  2OA4 A;  2UXH A;  2CG4 A;  1PP8 F;  1F36 A;  3I4P A;  4D5C A;  3JRI A;  2IGO A;  4BEH A;  1A35 A;  1QBJ A;  3N05 A;  2X6O A;  3ZPL A;  3S1N J;  1U3E M;  1IG7 A;  2AO9 A;  2ELJ A;  2M1B A;  4LJZ F;  2NYX A;  4E6K G;  2DA2 A;  5GTH C;  2R7T A;  2PBI A;  3DTI A;  1PDN C;  1ZG5 A;  4KFC A;  3FXK A;  4HSR A;  5A2Q Z;  2R7U A;  2VKD A;  4XSZ F;  4Z2Y A;  3OYE A;  2HDD A;  1YS6 A;  1MD0 A;  1KQ8 A;  2V1N A;  4CIC A;  3WU2 C;  5CYV A;  4ZYH A;  1FPQ A;  3CDI A;  3OIP A;  3G7R A;  2VN2 A;  3IL2 A;  2XRL A;  4U0Y A;  5KAI C;  2M30 A;  5IOY A;  1D1B A;  3JAM K;  2YSR A;  5ERI A;  2E1O A;  2KKO A;  3WG9 A;  5BPI A;  4Q5S F;  3VDX A;  1EH6 A;  4M73 A;  5L3E A;  2DQR A;  3DPL C;  5E20 A;  3OY9 A;  3CME I;  4AC6 A;  1YRN B;  3ANG A;  2UXX A;  2BY2 A;  3HC7 A;  3SQN A;  3HKZ N;  3GTO J;  3OSG A;  2RNG A;  1K4S A;  2B63 J;  2M7B A;  3PIP F;  1UHM A;  1O3T A;  4B43 A;  1MMS A;  2VJ5 A;  3ML6 A;  4CYD A;  5FKO A;  3K4C A;  5KVR A;  4OIR F;  1K61 A;  4A5M A;  2L0K A;  4G8X A;  2NRA C;  1FOW A;  1MSE C;  4NN1 A;  1R22 A;  2VAS A;  2WB1 N;  1X3W B;  3ON4 A;  3QPH A;  5J4Y A;  2CUJ A; 
#chains in the Genus database with same CATH homology
 1JTX A;  3VPR A;  4B3A A;  5HAW A;  1JT0 A;  5DS9 A;  2IAI A;  1JJ8 C;  4X6A J;  5F1J A;  2YUS A;  1GVD A;  4ICH A;  5GPA A;  4C2M J;  1U9N A;  1JTY A;  3HE0 A;  2NS7 A;  2ELK A;  1MBH A;  2LY9 A;  3QQA A;  5EF6 A;  4BXX J;  4J19 A;  1MSF C;  3B6C A;  2LKX A;  2RAE A;  1Z77 A;  1UI5 A;  2CQX A;  1EF4 A;  4BBR J;  2DMU A;  4A3L J;  2XDN A;  2Y9Z A;  5CW8 A;  3JRB A;  2DA5 A;  3C07 A;  2EBI A;  3GTL J;  1TWC J;  5EDN A;  1Y1V J;  3BQY A;  5FJ8 J;  2ID6 A;  4QSH A;  1HOM A;  3V78 A;  4A3B J;  2Y2Z A;  3S1R J;  2R5Z A;  3PPB A;  3QBM A;  1B8I A;  2LVS A;  1AU7 A;  1GV5 A;  4GCL A;  2VPR A;  5F0H A;  5J1Y A;  2K9Q A;  1ITY A;  2NVX J;  2XPU A;  3FIS A;  5H9T A;  3RZD J;  2PZ9 A;  4MO7 A;  3ZOB A;  2TRT A;  3S14 J;  4BKX A;  1AHD P;  3AQS A;  4IHX A;  2KT0 A;  1X2M A;  2CQQ A;  2DA3 A;  3G1M A;  5EYR A;  2M34 A;  2XB5 A;  2O9L A;  3HOV J;  4A3J J;  3MNL A;  4ME9 A;  3OIO A;  2ECC A;  3BQZ A;  4B1R A;  3PO2 J;  3L1P A;  3S1Q J;  3CWR A;  3JRH A;  4AF5 A;  4A3K J;  1B72 A;  5IP9 J;  5EG0 B;  4FE4 A;  2O7T A;  5FLV A;  1QVT A;  3LSR A;  2IEK A;  5AQC A;  5D18 A;  2RHA A;  2OF7 A;  4AYB N;  1ETW A;  1A5J A;  2GM4 A;  2JA6 J;  2X48 A;  2D5V A;  1WH5 A;  3A01 A;  3KNW A;  2LD5 A;  4A3I J;  1FJL A;  4AUX A;  2DMN A;  2DMQ A;  2ZCN A;  5D1R A;  1R9T J;  3NI7 A;  2NP5 A;  3FRQ A;  1ETO A;  1NTC A;  5K58 A;  3S17 J;  3HEF A;  3VIB A;  2YVH A;  4XRS G;  4D7M A;  3KKD A;  3MKL A;  4GFK A;  2D6Y A;  4V2G A;  4JNN A;  3T6N A;  2NX4 A;  4A69 C;  3V6G A;  3GTQ J;  3PAS A;  2R92 J;  2R5Y B;  4GFL A;  1JUP A;  3BJB A;  4UUT A;  3F1B A;  5CXG A;  4FIS A;  3BR0 A;  3VOK A;  1VND A;  1PUF B;  3JRG A;  3VVY A;  2FQ4 A;  1U8B A;  3IH4 A;  5EZG A;  4ACI A;  1TWF J;  1TWG J;  2EZH A;  3QPL A;  4UDS A;  2FX0 A;  3TP0 A;  2IU5 A;  2VKV A;  3COL A;  2LR8 A;  2N8G A;  5C4J J;  2R0Q C;  5IPA A;  4M3G A;  1MNM C;  2GEN A;  1BW6 A;  1BW5 A;  3M4O J;  1Q1V A;  3RQI A;  2M2E A;  2LK2 A;  4HNV A;  2I10 A;  3BT9 A;  3ZQC A;  3VW1 A;  4MK6 A;  1RKW A;  3EGQ A;  5EGO A;  2G7G A;  2DA6 A;  2R5Y A;  1G2H A;  4I76 A;  2NOG A;  3BR6 A;  2DG7 A;  3HM5 A;  2K40 A;  4FCY A;  3BRU A;  3GTJ J;  3TW7 A;  2CUF A;  2DA7 A;  3CQZ J;  1JKQ C;  4L62 A;  1ZK8 A;  1GUU A;  5IP7 J;  4D7N A;  2JK3 A;  3LOC A;  3HOZ J;  3JRC A;  3BHQ A;  2WV1 A;  1JKR C;  1JJ6 C;  3LSG A;  5FKK A;  3D1N I;  3VUQ A;  1SGM A;  3HTA A;  3E7L A;  3S2D J;  5E3N A;  4A3D J;  3RZO J;  1GT0 C;  5F0C A;  5M5Y J;  3E7Q A;  5FGL A;  5GP9 A;  4DZJ A;  3BTL A;  1IC8 A;  1MH3 A;  5FKM A;  1UI6 A;  2Q24 A;  1NK2 P;  5FKN A;  1IDY A;  4GCT A;  3OSF A;  3AQT A;  2OER A;  2L7F P;  3JRD A;  4JP0 A;  4D5F A;  5IYB J;  1Z0X A;  2AHQ A;  5JLW A;  1TC3 C;  3MVP A;  4V2F A;  1AKH B;  1HDD C;  1B72 B;  2GLO A;  2NP3 A;  1WGX A;  3W6V A;  4IHV A;  3GTK J;  2WGB A;  3VVZ A;  3CDL A;  3DEW A;  1NK3 P;  2TCT A;  4C3I J;  4RBO A;  1HF0 A;  2CU7 A;  5IP6 A;  4A93 J;  2NVT J;  2FJ1 A;  3SFI A;  3ZQF A;  5IOZ A;  2DG8 A;  2G3B A;  2W53 A;  3JSJ A;  5K7Z A;  2LP0 A;  3S5R A;  2ME0 A;  3A01 B;  2F07 A;  3BCG A;  2GBY A;  3JRF A;  2UXI A;  2ZB9 A;  3H3V K;  1S7E A;  2UXO A;  4S0H B;  3MN2 A;  5BNG A;  1ETX A;  2X9D A;  1F43 A;  2XSD C;  1JT6 A;  3VW2 A;  2QF7 A;  3FK6 A;  5HBU A;  2NVY J;  9ANT A;  2DA1 A;  2ME6 A;  3NXC A;  3BG9 A;  5M3F J;  2HYT A;  2M0C A;  1XG1 A;  2Y30 A;  3ZQL A;  1OFC X;  4DW6 A;  1MBJ A;  3BTJ A;  3ZQH A;  3HTH A;  1JKP C;  2JA7 J;  4M6V A;  3O8H A;  4MFD A;  2ID3 A;  1IGN A;  4Y7N J;  4BY1 J;  3HBL A;  1BL0 A;  3HTJ A;  3LWJ A;  3G1O A;  1LE8 B;  2CUE A;  4M3F A;  1OCT C;  2EH3 A;  3C2B A;  5DTD A;  3HOX J;  3M3Y J;  2XB0 X;  1FTT A;  3BG3 A;  3DPJ A;  2CJJ A;  2HQ5 A;  5F04 A;  2DMT A;  2NVQ J;  4CYC A;  1XS9 A;  1WI3 A;  4XIC A;  4IHY A;  1QVU A;  4DYQ A;  1IV6 A;  1P7I A;  4GFB A;  2HOA A;  1CQT A;  1I50 J;  3NAU A;  5M3M J;  2JA8 J;  3HOU J;  4M3E A;  1WPK A;  2XGD A;  4CYC B;  1GDT A;  5E3M A;  4JL3 A;  3CMY A;  3B81 A;  4JX4 A;  5J3L A;  4A3C J;  3FK7 A;  2WUI A;  2QTQ A;  1FTZ A;  1ETQ A;  3BR1 A;  4C3H J;  3ON2 A;  1JKO C;  1A6I A;  1WH7 A;  2K9S A;  1UMQ A;  2M9H A;  3LJL A;  3LSJ A;  2DA4 A;  4FE7 A;  3GEU A;  5JLX A;  1X58 A;  2K9N A;  5D19 A;  4HKU A;  4G12 A;  1U78 A;  4JKZ A;  4M3B A;  1BJZ A;  4W97 A;  1W0U A;  1ZGW A;  1ZTR A;  3I4N J;  1ZR4 A;  4YZE A;  3VOX A;  2Y9Y A;  2E2J J;  3GTG J;  4BBS J;  3BR3 A;  2JN6 A;  3Q0W A;  4RDU A;  2FBQ A;  2MG4 A;  3BR2 A;  1ETK A;  4A3G J;  1TWA J;  3P9T A;  2XPV A;  3S16 J;  3IH3 A;  2VI6 A;  3ANP A;  1RR7 A;  4UUS B;  2VUM J;  4GCK A;  1PUF A;  1SAN A;  3BR5 A;  2PBX A;  2HXI A;  2FD5 A;  2MGQ A;  1LFU P;  2RAS A;  1H89 C;  1W0T A;  2EZL A;  4DZP A;  1ZKG A;  3FIW A;  3G56 A;  1RPW A;  1VF9 A;  3ZQI A;  1DU6 A;  2JJ7 A;  5J1U A;  5E3O A;  4I6Z A;  2YS9 A;  1I6H J;  1APL C;  3HIM A;  1K83 J;  2ZCM A;  2DTZ A;  1IJW C;  1SFO J;  2UXU A;  2GFN A;  2ZCX A;  2HKU A;  4XRS A;  1VI0 A;  3G1L A;  2HOS A;  4A3M J;  2G7S A;  1FIP A;  2QCO A;  1ZQ3 P;  1MBF A;  1WCM J;  3Q3S A;  4QTR A;  3A02 A;  5C4X J;  4X1E A;  2QOP A;  3S1M J;  4MIM A;  4JYK A;  5IYD J;  3A03 A;  2P81 A;  1TWH J;  3TED A;  3CJD A;  2R7Z J;  3BTC A;  2VKE A;  3K2A A;  3HB9 A;  2ZOY A;  5C4Y A;  2JA5 J;  2DN0 A;  2R93 J;  3KKC A;  1FEX A;  2XPW A;  1IDZ A;  5F08 A;  1ETY A;  3IUV A;  1RET A;  1P7J A;  2MSY A;  3NAR A;  3TW6 A;  3CRJ A;  4Y52 J;  3RKQ A;  1MBK A;  1XC5 A;  2O8K A;  4A3F J;  3BNI A;  2LTP A;  2CRG A;  3NRG A;  4CGR A;  1GV2 A;  4L5E A;  5EZH A;  2KDZ A;  1ZR2 A;  3NNR A;  3Q0V A;  1E3O C;  3HDD A;  3BG5 A;  3EUP A;  1I3Q J;  1O4X A;  3WHC A;  2E19 A;  4IHW A;  2W48 A;  2EZI A;  5EGO B;  2Y0S N;  1U9O A;  3RD3 A;  2G7L A;  3LHQ A;  1AKH A;  5FLM J;  1H88 C;  4AC0 A;  5FHP A;  2Y31 A;  2L9R A;  2G0E A;  1ORK A;  5K7F A;  1B8I B;  4JX5 A;  1H8A C;  2O7O A;  5J1R A;  4NEL A;  3DCF A;  3SDG A;  4C3J J;  3LSP A;  2E2I J;  5K7H A;  1UHS A;  4W1U A;  2XGE A;  3IV5 A;  2H1K A;  2ECB A;  3TP3 A;  1MBG A;  5EG0 A;  1QRY A;  1JUM A;  3QKX A;  2EZK A;  2DMP A;  2LLK A;  2V57 A;  1MH4 A;  5E3L A;  1T56 A;  1X2N A;  1D5Y A;  3GTP J;  1DU0 A;  4PXI A;  5CXI A;  3S2H J;  2QWT A;  3JRA A;  2WAQ N;  3KZ9 A;  5M5X J;  5M5W J;  1HCR A;  4IEJ A;  3SJM A;  1IUF A;  4FTH A;  2ZOZ A;  3UKG A;  5HSZ A;  3I4M J;  4NDL A;  5IYC J;  4LOC A;  3GTM J;  2HYJ A;  1JGG A;  2PMZ N;  3K7A J;  2OI8 A;  4UUS A;  2M8G X;  2L7M P;  4XK4 A;  4DYR A;  3O60 A;  3PM1 A;  4MLO A;  2HXO A;  3QPS A;  1ETV A;  2DJN A;  2LFB A;  2YVE A;  2UXP A;  4BY7 J;  4XID A;  1HDP A;  2HI3 A;  1Y1W J;  3IH2 A;  3F0C A;  3HGG A;  3FKI J;  4JX6 A;  3GZI A;  2XGC A;  3H0G J;  2EQR A;  3S15 J;  2UXH A;  2QKO A;  3JRE A;  1F36 A;  2OPT A;  3JRI A;  4D5C A;  1RES A;  4KWA A;  3JR9 A;  3VVX A;  2X6O A;  3ZQG A;  3S1N J;  3GBG A;  1HLV A;  2AO9 A;  1IG7 A;  1OJL A;  2DA2 A;  3B6A A;  1YRN A;  1QPI A;  3O8G A;  3PO3 J;  5EFY A;  3BTI A;  5FKL A;  4M3D A;  5GPC A;  1T33 A;  3LNQ A;  5F27 A;  2HDD A;  1ENH A;  2HOT A;  3Q0U A;  4DYC A;  5C3E J;  2QIB A;  2REK A;  4MXM A;  3RH2 A;  3G7R A;  4A3E J;  2E2H J;  1MBE A;  2XRL A;  1BA5 A;  3NPI A;  5IOY A;  3HTI A;  1RKT A;  1IRZ A;  2E1O A;  4MFE A;  4EEF G;  4XRM A;  1VFC A;  2R5Z B;  5F0F A;  3HGY A;  2YU9 J;  2GUH A;  5DAJ A;  3VP5 A;  4AC6 A;  1YRN B;  3ANG A;  4B4C A;  2JMW A;  3CCY A;  2H8R A;  4ABZ A;  3HKZ N;  3GTO J;  3OSG A;  2L7Z A;  1OCP A;  1JUS A;  2B63 J;  2JWT A;  2IBD A;  1LE8 A;  3OOU A;  3WHB A;  5HOD A;  3HOY J;  1UG2 A;  3VW0 A;  5FKO A;  1K61 A;  4QIW N;  2L0K A;  3HOW J;  2MW8 A;  2NS8 A;  1MSE C;  1LFB A;  4NN1 A;  2COB A;  5FMP A;  5C44 J;  1POG A;  2WB1 N;  5EEA A;  3ON4 A;  1FIA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...