1JT7A

Human acidic fibroblast growth factor. 141 amino acid form with amino terminal his tag and leu 44 replaced by phe and leu 73 replaced by val and val 109 replaced by leu (l44f/l73v/v109l)
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
141
structure length
141
Chain Sequence
HHHHFNLPPGNYKKPKLLYCSNGGHFLRILPDGTVDGTRDRSDQHIQFQLSAESVGEVYIKSTETGQYLAMDTDGLVYGSQTPNEECLFLERLEENHYNTYISKKHAEKNWFLGLKKNGSCKRGPRTHYGQKAILFLPLPV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure and stability effects of mutations designed to increase the primary sequence symmetry within the core region of a beta-trefoil.
pubmed doi rcsb
molecule keywords acidic fibroblast growth factor
molecule tags Hormone/growth factor
source organism Homo sapiens
total genus 36
structure length 141
sequence length 141
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2001-08-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00167 FGF Fibroblast growth factor
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.80.10.50 Mainly Beta Trefoil Trefoil (Acidic Fibroblast Growth Factor, subunit A) Trefoil (Acidic Fibroblast Growth Factor, subunit A) 1jt7A00
4DCKC 1QQLA 4I4XA 1RG8A 4LO8B 1J0SA 3S8KA 1I1EA 1GGPB 3O4AA 1L2HA 4EFPA 1V6WA 2VU9A 4A7KA 4L4IA 1EPWA 4OWLA 1K5UA 41BIA 5EC5A 3H6SE 2HZ9A 2P39A 2LIQA 1Q04A 3OJ2A 1AF9A 3OBRA 3CA1A 3V0BA 4JRAA 4EKXB 4GOYA 2F8XC 1JLYA 2MIBA 1HWMB 1DFQA 1G9DA 1ISYA 1HWOB 4XFUA 3A22A 5I1BA 1KNMA 1AFCA 1UPSA 4IY9A 4DENA 4GP3A 3ZXDA 1HWNB 1V6UA 2F2FC 3WMVA 5JLVA 4I4UA 9ILBA 1S0EA 1YBIA 3WMUA 3N7JA 3UDAA 1P63A 3WO2A 2KKIA 4R6UB 4ISRA 4ZFWB 1TFMB 2BEBA 3QR5A 2XOAA 1HKNA 4J2KA 5DUYA 4LO1C 3V79C 3FJDA 3F62B 2D20A 4IZXA 3ZC8A 2UUSA 5F8WA 4J2SA 5DSSB 1QQKA 3P6IA 2HWMA 7I1BA 5BQUC 4H9WA 2AAIB 5D62A 2BFHA 4LO3A 1PC8B 3O44A 4QKSA 3FJKA 4I4PA 4JPZA 1FWVA 4I4OA 2NVHA 3D7WB 2HWAA 2D7IA 2M49A 3AKHA 31BIA 4QBVA 3OBTA 2NM1A 2RSTA 4I1BA 4HR6C 3BAHA 3LTQA 3BB2A 3BAOA 3WO3A 4G9MA 3V0AA 1FWUA 1BFBA 3PUBA 3TC2A 2X2SA 3UD8A 1RZOB 3BTAA 4Z9WB 4OEFA 1S0FA 4EFRA 3N0KA 1MD6A 1DQGA 1K5VA 1ONKB 2P23A 1T9FA 2I1BA 2D23A 2E4MC 3CA6A 4JP0A 3O4BA 3B9UA 2K4AB 3N7MA 1JT4A 1Q03A 3OJMA 3T8SA 1TP0A 4IZEA 3FJCA 1Z4SA 3MALA 3QYDA 1F31A 4ISQA 4I8MA 1XHBA 1ISWA 4J2XA 3BRDA 1DLLA 1QXMA 3VSZA 2FDBM 3Q7WA 1PUUB 3BRFA 3CA4A 4D0TA 1HCEA 3BAVA 3AH2A 4QBCA 4H04A 4QC4A 2ZQOA 3AKFA 3W9TA 4OEGA 3OJVA 1R8OA 4I37A 3PHZA 4J23B 1ISXA 1S0CA 3CA3A 1II4A 1BARA 5EHAA 4Q91A 5FZUA 3ZC9A 5FZZA 3NBEA 1DQOA 1JT7A 4G1RA 3FJBA 1JTCA 4KEIA 3P6JA 1HWPB 4OWJA 1G82A 2FGFA 1WBCA 1IOBA 3FJJA 3A07A 3IIRA 4II0A 1TWEA 2NZ9A 3H6QA 4HA2A 4D0ZA 4XKIA 1VCLA 1FMZA 3IM7A 3VT2A 3O4OA 5BXSA 4IHZA 5BXTA 1BA7A 1FV3A 2NTDA 3FJ9A 3OGFA 1FN0A 5BXPA 4I96A 6I1BA 1EYLA 1TOOA 2ESUA 4EEEB 2BEAA 3E8LC 3BRGC 3CRGA 3RSJA 5BXRA 4FVVA 3BAQA 4I4VA 5FNXA 2D22A 1SZ6B 3CQAA 4LO2A 1MC9A 4OUJA 1TWMA 2Y9FA 5D61A 1BFCA 5F8SA 4A7YA 5BVPI 1FGAA 5F8YA 3VT0A 3VWCA 4IY8A 3HMYA 2AXMA 2Y9XE 2R9KB 3AH1A 1HIBA 2RG9B 2ZQNA 3UD7A 1WD4A 3MPPG 1M2TB 3POKA 4X3AA 1IJTA 3BA7A 5BP5A 1BFFA 3A21A 4I2SA 3UJ0A 3BAGA 2GO2A 4FGFA 2KLLA 4JKXB 5F90A 4EFQA 2VXTI 2F2FA 3WINC 1DZDA 2D1ZA 3FUQA 3CA5A 1ILR1 4I4QA 4YOLA 4ZGRB 2D7RA 1BLAA 1XYFA 3O4DA 1A8DA 3FJEA 3FUOA 3FJIA 3Q7YA 2ET2A 1IHKA 2MC2A 3RTJB 1AVAC 2FFVA 4I4YA 3AKGA 1AVWB 21BIA 2Z48A 3H6RB 4P0JA 2Q3NB 2QN4A 3O49A 4DEPA 1SR4A 1W3GA 1JLXA 2IHOA 4GP0A 3CA0A 2FO1A 3SNVA 3AZWA 4XFTA 1FQ9A 3JRRA 1DFCA 3BAUA 1IT0A 3O5WB 2WRYA 4AN6A 4ZKTB 4LO7C 4ZFUB 4P0LA 1IRPA 4G6JA 4LO0C 4F34A 2D24A 4ZOTA 4Z8SB 4OEEA 1G9CA 2X2TA 1BFGA 3I29B 4USPA 4KEKA 5HPZA 2IWTB 4QO3A 3ZX7A 5DZUA 4I7IA 1ABRB 3VEQA 1D0HA 4I1EA 2NYYA 4P6AA 1G9AA 3IM5A 5G00A 3F1RA 3IM6A 1YYNA 3FFZA 2L5XA 4USOA 2AFGA 3KMVA 4I0YA 3CU1B 3IAGC 2LIEA 3HN1A 1TTUA 1PUMB 4I6IA 3O3QA 2VSAA 3NBDA 4LO7B 2AQZA 2KI4A 4A7ZA 1FV2A 3HSMA 3HOMA 3ZXGA 4GAFA 4HJJA 1BLDA 2DS0A 1V6VA 3Q7XA 8I1BA 5GAQA 5BOWA 5FNWA 3RMXA 2Y9GA 2QYIB 1BASA 1PZZA 3AZVA 1DJSB 1TIEA 1IILA 3HBWA 4LO2C 1S0GA 2GZBA 4I4SA 1YTOA 1S0BA 1RMLA 3AJ6A 3LLPA 1E0OA 3S8JA 2HW9A 4OWKA 1DZCA 1M16A 1CE7B 1JT5A 4EB2B 1Z2VA 3V0BB 2KH2A 2ZR1B 3AH4A 4GOVA 4X37A 1V6XA 3R4SA 4ZBVB 1R8NA 5BP5C 3CAHA 3UD9A 2VSEA 4PC4A 4QKRA 4IQPA 3VT1A 4LO3C 3NBCA 1XG6A 3O4CA 1CVSA 4X38A 4QD2C 4ENDA 3BX1C 5FZYA 3RMYA 3NJ5A 2DRZA 2D43A 4JKQA 5E24E 2VLCA 1JQZA 1Q1UA 1EVTA 3JUTA 2Q9XA 3CRIA 2YUGA 2ERMA 4G6MA 4JAWA 3BA5A 1N4KA 1NUNA 1HCDA 1PWAA 2DRYA 1S0DA 1SR4C 1IRAX 2FFUA 4QALA 1YF8B 4WBCA 1G9BA 4F83A 2VUAA 2Y9WC 3PG0A 2K8RA 2WBCA 3OGGA 4J2YA 4Q9GA 4ZLBB 3I2XA 1AVUA 1EV2A 3FJFA 1NZKA 4LO1A 4OW4A 4GAIA 1I1BA 3WA1A 3H6RA 1ISZA 4QD2B 1ISVA 4KC3A 1XZZA 1FMMS 5EG6C 4ZFYB 1S0LA 2D44A 2RQ9A 3N7LA 5BQUA 2MLLB 4I3NA 4JQ0A 4G9NA 3V0AB 3BADA 3WINA 1OQLB 5D63A 1T4QA 1JY0A 1ITBA 3K1XA 3VUOA 4P0KA 3FGMA 1YXWA 3WO4A 2Z49A 5JMCA 3FJ8A 4AN7B 4IYBA 1WD3A 3AJ5A 3AKIA 3FJHA 3VSFA 4CJMA 5DVHA 3UJ4A 4KBBA 3FJAA 3NBNA 4ZA3B 4D8HA 4X39A 1AXMA 3R4UA 1RY7A 3EF2A 4IONA 2K43A 3BA4A 3HALA 4XFSA 2DREA 1AVXB 1JT3A 3I2AA 3PMEA 2E4MA 2J3PA 3ILAA 4KEJA 3C9ZA 2NP0A 4Q9PA 4LO0A 4I4RA 1W3AA 2VXRA 1W3FA 2KI6B 1Z0HA 3RTIB 5B2HA 1DIWA 3N7KA 1WBAA 3P53A 4L4HA 4TLPA 3A23A 3CRHA
chains in the Genus database with same CATH superfamily
4DCKC 1QQLA 4I4XA 1RG8A 4LO8B 1J0SA 3S8KA 1I1EA 1GGPB 3O4AA 1L2HA 4EFPA 1V6WA 2VU9A 4A7KA 4L4IA 1EPWA 4OWLA 1K5UA 41BIA 5EC5A 3H6SE 2HZ9A 2P39A 2LIQA 1Q04A 3OJ2A 1AF9A 3OBRA 3CA1A 3V0BA 4JRAA 4EKXB 4GOYA 2F8XC 1JLYA 2MIBA 1HWMB 1DFQA 1G9DA 1ISYA 1HWOB 4XFUA 3A22A 5I1BA 1KNMA 1AFCA 1UPSA 4IY9A 4DENA 4GP3A 3ZXDA 1HWNB 1V6UA 2F2FC 3WMVA 5JLVA 4I4UA 9ILBA 1S0EA 1YBIA 3WMUA 3N7JA 3UDAA 1P63A 3WO2A 2KKIA 4R6UB 4ISRA 4ZFWB 1TFMB 2BEBA 3QR5A 2XOAA 1HKNA 4J2KA 5DUYA 4LO1C 3V79C 3FJDA 3F62B 2D20A 4IZXA 4MZFB 3ZC8A 2UUSA 5F8WA 4J2SA 5DSSB 1QQKA 3P6IA 2HWMA 7I1BA 5BQUC 4H9WA 2AAIB 5D62A 2BFHA 4LO3A 1PC8B 3O44A 4QKSA 3FJKA 4I4PA 4JPZA 1FWVA 4I4OA 2NVHA 3D7WB 2HWAA 2D7IA 2M49A 3AKHA 31BIA 4QBVA 3OBTA 2NM1A 2RSTA 4I1BA 4HR6C 3BAHA 3LTQA 3BB2A 3BAOA 3WO3A 4G9MA 3V0AA 1FWUA 1BFBA 3PUBA 3TC2A 2X2SA 3UD8A 1RZOB 3BTAA 4Z9WB 4OEFA 1S0FA 4EFRA 3N0KA 1MD6A 1DQGA 1K5VA 1ONKB 2P23A 1T9FA 2I1BA 2D23A 2E4MC 3CA6A 4JP0A 3O4BA 3B9UA 2K4AB 3N7MA 1JT4A 1Q03A 3OJMA 3T8SA 1TP0A 4IZEA 3FJCA 1Z4SA 3MALA 3QYDA 1F31A 4ISQA 4I8MA 1XHBA 1ISWA 4J2XA 3BRDA 1DLLA 1QXMA 3VSZA 2FDBM 3Q7WA 1PUUB 3BRFA 3CA4A 4D0TA 1HCEA 3BAVA 3AH2A 4QBCA 4H04A 4QC4A 2ZQOA 3AKFA 3W9TA 4OEGA 3OJVA 1R8OA 4I37A 3PHZA 4J23B 1ISXA 1S0CA 3CA3A 1II4A 1BARA 5EHAA 4Q91A 5FZUA 3ZC9A 5FZZA 3NBEA 1DQOA 1JT7A 4G1RA 3FJBA 1JTCA 4KEIA 3P6JA 1HWPB 4OWJA 1G82A 2FGFA 1WBCA 1IOBA 3FJJA 3A07A 3IIRA 4II0A 2NS2A 1TWEA 2NZ9A 3H6QA 4HA2A 4D0ZA 4XKIA 1VCLA 1FMZA 3IM7A 3VT2A 3O4OA 5BXSA 4IHZA 5BXTA 1BA7A 1FV3A 2NTDA 3FJ9A 3OGFA 1FN0A 5BXPA 4I96A 6I1BA 1EYLA 1TOOA 2ESUA 4EEEB 2BEAA 3E8LC 3BRGC 3CRGA 3RSJA 5BXRA 4FVVA 3BAQA 4I4VA 5FNXA 2D22A 1SZ6B 3CQAA 4LO2A 1MC9A 4OUJA 1TWMA 2Y9FA 5D61A 1BFCA 5F8SA 4A7YA 5BVPI 1FGAA 5F8YA 3VT0A 3VWCA 4IY8A 3HMYA 2AXMA 2Y9XE 2R9KB 3AH1A 1HIBA 2RG9B 2ZQNA 3UD7A 1WD4A 3MPPG 1M2TB 3POKA 4X3AA 1IJTA 3BA7A 5BP5A 1BFFA 3A21A 4I2SA 3UJ0A 3BAGA 2GO2A 4FGFA 2KLLA 4JKXB 5F90A 4EFQA 2VXTI 2F2FA 3WINC 1DZDA 2D1ZA 3FUQA 3CA5A 1ILR1 4I4QA 4YOLA 4ZGRB 2D7RA 1BLAA 1XYFA 3O4DA 1A8DA 3FJEA 3FUOA 3FJIA 3Q7YA 2ET2A 1IHKA 2MC2A 3RTJB 1AVAC 2FFVA 4I4YA 3AKGA 1AVWB 21BIA 2Z48A 3H6RB 4P0JA 2Q3NB 2QN4A 3O49A 4DEPA 4H75A 1SR4A 1W3GA 1JLXA 2IHOA 4GP0A 3CA0A 2FO1A 3SNVA 3AZWA 4XFTA 1FQ9A 3JRRA 1DFCA 3BAUA 1IT0A 3O5WB 2WRYA 4AN6A 4ZKTB 4LO7C 4ZFUB 4P0LA 1IRPA 4G6JA 4LO0C 4F34A 2D24A 4ZOTA 4Z8SB 4OEEA 1G9CA 2X2TA 1BFGA 3I29B 4USPA 4KEKA 5HPZA 2IWTB 4QO3A 3ZX7A 5DZUA 4I7IA 1ABRB 3VEQA 1D0HA 4I1EA 2NYYA 4P6AA 1G9AA 3IM5A 5G00A 3F1RA 3IM6A 1YYNA 3FFZA 2L5XA 4USOA 2AFGA 3KMVA 4I0YA 3CU1B 4MZHA 3IAGC 2LIEA 3HN1A 1TTUA 1PUMB 4I6IA 3O3QA 2VSAA 3NBDA 4LO7B 2AQZA 2KI4A 4A7ZA 1FV2A 3HSMA 3HOMA 3ZXGA 4GAFA 4HJJA 1BLDA 2DS0A 1V6VA 3Q7XA 8I1BA 5GAQA 5BOWA 5FNWA 3RMXA 2Y9GA 2QYIB 1BASA 1PZZA 3AZVA 1DJSB 1TIEA 1IILA 3HBWA 4LO2C 1S0GA 2GZBA 4I4SA 1YTOA 1S0BA 1RMLA 3AJ6A 3LLPA 1E0OA 3S8JA 2HW9A 4OWKA 1DZCA 1M16A 1CE7B 1JT5A 4EB2B 1Z2VA 3V0BB 2KH2A 2ZR1B 3AH4A 4GOVA 4X37A 1V6XA 3R4SA 4ZBVB 1R8NA 5BP5C 3CAHA 3UD9A 2VSEA 4PC4A 4QKRA 4IQPA 3VT1A 4LO3C 3NBCA 1XG6A 3O4CA 1CVSA 4X38A 4QD2C 4ENDA 3BX1C 5FZYA 3RMYA 3NJ5A 2DRZA 2D43A 4JKQA 5E24E 2VLCA 1JQZA 1Q1UA 1EVTA 3JUTA 2Q9XA 3CRIA 2YUGA 2ERMA 4G6MA 4JAWA 3BA5A 1N4KA 1NUNA 1HCDA 1PWAA 2DRYA 1S0DA 1SR4C 1IRAX 2FFUA 4QALA 1YF8B 4WBCA 1G9BA 4F83A 2VUAA 2Y9WC 3PG0A 2K8RA 2WBCA 3OGGA 4J2YA 4Q9GA 4ZLBB 3I2XA 1AVUA 1EV2A 3FJFA 1NZKA 4LO1A 4OW4A 4GAIA 1I1BA 3WA1A 3H6RA 1ISZA 4QD2B 1ISVA 4KC3A 1XZZA 1FMMS 5EG6C 4ZFYB 1S0LA 2D44A 2RQ9A 3N7LA 5BQUA 2MLLB 4I3NA 4JQ0A 4UY4A 4G9NA 3V0AB 3BADA 3WINA 1OQLB 5D63A 1T4QA 1JY0A 1ITBA 3K1XA 3VUOA 4P0KA 3FGMA 1YXWA 3WO4A 2Z49A 5JMCA 3FJ8A 4AN7B 4IYBA 1WD3A 3AJ5A 3AKIA 3FJHA 3VSFA 4CJMA 5DVHA 3UJ4A 4KBBA 3FJAA 3NBNA 4ZA3B 4D8HA 4X39A 1AXMA 3R4UA 4MZGB 1RY7A 3EF2A 4IONA 2K43A 3BA4A 3HALA 4XFSA 2DREA 1AVXB 1JT3A 3I2AA 3PMEA 2E4MA 2J3PA 3ILAA 4KEJA 3C9ZA 2NP0A 4Q9PA 4LO0A 4I4RA 1W3AA 2VXRA 1W3FA 2KI6B 1Z0HA 3RTIB 5B2HA 1DIWA 3N7KA 1WBAA 3P53A 4L4HA 4TLPA 3A23A 3CRHA
chains in the Genus database with same CATH topology
4DCKC 1QQLA 4I4XA 1RG8A 4LO8B 1J0SA 3S8KA 1I1EA 1GGPB 3O4AA 1L2HA 4EFPA 1V6WA 2VU9A 4A7KA 4L4IA 1EPWA 4OWLA 1K5UA 41BIA 5EC5A 3H6SE 2HZ9A 2P39A 2LIQA 1Q04A 3OJ2A 1AF9A 3OBRA 3CA1A 3V0BA 4JRAA 4EKXB 4GOYA 2F8XC 1JLYA 2MIBA 1HWMB 1DFQA 1G9DA 1ISYA 1HWOB 4XFUA 3A22A 5I1BA 1KNMA 1AFCA 1UPSA 4IY9A 4DENA 4GP3A 3ZXDA 1HWNB 1V6UA 2F2FC 3WMVA 5JLVA 4I4UA 9ILBA 1S0EA 1YBIA 3WMUA 3N7JA 3UDAA 1P63A 3WO2A 2KKIA 4R6UB 4ISRA 4ZFWB 1TFMB 2BEBA 3QR5A 2XOAA 1HKNA 4J2KA 5DUYA 4LO1C 3V79C 3FJDA 3F62B 2D20A 4IZXA 4MZFB 3ZC8A 2UUSA 5F8WA 4J2SA 5DSSB 1QQKA 3P6IA 2HWMA 7I1BA 5BQUC 4H9WA 2AAIB 5D62A 2BFHA 4LO3A 1PC8B 3O44A 4QKSA 3FJKA 4I4PA 4JPZA 1FWVA 4I4OA 2NVHA 3D7WB 2HWAA 2D7IA 2M49A 3AKHA 31BIA 4QBVA 3OBTA 2NM1A 2RSTA 4I1BA 4HR6C 3BAHA 3LTQA 3BB2A 3BAOA 3WO3A 4G9MA 3V0AA 1FWUA 1BFBA 3PUBA 3TC2A 2X2SA 3UD8A 1RZOB 3BTAA 4Z9WB 4OEFA 1S0FA 4EFRA 3N0KA 1MD6A 1DQGA 1K5VA 1ONKB 2P23A 1T9FA 2I1BA 2D23A 2E4MC 3CA6A 4JP0A 3O4BA 3B9UA 2K4AB 3N7MA 1JT4A 1Q03A 3OJMA 3T8SA 1TP0A 4IZEA 3FJCA 1Z4SA 3MALA 3QYDA 1F31A 4ISQA 4I8MA 1XHBA 1ISWA 4J2XA 3BRDA 1DLLA 1QXMA 3VSZA 2FDBM 3Q7WA 1PUUB 3BRFA 3CA4A 4D0TA 1HCEA 3BAVA 3AH2A 4QBCA 4H04A 4QC4A 2ZQOA 3AKFA 3W9TA 4OEGA 3OJVA 1R8OA 4I37A 3PHZA 4J23B 1ISXA 1S0CA 3CA3A 1II4A 1BARA 5EHAA 4Q91A 5FZUA 3ZC9A 5FZZA 3NBEA 1DQOA 1JT7A 4G1RA 3FJBA 1JTCA 4KEIA 3P6JA 1HWPB 4OWJA 1G82A 2FGFA 1WBCA 1IOBA 3FJJA 3A07A 3IIRA 4II0A 2NS2A 1TWEA 2NZ9A 3H6QA 4HA2A 4D0ZA 4XKIA 1VCLA 1FMZA 3IM7A 3VT2A 3O4OA 5BXSA 4IHZA 5BXTA 1BA7A 1FV3A 2NTDA 3FJ9A 3OGFA 1FN0A 5BXPA 4I96A 6I1BA 1EYLA 1TOOA 2ESUA 4EEEB 2BEAA 3E8LC 3BRGC 3CRGA 3RSJA 5BXRA 4FVVA 3BAQA 4I4VA 5FNXA 2D22A 1SZ6B 3CQAA 4LO2A 1MC9A 4OUJA 1TWMA 2Y9FA 5D61A 1BFCA 5F8SA 4A7YA 5BVPI 1FGAA 5F8YA 3VT0A 3VWCA 4IY8A 3HMYA 2AXMA 2Y9XE 2R9KB 3AH1A 1HIBA 2RG9B 2ZQNA 3UD7A 1WD4A 3MPPG 1M2TB 3POKA 4X3AA 1IJTA 3BA7A 5BP5A 1BFFA 3A21A 4I2SA 3UJ0A 3BAGA 2GO2A 4FGFA 2KLLA 4JKXB 5F90A 4EFQA 2VXTI 2F2FA 3WINC 1DZDA 2D1ZA 3FUQA 3CA5A 1ILR1 4I4QA 4YOLA 4ZGRB 2D7RA 1BLAA 1XYFA 3O4DA 1A8DA 3FJEA 3FUOA 3FJIA 3Q7YA 2ET2A 1IHKA 2MC2A 3RTJB 1AVAC 2FFVA 4I4YA 3AKGA 1AVWB 21BIA 2Z48A 3H6RB 4P0JA 2Q3NB 2QN4A 3O49A 4DEPA 4H75A 1SR4A 1W3GA 1JLXA 2IHOA 4GP0A 3CA0A 2FO1A 3SNVA 3AZWA 4XFTA 1FQ9A 3JRRA 1DFCA 3BAUA 1IT0A 3O5WB 2WRYA 4AN6A 4ZKTB 4LO7C 4ZFUB 4P0LA 1IRPA 4G6JA 4LO0C 4F34A 2D24A 4ZOTA 4Z8SB 4OEEA 1G9CA 2X2TA 1BFGA 3I29B 4USPA 4KEKA 5HPZA 2IWTB 4QO3A 3ZX7A 5DZUA 4I7IA 1ABRB 3VEQA 1D0HA 4I1EA 2NYYA 4P6AA 1G9AA 3IM5A 5G00A 3F1RA 3IM6A 1YYNA 3FFZA 2L5XA 4USOA 2AFGA 3KMVA 4I0YA 3CU1B 4MZHA 3IAGC 2LIEA 3HN1A 1TTUA 1PUMB 4I6IA 3O3QA 2VSAA 3NBDA 4LO7B 2AQZA 2KI4A 4A7ZA 1FV2A 3HSMA 3HOMA 3ZXGA 4GAFA 4HJJA 1BLDA 2DS0A 1V6VA 3Q7XA 8I1BA 5GAQA 5BOWA 5FNWA 3RMXA 2Y9GA 2QYIB 1BASA 1PZZA 3AZVA 1DJSB 1TIEA 1IILA 3HBWA 4LO2C 1S0GA 2GZBA 4I4SA 1YTOA 1S0BA 1RMLA 3AJ6A 3LLPA 1E0OA 3S8JA 2HW9A 4OWKA 1DZCA 1M16A 1CE7B 1JT5A 4EB2B 1Z2VA 3V0BB 2KH2A 2ZR1B 3AH4A 4GOVA 4X37A 1V6XA 3R4SA 4ZBVB 1R8NA 5BP5C 3CAHA 3UD9A 2VSEA 4PC4A 4QKRA 4IQPA 3VT1A 4LO3C 3NBCA 1XG6A 3O4CA 1CVSA 4X38A 4QD2C 4ENDA 3BX1C 5FZYA 3RMYA 3NJ5A 2DRZA 2D43A 4JKQA 5E24E 2VLCA 1JQZA 1Q1UA 1EVTA 3JUTA 2Q9XA 3CRIA 2YUGA 2ERMA 4G6MA 4JAWA 3BA5A 1N4KA 1NUNA 1HCDA 1PWAA 2DRYA 1S0DA 1SR4C 1IRAX 2FFUA 4QALA 1YF8B 4WBCA 1G9BA 4F83A 2VUAA 2Y9WC 3PG0A 2K8RA 2WBCA 3OGGA 4J2YA 4Q9GA 4ZLBB 3I2XA 1AVUA 1EV2A 3FJFA 1NZKA 4LO1A 4OW4A 4GAIA 1I1BA 3WA1A 3H6RA 1ISZA 4QD2B 1ISVA 4KC3A 1XZZA 1FMMS 5EG6C 4ZFYB 1S0LA 2D44A 2RQ9A 3N7LA 5BQUA 2MLLB 4I3NA 4JQ0A 4UY4A 4G9NA 3V0AB 3BADA 3WINA 1OQLB 5D63A 1T4QA 1JY0A 1ITBA 3K1XA 3VUOA 4P0KA 3FGMA 1YXWA 3WO4A 2Z49A 5JMCA 3FJ8A 4AN7B 4IYBA 1WD3A 3AJ5A 3AKIA 3FJHA 3VSFA 4CJMA 5DVHA 3UJ4A 4KBBA 3FJAA 3NBNA 4ZA3B 4D8HA 4X39A 1AXMA 3R4UA 4MZGB 1RY7A 3EF2A 4IONA 2K43A 3BA4A 3HALA 4XFSA 2DREA 1AVXB 1JT3A 3I2AA 3PMEA 2E4MA 2J3PA 3ILAA 4KEJA 3C9ZA 2NP0A 4Q9PA 4LO0A 4I4RA 1W3AA 2VXRA 1W3FA 2KI6B 1Z0HA 3RTIB 5B2HA 1DIWA 3N7KA 1WBAA 3P53A 4L4HA 4TLPA 3A23A 3CRHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4DCK C;  1QQL A;  4I4X A;  1RG8 A;  4LO8 B;  1J0S A;  3S8K A;  1I1E A;  1GGP B;  3O4A A;  1L2H A;  4EFP A;  1V6W A;  2VU9 A;  4A7K A;  4L4I A;  1EPW A;  4OWL A;  1K5U A;  41BI A;  5EC5 A;  3H6S E;  2HZ9 A;  2P39 A;  2LIQ A;  1Q04 A;  3OJ2 A;  1AF9 A;  3OBR A;  3CA1 A;  3V0B A;  4JRA A;  4EKX B;  4GOY A;  2F8X C;  1JLY A;  2MIB A;  1HWM B;  1DFQ A;  1G9D A;  1ISY A;  1HWO B;  4XFU A;  3A22 A;  5I1B A;  1KNM A;  1AFC A;  1UPS A;  4IY9 A;  4DEN A;  4GP3 A;  3ZXD A;  1HWN B;  1V6U A;  2F2F C;  3WMV A;  5JLV A;  4I4U A;  9ILB A;  1S0E A;  1YBI A;  3WMU A;  3N7J A;  3UDA A;  1P63 A;  3WO2 A;  2KKI A;  4R6U B;  4ISR A;  4ZFW B;  1TFM B;  2BEB A;  3QR5 A;  2XOA A;  1HKN A;  4J2K A;  5DUY A;  4LO1 C;  3V79 C;  3FJD A;  3F62 B;  2D20 A;  4IZX A;  3ZC8 A;  2UUS A;  5F8W A;  4J2S A;  5DSS B;  1QQK A;  3P6I A;  2HWM A;  7I1B A;  5BQU C;  4H9W A;  2AAI B;  5D62 A;  2BFH A;  4LO3 A;  1PC8 B;  3O44 A;  4QKS A;  3FJK A;  4I4P A;  4JPZ A;  1FWV A;  4I4O A;  2NVH A;  3D7W B;  2HWA A;  2D7I A;  2M49 A;  3AKH A;  31BI A;  4QBV A;  3OBT A;  2NM1 A;  2RST A;  4I1B A;  4HR6 C;  3BAH A;  3LTQ A;  3BB2 A;  3BAO A;  3WO3 A;  4G9M A;  3V0A A;  1FWU A;  1BFB A;  3PUB A;  3TC2 A;  2X2S A;  3UD8 A;  1RZO B;  3BTA A;  4Z9W B;  4OEF A;  1S0F A;  4EFR A;  3N0K A;  1MD6 A;  1DQG A;  1K5V A;  1ONK B;  2P23 A;  1T9F A;  2I1B A;  2D23 A;  2E4M C;  3CA6 A;  4JP0 A;  3O4B A;  3B9U A;  2K4A B;  3N7M A;  1JT4 A;  1Q03 A;  3OJM A;  3T8S A;  1TP0 A;  4IZE A;  3FJC A;  1Z4S A;  3MAL A;  3QYD A;  1F31 A;  4ISQ A;  4I8M A;  1XHB A;  1ISW A;  4J2X A;  3BRD A;  1DLL A;  1QXM A;  3VSZ A;  2FDB M;  3Q7W A;  1PUU B;  3BRF A;  3CA4 A;  4D0T A;  1HCE A;  3BAV A;  3AH2 A;  4QBC A;  4H04 A;  4QC4 A;  2ZQO A;  3AKF A;  3W9T A;  4OEG A;  3OJV A;  1R8O A;  4I37 A;  3PHZ A;  4J23 B;  1ISX A;  1S0C A;  3CA3 A;  1II4 A;  1BAR A;  5EHA A;  4Q91 A;  5FZU A;  3ZC9 A;  5FZZ A;  3NBE A;  1DQO A;  1JT7 A;  4G1R A;  3FJB A;  1JTC A;  4KEI A;  3P6J A;  1HWP B;  4OWJ A;  1G82 A;  2FGF A;  1WBC A;  1IOB A;  3FJJ A;  3A07 A;  3IIR A;  4II0 A;  1TWE A;  2NZ9 A;  3H6Q A;  4HA2 A;  4D0Z A;  4XKI A;  1VCL A;  1FMZ A;  3IM7 A;  3VT2 A;  3O4O A;  5BXS A;  4IHZ A;  5BXT A;  1BA7 A;  1FV3 A;  2NTD A;  3FJ9 A;  3OGF A;  1FN0 A;  5BXP A;  4I96 A;  6I1B A;  1EYL A;  1TOO A;  2ESU A;  4EEE B;  2BEA A;  3E8L C;  3BRG C;  3CRG A;  3RSJ A;  5BXR A;  4FVV A;  3BAQ A;  4I4V A;  5FNX A;  2D22 A;  1SZ6 B;  3CQA A;  4LO2 A;  1MC9 A;  4OUJ A;  1TWM A;  2Y9F A;  5D61 A;  1BFC A;  5F8S A;  4A7Y A;  5BVP I;  1FGA A;  5F8Y A;  3VT0 A;  3VWC A;  4IY8 A;  3HMY A;  2AXM A;  2Y9X E;  2R9K B;  3AH1 A;  1HIB A;  2RG9 B;  2ZQN A;  3UD7 A;  1WD4 A;  3MPP G;  1M2T B;  3POK A;  4X3A A;  1IJT A;  3BA7 A;  5BP5 A;  1BFF A;  3A21 A;  4I2S A;  3UJ0 A;  3BAG A;  2GO2 A;  4FGF A;  2KLL A;  4JKX B;  5F90 A;  4EFQ A;  2VXT I;  2F2F A;  3WIN C;  1DZD A;  2D1Z A;  3FUQ A;  3CA5 A;  1ILR 1;  4I4Q A;  4YOL A;  4ZGR B;  2D7R A;  1BLA A;  1XYF A;  3O4D A;  1A8D A;  3FJE A;  3FUO A;  3FJI A;  3Q7Y A;  2ET2 A;  1IHK A;  2MC2 A;  3RTJ B;  1AVA C;  2FFV A;  4I4Y A;  3AKG A;  1AVW B;  21BI A;  2Z48 A;  3H6R B;  4P0J A;  2Q3N B;  2QN4 A;  3O49 A;  4DEP A;  1SR4 A;  1W3G A;  1JLX A;  2IHO A;  4GP0 A;  3CA0 A;  2FO1 A;  3SNV A;  3AZW A;  4XFT A;  1FQ9 A;  3JRR A;  1DFC A;  3BAU A;  1IT0 A;  3O5W B;  2WRY A;  4AN6 A;  4ZKT B;  4LO7 C;  4ZFU B;  4P0L A;  1IRP A;  4G6J A;  4LO0 C;  4F34 A;  2D24 A;  4ZOT A;  4Z8S B;  4OEE A;  1G9C A;  2X2T A;  1BFG A;  3I29 B;  4USP A;  4KEK A;  5HPZ A;  2IWT B;  4QO3 A;  3ZX7 A;  5DZU A;  4I7I A;  1ABR B;  3VEQ A;  1D0H A;  4I1E A;  2NYY A;  4P6A A;  1G9A A;  3IM5 A;  5G00 A;  3F1R A;  3IM6 A;  1YYN A;  3FFZ A;  2L5X A;  4USO A;  2AFG A;  3KMV A;  4I0Y A;  3CU1 B;  3IAG C;  2LIE A;  3HN1 A;  1TTU A;  1PUM B;  4I6I A;  3O3Q A;  2VSA A;  3NBD A;  4LO7 B;  2AQZ A;  2KI4 A;  4A7Z A;  1FV2 A;  3HSM A;  3HOM A;  3ZXG A;  4GAF A;  4HJJ A;  1BLD A;  2DS0 A;  1V6V A;  3Q7X A;  8I1B A;  5GAQ A;  5BOW A;  5FNW A;  3RMX A;  2Y9G A;  2QYI B;  1BAS A;  1PZZ A;  3AZV A;  1DJS B;  1TIE A;  1IIL A;  3HBW A;  4LO2 C;  1S0G A;  2GZB A;  4I4S A;  1YTO A;  1S0B A;  1RML A;  3AJ6 A;  3LLP A;  1E0O A;  3S8J A;  2HW9 A;  4OWK A;  1DZC A;  1M16 A;  1CE7 B;  1JT5 A;  4EB2 B;  1Z2V A;  3V0B B;  2KH2 A;  2ZR1 B;  3AH4 A;  4GOV A;  4X37 A;  1V6X A;  3R4S A;  4ZBV B;  1R8N A;  5BP5 C;  3CAH A;  3UD9 A;  2VSE A;  4PC4 A;  4QKR A;  4IQP A;  3VT1 A;  4LO3 C;  3NBC A;  1XG6 A;  3O4C A;  1CVS A;  4X38 A;  4QD2 C;  4END A;  3BX1 C;  5FZY A;  3RMY A;  3NJ5 A;  2DRZ A;  2D43 A;  4JKQ A;  5E24 E;  2VLC A;  1JQZ A;  1Q1U A;  1EVT A;  3JUT A;  2Q9X A;  3CRI A;  2YUG A;  2ERM A;  4G6M A;  4JAW A;  3BA5 A;  1N4K A;  1NUN A;  1HCD A;  1PWA A;  2DRY A;  1S0D A;  1SR4 C;  1IRA X;  2FFU A;  4QAL A;  1YF8 B;  4WBC A;  1G9B A;  4F83 A;  2VUA A;  2Y9W C;  3PG0 A;  2K8R A;  2WBC A;  3OGG A;  4J2Y A;  4Q9G A;  4ZLB B;  3I2X A;  1AVU A;  1EV2 A;  3FJF A;  1NZK A;  4LO1 A;  4OW4 A;  4GAI A;  1I1B A;  3WA1 A;  3H6R A;  1ISZ A;  4QD2 B;  1ISV A;  4KC3 A;  1XZZ A;  1FMM S;  5EG6 C;  4ZFY B;  1S0L A;  2D44 A;  2RQ9 A;  3N7L A;  5BQU A;  2MLL B;  4I3N A;  4JQ0 A;  4G9N A;  3V0A B;  3BAD A;  3WIN A;  1OQL B;  5D63 A;  1T4Q A;  1JY0 A;  1ITB A;  3K1X A;  3VUO A;  4P0K A;  3FGM A;  1YXW A;  3WO4 A;  2Z49 A;  5JMC A;  3FJ8 A;  4AN7 B;  4IYB A;  1WD3 A;  3AJ5 A;  3AKI A;  3FJH A;  3VSF A;  4CJM A;  5DVH A;  3UJ4 A;  4KBB A;  3FJA A;  3NBN A;  4ZA3 B;  4D8H A;  4X39 A;  1AXM A;  3R4U A;  1RY7 A;  3EF2 A;  4ION A;  2K43 A;  3BA4 A;  3HAL A;  4XFS A;  2DRE A;  1AVX B;  1JT3 A;  3I2A A;  3PME A;  2E4M A;  2J3P A;  3ILA A;  4KEJ A;  3C9Z A;  2NP0 A;  4Q9P A;  4LO0 A;  4I4R A;  1W3A A;  2VXR A;  1W3F A;  2KI6 B;  1Z0H A;  3RTI B;  5B2H A;  1DIW A;  3N7K A;  1WBA A;  3P53 A;  4L4H A;  4TLP A;  3A23 A;  3CRH A; 
#chains in the Genus database with same CATH topology
 4DCK C;  1QQL A;  4I4X A;  1RG8 A;  4LO8 B;  1J0S A;  3S8K A;  1I1E A;  1GGP B;  3O4A A;  1L2H A;  4EFP A;  1V6W A;  2VU9 A;  4A7K A;  4L4I A;  1EPW A;  4OWL A;  1K5U A;  41BI A;  5EC5 A;  3H6S E;  2HZ9 A;  2P39 A;  2LIQ A;  1Q04 A;  3OJ2 A;  1AF9 A;  3OBR A;  3CA1 A;  3V0B A;  4JRA A;  4EKX B;  4GOY A;  2F8X C;  1JLY A;  2MIB A;  1HWM B;  1DFQ A;  1G9D A;  1ISY A;  1HWO B;  4XFU A;  3A22 A;  5I1B A;  1KNM A;  1AFC A;  1UPS A;  4IY9 A;  4DEN A;  4GP3 A;  3ZXD A;  1HWN B;  1V6U A;  2F2F C;  3WMV A;  5JLV A;  4I4U A;  9ILB A;  1S0E A;  1YBI A;  3WMU A;  3N7J A;  3UDA A;  1P63 A;  3WO2 A;  2KKI A;  4R6U B;  4ISR A;  4ZFW B;  1TFM B;  2BEB A;  3QR5 A;  2XOA A;  1HKN A;  4J2K A;  5DUY A;  4LO1 C;  3V79 C;  3FJD A;  3F62 B;  2D20 A;  4IZX A;  4MZF B;  3ZC8 A;  2UUS A;  5F8W A;  4J2S A;  5DSS B;  1QQK A;  3P6I A;  2HWM A;  7I1B A;  5BQU C;  4H9W A;  2AAI B;  5D62 A;  2BFH A;  4LO3 A;  1PC8 B;  3O44 A;  4QKS A;  3FJK A;  4I4P A;  4JPZ A;  1FWV A;  4I4O A;  2NVH A;  3D7W B;  2HWA A;  2D7I A;  2M49 A;  3AKH A;  31BI A;  4QBV A;  3OBT A;  2NM1 A;  2RST A;  4I1B A;  4HR6 C;  3BAH A;  3LTQ A;  3BB2 A;  3BAO A;  3WO3 A;  4G9M A;  3V0A A;  1FWU A;  1BFB A;  3PUB A;  3TC2 A;  2X2S A;  3UD8 A;  1RZO B;  3BTA A;  4Z9W B;  4OEF A;  1S0F A;  4EFR A;  3N0K A;  1MD6 A;  1DQG A;  1K5V A;  1ONK B;  2P23 A;  1T9F A;  2I1B A;  2D23 A;  2E4M C;  3CA6 A;  4JP0 A;  3O4B A;  3B9U A;  2K4A B;  3N7M A;  1JT4 A;  1Q03 A;  3OJM A;  3T8S A;  1TP0 A;  4IZE A;  3FJC A;  1Z4S A;  3MAL A;  3QYD A;  1F31 A;  4ISQ A;  4I8M A;  1XHB A;  1ISW A;  4J2X A;  3BRD A;  1DLL A;  1QXM A;  3VSZ A;  2FDB M;  3Q7W A;  1PUU B;  3BRF A;  3CA4 A;  4D0T A;  1HCE A;  3BAV A;  3AH2 A;  4QBC A;  4H04 A;  4QC4 A;  2ZQO A;  3AKF A;  3W9T A;  4OEG A;  3OJV A;  1R8O A;  4I37 A;  3PHZ A;  4J23 B;  1ISX A;  1S0C A;  3CA3 A;  1II4 A;  1BAR A;  5EHA A;  4Q91 A;  5FZU A;  3ZC9 A;  5FZZ A;  3NBE A;  1DQO A;  1JT7 A;  4G1R A;  3FJB A;  1JTC A;  4KEI A;  3P6J A;  1HWP B;  4OWJ A;  1G82 A;  2FGF A;  1WBC A;  1IOB A;  3FJJ A;  3A07 A;  3IIR A;  4II0 A;  2NS2 A;  1TWE A;  2NZ9 A;  3H6Q A;  4HA2 A;  4D0Z A;  4XKI A;  1VCL A;  1FMZ A;  3IM7 A;  3VT2 A;  3O4O A;  5BXS A;  4IHZ A;  5BXT A;  1BA7 A;  1FV3 A;  2NTD A;  3FJ9 A;  3OGF A;  1FN0 A;  5BXP A;  4I96 A;  6I1B A;  1EYL A;  1TOO A;  2ESU A;  4EEE B;  2BEA A;  3E8L C;  3BRG C;  3CRG A;  3RSJ A;  5BXR A;  4FVV A;  3BAQ A;  4I4V A;  5FNX A;  2D22 A;  1SZ6 B;  3CQA A;  4LO2 A;  1MC9 A;  4OUJ A;  1TWM A;  2Y9F A;  5D61 A;  1BFC A;  5F8S A;  4A7Y A;  5BVP I;  1FGA A;  5F8Y A;  3VT0 A;  3VWC A;  4IY8 A;  3HMY A;  2AXM A;  2Y9X E;  2R9K B;  3AH1 A;  1HIB A;  2RG9 B;  2ZQN A;  3UD7 A;  1WD4 A;  3MPP G;  1M2T B;  3POK A;  4X3A A;  1IJT A;  3BA7 A;  5BP5 A;  1BFF A;  3A21 A;  4I2S A;  3UJ0 A;  3BAG A;  2GO2 A;  4FGF A;  2KLL A;  4JKX B;  5F90 A;  4EFQ A;  2VXT I;  2F2F A;  3WIN C;  1DZD A;  2D1Z A;  3FUQ A;  3CA5 A;  1ILR 1;  4I4Q A;  4YOL A;  4ZGR B;  2D7R A;  1BLA A;  1XYF A;  3O4D A;  1A8D A;  3FJE A;  3FUO A;  3FJI A;  3Q7Y A;  2ET2 A;  1IHK A;  2MC2 A;  3RTJ B;  1AVA C;  2FFV A;  4I4Y A;  3AKG A;  1AVW B;  21BI A;  2Z48 A;  3H6R B;  4P0J A;  2Q3N B;  2QN4 A;  3O49 A;  4DEP A;  4H75 A;  1SR4 A;  1W3G A;  1JLX A;  2IHO A;  4GP0 A;  3CA0 A;  2FO1 A;  3SNV A;  3AZW A;  4XFT A;  1FQ9 A;  3JRR A;  1DFC A;  3BAU A;  1IT0 A;  3O5W B;  2WRY A;  4AN6 A;  4ZKT B;  4LO7 C;  4ZFU B;  4P0L A;  1IRP A;  4G6J A;  4LO0 C;  4F34 A;  2D24 A;  4ZOT A;  4Z8S B;  4OEE A;  1G9C A;  2X2T A;  1BFG A;  3I29 B;  4USP A;  4KEK A;  5HPZ A;  2IWT B;  4QO3 A;  3ZX7 A;  5DZU A;  4I7I A;  1ABR B;  3VEQ A;  1D0H A;  4I1E A;  2NYY A;  4P6A A;  1G9A A;  3IM5 A;  5G00 A;  3F1R A;  3IM6 A;  1YYN A;  3FFZ A;  2L5X A;  4USO A;  2AFG A;  3KMV A;  4I0Y A;  3CU1 B;  4MZH A;  3IAG C;  2LIE A;  3HN1 A;  1TTU A;  1PUM B;  4I6I A;  3O3Q A;  2VSA A;  3NBD A;  4LO7 B;  2AQZ A;  2KI4 A;  4A7Z A;  1FV2 A;  3HSM A;  3HOM A;  3ZXG A;  4GAF A;  4HJJ A;  1BLD A;  2DS0 A;  1V6V A;  3Q7X A;  8I1B A;  5GAQ A;  5BOW A;  5FNW A;  3RMX A;  2Y9G A;  2QYI B;  1BAS A;  1PZZ A;  3AZV A;  1DJS B;  1TIE A;  1IIL A;  3HBW A;  4LO2 C;  1S0G A;  2GZB A;  4I4S A;  1YTO A;  1S0B A;  1RML A;  3AJ6 A;  3LLP A;  1E0O A;  3S8J A;  2HW9 A;  4OWK A;  1DZC A;  1M16 A;  1CE7 B;  1JT5 A;  4EB2 B;  1Z2V A;  3V0B B;  2KH2 A;  2ZR1 B;  3AH4 A;  4GOV A;  4X37 A;  1V6X A;  3R4S A;  4ZBV B;  1R8N A;  5BP5 C;  3CAH A;  3UD9 A;  2VSE A;  4PC4 A;  4QKR A;  4IQP A;  3VT1 A;  4LO3 C;  3NBC A;  1XG6 A;  3O4C A;  1CVS A;  4X38 A;  4QD2 C;  4END A;  3BX1 C;  5FZY A;  3RMY A;  3NJ5 A;  2DRZ A;  2D43 A;  4JKQ A;  5E24 E;  2VLC A;  1JQZ A;  1Q1U A;  1EVT A;  3JUT A;  2Q9X A;  3CRI A;  2YUG A;  2ERM A;  4G6M A;  4JAW A;  3BA5 A;  1N4K A;  1NUN A;  1HCD A;  1PWA A;  2DRY A;  1S0D A;  1SR4 C;  1IRA X;  2FFU A;  4QAL A;  1YF8 B;  4WBC A;  1G9B A;  4F83 A;  2VUA A;  2Y9W C;  3PG0 A;  2K8R A;  2WBC A;  3OGG A;  4J2Y A;  4Q9G A;  4ZLB B;  3I2X A;  1AVU A;  1EV2 A;  3FJF A;  1NZK A;  4LO1 A;  4OW4 A;  4GAI A;  1I1B A;  3WA1 A;  3H6R A;  1ISZ A;  4QD2 B;  1ISV A;  4KC3 A;  1XZZ A;  1FMM S;  5EG6 C;  4ZFY B;  1S0L A;  2D44 A;  2RQ9 A;  3N7L A;  5BQU A;  2MLL B;  4I3N A;  4JQ0 A;  4UY4 A;  4G9N A;  3V0A B;  3BAD A;  3WIN A;  1OQL B;  5D63 A;  1T4Q A;  1JY0 A;  1ITB A;  3K1X A;  3VUO A;  4P0K A;  3FGM A;  1YXW A;  3WO4 A;  2Z49 A;  5JMC A;  3FJ8 A;  4AN7 B;  4IYB A;  1WD3 A;  3AJ5 A;  3AKI A;  3FJH A;  3VSF A;  4CJM A;  5DVH A;  3UJ4 A;  4KBB A;  3FJA A;  3NBN A;  4ZA3 B;  4D8H A;  4X39 A;  1AXM A;  3R4U A;  4MZG B;  1RY7 A;  3EF2 A;  4ION A;  2K43 A;  3BA4 A;  3HAL A;  4XFS A;  2DRE A;  1AVX B;  1JT3 A;  3I2A A;  3PME A;  2E4M A;  2J3P A;  3ILA A;  4KEJ A;  3C9Z A;  2NP0 A;  4Q9P A;  4LO0 A;  4I4R A;  1W3A A;  2VXR A;  1W3F A;  2KI6 B;  1Z0H A;  3RTI B;  5B2H A;  1DIW A;  3N7K A;  1WBA A;  3P53 A;  4L4H A;  4TLP A;  3A23 A;  3CRH A; 
#chains in the Genus database with same CATH homology
 4DCK C;  1QQL A;  4I4X A;  1RG8 A;  4LO8 B;  1J0S A;  3S8K A;  1I1E A;  1GGP B;  3O4A A;  1L2H A;  4EFP A;  1V6W A;  2VU9 A;  4A7K A;  4L4I A;  1EPW A;  4OWL A;  1K5U A;  41BI A;  5EC5 A;  3H6S E;  2HZ9 A;  2P39 A;  2LIQ A;  1Q04 A;  3OJ2 A;  1AF9 A;  3OBR A;  3CA1 A;  3V0B A;  4JRA A;  4EKX B;  4GOY A;  2F8X C;  1JLY A;  2MIB A;  1HWM B;  1DFQ A;  1G9D A;  1ISY A;  1HWO B;  4XFU A;  3A22 A;  5I1B A;  1KNM A;  1AFC A;  1UPS A;  4IY9 A;  4DEN A;  4GP3 A;  3ZXD A;  1HWN B;  1V6U A;  2F2F C;  3WMV A;  5JLV A;  4I4U A;  9ILB A;  1S0E A;  1YBI A;  3WMU A;  3N7J A;  3UDA A;  1P63 A;  3WO2 A;  2KKI A;  4R6U B;  4ISR A;  4ZFW B;  1TFM B;  2BEB A;  3QR5 A;  2XOA A;  1HKN A;  4J2K A;  5DUY A;  4LO1 C;  3V79 C;  3FJD A;  3F62 B;  2D20 A;  4IZX A;  4MZF B;  3ZC8 A;  2UUS A;  5F8W A;  4J2S A;  5DSS B;  1QQK A;  3P6I A;  2HWM A;  7I1B A;  5BQU C;  4H9W A;  2AAI B;  5D62 A;  2BFH A;  4LO3 A;  1PC8 B;  3O44 A;  4QKS A;  3FJK A;  4I4P A;  4JPZ A;  1FWV A;  4I4O A;  2NVH A;  3D7W B;  2HWA A;  2D7I A;  2M49 A;  3AKH A;  31BI A;  4QBV A;  3OBT A;  2NM1 A;  2RST A;  4I1B A;  4HR6 C;  3BAH A;  3LTQ A;  3BB2 A;  3BAO A;  3WO3 A;  4G9M A;  3V0A A;  1FWU A;  1BFB A;  3PUB A;  3TC2 A;  2X2S A;  3UD8 A;  1RZO B;  3BTA A;  4Z9W B;  4OEF A;  1S0F A;  4EFR A;  3N0K A;  1MD6 A;  1DQG A;  1K5V A;  1ONK B;  2P23 A;  1T9F A;  2I1B A;  2D23 A;  2E4M C;  3CA6 A;  4JP0 A;  3O4B A;  3B9U A;  2K4A B;  3N7M A;  1JT4 A;  1Q03 A;  3OJM A;  3T8S A;  1TP0 A;  4IZE A;  3FJC A;  1Z4S A;  3MAL A;  3QYD A;  1F31 A;  4ISQ A;  4I8M A;  1XHB A;  1ISW A;  4J2X A;  3BRD A;  1DLL A;  1QXM A;  3VSZ A;  2FDB M;  3Q7W A;  1PUU B;  3BRF A;  3CA4 A;  4D0T A;  1HCE A;  3BAV A;  3AH2 A;  4QBC A;  4H04 A;  4QC4 A;  2ZQO A;  3AKF A;  3W9T A;  4OEG A;  3OJV A;  1R8O A;  4I37 A;  3PHZ A;  4J23 B;  1ISX A;  1S0C A;  3CA3 A;  1II4 A;  1BAR A;  5EHA A;  4Q91 A;  5FZU A;  3ZC9 A;  5FZZ A;  3NBE A;  1DQO A;  1JT7 A;  4G1R A;  3FJB A;  1JTC A;  4KEI A;  3P6J A;  1HWP B;  4OWJ A;  1G82 A;  2FGF A;  1WBC A;  1IOB A;  3FJJ A;  3A07 A;  3IIR A;  4II0 A;  2NS2 A;  1TWE A;  2NZ9 A;  3H6Q A;  4HA2 A;  4D0Z A;  4XKI A;  1VCL A;  1FMZ A;  3IM7 A;  3VT2 A;  3O4O A;  5BXS A;  4IHZ A;  5BXT A;  1BA7 A;  1FV3 A;  2NTD A;  3FJ9 A;  3OGF A;  1FN0 A;  5BXP A;  4I96 A;  6I1B A;  1EYL A;  1TOO A;  2ESU A;  4EEE B;  2BEA A;  3E8L C;  3BRG C;  3CRG A;  3RSJ A;  5BXR A;  4FVV A;  3BAQ A;  4I4V A;  5FNX A;  2D22 A;  1SZ6 B;  3CQA A;  4LO2 A;  1MC9 A;  4OUJ A;  1TWM A;  2Y9F A;  5D61 A;  1BFC A;  5F8S A;  4A7Y A;  5BVP I;  1FGA A;  5F8Y A;  3VT0 A;  3VWC A;  4IY8 A;  3HMY A;  2AXM A;  2Y9X E;  2R9K B;  3AH1 A;  1HIB A;  2RG9 B;  2ZQN A;  3UD7 A;  1WD4 A;  3MPP G;  1M2T B;  3POK A;  4X3A A;  1IJT A;  3BA7 A;  5BP5 A;  1BFF A;  3A21 A;  4I2S A;  3UJ0 A;  3BAG A;  2GO2 A;  4FGF A;  2KLL A;  4JKX B;  5F90 A;  4EFQ A;  2VXT I;  2F2F A;  3WIN C;  1DZD A;  2D1Z A;  3FUQ A;  3CA5 A;  1ILR 1;  4I4Q A;  4YOL A;  4ZGR B;  2D7R A;  1BLA A;  1XYF A;  3O4D A;  1A8D A;  3FJE A;  3FUO A;  3FJI A;  3Q7Y A;  2ET2 A;  1IHK A;  2MC2 A;  3RTJ B;  1AVA C;  2FFV A;  4I4Y A;  3AKG A;  1AVW B;  21BI A;  2Z48 A;  3H6R B;  4P0J A;  2Q3N B;  2QN4 A;  3O49 A;  4DEP A;  4H75 A;  1SR4 A;  1W3G A;  1JLX A;  2IHO A;  4GP0 A;  3CA0 A;  2FO1 A;  3SNV A;  3AZW A;  4XFT A;  1FQ9 A;  3JRR A;  1DFC A;  3BAU A;  1IT0 A;  3O5W B;  2WRY A;  4AN6 A;  4ZKT B;  4LO7 C;  4ZFU B;  4P0L A;  1IRP A;  4G6J A;  4LO0 C;  4F34 A;  2D24 A;  4ZOT A;  4Z8S B;  4OEE A;  1G9C A;  2X2T A;  1BFG A;  3I29 B;  4USP A;  4KEK A;  5HPZ A;  2IWT B;  4QO3 A;  3ZX7 A;  5DZU A;  4I7I A;  1ABR B;  3VEQ A;  1D0H A;  4I1E A;  2NYY A;  4P6A A;  1G9A A;  3IM5 A;  5G00 A;  3F1R A;  3IM6 A;  1YYN A;  3FFZ A;  2L5X A;  4USO A;  2AFG A;  3KMV A;  4I0Y A;  3CU1 B;  4MZH A;  3IAG C;  2LIE A;  3HN1 A;  1TTU A;  1PUM B;  4I6I A;  3O3Q A;  2VSA A;  3NBD A;  4LO7 B;  2AQZ A;  2KI4 A;  4A7Z A;  1FV2 A;  3HSM A;  3HOM A;  3ZXG A;  4GAF A;  4HJJ A;  1BLD A;  2DS0 A;  1V6V A;  3Q7X A;  8I1B A;  5GAQ A;  5BOW A;  5FNW A;  3RMX A;  2Y9G A;  2QYI B;  1BAS A;  1PZZ A;  3AZV A;  1DJS B;  1TIE A;  1IIL A;  3HBW A;  4LO2 C;  1S0G A;  2GZB A;  4I4S A;  1YTO A;  1S0B A;  1RML A;  3AJ6 A;  3LLP A;  1E0O A;  3S8J A;  2HW9 A;  4OWK A;  1DZC A;  1M16 A;  1CE7 B;  1JT5 A;  4EB2 B;  1Z2V A;  3V0B B;  2KH2 A;  2ZR1 B;  3AH4 A;  4GOV A;  4X37 A;  1V6X A;  3R4S A;  4ZBV B;  1R8N A;  5BP5 C;  3CAH A;  3UD9 A;  2VSE A;  4PC4 A;  4QKR A;  4IQP A;  3VT1 A;  4LO3 C;  3NBC A;  1XG6 A;  3O4C A;  1CVS A;  4X38 A;  4QD2 C;  4END A;  3BX1 C;  5FZY A;  3RMY A;  3NJ5 A;  2DRZ A;  2D43 A;  4JKQ A;  5E24 E;  2VLC A;  1JQZ A;  1Q1U A;  1EVT A;  3JUT A;  2Q9X A;  3CRI A;  2YUG A;  2ERM A;  4G6M A;  4JAW A;  3BA5 A;  1N4K A;  1NUN A;  1HCD A;  1PWA A;  2DRY A;  1S0D A;  1SR4 C;  1IRA X;  2FFU A;  4QAL A;  1YF8 B;  4WBC A;  1G9B A;  4F83 A;  2VUA A;  2Y9W C;  3PG0 A;  2K8R A;  2WBC A;  3OGG A;  4J2Y A;  4Q9G A;  4ZLB B;  3I2X A;  1AVU A;  1EV2 A;  3FJF A;  1NZK A;  4LO1 A;  4OW4 A;  4GAI A;  1I1B A;  3WA1 A;  3H6R A;  1ISZ A;  4QD2 B;  1ISV A;  4KC3 A;  1XZZ A;  1FMM S;  5EG6 C;  4ZFY B;  1S0L A;  2D44 A;  2RQ9 A;  3N7L A;  5BQU A;  2MLL B;  4I3N A;  4JQ0 A;  4UY4 A;  4G9N A;  3V0A B;  3BAD A;  3WIN A;  1OQL B;  5D63 A;  1T4Q A;  1JY0 A;  1ITB A;  3K1X A;  3VUO A;  4P0K A;  3FGM A;  1YXW A;  3WO4 A;  2Z49 A;  5JMC A;  3FJ8 A;  4AN7 B;  4IYB A;  1WD3 A;  3AJ5 A;  3AKI A;  3FJH A;  3VSF A;  4CJM A;  5DVH A;  3UJ4 A;  4KBB A;  3FJA A;  3NBN A;  4ZA3 B;  4D8H A;  4X39 A;  1AXM A;  3R4U A;  4MZG B;  1RY7 A;  3EF2 A;  4ION A;  2K43 A;  3BA4 A;  3HAL A;  4XFS A;  2DRE A;  1AVX B;  1JT3 A;  3I2A A;  3PME A;  2E4M A;  2J3P A;  3ILA A;  4KEJ A;  3C9Z A;  2NP0 A;  4Q9P A;  4LO0 A;  4I4R A;  1W3A A;  2VXR A;  1W3F A;  2KI6 B;  1Z0H A;  3RTI B;  5B2H A;  1DIW A;  3N7K A;  1WBA A;  3P53 A;  4L4H A;  4TLP A;  3A23 A;  3CRH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...