1JTCA

Human acidic fibroblast growth factor. 141 amino acid form with amino terminal his tag and leu 44 replaced by phe (l44f)
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
141
structure length
141
Chain Sequence
HHHHFNLPPGNYKKPKLLYCSNGGHFLRILPDGTVDGTRDRSDQHIQFQLSAESVGEVYIKSTETGQYLAMDTDGLLYGSQTPNEECLFLERLEENHYNTYISKKHAEKNWFVGLKKNGSCKRGPRTHYGQKAILFLPLPV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords acidic fibroblast growth factor
publication title Structure and stability effects of mutations designed to increase the primary sequence symmetry within the core region of a beta-trefoil.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hormone/growth factor
total genus 36
structure length 141
sequence length 141
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2001-08-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00167 FGF Fibroblast growth factor
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.80.10.50 Mainly Beta Trefoil Trefoil (Acidic Fibroblast Growth Factor, subunit A) Trefoil (Acidic Fibroblast Growth Factor, subunit A) 1jtcA00
2ERMA 3HSMA 4I4PA 2KKIA 3FJIA 4EEEB 4F83A 4Q91A 3RSJA 3NJ5A 3ZX7A 3VUOA 1ISWA 2ESUA 3H6SE 3O3QA 4X37A 1FN0A 4I4YA 3OJMA 3D7WB 1JLYA 3PUBA 5FZUA 3FJJA 4TLPA 2FGFA 1PZZA 1T4QA 2AXMA 4J2SA 1FQ9A 1G9AA 3NBDA 5F90A 5FZZA 3FJKA 3BA4A 4USPA 1BA7A 3O4DA 4P0JA 1TP0A 4DEPA 4Z8SB 1FV2A 3AKGA 1HWNB 4QC4A 1M2TB 3NBCA 4QBVA 4JKQA 4WBCA 1G9CA 3FJAA 1CVSA 1NUNA 3AZWA 4I2SA 1Z4SA 4ISRA 1N4KA 2DREA 3UD9A 2QYIB 1S0DA 5EC5A 3EF2A 3ZXDA 4GP0A 1KNMA 2KI4A 3H6RB 3FJHA 4QALA 3ZXGA 4KC3A 5D62A 1AVUA 3CAHA 1FWUA 4ZGRB 1S0CA 1V6VA 3VT0A 2E4MC 1BLAA 3H6RA 3OBTA 3OGFA 5I1BA 1FMZA 4LO3A 4ZKTB 1S0FA 3AH4A 4QD2C 3IM6A 1HIBA 3FFZA 1R8OA 3BA7A 2X2TA 1BFFA 2Q3NB 5BP5C 2WBCA 3FGMA 2K43A 4LO8B 4Q9GA 5BXRA 1IOBA 3T8SA 4I37A 4I7IA 1IRAX 4H9WA 4USOA 2X2SA 4JPZA 1S0BA 1RY7A 9ILBA 4JAWA 3N7LA 4J2XA 3WMUA 2M49A 3RMXA 4EKXB 4P6AA 1F31A 3CA3A 3UD7A 1IRPA 3BA5A 4QO3A 2RQ9A 3RTIB 41BIA 1SR4C 4LO2A 3I2AA 3BAUA 1I1BA 4I4UA 1JY0A 4LO7B 2IWTB 4GOVA 5FZYA 5G00A 2NM1A 3UJ0A 2D43A 3JRRA 2AAIB 4QKSA 4ZFYB 4A7KA 4A7YA 4ZOTA 4HJJA 3N7MA 1JT3A 2D23A 4G9NA 4OEEA 4XFTA 2HZ9A 3BAHA 1G9DA 4KEJA 3E8LC 3V79C 4YOLA 1YXWA 4LO1A 4I4VA 1Q1UA 4I1BA 3VSZA 3A22A 4EFPA 4KEKA 3A23A 1ABRB 1BARA 5BXPA 3O4BA 3P53A 1L2HA 3O4CA 1QQLA 4ZBVB 2VXRA 2AFGA 3MPPG 1DQOA 3HMYA 3BRDA 4EFQA 3FJFA 3N0KA 4L4IA 2UUSA 4JKXB 1A8DA 3WINC 4I96A 3S8JA 2NVHA 2KLLA 1JT5A 4X38A 3Q7YA 1D0HA 2D44A 1DZDA 1G82A 3O49A 2VU9A 1YF8B 1XYFA 5D61A 4L4HA 4G6MA 1AVAC 3F62B 2R9KB 3AKFA 2D7RA 1RG8A 1OQLB 4AN6A 3WO2A 3FJ9A 3OJVA 2NP0A 4IONA 3CRGA 1BFGA 5B2HA 1ISXA 1E0OA 2BEAA 2MLLB 4PC4A 5DZUA 4QD2B 3PMEA 1DFCA 2F2FC 1HWMB 3BX1C 2Z48A 3O4AA 4P0LA 2RSTA 4H04A 2Y9GA 1HCDA 1PUUB 3CA4A 1Q03A 1RZOB 21BIA 2IHOA 1Q04A 3FUQA 3FJBA 1AFCA 5FNXA 4IQPA 2ZQOA 1HWPB 1ILR1 1PC8B 1G9BA 1FMMS 1JTCA 1TIEA 5BP5A 5JLVA 1AF9A 5BOWA 3QR5A 1SZ6B 2DRYA 5BQUC 4OWLA 3S8KA 1ISZA 4J23B 4QKRA 3BAOA 1WD4A 2GO2A 5F8YA 4X3AA 3HALA 4J2YA 4OEGA 2WRYA 4DENA 3CA0A 1DJSB 4Z9WB 1IILA 4I1EA 3OBRA 4IHZA 2K4AB 2NZ9A 4D0ZA 3FUOA 3H6QA 1WD3A 3SNVA 4OEFA 1WBAA 1SR4A 3CU1B 4I4SA 1K5UA 3JUTA 2ZR1B 2Y9FA 3PG0A 4G9MA 2GZBA 1II4A 3LLPA 5F8SA 4OWKA 4P0KA 3K1XA 2LIQA 2BFHA 3R4UA 1ITBA 3N7JA 3BTAA 1BFBA 3HN1A 5DVHA 2MIBA 1P63A 1YYNA 4X39A 4ZFUB 5HPZA 1W3FA 3C9ZA 4IY8A 1ISYA 3IAGC 1EV2A 3AZVA 3BAGA 1MC9A 2VUAA 3UD8A 1TOOA 1IT0A 1TFMB 3F1RA 1Z2VA 4GAFA 3R4SA 2ET2A 4I3NA 5JMCA 2D22A 1WBCA 1V6WA 4I4RA 4J2KA 1S0GA 4G6JA 4D8HA 4LO0C 2FO1A 1QXMA 1DFQA 1ISVA 1VCLA 2Q9XA 2RG9B 2D20A 4Q9PA 1HCEA 3FJDA 3HBWA 1I1EA 5DUYA 5D63A 1EPWA 2QN4A 3ZC9A 2D1ZA 1DLLA 1W3AA 4DCKC 3CRIA 2KH2A 2HWAA 3VWCA 4LO7C 3AH1A 4KBBA 1UPSA 2I1BA 2VLCA 3WO3A 2AQZA 3CQAA 1CE7B 4G1RA 4OUJA 1DIWA 3V0AB 3IM7A 1XHBA 5F8WA 4FGFA 4EB2B 2YUGA 3W9TA 4ENDA 3OJ2A 1K5VA 1RMLA 4JRAA 1J0SA 3MALA 3TC2A 3WA1A 3V0BB 1BLDA 3V0AA 2Z49A 4I0YA 2HW9A 1XZZA 4I4XA 3OGGA 4I8MA 1MD6A 3CA5A 3UJ4A 3CRHA 3KMVA 4ZFWB 1AXMA 5BXSA 3AJ6A 2Y9WC 3V0BA 3BB2A 4D0TA 3FJEA 4ZA3B 3PHZA 2F2FA 3I2XA 4IY9A 6I1BA 4I4OA 4HR6C 4IZXA 4HA2A 4CJMA 1ONKB 1JT4A 2E4MA 1BFCA 1HKNA 3FJ8A 3QYDA 4R6UB 8I1BA 3IM5A 3AJ5A 4GOYA 4F34A 1JQZA 2FFVA 1HWOB 3Q7WA 3VSFA 3P6IA 5BQUA 1EVTA 3O4OA 3NBNA 3IIRA 3AKIA 4AN7B 4GP3A 3RTJB 2KI6B 1JLXA 3BADA 1V6XA 1QQKA 2Y9XE 3VT1A 1TWMA 1FV3A 4IYBA 2MC2A 1W3GA 3FJCA 5BVPI 1JT7A 2P39A 4II0A 3RMYA 3BRFA 4FVVA 3VEQA 2VSEA 2NYYA 1DQGA 4GAIA 1NZKA 1IHKA 3BAQA 1PUMB 1XG6A 4QBCA 2FFUA 4ISQA 4LO3C 5DSSB 1S0EA 5EG6C 5EHAA 1TWEA 3P6JA 1EYLA 4I4QA 3A21A 4IZEA 2L5XA 2ZQNA 3O44A 1IJTA 4A7ZA 1FWVA 1DZCA 1TTUA 3Q7XA 1R8NA 1YBIA 2VSAA 2K8RA 3A07A 3BAVA 3I29B 1Z0HA 2LIEA 3POKA 2VXTI 3ZC8A 2HWMA 4XFUA 3WO4A 3B9UA 2DS0A 3VT2A 4XKIA 3AKHA 4XFSA 3AH2A 3CA1A 3NBEA 7I1BA 4I6IA 3WMVA 2DRZA 1YTOA 2FDBM 5FNWA 4LO0A 1AVWB 2D7IA 1M16A 3CA6A 4JQ0A 1FGAA 3N7KA 3BRGC 1S0LA 3ILAA 4LO2C 1BASA 1AVXB 3LTQA 4KEIA 3HOMA 1PWAA 3O5WB 2J3PA 5BXTA 4EFRA 1GGPB 2BEBA 1T9FA 31BIA 4ZLBB 2D24A 2NTDA 4JP0A 2XOAA 5GAQA 3UDAA 3WINA 2F8XC 2P23A 4OWJA 5E24E 1V6UA 4OW4A 4LO1C
chains in the Genus database with same CATH superfamily
2ERMA 3HSMA 4I4PA 2KKIA 3FJIA 4EEEB 4F83A 2NS2A 4Q91A 3RSJA 3NJ5A 3ZX7A 3VUOA 1ISWA 2ESUA 3H6SE 3O3QA 4X37A 1FN0A 4I4YA 3OJMA 3D7WB 1JLYA 3PUBA 5FZUA 3FJJA 4TLPA 2FGFA 1PZZA 1T4QA 2AXMA 4J2SA 1FQ9A 1G9AA 3NBDA 5F90A 5FZZA 3FJKA 3BA4A 4USPA 1BA7A 3O4DA 4P0JA 1TP0A 4DEPA 4Z8SB 1FV2A 3AKGA 1HWNB 4QC4A 1M2TB 3NBCA 4QBVA 4JKQA 4WBCA 1G9CA 3FJAA 1CVSA 1NUNA 3AZWA 4I2SA 1Z4SA 4ISRA 1N4KA 2DREA 3UD9A 2QYIB 1S0DA 5EC5A 3EF2A 3ZXDA 4GP0A 1KNMA 2KI4A 3H6RB 3FJHA 4QALA 3ZXGA 4KC3A 5D62A 1AVUA 3CAHA 1FWUA 4ZGRB 1S0CA 1V6VA 3VT0A 2E4MC 1BLAA 3H6RA 3OBTA 3OGFA 5I1BA 1FMZA 4LO3A 4ZKTB 1S0FA 3AH4A 4QD2C 3IM6A 1HIBA 3FFZA 1R8OA 3BA7A 2X2TA 1BFFA 2Q3NB 5BP5C 2WBCA 3FGMA 2K43A 4LO8B 4Q9GA 5BXRA 1IOBA 3T8SA 4I37A 4I7IA 1IRAX 4H9WA 4USOA 2X2SA 4JPZA 4MZHA 1S0BA 1RY7A 9ILBA 4JAWA 3N7LA 4J2XA 3WMUA 2M49A 3RMXA 4EKXB 4P6AA 1F31A 3CA3A 3UD7A 1IRPA 3BA5A 4QO3A 2RQ9A 3RTIB 41BIA 1SR4C 4LO2A 3I2AA 3BAUA 1I1BA 4I4UA 4MZGB 1JY0A 4LO7B 2IWTB 4GOVA 5FZYA 5G00A 2NM1A 3UJ0A 2D43A 3JRRA 2AAIB 4QKSA 4ZFYB 4A7KA 4A7YA 4ZOTA 4HJJA 3N7MA 1JT3A 2D23A 4G9NA 4OEEA 4XFTA 2HZ9A 3BAHA 1G9DA 4KEJA 3E8LC 3V79C 4YOLA 1YXWA 4LO1A 4I4VA 1Q1UA 4I1BA 3VSZA 3A22A 4EFPA 4KEKA 3A23A 1ABRB 1BARA 5BXPA 3O4BA 3P53A 1L2HA 3O4CA 1QQLA 4ZBVB 2VXRA 2AFGA 3MPPG 1DQOA 3HMYA 3BRDA 4EFQA 3FJFA 3N0KA 4L4IA 2UUSA 4JKXB 1A8DA 3WINC 4I96A 3S8JA 2NVHA 2KLLA 1JT5A 4X38A 3Q7YA 1D0HA 2D44A 1DZDA 1G82A 3O49A 2VU9A 1YF8B 1XYFA 5D61A 4L4HA 4G6MA 1AVAC 3F62B 2R9KB 3AKFA 2D7RA 1RG8A 1OQLB 4AN6A 3WO2A 3FJ9A 3OJVA 2NP0A 4IONA 3CRGA 1BFGA 5B2HA 1ISXA 1E0OA 2BEAA 2MLLB 4PC4A 5DZUA 4QD2B 3PMEA 1DFCA 2F2FC 1HWMB 3BX1C 2Z48A 3O4AA 4P0LA 2RSTA 4H04A 2Y9GA 1HCDA 1PUUB 3CA4A 1Q03A 1RZOB 21BIA 2IHOA 1Q04A 3FUQA 3FJBA 1AFCA 5FNXA 4IQPA 2ZQOA 1HWPB 1ILR1 1PC8B 1G9BA 1FMMS 1JTCA 1TIEA 5BP5A 5JLVA 1AF9A 5BOWA 3QR5A 1SZ6B 2DRYA 5BQUC 4OWLA 3S8KA 1ISZA 4J23B 4QKRA 3BAOA 1WD4A 2GO2A 5F8YA 4X3AA 3HALA 4J2YA 4OEGA 2WRYA 4DENA 3CA0A 1DJSB 4Z9WB 1IILA 4I1EA 3OBRA 4IHZA 2K4AB 2NZ9A 4D0ZA 3FUOA 3H6QA 1WD3A 3SNVA 4OEFA 1WBAA 1SR4A 3CU1B 4I4SA 1K5UA 3JUTA 2ZR1B 2Y9FA 3PG0A 4G9MA 2GZBA 1II4A 3LLPA 5F8SA 4OWKA 4P0KA 3K1XA 2LIQA 2BFHA 3R4UA 1ITBA 3N7JA 3BTAA 1BFBA 3HN1A 5DVHA 2MIBA 1P63A 1YYNA 4X39A 4ZFUB 5HPZA 1W3FA 3C9ZA 4IY8A 1ISYA 3IAGC 1EV2A 3AZVA 3BAGA 1MC9A 2VUAA 3UD8A 1TOOA 1IT0A 1TFMB 3F1RA 1Z2VA 4GAFA 3R4SA 2ET2A 4I3NA 5JMCA 2D22A 1WBCA 1V6WA 4I4RA 4J2KA 1S0GA 4G6JA 4D8HA 4LO0C 2FO1A 1QXMA 1DFQA 1ISVA 1VCLA 2Q9XA 2RG9B 2D20A 4Q9PA 1HCEA 3FJDA 3HBWA 1I1EA 5DUYA 5D63A 1EPWA 2QN4A 3ZC9A 2D1ZA 1DLLA 1W3AA 4DCKC 3CRIA 2KH2A 2HWAA 3VWCA 4LO7C 3AH1A 4KBBA 1UPSA 2I1BA 2VLCA 4H75A 3WO3A 2AQZA 3CQAA 1CE7B 4G1RA 4OUJA 1DIWA 3V0AB 3IM7A 1XHBA 5F8WA 4FGFA 4EB2B 2YUGA 3W9TA 4ENDA 3OJ2A 1K5VA 1RMLA 4JRAA 1J0SA 3MALA 3TC2A 3WA1A 3V0BB 1BLDA 3V0AA 2Z49A 4I0YA 2HW9A 1XZZA 4I4XA 3OGGA 4I8MA 1MD6A 3CA5A 3UJ4A 3CRHA 3KMVA 4ZFWB 1AXMA 5BXSA 3AJ6A 2Y9WC 3V0BA 3BB2A 4D0TA 3FJEA 4ZA3B 3PHZA 2F2FA 3I2XA 4IY9A 6I1BA 4I4OA 4HR6C 4IZXA 4HA2A 4CJMA 1ONKB 1JT4A 2E4MA 1BFCA 1HKNA 3FJ8A 3QYDA 4R6UB 8I1BA 3IM5A 3AJ5A 4GOYA 4F34A 1JQZA 2FFVA 1HWOB 3Q7WA 3VSFA 3P6IA 5BQUA 1EVTA 3O4OA 3NBNA 3IIRA 3AKIA 4AN7B 4GP3A 3RTJB 2KI6B 1JLXA 3BADA 1V6XA 1QQKA 2Y9XE 3VT1A 1TWMA 1FV3A 4IYBA 2MC2A 1W3GA 3FJCA 5BVPI 1JT7A 2P39A 4II0A 3RMYA 3BRFA 4FVVA 3VEQA 2VSEA 2NYYA 1DQGA 4GAIA 1NZKA 1IHKA 3BAQA 1PUMB 1XG6A 4QBCA 2FFUA 4ISQA 4LO3C 5DSSB 1S0EA 5EG6C 5EHAA 1TWEA 3P6JA 1EYLA 4I4QA 3A21A 4IZEA 2L5XA 2ZQNA 3O44A 1IJTA 4A7ZA 1FWVA 1DZCA 1TTUA 3Q7XA 1R8NA 1YBIA 2VSAA 2K8RA 3A07A 3BAVA 3I29B 1Z0HA 2LIEA 3POKA 2VXTI 3ZC8A 2HWMA 4XFUA 3WO4A 3B9UA 2DS0A 3VT2A 4XKIA 3AKHA 4XFSA 3AH2A 3CA1A 3NBEA 7I1BA 4I6IA 3WMVA 2DRZA 1YTOA 2FDBM 5FNWA 4MZFB 4LO0A 1AVWB 2D7IA 1M16A 3CA6A 4JQ0A 1FGAA 3N7KA 3BRGC 1S0LA 3ILAA 4LO2C 1BASA 1AVXB 3LTQA 4KEIA 3HOMA 1PWAA 3O5WB 2J3PA 5BXTA 4EFRA 1GGPB 2BEBA 1T9FA 31BIA 4ZLBB 2D24A 2NTDA 4JP0A 4UY4A 2XOAA 5GAQA 3UDAA 3WINA 2F8XC 2P23A 4OWJA 5E24E 1V6UA 4OW4A 4LO1C
chains in the Genus database with same CATH topology
2ERMA 3HSMA 4I4PA 2KKIA 3FJIA 4EEEB 4F83A 2NS2A 4Q91A 3RSJA 3NJ5A 3ZX7A 3VUOA 1ISWA 2ESUA 3H6SE 3O3QA 4X37A 1FN0A 4I4YA 3OJMA 3D7WB 1JLYA 3PUBA 5FZUA 3FJJA 4TLPA 2FGFA 1PZZA 1T4QA 2AXMA 4J2SA 1FQ9A 1G9AA 3NBDA 5F90A 5FZZA 3FJKA 3BA4A 4USPA 1BA7A 3O4DA 4P0JA 1TP0A 4DEPA 4Z8SB 1FV2A 3AKGA 1HWNB 4QC4A 1M2TB 3NBCA 4QBVA 4JKQA 4WBCA 1G9CA 3FJAA 1CVSA 1NUNA 3AZWA 4I2SA 1Z4SA 4ISRA 1N4KA 2DREA 3UD9A 2QYIB 1S0DA 5EC5A 3EF2A 3ZXDA 4GP0A 1KNMA 2KI4A 3H6RB 3FJHA 4QALA 3ZXGA 4KC3A 5D62A 1AVUA 3CAHA 1FWUA 4ZGRB 1S0CA 1V6VA 3VT0A 2E4MC 1BLAA 3H6RA 3OBTA 3OGFA 5I1BA 1FMZA 4LO3A 4ZKTB 1S0FA 3AH4A 4QD2C 3IM6A 1HIBA 3FFZA 1R8OA 3BA7A 2X2TA 1BFFA 2Q3NB 5BP5C 2WBCA 3FGMA 2K43A 4LO8B 4Q9GA 5BXRA 1IOBA 3T8SA 4I37A 4I7IA 1IRAX 4H9WA 4USOA 2X2SA 4JPZA 4MZHA 1S0BA 1RY7A 9ILBA 4JAWA 3N7LA 4J2XA 3WMUA 2M49A 3RMXA 4EKXB 4P6AA 1F31A 3CA3A 3UD7A 1IRPA 3BA5A 4QO3A 2RQ9A 3RTIB 41BIA 1SR4C 4LO2A 3I2AA 3BAUA 1I1BA 4I4UA 4MZGB 1JY0A 4LO7B 2IWTB 4GOVA 5FZYA 5G00A 2NM1A 3UJ0A 2D43A 3JRRA 2AAIB 4QKSA 4ZFYB 4A7KA 4A7YA 4ZOTA 4HJJA 3N7MA 1JT3A 2D23A 4G9NA 4OEEA 4XFTA 2HZ9A 3BAHA 1G9DA 4KEJA 3E8LC 3V79C 4YOLA 1YXWA 4LO1A 4I4VA 1Q1UA 4I1BA 3VSZA 3A22A 4EFPA 4KEKA 3A23A 1ABRB 1BARA 5BXPA 3O4BA 3P53A 1L2HA 3O4CA 1QQLA 4ZBVB 2VXRA 2AFGA 3MPPG 1DQOA 3HMYA 3BRDA 4EFQA 3FJFA 3N0KA 4L4IA 2UUSA 4JKXB 1A8DA 3WINC 4I96A 3S8JA 2NVHA 2KLLA 1JT5A 4X38A 3Q7YA 1D0HA 2D44A 1DZDA 1G82A 3O49A 2VU9A 1YF8B 1XYFA 5D61A 4L4HA 4G6MA 1AVAC 3F62B 2R9KB 3AKFA 2D7RA 1RG8A 1OQLB 4AN6A 3WO2A 3FJ9A 3OJVA 2NP0A 4IONA 3CRGA 1BFGA 5B2HA 1ISXA 1E0OA 2BEAA 2MLLB 4PC4A 5DZUA 4QD2B 3PMEA 1DFCA 2F2FC 1HWMB 3BX1C 2Z48A 3O4AA 4P0LA 2RSTA 4H04A 2Y9GA 1HCDA 1PUUB 3CA4A 1Q03A 1RZOB 21BIA 2IHOA 1Q04A 3FUQA 3FJBA 1AFCA 5FNXA 4IQPA 2ZQOA 1HWPB 1ILR1 1PC8B 1G9BA 1FMMS 1JTCA 1TIEA 5BP5A 5JLVA 1AF9A 5BOWA 3QR5A 1SZ6B 2DRYA 5BQUC 4OWLA 3S8KA 1ISZA 4J23B 4QKRA 3BAOA 1WD4A 2GO2A 5F8YA 4X3AA 3HALA 4J2YA 4OEGA 2WRYA 4DENA 3CA0A 1DJSB 4Z9WB 1IILA 4I1EA 3OBRA 4IHZA 2K4AB 2NZ9A 4D0ZA 3FUOA 3H6QA 1WD3A 3SNVA 4OEFA 1WBAA 1SR4A 3CU1B 4I4SA 1K5UA 3JUTA 2ZR1B 2Y9FA 3PG0A 4G9MA 2GZBA 1II4A 3LLPA 5F8SA 4OWKA 4P0KA 3K1XA 2LIQA 2BFHA 3R4UA 1ITBA 3N7JA 3BTAA 1BFBA 3HN1A 5DVHA 2MIBA 1P63A 1YYNA 4X39A 4ZFUB 5HPZA 1W3FA 3C9ZA 4IY8A 1ISYA 3IAGC 1EV2A 3AZVA 3BAGA 1MC9A 2VUAA 3UD8A 1TOOA 1IT0A 1TFMB 3F1RA 1Z2VA 4GAFA 3R4SA 2ET2A 4I3NA 5JMCA 2D22A 1WBCA 1V6WA 4I4RA 4J2KA 1S0GA 4G6JA 4D8HA 4LO0C 2FO1A 1QXMA 1DFQA 1ISVA 1VCLA 2Q9XA 2RG9B 2D20A 4Q9PA 1HCEA 3FJDA 3HBWA 1I1EA 5DUYA 5D63A 1EPWA 2QN4A 3ZC9A 2D1ZA 1DLLA 1W3AA 4DCKC 3CRIA 2KH2A 2HWAA 3VWCA 4LO7C 3AH1A 4KBBA 1UPSA 2I1BA 2VLCA 4H75A 3WO3A 2AQZA 3CQAA 1CE7B 4G1RA 4OUJA 1DIWA 3V0AB 3IM7A 1XHBA 5F8WA 4FGFA 4EB2B 2YUGA 3W9TA 4ENDA 3OJ2A 1K5VA 1RMLA 4JRAA 1J0SA 3MALA 3TC2A 3WA1A 3V0BB 1BLDA 3V0AA 2Z49A 4I0YA 2HW9A 1XZZA 4I4XA 3OGGA 4I8MA 1MD6A 3CA5A 3UJ4A 3CRHA 3KMVA 4ZFWB 1AXMA 5BXSA 3AJ6A 2Y9WC 3V0BA 3BB2A 4D0TA 3FJEA 4ZA3B 3PHZA 2F2FA 3I2XA 4IY9A 6I1BA 4I4OA 4HR6C 4IZXA 4HA2A 4CJMA 1ONKB 1JT4A 2E4MA 1BFCA 1HKNA 3FJ8A 3QYDA 4R6UB 8I1BA 3IM5A 3AJ5A 4GOYA 4F34A 1JQZA 2FFVA 1HWOB 3Q7WA 3VSFA 3P6IA 5BQUA 1EVTA 3O4OA 3NBNA 3IIRA 3AKIA 4AN7B 4GP3A 3RTJB 2KI6B 1JLXA 3BADA 1V6XA 1QQKA 2Y9XE 3VT1A 1TWMA 1FV3A 4IYBA 2MC2A 1W3GA 3FJCA 5BVPI 1JT7A 2P39A 4II0A 3RMYA 3BRFA 4FVVA 3VEQA 2VSEA 2NYYA 1DQGA 4GAIA 1NZKA 1IHKA 3BAQA 1PUMB 1XG6A 4QBCA 2FFUA 4ISQA 4LO3C 5DSSB 1S0EA 5EG6C 5EHAA 1TWEA 3P6JA 1EYLA 4I4QA 3A21A 4IZEA 2L5XA 2ZQNA 3O44A 1IJTA 4A7ZA 1FWVA 1DZCA 1TTUA 3Q7XA 1R8NA 1YBIA 2VSAA 2K8RA 3A07A 3BAVA 3I29B 1Z0HA 2LIEA 3POKA 2VXTI 3ZC8A 2HWMA 4XFUA 3WO4A 3B9UA 2DS0A 3VT2A 4XKIA 3AKHA 4XFSA 3AH2A 3CA1A 3NBEA 7I1BA 4I6IA 3WMVA 2DRZA 1YTOA 2FDBM 5FNWA 4MZFB 4LO0A 1AVWB 2D7IA 1M16A 3CA6A 4JQ0A 1FGAA 3N7KA 3BRGC 1S0LA 3ILAA 4LO2C 1BASA 1AVXB 3LTQA 4KEIA 3HOMA 1PWAA 3O5WB 2J3PA 5BXTA 4EFRA 1GGPB 2BEBA 1T9FA 31BIA 4ZLBB 2D24A 2NTDA 4JP0A 4UY4A 2XOAA 5GAQA 3UDAA 3WINA 2F8XC 2P23A 4OWJA 5E24E 1V6UA 4OW4A 4LO1C
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2ERM A;  3HSM A;  4I4P A;  2KKI A;  3FJI A;  4EEE B;  4F83 A;  4Q91 A;  3RSJ A;  3NJ5 A;  3ZX7 A;  3VUO A;  1ISW A;  2ESU A;  3H6S E;  3O3Q A;  4X37 A;  1FN0 A;  4I4Y A;  3OJM A;  3D7W B;  1JLY A;  3PUB A;  5FZU A;  3FJJ A;  4TLP A;  2FGF A;  1PZZ A;  1T4Q A;  2AXM A;  4J2S A;  1FQ9 A;  1G9A A;  3NBD A;  5F90 A;  5FZZ A;  3FJK A;  3BA4 A;  4USP A;  1BA7 A;  3O4D A;  4P0J A;  1TP0 A;  4DEP A;  4Z8S B;  1FV2 A;  3AKG A;  1HWN B;  4QC4 A;  1M2T B;  3NBC A;  4QBV A;  4JKQ A;  4WBC A;  1G9C A;  3FJA A;  1CVS A;  1NUN A;  3AZW A;  4I2S A;  1Z4S A;  4ISR A;  1N4K A;  2DRE A;  3UD9 A;  2QYI B;  1S0D A;  5EC5 A;  3EF2 A;  3ZXD A;  4GP0 A;  1KNM A;  2KI4 A;  3H6R B;  3FJH A;  4QAL A;  3ZXG A;  4KC3 A;  5D62 A;  1AVU A;  3CAH A;  1FWU A;  4ZGR B;  1S0C A;  1V6V A;  3VT0 A;  2E4M C;  1BLA A;  3H6R A;  3OBT A;  3OGF A;  5I1B A;  1FMZ A;  4LO3 A;  4ZKT B;  1S0F A;  3AH4 A;  4QD2 C;  3IM6 A;  1HIB A;  3FFZ A;  1R8O A;  3BA7 A;  2X2T A;  1BFF A;  2Q3N B;  5BP5 C;  2WBC A;  3FGM A;  2K43 A;  4LO8 B;  4Q9G A;  5BXR A;  1IOB A;  3T8S A;  4I37 A;  4I7I A;  1IRA X;  4H9W A;  4USO A;  2X2S A;  4JPZ A;  1S0B A;  1RY7 A;  9ILB A;  4JAW A;  3N7L A;  4J2X A;  3WMU A;  2M49 A;  3RMX A;  4EKX B;  4P6A A;  1F31 A;  3CA3 A;  3UD7 A;  1IRP A;  3BA5 A;  4QO3 A;  2RQ9 A;  3RTI B;  41BI A;  1SR4 C;  4LO2 A;  3I2A A;  3BAU A;  1I1B A;  4I4U A;  1JY0 A;  4LO7 B;  2IWT B;  4GOV A;  5FZY A;  5G00 A;  2NM1 A;  3UJ0 A;  2D43 A;  3JRR A;  2AAI B;  4QKS A;  4ZFY B;  4A7K A;  4A7Y A;  4ZOT A;  4HJJ A;  3N7M A;  1JT3 A;  2D23 A;  4G9N A;  4OEE A;  4XFT A;  2HZ9 A;  3BAH A;  1G9D A;  4KEJ A;  3E8L C;  3V79 C;  4YOL A;  1YXW A;  4LO1 A;  4I4V A;  1Q1U A;  4I1B A;  3VSZ A;  3A22 A;  4EFP A;  4KEK A;  3A23 A;  1ABR B;  1BAR A;  5BXP A;  3O4B A;  3P53 A;  1L2H A;  3O4C A;  1QQL A;  4ZBV B;  2VXR A;  2AFG A;  3MPP G;  1DQO A;  3HMY A;  3BRD A;  4EFQ A;  3FJF A;  3N0K A;  4L4I A;  2UUS A;  4JKX B;  1A8D A;  3WIN C;  4I96 A;  3S8J A;  2NVH A;  2KLL A;  1JT5 A;  4X38 A;  3Q7Y A;  1D0H A;  2D44 A;  1DZD A;  1G82 A;  3O49 A;  2VU9 A;  1YF8 B;  1XYF A;  5D61 A;  4L4H A;  4G6M A;  1AVA C;  3F62 B;  2R9K B;  3AKF A;  2D7R A;  1RG8 A;  1OQL B;  4AN6 A;  3WO2 A;  3FJ9 A;  3OJV A;  2NP0 A;  4ION A;  3CRG A;  1BFG A;  5B2H A;  1ISX A;  1E0O A;  2BEA A;  2MLL B;  4PC4 A;  5DZU A;  4QD2 B;  3PME A;  1DFC A;  2F2F C;  1HWM B;  3BX1 C;  2Z48 A;  3O4A A;  4P0L A;  2RST A;  4H04 A;  2Y9G A;  1HCD A;  1PUU B;  3CA4 A;  1Q03 A;  1RZO B;  21BI A;  2IHO A;  1Q04 A;  3FUQ A;  3FJB A;  1AFC A;  5FNX A;  4IQP A;  2ZQO A;  1HWP B;  1ILR 1;  1PC8 B;  1G9B A;  1FMM S;  1JTC A;  1TIE A;  5BP5 A;  5JLV A;  1AF9 A;  5BOW A;  3QR5 A;  1SZ6 B;  2DRY A;  5BQU C;  4OWL A;  3S8K A;  1ISZ A;  4J23 B;  4QKR A;  3BAO A;  1WD4 A;  2GO2 A;  5F8Y A;  4X3A A;  3HAL A;  4J2Y A;  4OEG A;  2WRY A;  4DEN A;  3CA0 A;  1DJS B;  4Z9W B;  1IIL A;  4I1E A;  3OBR A;  4IHZ A;  2K4A B;  2NZ9 A;  4D0Z A;  3FUO A;  3H6Q A;  1WD3 A;  3SNV A;  4OEF A;  1WBA A;  1SR4 A;  3CU1 B;  4I4S A;  1K5U A;  3JUT A;  2ZR1 B;  2Y9F A;  3PG0 A;  4G9M A;  2GZB A;  1II4 A;  3LLP A;  5F8S A;  4OWK A;  4P0K A;  3K1X A;  2LIQ A;  2BFH A;  3R4U A;  1ITB A;  3N7J A;  3BTA A;  1BFB A;  3HN1 A;  5DVH A;  2MIB A;  1P63 A;  1YYN A;  4X39 A;  4ZFU B;  5HPZ A;  1W3F A;  3C9Z A;  4IY8 A;  1ISY A;  3IAG C;  1EV2 A;  3AZV A;  3BAG A;  1MC9 A;  2VUA A;  3UD8 A;  1TOO A;  1IT0 A;  1TFM B;  3F1R A;  1Z2V A;  4GAF A;  3R4S A;  2ET2 A;  4I3N A;  5JMC A;  2D22 A;  1WBC A;  1V6W A;  4I4R A;  4J2K A;  1S0G A;  4G6J A;  4D8H A;  4LO0 C;  2FO1 A;  1QXM A;  1DFQ A;  1ISV A;  1VCL A;  2Q9X A;  2RG9 B;  2D20 A;  4Q9P A;  1HCE A;  3FJD A;  3HBW A;  1I1E A;  5DUY A;  5D63 A;  1EPW A;  2QN4 A;  3ZC9 A;  2D1Z A;  1DLL A;  1W3A A;  4DCK C;  3CRI A;  2KH2 A;  2HWA A;  3VWC A;  4LO7 C;  3AH1 A;  4KBB A;  1UPS A;  2I1B A;  2VLC A;  3WO3 A;  2AQZ A;  3CQA A;  1CE7 B;  4G1R A;  4OUJ A;  1DIW A;  3V0A B;  3IM7 A;  1XHB A;  5F8W A;  4FGF A;  4EB2 B;  2YUG A;  3W9T A;  4END A;  3OJ2 A;  1K5V A;  1RML A;  4JRA A;  1J0S A;  3MAL A;  3TC2 A;  3WA1 A;  3V0B B;  1BLD A;  3V0A A;  2Z49 A;  4I0Y A;  2HW9 A;  1XZZ A;  4I4X A;  3OGG A;  4I8M A;  1MD6 A;  3CA5 A;  3UJ4 A;  3CRH A;  3KMV A;  4ZFW B;  1AXM A;  5BXS A;  3AJ6 A;  2Y9W C;  3V0B A;  3BB2 A;  4D0T A;  3FJE A;  4ZA3 B;  3PHZ A;  2F2F A;  3I2X A;  4IY9 A;  6I1B A;  4I4O A;  4HR6 C;  4IZX A;  4HA2 A;  4CJM A;  1ONK B;  1JT4 A;  2E4M A;  1BFC A;  1HKN A;  3FJ8 A;  3QYD A;  4R6U B;  8I1B A;  3IM5 A;  3AJ5 A;  4GOY A;  4F34 A;  1JQZ A;  2FFV A;  1HWO B;  3Q7W A;  3VSF A;  3P6I A;  5BQU A;  1EVT A;  3O4O A;  3NBN A;  3IIR A;  3AKI A;  4AN7 B;  4GP3 A;  3RTJ B;  2KI6 B;  1JLX A;  3BAD A;  1V6X A;  1QQK A;  2Y9X E;  3VT1 A;  1TWM A;  1FV3 A;  4IYB A;  2MC2 A;  1W3G A;  3FJC A;  5BVP I;  1JT7 A;  2P39 A;  4II0 A;  3RMY A;  3BRF A;  4FVV A;  3VEQ A;  2VSE A;  2NYY A;  1DQG A;  4GAI A;  1NZK A;  1IHK A;  3BAQ A;  1PUM B;  1XG6 A;  4QBC A;  2FFU A;  4ISQ A;  4LO3 C;  5DSS B;  1S0E A;  5EG6 C;  5EHA A;  1TWE A;  3P6J A;  1EYL A;  4I4Q A;  3A21 A;  4IZE A;  2L5X A;  2ZQN A;  3O44 A;  1IJT A;  4A7Z A;  1FWV A;  1DZC A;  1TTU A;  3Q7X A;  1R8N A;  1YBI A;  2VSA A;  2K8R A;  3A07 A;  3BAV A;  3I29 B;  1Z0H A;  2LIE A;  3POK A;  2VXT I;  3ZC8 A;  2HWM A;  4XFU A;  3WO4 A;  3B9U A;  2DS0 A;  3VT2 A;  4XKI A;  3AKH A;  4XFS A;  3AH2 A;  3CA1 A;  3NBE A;  7I1B A;  4I6I A;  3WMV A;  2DRZ A;  1YTO A;  2FDB M;  5FNW A;  4LO0 A;  1AVW B;  2D7I A;  1M16 A;  3CA6 A;  4JQ0 A;  1FGA A;  3N7K A;  3BRG C;  1S0L A;  3ILA A;  4LO2 C;  1BAS A;  1AVX B;  3LTQ A;  4KEI A;  3HOM A;  1PWA A;  3O5W B;  2J3P A;  5BXT A;  4EFR A;  1GGP B;  2BEB A;  1T9F A;  31BI A;  4ZLB B;  2D24 A;  2NTD A;  4JP0 A;  2XOA A;  5GAQ A;  3UDA A;  3WIN A;  2F8X C;  2P23 A;  4OWJ A;  5E24 E;  1V6U A;  4OW4 A;  4LO1 C; 
#chains in the Genus database with same CATH topology
 2ERM A;  3HSM A;  4I4P A;  2KKI A;  3FJI A;  4EEE B;  4F83 A;  2NS2 A;  4Q91 A;  3RSJ A;  3NJ5 A;  3ZX7 A;  3VUO A;  1ISW A;  2ESU A;  3H6S E;  3O3Q A;  4X37 A;  1FN0 A;  4I4Y A;  3OJM A;  3D7W B;  1JLY A;  3PUB A;  5FZU A;  3FJJ A;  4TLP A;  2FGF A;  1PZZ A;  1T4Q A;  2AXM A;  4J2S A;  1FQ9 A;  1G9A A;  3NBD A;  5F90 A;  5FZZ A;  3FJK A;  3BA4 A;  4USP A;  1BA7 A;  3O4D A;  4P0J A;  1TP0 A;  4DEP A;  4Z8S B;  1FV2 A;  3AKG A;  1HWN B;  4QC4 A;  1M2T B;  3NBC A;  4QBV A;  4JKQ A;  4WBC A;  1G9C A;  3FJA A;  1CVS A;  1NUN A;  3AZW A;  4I2S A;  1Z4S A;  4ISR A;  1N4K A;  2DRE A;  3UD9 A;  2QYI B;  1S0D A;  5EC5 A;  3EF2 A;  3ZXD A;  4GP0 A;  1KNM A;  2KI4 A;  3H6R B;  3FJH A;  4QAL A;  3ZXG A;  4KC3 A;  5D62 A;  1AVU A;  3CAH A;  1FWU A;  4ZGR B;  1S0C A;  1V6V A;  3VT0 A;  2E4M C;  1BLA A;  3H6R A;  3OBT A;  3OGF A;  5I1B A;  1FMZ A;  4LO3 A;  4ZKT B;  1S0F A;  3AH4 A;  4QD2 C;  3IM6 A;  1HIB A;  3FFZ A;  1R8O A;  3BA7 A;  2X2T A;  1BFF A;  2Q3N B;  5BP5 C;  2WBC A;  3FGM A;  2K43 A;  4LO8 B;  4Q9G A;  5BXR A;  1IOB A;  3T8S A;  4I37 A;  4I7I A;  1IRA X;  4H9W A;  4USO A;  2X2S A;  4JPZ A;  4MZH A;  1S0B A;  1RY7 A;  9ILB A;  4JAW A;  3N7L A;  4J2X A;  3WMU A;  2M49 A;  3RMX A;  4EKX B;  4P6A A;  1F31 A;  3CA3 A;  3UD7 A;  1IRP A;  3BA5 A;  4QO3 A;  2RQ9 A;  3RTI B;  41BI A;  1SR4 C;  4LO2 A;  3I2A A;  3BAU A;  1I1B A;  4I4U A;  4MZG B;  1JY0 A;  4LO7 B;  2IWT B;  4GOV A;  5FZY A;  5G00 A;  2NM1 A;  3UJ0 A;  2D43 A;  3JRR A;  2AAI B;  4QKS A;  4ZFY B;  4A7K A;  4A7Y A;  4ZOT A;  4HJJ A;  3N7M A;  1JT3 A;  2D23 A;  4G9N A;  4OEE A;  4XFT A;  2HZ9 A;  3BAH A;  1G9D A;  4KEJ A;  3E8L C;  3V79 C;  4YOL A;  1YXW A;  4LO1 A;  4I4V A;  1Q1U A;  4I1B A;  3VSZ A;  3A22 A;  4EFP A;  4KEK A;  3A23 A;  1ABR B;  1BAR A;  5BXP A;  3O4B A;  3P53 A;  1L2H A;  3O4C A;  1QQL A;  4ZBV B;  2VXR A;  2AFG A;  3MPP G;  1DQO A;  3HMY A;  3BRD A;  4EFQ A;  3FJF A;  3N0K A;  4L4I A;  2UUS A;  4JKX B;  1A8D A;  3WIN C;  4I96 A;  3S8J A;  2NVH A;  2KLL A;  1JT5 A;  4X38 A;  3Q7Y A;  1D0H A;  2D44 A;  1DZD A;  1G82 A;  3O49 A;  2VU9 A;  1YF8 B;  1XYF A;  5D61 A;  4L4H A;  4G6M A;  1AVA C;  3F62 B;  2R9K B;  3AKF A;  2D7R A;  1RG8 A;  1OQL B;  4AN6 A;  3WO2 A;  3FJ9 A;  3OJV A;  2NP0 A;  4ION A;  3CRG A;  1BFG A;  5B2H A;  1ISX A;  1E0O A;  2BEA A;  2MLL B;  4PC4 A;  5DZU A;  4QD2 B;  3PME A;  1DFC A;  2F2F C;  1HWM B;  3BX1 C;  2Z48 A;  3O4A A;  4P0L A;  2RST A;  4H04 A;  2Y9G A;  1HCD A;  1PUU B;  3CA4 A;  1Q03 A;  1RZO B;  21BI A;  2IHO A;  1Q04 A;  3FUQ A;  3FJB A;  1AFC A;  5FNX A;  4IQP A;  2ZQO A;  1HWP B;  1ILR 1;  1PC8 B;  1G9B A;  1FMM S;  1JTC A;  1TIE A;  5BP5 A;  5JLV A;  1AF9 A;  5BOW A;  3QR5 A;  1SZ6 B;  2DRY A;  5BQU C;  4OWL A;  3S8K A;  1ISZ A;  4J23 B;  4QKR A;  3BAO A;  1WD4 A;  2GO2 A;  5F8Y A;  4X3A A;  3HAL A;  4J2Y A;  4OEG A;  2WRY A;  4DEN A;  3CA0 A;  1DJS B;  4Z9W B;  1IIL A;  4I1E A;  3OBR A;  4IHZ A;  2K4A B;  2NZ9 A;  4D0Z A;  3FUO A;  3H6Q A;  1WD3 A;  3SNV A;  4OEF A;  1WBA A;  1SR4 A;  3CU1 B;  4I4S A;  1K5U A;  3JUT A;  2ZR1 B;  2Y9F A;  3PG0 A;  4G9M A;  2GZB A;  1II4 A;  3LLP A;  5F8S A;  4OWK A;  4P0K A;  3K1X A;  2LIQ A;  2BFH A;  3R4U A;  1ITB A;  3N7J A;  3BTA A;  1BFB A;  3HN1 A;  5DVH A;  2MIB A;  1P63 A;  1YYN A;  4X39 A;  4ZFU B;  5HPZ A;  1W3F A;  3C9Z A;  4IY8 A;  1ISY A;  3IAG C;  1EV2 A;  3AZV A;  3BAG A;  1MC9 A;  2VUA A;  3UD8 A;  1TOO A;  1IT0 A;  1TFM B;  3F1R A;  1Z2V A;  4GAF A;  3R4S A;  2ET2 A;  4I3N A;  5JMC A;  2D22 A;  1WBC A;  1V6W A;  4I4R A;  4J2K A;  1S0G A;  4G6J A;  4D8H A;  4LO0 C;  2FO1 A;  1QXM A;  1DFQ A;  1ISV A;  1VCL A;  2Q9X A;  2RG9 B;  2D20 A;  4Q9P A;  1HCE A;  3FJD A;  3HBW A;  1I1E A;  5DUY A;  5D63 A;  1EPW A;  2QN4 A;  3ZC9 A;  2D1Z A;  1DLL A;  1W3A A;  4DCK C;  3CRI A;  2KH2 A;  2HWA A;  3VWC A;  4LO7 C;  3AH1 A;  4KBB A;  1UPS A;  2I1B A;  2VLC A;  4H75 A;  3WO3 A;  2AQZ A;  3CQA A;  1CE7 B;  4G1R A;  4OUJ A;  1DIW A;  3V0A B;  3IM7 A;  1XHB A;  5F8W A;  4FGF A;  4EB2 B;  2YUG A;  3W9T A;  4END A;  3OJ2 A;  1K5V A;  1RML A;  4JRA A;  1J0S A;  3MAL A;  3TC2 A;  3WA1 A;  3V0B B;  1BLD A;  3V0A A;  2Z49 A;  4I0Y A;  2HW9 A;  1XZZ A;  4I4X A;  3OGG A;  4I8M A;  1MD6 A;  3CA5 A;  3UJ4 A;  3CRH A;  3KMV A;  4ZFW B;  1AXM A;  5BXS A;  3AJ6 A;  2Y9W C;  3V0B A;  3BB2 A;  4D0T A;  3FJE A;  4ZA3 B;  3PHZ A;  2F2F A;  3I2X A;  4IY9 A;  6I1B A;  4I4O A;  4HR6 C;  4IZX A;  4HA2 A;  4CJM A;  1ONK B;  1JT4 A;  2E4M A;  1BFC A;  1HKN A;  3FJ8 A;  3QYD A;  4R6U B;  8I1B A;  3IM5 A;  3AJ5 A;  4GOY A;  4F34 A;  1JQZ A;  2FFV A;  1HWO B;  3Q7W A;  3VSF A;  3P6I A;  5BQU A;  1EVT A;  3O4O A;  3NBN A;  3IIR A;  3AKI A;  4AN7 B;  4GP3 A;  3RTJ B;  2KI6 B;  1JLX A;  3BAD A;  1V6X A;  1QQK A;  2Y9X E;  3VT1 A;  1TWM A;  1FV3 A;  4IYB A;  2MC2 A;  1W3G A;  3FJC A;  5BVP I;  1JT7 A;  2P39 A;  4II0 A;  3RMY A;  3BRF A;  4FVV A;  3VEQ A;  2VSE A;  2NYY A;  1DQG A;  4GAI A;  1NZK A;  1IHK A;  3BAQ A;  1PUM B;  1XG6 A;  4QBC A;  2FFU A;  4ISQ A;  4LO3 C;  5DSS B;  1S0E A;  5EG6 C;  5EHA A;  1TWE A;  3P6J A;  1EYL A;  4I4Q A;  3A21 A;  4IZE A;  2L5X A;  2ZQN A;  3O44 A;  1IJT A;  4A7Z A;  1FWV A;  1DZC A;  1TTU A;  3Q7X A;  1R8N A;  1YBI A;  2VSA A;  2K8R A;  3A07 A;  3BAV A;  3I29 B;  1Z0H A;  2LIE A;  3POK A;  2VXT I;  3ZC8 A;  2HWM A;  4XFU A;  3WO4 A;  3B9U A;  2DS0 A;  3VT2 A;  4XKI A;  3AKH A;  4XFS A;  3AH2 A;  3CA1 A;  3NBE A;  7I1B A;  4I6I A;  3WMV A;  2DRZ A;  1YTO A;  2FDB M;  5FNW A;  4MZF B;  4LO0 A;  1AVW B;  2D7I A;  1M16 A;  3CA6 A;  4JQ0 A;  1FGA A;  3N7K A;  3BRG C;  1S0L A;  3ILA A;  4LO2 C;  1BAS A;  1AVX B;  3LTQ A;  4KEI A;  3HOM A;  1PWA A;  3O5W B;  2J3P A;  5BXT A;  4EFR A;  1GGP B;  2BEB A;  1T9F A;  31BI A;  4ZLB B;  2D24 A;  2NTD A;  4JP0 A;  4UY4 A;  2XOA A;  5GAQ A;  3UDA A;  3WIN A;  2F8X C;  2P23 A;  4OWJ A;  5E24 E;  1V6U A;  4OW4 A;  4LO1 C; 
#chains in the Genus database with same CATH homology
 2ERM A;  3HSM A;  4I4P A;  2KKI A;  3FJI A;  4EEE B;  4F83 A;  2NS2 A;  4Q91 A;  3RSJ A;  3NJ5 A;  3ZX7 A;  3VUO A;  1ISW A;  2ESU A;  3H6S E;  3O3Q A;  4X37 A;  1FN0 A;  4I4Y A;  3OJM A;  3D7W B;  1JLY A;  3PUB A;  5FZU A;  3FJJ A;  4TLP A;  2FGF A;  1PZZ A;  1T4Q A;  2AXM A;  4J2S A;  1FQ9 A;  1G9A A;  3NBD A;  5F90 A;  5FZZ A;  3FJK A;  3BA4 A;  4USP A;  1BA7 A;  3O4D A;  4P0J A;  1TP0 A;  4DEP A;  4Z8S B;  1FV2 A;  3AKG A;  1HWN B;  4QC4 A;  1M2T B;  3NBC A;  4QBV A;  4JKQ A;  4WBC A;  1G9C A;  3FJA A;  1CVS A;  1NUN A;  3AZW A;  4I2S A;  1Z4S A;  4ISR A;  1N4K A;  2DRE A;  3UD9 A;  2QYI B;  1S0D A;  5EC5 A;  3EF2 A;  3ZXD A;  4GP0 A;  1KNM A;  2KI4 A;  3H6R B;  3FJH A;  4QAL A;  3ZXG A;  4KC3 A;  5D62 A;  1AVU A;  3CAH A;  1FWU A;  4ZGR B;  1S0C A;  1V6V A;  3VT0 A;  2E4M C;  1BLA A;  3H6R A;  3OBT A;  3OGF A;  5I1B A;  1FMZ A;  4LO3 A;  4ZKT B;  1S0F A;  3AH4 A;  4QD2 C;  3IM6 A;  1HIB A;  3FFZ A;  1R8O A;  3BA7 A;  2X2T A;  1BFF A;  2Q3N B;  5BP5 C;  2WBC A;  3FGM A;  2K43 A;  4LO8 B;  4Q9G A;  5BXR A;  1IOB A;  3T8S A;  4I37 A;  4I7I A;  1IRA X;  4H9W A;  4USO A;  2X2S A;  4JPZ A;  4MZH A;  1S0B A;  1RY7 A;  9ILB A;  4JAW A;  3N7L A;  4J2X A;  3WMU A;  2M49 A;  3RMX A;  4EKX B;  4P6A A;  1F31 A;  3CA3 A;  3UD7 A;  1IRP A;  3BA5 A;  4QO3 A;  2RQ9 A;  3RTI B;  41BI A;  1SR4 C;  4LO2 A;  3I2A A;  3BAU A;  1I1B A;  4I4U A;  4MZG B;  1JY0 A;  4LO7 B;  2IWT B;  4GOV A;  5FZY A;  5G00 A;  2NM1 A;  3UJ0 A;  2D43 A;  3JRR A;  2AAI B;  4QKS A;  4ZFY B;  4A7K A;  4A7Y A;  4ZOT A;  4HJJ A;  3N7M A;  1JT3 A;  2D23 A;  4G9N A;  4OEE A;  4XFT A;  2HZ9 A;  3BAH A;  1G9D A;  4KEJ A;  3E8L C;  3V79 C;  4YOL A;  1YXW A;  4LO1 A;  4I4V A;  1Q1U A;  4I1B A;  3VSZ A;  3A22 A;  4EFP A;  4KEK A;  3A23 A;  1ABR B;  1BAR A;  5BXP A;  3O4B A;  3P53 A;  1L2H A;  3O4C A;  1QQL A;  4ZBV B;  2VXR A;  2AFG A;  3MPP G;  1DQO A;  3HMY A;  3BRD A;  4EFQ A;  3FJF A;  3N0K A;  4L4I A;  2UUS A;  4JKX B;  1A8D A;  3WIN C;  4I96 A;  3S8J A;  2NVH A;  2KLL A;  1JT5 A;  4X38 A;  3Q7Y A;  1D0H A;  2D44 A;  1DZD A;  1G82 A;  3O49 A;  2VU9 A;  1YF8 B;  1XYF A;  5D61 A;  4L4H A;  4G6M A;  1AVA C;  3F62 B;  2R9K B;  3AKF A;  2D7R A;  1RG8 A;  1OQL B;  4AN6 A;  3WO2 A;  3FJ9 A;  3OJV A;  2NP0 A;  4ION A;  3CRG A;  1BFG A;  5B2H A;  1ISX A;  1E0O A;  2BEA A;  2MLL B;  4PC4 A;  5DZU A;  4QD2 B;  3PME A;  1DFC A;  2F2F C;  1HWM B;  3BX1 C;  2Z48 A;  3O4A A;  4P0L A;  2RST A;  4H04 A;  2Y9G A;  1HCD A;  1PUU B;  3CA4 A;  1Q03 A;  1RZO B;  21BI A;  2IHO A;  1Q04 A;  3FUQ A;  3FJB A;  1AFC A;  5FNX A;  4IQP A;  2ZQO A;  1HWP B;  1ILR 1;  1PC8 B;  1G9B A;  1FMM S;  1JTC A;  1TIE A;  5BP5 A;  5JLV A;  1AF9 A;  5BOW A;  3QR5 A;  1SZ6 B;  2DRY A;  5BQU C;  4OWL A;  3S8K A;  1ISZ A;  4J23 B;  4QKR A;  3BAO A;  1WD4 A;  2GO2 A;  5F8Y A;  4X3A A;  3HAL A;  4J2Y A;  4OEG A;  2WRY A;  4DEN A;  3CA0 A;  1DJS B;  4Z9W B;  1IIL A;  4I1E A;  3OBR A;  4IHZ A;  2K4A B;  2NZ9 A;  4D0Z A;  3FUO A;  3H6Q A;  1WD3 A;  3SNV A;  4OEF A;  1WBA A;  1SR4 A;  3CU1 B;  4I4S A;  1K5U A;  3JUT A;  2ZR1 B;  2Y9F A;  3PG0 A;  4G9M A;  2GZB A;  1II4 A;  3LLP A;  5F8S A;  4OWK A;  4P0K A;  3K1X A;  2LIQ A;  2BFH A;  3R4U A;  1ITB A;  3N7J A;  3BTA A;  1BFB A;  3HN1 A;  5DVH A;  2MIB A;  1P63 A;  1YYN A;  4X39 A;  4ZFU B;  5HPZ A;  1W3F A;  3C9Z A;  4IY8 A;  1ISY A;  3IAG C;  1EV2 A;  3AZV A;  3BAG A;  1MC9 A;  2VUA A;  3UD8 A;  1TOO A;  1IT0 A;  1TFM B;  3F1R A;  1Z2V A;  4GAF A;  3R4S A;  2ET2 A;  4I3N A;  5JMC A;  2D22 A;  1WBC A;  1V6W A;  4I4R A;  4J2K A;  1S0G A;  4G6J A;  4D8H A;  4LO0 C;  2FO1 A;  1QXM A;  1DFQ A;  1ISV A;  1VCL A;  2Q9X A;  2RG9 B;  2D20 A;  4Q9P A;  1HCE A;  3FJD A;  3HBW A;  1I1E A;  5DUY A;  5D63 A;  1EPW A;  2QN4 A;  3ZC9 A;  2D1Z A;  1DLL A;  1W3A A;  4DCK C;  3CRI A;  2KH2 A;  2HWA A;  3VWC A;  4LO7 C;  3AH1 A;  4KBB A;  1UPS A;  2I1B A;  2VLC A;  4H75 A;  3WO3 A;  2AQZ A;  3CQA A;  1CE7 B;  4G1R A;  4OUJ A;  1DIW A;  3V0A B;  3IM7 A;  1XHB A;  5F8W A;  4FGF A;  4EB2 B;  2YUG A;  3W9T A;  4END A;  3OJ2 A;  1K5V A;  1RML A;  4JRA A;  1J0S A;  3MAL A;  3TC2 A;  3WA1 A;  3V0B B;  1BLD A;  3V0A A;  2Z49 A;  4I0Y A;  2HW9 A;  1XZZ A;  4I4X A;  3OGG A;  4I8M A;  1MD6 A;  3CA5 A;  3UJ4 A;  3CRH A;  3KMV A;  4ZFW B;  1AXM A;  5BXS A;  3AJ6 A;  2Y9W C;  3V0B A;  3BB2 A;  4D0T A;  3FJE A;  4ZA3 B;  3PHZ A;  2F2F A;  3I2X A;  4IY9 A;  6I1B A;  4I4O A;  4HR6 C;  4IZX A;  4HA2 A;  4CJM A;  1ONK B;  1JT4 A;  2E4M A;  1BFC A;  1HKN A;  3FJ8 A;  3QYD A;  4R6U B;  8I1B A;  3IM5 A;  3AJ5 A;  4GOY A;  4F34 A;  1JQZ A;  2FFV A;  1HWO B;  3Q7W A;  3VSF A;  3P6I A;  5BQU A;  1EVT A;  3O4O A;  3NBN A;  3IIR A;  3AKI A;  4AN7 B;  4GP3 A;  3RTJ B;  2KI6 B;  1JLX A;  3BAD A;  1V6X A;  1QQK A;  2Y9X E;  3VT1 A;  1TWM A;  1FV3 A;  4IYB A;  2MC2 A;  1W3G A;  3FJC A;  5BVP I;  1JT7 A;  2P39 A;  4II0 A;  3RMY A;  3BRF A;  4FVV A;  3VEQ A;  2VSE A;  2NYY A;  1DQG A;  4GAI A;  1NZK A;  1IHK A;  3BAQ A;  1PUM B;  1XG6 A;  4QBC A;  2FFU A;  4ISQ A;  4LO3 C;  5DSS B;  1S0E A;  5EG6 C;  5EHA A;  1TWE A;  3P6J A;  1EYL A;  4I4Q A;  3A21 A;  4IZE A;  2L5X A;  2ZQN A;  3O44 A;  1IJT A;  4A7Z A;  1FWV A;  1DZC A;  1TTU A;  3Q7X A;  1R8N A;  1YBI A;  2VSA A;  2K8R A;  3A07 A;  3BAV A;  3I29 B;  1Z0H A;  2LIE A;  3POK A;  2VXT I;  3ZC8 A;  2HWM A;  4XFU A;  3WO4 A;  3B9U A;  2DS0 A;  3VT2 A;  4XKI A;  3AKH A;  4XFS A;  3AH2 A;  3CA1 A;  3NBE A;  7I1B A;  4I6I A;  3WMV A;  2DRZ A;  1YTO A;  2FDB M;  5FNW A;  4MZF B;  4LO0 A;  1AVW B;  2D7I A;  1M16 A;  3CA6 A;  4JQ0 A;  1FGA A;  3N7K A;  3BRG C;  1S0L A;  3ILA A;  4LO2 C;  1BAS A;  1AVX B;  3LTQ A;  4KEI A;  3HOM A;  1PWA A;  3O5W B;  2J3P A;  5BXT A;  4EFR A;  1GGP B;  2BEB A;  1T9F A;  31BI A;  4ZLB B;  2D24 A;  2NTD A;  4JP0 A;  4UY4 A;  2XOA A;  5GAQ A;  3UDA A;  3WIN A;  2F8X C;  2P23 A;  4OWJ A;  5E24 E;  1V6U A;  4OW4 A;  4LO1 C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...