1JTEA

Crystal structure analysis of vp39 f180w mutant
Total Genus 104
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
104
sequence length
297
structure length
291
Chain Sequence
MDVVSLDKPFMYFEEIDNELDYEPESANEVAKKLPYQGQLKLLLGELFFLSKLQRHGILDGATVVYIGSAPGTHIRYLRDHFYNLGVIIKWMLIDGRHHDPILNGLRDVTLVTRFVDEEYLRSIKKQLHPSKIILISDVRSPSTADLLSNYALQNVMISILNPVASSLKWRCPWPDQWIKDFYIPHGNKMLQPFAPSYSAEMRLLSIYTGENMRLTRVTKSDAVNYEKKMYYLNKIVRNKVVVNFDYPNQEYDYFHMYFMLRTVYCNKTFPTTKAKVLFLQQSIFRFLNIP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The "cap-binding slot" of an mRNA cap-binding protein: quantitative effects of aromatic side chain choice in the double-stacking sandwich with cap.
pubmed doi rcsb
source organism Vaccinia virus
molecule tags Transferase
molecule keywords VP39
total genus 104
structure length 291
sequence length 297
ec nomenclature ec 2.1.1.57: Methyltransferase cap1.
pdb deposition date 2001-08-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01358 PARP_regulatory Poly A polymerase regulatory subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 1jteA00
4BY9E 5DTQA 5C1IA 3ER8A 3KQOA 5C9ZA 1NW8A 5HZMA 2AN4A 5T64A 4GC9A 2ZBPA 3P9KA 3BGDA 3SR4A 2AOUB 3LDGA 2FPOA 3OPNA 2AOUA 2WK1A 3JWJA 5GM2A 4U7PB 3PLAE 3MQ2A 2CKDA 4LWPA 4YUXA 4PGHA 3GCZA 3B5IA 3MTEA 2HV9A 5CM2Z 1BKYA 2FK8A 2PX4A 1DUSA 4DA4A 4PYKA 3LCVB 5K03A 5LQRA 4FSDA 3KQYA 3UJ9A 2AOWA 3F4KA 4MTLA 5K0NA 3HTXA 1M6YA 5LQAA 3DP7A 1EIZA 4R8RA 1B42A 5HIJA 3UJ7A 4EK9A 1JTFA 3SX0A 3L8DA 3B3GA 4RTRA 1L3IA 3O4FA 4RVHA 1FP2A 3M6XA 1R74A 1VIDA 3GXOA 1QANA 5K05A 2ONZA 3A27A 2IBSA 2R6ZA 3G8AA 4OQEA 5CVEA 4AZSA 1MHTA 4HC4A 4X61A 1WZNA 2ZZNA 4GOLD 3FUWA 4U7TB 5CUQA 4POOA 5CCXA 3P2IA 4YUVA 4CWAA 3A7EA 4P7KA 3QOWA 2HWKA 1DCTA 3R9XB 2PY6A 4AX8A 1QAMA 1SQFA 2ZWVA 3KPVA 2NP6A 2ZZKA 5FWDA 3BXOA 1H1DA 5FTWA 2VDWA 1QZZA 4WXHA 3NJRA 3SM3A 1KR5A 3AWIA 1M6EX 1ORHA 3REOA 3KHKA 2H11A 3VSEA 5LQKA 4MWZA 2ADMA 1VP9A 3FUUA 4M36A 3P9IA 5FA5A 2GAFA 5HOQA 4PNEA 1HNNA 4RVDA 1UIRA 4FR0A 2UYQA 2AZTA 2V74B 3DXYA 2BM8A 3BGIA 1L9KA 1VPTA 5DTMA 2ZW9A 2OB2A 5JUWA 4RVGA 1JG1A 1NV9A 5DX8A 5HIKA 3BKWA 4C05A 2AN5A 2OKCA 5EMLA 5K09A 1IXKA 3GNLA 3LCCA 2XVMA 3HCDA 5DT2A 5K0CA 2C7QA 2ZIEA 4UOEA 5K0FA 3IV6A 3PFGA 4B17A 1BHJA 3MB5A 3T7TA 3EGVA 5BXYA 4YMHA 3THSA 2ZZMA 3LHDA 3GRVA 3B3JA 3VC2A 3GU3A 3M70A 3OU6A 4KWCA 3LBYA 5T6BA 3GRUA 2JHPA 3EVDA 1JQDA 3I58A 3ORHA 4GUAA 1IY9A 1UFKA 2P40A 3JWIA 2OO3A 4C03A 3NDJA 1F38A 3MCZA 4XUDA 5EZSA 2QRVB 1XDUA 1ZG3A 5DM2A 1UWVA 3HA5A 5E8RA 3PB3A 3T7SA 1RI2A 1EQAA 3UJBA 4PWYA 4EKGA 3TLJA 8MHTA 4RWZA 1SVUA 2Q41A 3HCAA 2O05A 3VC1A 1NT2A 5EC8A 2PJDA 1KPHA 4FZVA 5DLYA 5DSTA 2VS1A 2BM9A 3FTEA 4GBED 3M6WA 4Z2YA 5K01A 1XJ5A 5K0JA 2ZBRA 3E7PA 3EMDA 1I9GA 3P2EA 3NW9A 3MGGA 4KW7A 5ERGB 5FHQA 2ZIFA 2PXXA 1X1AA 4E2WA 5LR6A 2WA1A 3UJ8A 4EKIA 2ONYA 4BLUA 4XUEA 4KDCA 4QQKA 4RV9A 2G72A 3BZBA 2O06A 2ZIGA 4G56A 1N2XA 5HIMA 2OY0A 3C6MA 3I9FA 4FT4A 3P9NA 5LQUA 5KQRA 3JWGA 3DUWA 5E1OA 5U4XA 4P7FA 3A26A 2OZVA 3KR9A 3BUSA 1TW2A 2IPXA 4YV0A 3NDIA 2H00A 3BWBA 3EVCA 1AF7A 4E2XA 5EMMA 2QYOA 3OFKA 5K0EA 4RTNA 1XDZA 3FUTA 1ORIA 3KR2A 4R6XA 3D2LA 2P1DA 5E2BA 2QY6A 5GINE 4E2YA 2EJTA 4HGZA 3CBGA 3G7UA 1AQJA 3EGIA 3KPWA 3UJDA 2HNKA 3KQVA 5ICGA 3KPJA 5KYGA 5DXJA 3AXSA 3V8VA 3HP7A 1VE3A 4GF5A 1WY7A 4PYIA 5DX0A 3DMHA 5FQOA 1JQEA 3G5LA 3KQSA 5FCDA 2CMHA 1KPGA 4CKBA 5GM1A 4E32A 1G38A 3Q87B 4RTSA 3DXZA 5DRYA 3HM2A 3FPGA 1KPIA 2AVNA 4EQZA 4RTKA 1QYRA 2FCAA 4PYOA 2GPYA 2YXLA 4QVKA 2AS0A 1KXZA 3CJRA 3EGEA 3T0IA 4CKCA 3FYDA 1RJGA 4LG1A 2AOXA 3UJAA 2PXAA 3HVIA 1RJFA 3P9CA 3TPZA 4OA5A 3FRHA 5P8WA 4C06A 2P7HA 3M4XA 3UZUA 5LQJA 2ORED 2ZFUA 3LKZA 4GEKA 3LKDA 1G8AA 5BW4A 4PCLA 2VDVE 4X1OA 5FA8A 3ER9A 1RI3A 3KQMA 2Z6QA 3CC8A 4HTFB 4ISCA 5HEKA 4M37A 4GQBA 3HCFA 2OPBA 1MJFA 2FYTA 4NECA 3GWZA 4PONA 5DM4A 5EPEA 5FULA 4DQ0A 5EMKA 3B89A 4K6MA 2G70A 3O31A 2CWWA 3OZSA 5ICFA 2IIPA 4YUZA 5DTRA 7MHTA 4GC5A 4MIKA 4M38A 2I9KA 1DL5A 1Q0TA 3SSMA 3TOSA 5E2AA 1IM8A 3KQWA 3E23A 4C4AA 3DLIA 1D2HA 2DPMA 1P39A 4RTPA 4R6WA 3PFHA 1P1BA 2UZ4A 2HMYB 5GWXA 3ELWA 3HVKA 1YB2A 3S68A 4QVGA 3DOUA 3HCBA 3NWBA 1D2GA 1KHHA 3LSTA 3KR1A 2OB1A 3EVZA 2C7OA 3MHTA 4RTJA 2YX1A 2XYRA 1X19A 2F8LA 3B3FA 3K6RA 4YUYA 4F85A 2ZVJA 4QTTB 1R8YA 1XDSA 5DPMA 4L7VA 1U2ZA 4QDKA 4BP1A 3MAGA 1R8XA 2XYVA 2GH1A 4PINA 3UWPA 3FUXA 4PYMA 3UA4A 5MHTA 1V39A 4O29A 2EJUA 2ESRA 3FTCA 1ZKDA 1XCJA 1SG9A 2WA2A 5KVAA 5E8JA 1ZHFA 3SGLA 1VP3A 2YXDA 1RJDA 3TMAA 1TPYA 2UYHA 3R0QA 1G60A 2JH8A 5CVUA 4DKJA 5E9WA 5GP1A 2PV0A 1FBNA 2G1PA 5EZQA 3LBFA 3H2BA 1RI4A 5CCBA 3IYLW 2OYRA 1P91A 1SUIA 3QV2A 3PTAA 2PBFA 4HH4A 5F2OA 1JTEA 3R24A 2GB4A 1M0EA 3EEYA 2PX8A 3FPHA 3I53A 4LECA 3KPUA 4X63A 2JHAA 3HVHA 1OR8A 4FGZA 5GOZA 5IKMA 4OA8A 3JWHA 5LQNA 5FHRA 4CTKA 1EJ6A 1EG2A 1EJ0A 2JG3A 2I7CA 2PWPA 3DXXA 1JG2A 3EVAA 2O0LA 3G2PA 2OBFA 4PYQA 5BW5A 4QDJA 2HR1A 1JQ3A 3PX3A 2R3SA 4X60A 5DM0A 2PVCA 4PYLA 1L3CA 2QE6A 2H1RA 3R3HA 4R05A 5EIFA 4E2ZA 4A6DA 3A25A 4E33A 5ICEA 4HG2A 2FHPA 4PYJA 2Z6AA 3SSNA 4BLVA 3AY0A 2CL5A 4MHTA 1NW6A 1NW7A 1TW3A 5K0BA 2NXEA 5KS2A 2ZULA 2UYOA 3ID6C 3OZRA 4IKPA 2IP2A 3TM4A 1YZHA 3TM5A 4QQNA 3TR6A 4C07A 2V7EA 4YV2A 5D1HA 3X0DA 2LD4A 2B2CA 2PXCA 2IFTA 3KQQA 2FRXA 1P1CA 4JXJA 5EOVA 2B3TA 3DULA 4F86A 4OX9Y 1SKMA 1XCLA 5EG5A 3CCFA 1KYZA 2EFJA 3NVMB 3CKKA 2O57A 3HA3A 3LGAA 4FSXA 4EMSA 3M6UA 3TFWA 1YFJA 3RW9A 2BR5A 1BOOA 2YQZA 3LPMA 2YTZA 5EMJA 5FUBA 5LQCA 3CGGA 3IHTA 3DMFA 3G2QA 4P58A 1L3BA 2E5WA 4QTUB 3RIEA 3THRA 3RODA 1AV6A 2AR0A 3OE5A 5EEGA 1WG8A 2G71A 1FJXA 4MQ4A 1NKVA 3BWCA 1VL5A 1X1CA 3EVBA 2EG5A 1N7IA 3LX6A 3Q7EA 3PVCA 5K8VA 2AOTA 3NMUF 3NTVA 1G55A 3LL7A 1NW5A 4EVIA 2JH9A 4KIGA 2HTEA 1JSZA 3ERCA 3UBTA 1NE2A 1KYWA 2GA9A 2NNWB 4QPPA 1X1BA 1I1NA 2PX2A 3FYCA 3UJ6A 4F84A 2XVAA 3SMQA 3E05A 1VBFA 4HGYA 4HRAA 3P8ZA 1O9HA 1RJEA 3FPEA 4V0RA 4RVFA 1I4WA 1SUSA 1ZGJA 2NXNA 3SVZA 2IBTA 2A14A 5F2KA 3BGVA 5DRTA 2VDUE 2ZSUA 5HIIA 5K0LA 3UA3A 5ICCA 1YF3A 4Y2HA 2Y1WA 3OFJA 5DM1A 3LDFA 3C0KA 5BP7A 1XXLA 4OBWA 3CVOA 3HNRA 1FP1D 1VQ1A 2G8NA 2XYQA 3OU2A 4LWOA 4CXMA 2IH4A 2UYCA 3EVFA 4ZTBA 4RTMA 1R18A 3LCUA 4YV1A 2IDKA 2ZLBA 5CVVA 1F3LA 1O9GA 3DLCA 3U81A 3EPPA 3R6TA 2PLWA 2OXTA 3TQSA 2ERCA 3HCEA 5KQSA 5D1NA 3B7PA 3C3PA 5DXAA 4YMGA 4PIPA 3FRIA 2PT6A 1D2CA 3PX2A 3M6VA 5E1MA 2VP3A 1HMYA 3GRYA 3KQPA 1X1DA 3KR0A 1Z3CA 4Y30A 2B78A 5DSXA 2BR3A 3G2MA 2BH2A 5CD1A 1RI5A 3KPYA 3LDUA 5GIOE 1FPQA 4KVZA 4H0NA 3OCJA 3FPFA 3ELYA 3IEIA 3MTIA 1JG3A 3KU1A 3O7WA 4P7JA 4PCAA 5K0GA 4OBXA 2P41A 4E70A 3TRKA 3CJTA 5LSAA 3EEOA 1R6AA 1O54A 3DR5A 4RSRA 5EVJA 4ER0A 3ANXA 4CKEA 4KIFA 5H02A 4XUCA 1PJZA 1BC5A 4IV0A 2CMGA 3T7RA 2AN3A 5DX1A 3VYWA 2QM3A 2FK7A 5T67A 4FP9A 5GIPE 5CVDA 1G6Q1 1QAOA 3CJQA 3OZTA 3MERA 2AVDA 4DM3A 2NYUA 1JSXA 1YZ3A 5HILA 4AUKA 3QOXA 2P35A 3ELDA 4C08A 4XCXA 2C7PA 3K0BA 3PS9A 4KDRA 1NW3A 2I62A 3EVEA 4R8SA 4FT2A 1QAQA 3P97A 5G02A 3AJDA 3C3YA 1JR4A 2IH5A 3G8BA 3FTFA 5FADA 4PYNA 4RTLA 2PT9A 2ZWAA 3GIWA 9MHTA 1SQGA 3ELUA 4PGGA 5C0OE 2P3LA 2QRVA 4GOMD 1INLA 4AZVA 1T43A 1G8SA 1XTPA 2GS9A 4PIMA 2P3QA 3V97A 3NVKI 4DCGA 5EQJB 2BR4A 4IV8A 1NV8A 3GDHA 5FWAA 3FZGA 1EAMA 2NXJA 4KRGA 4ER6A 4ER7A 5F2NA 4ER3A 2GLUA 4AZTA 3EMBA 2PX5A 2Y1XA 3SXJA 1ZQ9A 4DZRA 3GRRA 3GRZA 3M33A 2Z6UA 2P7IA 2P8JA 4FS8A 2BZGA 3FTDA 2AOVA 4A6EA 2YUIA 4IWNA 4RX1A 4QPNA 2XBMA 1KIAA 5HFJA 2K4MA 3G2OA 3P2KA 4ATNA 2NP7A 2EX4A 1WXWA 3GJYA 4OQDA 2B9EA 1NBHA 3BWMA 2AOTB 4RYLA 5EIWA 5FQNA 4DCMA 3HA7A 1VLMA 4HTFA 2I6GA 1PRYA 3C6KA 3EVGA 3WSTA 2JJQA 3GO4A 10MHA 5CVJA 5EKUA 4DF3A 3FPJA 2PSSA 4E30A 2C7RA 2YXEA 4M7RA 1ZGAA 5DWQA 3HVJA 1AQIA 3UJCA 3A4TA 2PWYA 4GOND 1KP9A 5E9QA 3SSOA 4BLWA 3DMGA 3UFBA 4V0QA 5EGSA 3A7DA 3DTNA 4ER5A 3TKYA 5CIYA 1YFLA 3I64A 2IGTA 5E1BA 3TKAA 3G5TA 2PGXA 3NWEA 3OE4A 2JHCA 2B25A 3BWYA 3MCTA 2YVLA 3E8SA 2YR0A 3G89A 5B1SA 5IH3A 3BKXA 2DULA 2O07A 4RTQA 2ZCJA 3HEMA 4P7GA 1RI1A 3G88A 5E9JA 3HCCA 3GGDA 5JR3A 2NXCA 3DH0A 5EEHA 5EKXA 1Y8CA 4CTJA 3P71T 3ME5A 3KKZA 4YUWA 4E31A 2ZBQA 4RTOA 3FUVA 5EHGA 2KW5A 4WVLA 4BP3A 2PKWA 4X41A 4C04A 3OU7A 1Q0SA 3LECA 4AZWA 5M5BA 1L1EA 3BT7A 1N7JA 2VZ9A 1WS6A 4HSGA 1WXXA 5E1DA 1NBIA 2IDJA 2ZTHA 4GOOD 3KQTA 3PT9A 1R00A 1JG4A 1XVAA 2N47A 3AXTA 5EHIA 4DMGA 2IH2A 2P3OA 3I5UA 1YUBA
chains in the Genus database with same CATH superfamily
4BY9E 1PAUA 5L3ZA 1H22A 4BXOB 1O7JA 2R7MA 4LHSA 2OZLB 1F3OA 1RC0A 4Q9AA 1V43A 1ODSA 3JQ6A 5KEIA 3H3XA 4RDIA 3HADA 5AUQA 4YY3B 2XODA 3F1KA 2MT9A 1JLLB 3KXLA 3KV1A 2HRBA 3OPNA 3F8SA 2Q5CA 3PYLA 4E7PA 5A4MS 3COVA 4A0SA 3TAUA 2CZCA 2JBAA 1FS5A 5BR4A 5ALQA 3OM0A 1GYRA 1FEZA 7YASA 4DA4A 2JGDA 3KQLA 3GLGB 3HBFA 2HSJA 2PQ0A 1W87A 2WJ3A 3D8HA 3A6DA 4C43A 1EK0A 5LU9A 2AOWA 1UMDA 3UBMA 1AGYA 1Q7CA 1KY4A 4ENQA 4D3ZA 4Z4EA 1B42A 1E1QA 1NKTA 4Q48A 1TADA 1Z4QA 1KVQA 4HI0E 4TUYF 1JPVA 1YOVB 1P74A 2EQBA 3R6GA 5D5PA 2DUNA 2IF2A 3WIOA 4S3MA 2ATCA 2OK7A 2PFSA 4PC3A 1PR2A 1ZMXA 4AQYB 1K7YA 4RV5A 3EE6A 2IHBA 3PBKA 4CCSA 1DTWA 1JMYA 3DYBA 5HP4A 4PLHA 1OSNA 2P77A 3EHEA 2DHRA 3A7EA 3L5KA 3QKIA 3O82A 2CL0X 4RDXA 3W5SA 3ZW9A 1RHKA 2GNOA 3VHXA 1EX9A 2J9GA 4QOGA 3KZMA 2O50A 4RDCA 3OAAA 5FTWA 4C22A 4E3ZA 3R6LA 2XBUA 3AWDA 1ID1A 3Q5EA 3ZZ1A 4ZYWA 5CEJA 2J0EA 3F96A 3KL2A 4LV8B 4ZRMA 5IJ9B 3PYMA 2NQ8A 4B80A 4LF6B 4B6JA 4M99A 4HH3C 3WV4A 1Q92A 1L9KA 3PGXA 4RJJA 5I8ZA 3STWA 5JUWA 5KDDA 1LBEA 4M83A 4EA8A 4DMKA 2OKCA 3RS5A 1DRUA 4CM6A 4LNAA 2BZ0A 1BXRB 2B92A 4QJ4A 2P68A 4RCZA 3NORA 1QXSA 3TO5A 2IYUA 5K0CA 3V7FA 2EBWA 3MB5A 1VHWA 3O1HB 1MG5A 1Q0UA 2CD7A 2QXTA 4K46A 1PKEA 1G4HA 4KO8A 4R7GA 1LZLA 2HGSA 2Q0HA 3LHDA 3TDMA 3U40A 3VU0A 3HJGA 4U8HA 3PV0A 1G2IA 3LBYA 3G5UA 2GK4A 1JQDA 5CB4F 2O2XA 4YR7A 4GUAA 2FA9A 2QMUA 1EUYA 1FFSA 2BKUA 4ZODA 3AUXA 3P5SA 4WZAA 2FWBA 4ISBA 1GV1A 3QP9A 5TGTA 2D0IA 3RHSA 5LZ4A 3HXTA 2AF4C 8MHTA 1B1CA 3ESQA 1T2FA 2TMYA 4QL3A 4J2HA 2AE1A 5L4NA 1EWRA 4PZ0A 4GFDA 2ZE7A 1DKNA 4NOJA 1P9WA 2BM9A 1KFJB 4DOMA 3ONNA 4R31A 5JCOA 4XOUA 3AP1A 3GLGA 1EM6A 2FW1A 2BFCB 2BUCA 2ZIFA 3GA0A 5FPHA 1FCJA 1G0OA 1X7XA 5IEBA 4LOJA 1W46A 3AUYA 1MO5A 2K5UA 3DBOB 1FNBA 4JYMA 1BFUA 4O5AA 4IJWA 3WLQA 3ZXUB 2QX7A 4Y2XA 5C8DA 3ZU5A 1IB6A 4RPLA 3H2HA 1ZIYA 1Q44A 2EKPA 2L69A 1U2EA 1LI4A 4NFLA 2HW8A 5IS2A 3QJYA 3GFTA 1FFCA 3BICA 1Z82A 4AW9A 3E9QA 4B1FA 1XGKA 4POAA 1NVBA 5K0EA 1RKBA 1DFHA 1PJCA 3JX9A 4GLLA 4LBVA 1D7OA 2PKYX 5LB4A 2VLBA 3D2LA 2FPSA 2ZK7A 3BERA 3GVPA 1R5OA 1BW9B 2AZ4A 2HV8A 3M3PA 1OFIA 2EJTA 2O20A 3TW6A 4CKYA 3CNQS 1AQJA 3UAXA 1Y1LA 4RAQA 1OYYA 3AXSA 5CP8A 3ETHA 3L6CA 3G5LA 7GPBA 2WQZA 3BGWA 2AKAB 3VQTA 1J56A 1WQ4A 1HZZA 2UZIR 1MLDA 4BFYA 2AWNA 3Q87B 1FFEA 2Y2UA 4I4CA 4DQLA 1SUPA 1DBWA 5CTAA 4FB5A 4A8JA 3QIAA 2Y93A 4BNMA 5DVZA 4FMDF 2PQ6A 1P2UA 3TDNA 4PYOA 4BLQA 1NXSA 1E5XA 2AS0A 2M32A 3RWMB 4WDQA 1I24A 4I4TA 3UKDA 4BGVA 1A8HA 4YJ2B 5K4HA 2BGWA 2WJVA 5DP1A 3N59A 1HDXA 2CNWD 2IEZA 2J3MA 2I1QA 1GEGA 2AXPA 2P7HA 3AIOA 2RI0A 1NLZA 4UTXA 1CRWG 1VZ2A 2PTHA 1PJRA 2W6NA 3H8JA 2VDNB 3TTSA 5KYXB 3J7AC 3IP3A 1X1SA 4GQIA 5A0FA 5IUJC 4CM8A 4XYMA 4DDKA 1KOLA 1GSOA 3B6IA 2ZYVX 4GQBA 4IIXA 4LNUB 1HOTA 4LX0A 5A3VA 5LUBA 3TK1A 2QN6A 3QSGA 1IM5A 5TPWA 4ITRC 3QFTA 2R4TA 3D2CA 3O31A 5AT1A 2FSGA 1Q11A 2JJYA 2VHVA 2CYAA 4MJ3A 2XTAA 4WZBA 4ZPJA 5CT8A 3SI7A 1B14A 2VP6A 3C3CA 4UHFA 1YI8A 2EW1A 2XMPA 3KC2A 1UPUA 1EP2B 2JFOA 3D6HA 4Y6GB 4DC0A 4BUCA 2GEVA 3LP8A 1MAUA 1V26A 3QLVC 4WCVA 3TZQA 4UVGA 1NFRA 3L84A 2XI4A 4W6ZA 4QG3A 5JY6A 1V41E 1E6LA 2IW1A 5TT0A 2VL7A 4BNUA 1QNLA 1YONA 2PZGA 3PFFA 3W34A 1E2LA 4DR5B 2YX1A 1YAHA 3OSUA 1EQ2A 3NHBA 4DQDA 1MX3A 1E60A 2Z2IA 4D4IA 1YTUA 2ANBA 1J0CA 2Y67A 4L7VA 5K05A 1I7NA 1KAGA 3OKCA 4G1FA 1FSZA 3NT4A 4HNHA 4V3CA 3UWPA 4JL8A 3CPEA 2QM7A 3VPDA 2XUHA 4YDHB 3RO7A 2C07A 3KIPA 3I5YA 1ULSA 4GPIB 1TZCA 2NVUA 2HCTA 2OFPA 2VWHA 3CCCA 3O5AA 5E8JA 4DNPA 3N2GA 2HO4A 1Y7TA 4UCWA 1HF3A 3R0QA 4YBRA 4CMCA 3SS8A 1OY1A 2IYFA 2J5BA 4YDSA 5AI4A 3RYIB 5BN4A 4IL5A 5JWOA 4BATA 2G1PA 3X1ZA 5I9SA 2H65A 1L7QA 3T5BA 3VPAA 3L82B 3NZEA 3HXQA 2QI9C 5IN4A 1FU7A 2RKBA 5IUKC 3BN3A 3QV2A 3OICA 1OX5A 5AKJA 4DBLE 4RSHA 5TV2A 1Z5VA 4XB2A 4JCOA 3FB4A 2HLHA 1E3DA 5AW8A 3EARA 3GCDA 3H0KA 1REQA 1OZGA 2GBFA 2JGIA 2VHUA 5JAIA 4W9MC 2B0JA 3LUDA 4YGXB 3LW8A 3FOFC 3AESB 3NYIA 5B1EA 4OXNA 3I2IA 3UGTA 4PLTA 4HVLA 4ABTA 3QX3A 1Y6JA 3EVAA 4UNPA 2WWIA 1N33B 5BMVF 4NHEA 1TIBA 3AJEA 4Y98A 1JDNA 1IOZA 4IF6A 1H65A 1Z4OA 1E2IA 3CYFA 1L4UA 3H87A 5J9FA 3R3HA 3A25A 3I6QA 1UAGA 4GPEA 3GNTA 2CXUA 1E9RA 3SHTA 3KVYA 1AX9A 1NW6A 3NBMA 1D6SA 2NSJA 3FCSB 4YRGA 1EDZA 5CJPA 3TM5A 3AL2A 3LC0A 4QQNA 2CCJA 2JIPA 2BE7A 3JQ7A 1JQ5A 1JJ7A 4UOQA 1CNMA 4OMCA 1YQXA 2FQXA 3R41A 3MLBA 4KZPA 3ZKWA 2GCGA 1FS6A 1FY2A 2ZBEA 3W2FA 4ZQGA 4BJ3A 1GNTA 3WMEA 3QMWA 3LGAA 2GSWA 2A5LA 4YQYA 2H3HA 1PK9A 3PHJA 3GELA 3VDNB 2BN4A 3ZD9A 5JFTA 1OTYA 4M1WA 4TMKA 2VXYA 1PT9A 3PXGA 1AU9A 4RBNA 1TVKA 1S4QA 4JI3B 4DC9A 2H4HA 3DLPX 3LE8A 2AXEA 4M8IA 3WY9A 4DCPA 5FUBA 1E18A 2GWRA 3CFYA 3BOSA 3O8DA 4IDCA 5CNJA 4AJJA 5AKEA 2XWPA 1R15A 2E5WA 3TIGA 2AR0A 5EEGA 3WQBA 4BEJA 4TTRA 1ZHOA 1KVTA 1DFGA 1VL5A 3K8YA 1J99A 1Q7GA 3BJEA 3BJRA 2VZ8A 2IXDA 4EB6B 3GDOA 1P8AA 2X7XA 3CLRD 2VJBA 4OIFA 2PG3A 1D7AA 1X38A 2Y68A 1JSZA 4DY6A 4EYGA 3RYFB 2Z2YA 2I1VB 3UBTA 4H77A 1E4EA 3TTXA 4RHCA 3Q85A 1L5KA 1P31A 3K0KA 4L0DA 3THYA 3CNOA 4V0RA 5AW9A 4D81A 2IS4A 1XALA 3CRW1 1ZRNA 4MWGA 4W82A 3H2GA 3GRFA 4C20A 3PHHA 1KEWA 5DRTA 2VDUE 3S27A 1YQ9A 3S1SA 1Y4UA 3H5AA 3A1DA 1E1DA 5E6RB 5JC8A 4ZD6A 1U7HA 4TT3A 2NU8A 2Q21A 3H2IA 4X9XA 1WMEA 4O4IA 4HX2A 4BS9A 2XMBA 1KI6A 4ROTA 1XTQA 3BM5A 3CG0A 4PZCA 3SYKA 3UV6A 4AMYA 3KTDA 5G1OA 1WR8A 5TB5A 4CKBB 2R7AA 1VM6A 1FK8A 4P08A 4G2NA 1QIDA 3H2SA 4G01B 3FI0A 4NOLA 4BECA 1L7VC 4S1WA 4DLPA 3B7PA 5EA2A 3VKUA 3K0SA 1MVNA 3LHIA 1Z2NX 1Z3CA 2Z6VA 2UVPB 1YDGA 1JQJC 4B3CA 1E7QA 1NNUA 3HEBA 3MUFA 5JO0A 5GIOE 3MOIA 2NZ2A 4HH1A 2BEVA 1H2YA 5EUBA 3BSYA 4Q4CA 1LDYA 2G83A 1QHGA 3EGDB 4WA8A 3KSUA 1C3XA 2P41A 5ICSA 1E79A 3QK7A 1YQTA 2FU5C 4M9ZA 5JISA 5KOYA 1LPAB 4ZIRB 1GWNA 1BXZA 3CZ9A 4ENTA 3VYVA 3EIWA 3ITKA 4CM1A 3QW2A 2XGMA 4WLUA 5BR1A 4Q4LA 3HN2A 1O58A 3DE6X 1JH8A 4IEFB 4UUQA 5CVDA 4IJ5A 4Z86A 5JPIA 2A0UA 3NT5A 1QR6A 2NYUA 2PZLA 2IUUA 2FW6A 3BPSA 1OI4A 1J06A 4XIIA 3QNUA 2C5LA 1E58A 1HLFA 4WH0A 1GPLA 4WY2A 3MRVA 4XCXA 4R16A 5BSRA 1SC6A 2Q3BA 3CIFA 4LQ4A 2I62A 3OLXA 2FUNB 4Y67A 3N5KA 5IU6A 4EGCB 1C7ZA 1JR4A 2D5AA 3NNSA 3RVLA 4ZCMA 5JS6A 4PYNA 3IBSA 1UR5A 3MTGA 3SBDA 4EMUA 1YR6A 1GO2A 3PXXA 4N82A 4A6XA 4DLWA 1Q91A 2FW0A 2GM5A 1GP2A 1T2AA 2RI1A 5FTLA 1WW2A 1FYDA 5D3QA 4GKKB 2H18A 2O3SA 1KAEA 1KY5A 3ESRA 2OZKA 1VPDA 4EHNA 3AZQA 5TVKA 5AQ1A 1D0SA 2WFMA 2ZJBA 2R1VA 2ZJ6A 3HACA 3T3NA 1WW3A 5B58C 1ST3A 4HUQB 3WNVA 2VFAA 3G2IA 3KZOA 4HDOB 3VSDA 1A4IA 3EMBA 3VDMA 2HYIC 4HZUB 3A2KA 3TL2A 3SVLA 4RA9A 3DS8A 4CUJA 1XQ9A 1DRJA 3UC9A 3F7MA 2JAOA 1N3IA 3BSWA 4ZHSA 1Z75A 3IQFA 3STTA 1R0CA 1C41A 4I99A 2IQIA 4MRAA 2P9QA 2IEYA 1FFXB 1UC5B 2CT8A 5FNZA 4DCMA 3B13B 1QRDA 3CA8A 1YQUA 5A04A 3Q1KA 3V2IA 5EKUA 1JE0A 1DAPA 3EA0A 4D0RA 2H16A 2IHKA 3ENVA 6GPBA 3LLMA 3RVOA 1CUYA 2HEIA 3OQIA 3T54A 1UBJS 4TWIA 1P29A 1LU9A 2IYWA 1BA2A 5MN4A 3IALA 1C3JA 4DDUA 2ALJA 2PUEA 2WDZA 4EZIA 1ADFA 3GCGA 3DEZA 3LYAA 4L5BA 2REBA 3O8OB 3JATA 4R1TA 3E8SA 3TLMA 3KBBA 4LOKA 3OLWA 3WDKA 2VAWA 3DFUA 5THKA 4FWTA 1BX3A 1O6CA 1VKRA 1BFKA 1FBTA 1IIBA 1EUDA 4LIPD 1KAMA 3DDZX 3SEZA 5DZSA 4TV9F 4J0GA 1YQQA 4A7PA 1RCFA 2FJPA 5M5BA 2PKWA 1J0BA 5F9MA 3ADPA 4JENA 1T0HB 1Z15A 1CUIA 5KTMA 3PFWO 1GQRA 2RC5A 1IY0A 1E2JA 1I3LA 2H54A 1BYIA 4U7JA 3E61A 1SQSA 3L07A 4H35A 1QDEA 3W6PA 2ZB2A 5I7FA 2OCLA 4X7PA 3S44A 3ZNNA 3CRNA 1QHNA 1LDMA 1XKLA 4UHDA 4WZ6A 2YXBA 1JFTA 2FPOA 4JNKA 4HB0A 4XGRA 4QBTA 5IAGA 4P0QB 2RHJA 3UYLA 4PGHA 5BVHA 1X8JA 1WCV1 1OXKB 3DEAA 4IIEA 2Y0BA 3UK2A 2Y8EA 4ZYZA 2RHTA 4DA8A 3G8DA 3ZBUA 1Q5PA 1Q77A 1R64A 5K03A 2YFYA 1I7SB 4AZ3A 3KQYA 3TBHA 3EODA 3VMFA 5HM8A 3HXOA 3A6KA 3M1IA 1F5SA 1LNZA 2YN2A 4R8RA 3J81k 2E82A 4LOHA 2HIHA 2WD8A 1ZRMA 4GNRA 3IAEA 1I5OA 3ES9A 4RGYA 1T24A 2PU7A 2J3JA 1GSHA 5EWLB 1D2MA 5AVKA 1VRWA 1EXWA 4HAUA 4EARA 1TUBB 4G89A 4ZCTA 2X4LA 2X42A 2I3DA 1U6KA 3V8NA 3Q0EA 4X61A 1JT9A 2WT8A 3GJTA 5EZYB 3VR5D 4X6XA 4OXRA 5FUWA 1RYYA 4H1WA 1JA9A 1DP4A 4H17A 5CA0B 5IEJA 1O77A 4QO8A 1AGNA 3K9WA 4BC1A 3UJPA 4CWAA 4QUHA 4TKVB 1IXYA 1EM8B 3MMZA 4URVR 1BH2A 3IBYA 3I34X 5D87A 4AX8A 1SQFA 2CNDA 1Z29A 2IUYA 2NP6A 3PJGA 3I9MA 2QIOA 3ZGVA 3T3MB 4FQ8A 2VDWA 3L0CA 1QZZA 4JP8A 2YZ7A 1C30A 1KR5A 2VN8A 4RH3A 4Z2AA 3MJFA 1KYTA 3GFPA 1CERA 2CBGA 3EDQA 4ZQEA 1Y7PA 3FY4A 2WF6A 5D7BA 1H5QA 1IM2A 1OX4B 1KJJA 5BRNA 3NHUA 1AZWA 2VHYA 2HSEA 4HLNA 4BRSA 4GEGA 1Z0JA 5GOTA 4YR9A 3W2GA 1I7LA 4CM4A 2NGRA 4CG2A 4CCWA 2AN5A 2CLOB 1HT0A 2NYRA 1XZPA 3WNBA 1FUKA 1GUFA 2C2GA 3MTQA 1VHTA 1WV0A 2W43A 3EG5A 4O4HA 3VAZA 4C1NA 3QLTA 1NXWA 3H9UA 4YACA 3QXHA 1HNXB 2FWPA 1F9EA 5BNTA 3T7TA 1ZSVA 3OSZA 2BFDB 4B76A 2QD2A 4LKOA 4DSNA 3WAJA 2WJGA 3D8SA 3QPWA 3WGMA 2ZDGA 1WP4A 2MSNA 1CYDA 4J49A 5H9WA 4C4ZA 2FSPA 2R2GA 5J3JA 2QRNA 4YRBA 1LPSA 1R5JA 2V7PA 1SHTX 3JWIA 4B71A 4BQPA 2G80A 1NOJA 1Z3IX 1LWOA 1D09A 221PA 1G6HA 1OPXA 3M0EA 3ONFA 3OZCA 4FMCB 4JC4A 4I1YA 4BQFA 3M49A 3KYIB 4ARBA 1G8KA 2X3UA 3NP9A 5LZ2A 2BGJA 2JKVA 4DRZA 5THXA 2YVQA 3VC1A 3ZHOA 1DKUA 4F38A 1B3RA 3HYRA 5DGIA 4JP2A 4L78A 1SHKA 2XNCA 4ZZ2A 5T3YA 1SBZA 5L3SB 1UEXC 3G1TA 5EZ6B 1YCDA 4CQMB 4MIOA 4H3VA 2FOIA 1GKYA 4R51A 2QTVA 2VNSA 4FFMA 2VF8A 3IAS6 3TCXB 4X95A 2ZIWB 3GRCA 2Q07A 4KPEC 1BD3A 3PRHA 1N2XA 2C3PA 3CUYA 4CIYA 3KJIA 1WAMA 2QR3A 2H08A 4ZJZA 1VKOA 3ZZ0A 3MZ0A 2EFHB 3K1JA 3N2IA 2HZBA 4O3FA 4UDNA 3KRTA 4IO1A 4V0OA 16PKA 4ZMBA 1TW2A 2IS6A 1JJAA 2Q7OE 4YV0A 1VG0B 2OV4A 3ABZA 3WMFA 3BB1A 1E6KA 5DHPA 3WYDA 1V6CA 1MJGA 3M6IA 1X0VA 2WVAA 1WMDA 1ZBDA 2QPTA 1EEHA 1FFBA 4RF4A 2P11A 4TLAA 2FWIA 3BMNB 5EUCA 1U7TA 5KU1A 3V4ZA 4PPQA 1HPLA 2FX3A 2FUKA 3A1SA 3O2JA 4CV3A 5IXSA 3O0DA 1I80A 1F4VA 2H1LA 1X3SA 1IUNA 3GAAA 2AF3C 4JLJA 2IU6A 2OYSA 4LV5B 5L3VA 4B3SB 3INTA 3PUYA 1VE3A 1VJTA 2BFFA 3A9SA 3QU9A 3AP2A 4A92A 3WYEA 1KIMA 1JQEA 4GSLA 5I5EA 5M29A 3MRXA 3RAEC 1WPRA 2EP7A 4OSOA 3H8VA 5AVSA 2SECE 2HD4A 3RYCA 3QVVA 5IAEA 4DL9A 4OFXA 3IPCA 5CG1A 1N6RA 4RV4A 4R1OA 3O8BA 2R6CA 4M49A 4OP1A 5B58T 3NLLA 1PVDA 3OTWA 2WUDA 3EGEA 3WGKA 4D92A 4IHJB 4PZEA 1LK5A 3SF8B 1SBTA 3M4NA 4RPJA 2GN8A 3OCUA 1IBLB 5C5DA 4WMLA 3RIXA 1R6BX 1Y3BE 1EFDN 3ZK9A 2P78A 3HWRA 3WMGA 3UNXA 4DIOA 2ZFUA 4W5NA 3K8OE 4KB5A 4DRXA 1QPBA 1RWOA 2DSNA 4I9NA 1XVLA 4ISCA 2VG8A 3KK0A 4L6IA 4B3DA 2YJ3A 2REQB 3EEIA 1YK1A 4ZU6X 1QH8B 4K88A 2WSYB 3GROA 3GJ5A 1U9ZA 1X0XA 4E5YA 2WJHA 3VO1A 1E2QA 2RJ3A 2WKQA 4LRQA 3K9NA 3GDGA 4PZPA 1T8TA 3RNOA 2BUBA 4IXMA 3PFHA 3GUHA 1C4KA 1KY2A 3V8BA 5BSWA 4B84A 1VRVA 1JL3A 5CW2A 1TEZA 4RXUA 3B2QA 2GCOA 2Y27A 2VQ6A 4JASB 3K6RA 2B61A 2IODA 2C29D 1GNRA 4NJMB 2C3YA 2O0KA 4KIJA 1D04A 1UDAA 2GVZC 3E48A 4B3FX 2ZRKA 1Y8ZA 1ZN8A 3L8HA 2B8NA 1TKBA 4KAAA 4MQFA 3SLRA 2GM4A 4MCJA 3U1VA 4MJ7A 2Z43A 2EXXA 2NWQA 1HDZA 3KKMA 1QHHA 2I22A 1L1RA 2QU8A 2Q7DA 1KZ9A 4HAWA 2Y92A 2GEKA 1FUYB 3ZVLA 3FM9A 2Q5EA 1TVMA 4B85A 4RMJA 1H9BA 2HLDA 5I7RA 2PBZA 2GM9A 4PANA 1K66A 2AD5A 3U6BA 2GD6A 3T8YA 1P91A 5DW3A 5I5GA 3KQHA 3ZDBA 4XDYA 3T5GA 4LZWA 3Q0IA 2H2HA 4TLLB 3I62A 3MGBA 2OO5A 3DTVA 1PR6A 2F43B 5GAJA 2QVGA 3I53A 4HN4B 1XVVA 2JIZA 1V6AA 2FETA 1X1EA 4WLVA 2OM2A 1LJ8A 2ONKA 3PI6A 1I6MA 2RJOA 3WB9A 2WWFA 4RE6A 3JD3A 5HTKA 1EE2A 3ZEAA 1X8KA 4M7WA 5HSGA 1QGED 1E2NA 1E69A 4UM5A 1NTOA 1Z06A 2O54A 1YHYA 2XXAB 5IN5A 4GZ3A 3WLAA 4YNBA 2IELA 1R0WA 4MQLA 4Y1FA 2FSSA 2CDAA 2GEJA 3N2KA 5K2MA 3ZIUA 1EVLA 4D6YA 4DUPA 4BN5A 4PN3A 4J0CA 2CMFA 4N5DA 3P26A 4ZJYA 3FB1A 4R05A 1F48A 4RF5A 3L0SA 2FZWA 4QGHA 4X3CA 5CT5A 3T7CA 1GZ4A 4F9FA 3H6HA 1MJNA 1K86A 1M2JA 2CFTA 1FYEA 1V1MB 1YCFA 2A9QA 2BEWB 3FG9A 2J7KA 4LZZA 4Q9KA 3ROTA 5IXJA 4HRVA 3KZ1E 4KVAA 1QTRA 1W4BA 1I3NA 4C07A 3CLVA 2P2ZA 4Z9AA 3TR6A 3LLCA 4L6CA 2OVBA 1J24A 2DMRA 1RYFA 3H99A 3WB1A 3C43A 1T1SA 1M2WA 1L5WA 3EGXA 3HKCB 3I3SR 3E3OA 3MMXA 1YDEA 1E61A 4I36A 4RQTA 5LA6F 3AR2A 1T3GA 4NJMA 5JSQA 4M1KA 4G0OA 3AFHA 4EJSB 3AHFA 3SWWA 1ULUA 2WWYA 1N36B 2R5WA 2GBIA 2XCIA 1BWSA 3VR0A 1NULA 2RGXA 4B4VA 4C0WA 3GXBA 3JQBA 4WOBA 1BG6A 1R6TA 2ZSDA 4N1AA 4BB6A 4TN1A 2C7GA 1USIA 1VSBA 4M0DA 4V0MA 2RBGA 4OK6A 3CNEA 4PAQA 3D81A 3KD3A 2Y4NA 1AV6A 1RE1A 4MRRA 4TZKA 1OWOA 2OT3B 4BNJA 5EJ9A 3VU3A 5DGTA 1PFVA 5JAPA 3EDMA 2CD9A 2EJBA 1YFZA 2REQA 2ZT7A 2QBYA 4H9GA 4NEQA 1B00A 1SRQA 1NW5A 4UBKA 2GZAA 2Z30A 3O4JA 2Z5VA 3NAGA 4P82A 1ADGA 4QPPA 5C1OA 1UZNA 3HN6A 3WJ7A 2ISSD 5TGZA 4H3KB 1T5OA 2R60A 5BR8B 4NMWA 5TVGA 3ZX5A 2NO0A 2CL7X 1BWQA 3U9TA 2ZVDA 1ABEA 1QMGA 3PPXA 3V1LA 2H57A 2NPFA 3VYSB 3VAAA 3DAFA 5LFAA 1KK3A 3OEHD 2X0FA 4E5SA 5IF3A 1C8BA 2ZJ3A 3CZCA 3GEMA 3QSYA 1Y1TA 3I9KA 3WL8A 1XSEA 4LY3A 1T6XA 1RPZA 2I9PA 4LF4B 3VH4A 4TYNA 4CXMA 1LTHR 1S2LA 4B5KA 1XYVA 3ZHXA 2Y77A 4X64B 4BBPA 5A2QA 5BQ5A 4BKMA 2NO9A 2AFHE 3EPPA 3VO2A 1A7KA 1E2EA 4D80A 3ZVKA 3P9YA 1OF1A 1NQ5A 4QG7A 3SJCA 1A0OA 5KQSA 3BHMA 2FKNA 4FINA 4XD7A 5E3IA 5EL0A 5C18A 1DJLA 4CF3A 4MO9A 4Z8XA 4BMCA 4YMGA 2J32A 3FVQA 3HU5A 3CVUA 2QHXA 3CB4A 5DM70 4Z51A 3WZ2A 4NCBA 2Z5LA 2J09A 1MQ8B 1QG4A 3T1HB 3BVPA 3DHWC 4ZKDA 3KPYA 1CF4A 3EY9A 4F45A 1WD5A 3FOBA 3B6KA 3IEIA 4A0QA 2G8LA 4D3XA 3D0KA 4HNAB 3JQAB 3KU1A 3NFYA 2GBLA 4J0JA 4OBXA 3GPBA 4L9SA 4D8UA 3OBBA 4EOGA 3COZA 2QTGA 4D02A 1FQJA 3X1DA 1EVJA 2QVZX 3KTOA 4WECA 2W6PA 4NYMQ 5IUNC 4LYAA 5DX1A 1G18A 4G0PA 1R0SA 2D0PB 3IBTA 1WZIA 3EXIA 1ODKA 5BWCA 5C5EA 4OCZA 4BVAA 3MERA 3QE3A 5H5JA 1PTJA 4NJEA 3K9LA 3SC6A 4YQEA 4HRYA 1V3QE 1ZK4A 4HDSA 3A14A 4G8BA 5L45A 1ARZA 4WHMA 3EXHB 1TIPA 4G25A 1NPYA 4H2DA 1M54A 4YALA 1NHWA 1ZWLA 4B34A 3DQQA 5HPYB 4IGAA 3KKKA 5CIWA 4KGDA 2QZPA 4Q1DA 4N0EA 2BI7A 3FMVA 4IIYA 3ROGA 1SCIA 4GYKA 4FFVA 4UVHA 2IA5A 2X5XA 1M34E 4X44A 5ALOA 3AQIA 2QUHA 3UXHA 4AZVA 1FP4A 2IYYA 5D5QA 1LB1B 3DGEC 4TV8B 3EIEA 3NEAA 1XQWA 2XIJA 1B8PA 1HO3A 1ZZEA 1YR1A 1PV2A 4ER3A 4PNHA 3SXUB 3V4RA 5TJHA 2X8BA 4AZTA 2QGZA 3VOAA 1T2EA 2OBYA 1FMCA 2COKA 4G5YA 4WX2B 3IAAA 4EFNA 4EENA 1WOMA 3EVTA 3QFSA 4TRRA 3AEUA 2G7MC 3CE6A 3P1JA 2UYGA 4L15A 2A1UB 2GZ2A 2HLNA 4NZOA 3STVA 3UMCA 1YUMA 4KCGA 5FPKA 3MOGA 1OKKA 3C4QA 3JU3A 2ZJ8A 5EXPA 1U94A 1Z5NA 1K3UB 3TECE 1WEHA 4OI2A 2JLXA 2NP7A 4ZARA 1WXWA 3LX5A 4H0CA 1KTVA 3EEBA 4EW6A 4GMFA 5HFNA 1X80B 3ZCSA 3U3KA 5IT4A 4E4TA 5DW0A 4V0ME 5AW3A 1UKCA 2JJQA 1MFZA 5AVZA 4EUSA 4UFOA 1YHNA 2BIFA 1E7RA 3OPQA 3X43A 3TZKA 2LCIA 1CG6A 3EDCA 3ESXA 3ND9A 5C1PA 1JFFB 5C7OO 2NUPA 4DLXA 3LY9A 3J7TA 5KWJA 3GVCA 4HQNA 3II6X 3IXQA 4CI0B 4ZAVA 1BVRA 1M8FA 3A4IA 3W06A 3A2MA 4FU0A 4EUNA 5BQXA 1C9MA 2H5JA 4MKZA 3BKXA 2O07A 4LJ9A 2TMKA 4TLEA 3PE3A 2F55A 4NJOA 4Y1RA 4ZI3A 3DJFA 4BNDB 1H9CA 3QZUA 1M6WA 5CVTA 1EEXB 1G9TA 2DY1A 3NXKA 4PS1A 3L0YA 2G1JA 2XUJA 5DXFA 1FDUA 1YBVA 1FLVA 2A84A 1XZAA 3O2QB 4RTOA 1XZMA 4XLLA 1Q1AA 1DHTA 1JDVA 1NMQA 2BCJQ 3PICA 2HC9A 4Q7KA 1J8MF 1A3CA 2WVHA 4LY0A 3D1JA 4WPGA 3SX4A 3HHPA 3PT9A 5LLSA 3CEHA 2N47A 3AXTA 4AZ3B 4DMGA 3OZIA 1JIUA 2C88A 5A06A 3M6LA 5C1IA 5GZ1A 5LOVA 3E2IA 3L43A 1Z4JA 1CB7A 2QD5A 3BMQA 4UTOA 1MQ9A 2IHUA 5T64A 3VR4A 1PG5A 5JAUA 1C3VA 4ZV9A 3F47A 3NO4A 1D1QA 1E2UA 2WHQA 3DCJA 3LDGA 3UF0A 2NN3C 3VSAA 4D0NA 1RQXA 4DCSA 1Y8QA 3IGFA 1DUVG 4MW2A 4OHPA 4R1MA 5DBGA 3H04A 3OE1A 2G5CA 3OQPA 3I12A 5SYAA 2UVDA 1L7BA 4ZOEA 5KYWA 3U61B 5I7WA 1HZJA 4RK6A 3ZDRA 4DILA 3C3WA 3U7RA 1IZ7A 2P6UA 2C9MA 5E0KB 3OUTA 3DMPA 3RUEA 4GPTA 1YB5A 4LXUA 3DB2A 4D8YA 2BFOA 2B99A 2I33A 2VSXA 3KAKA 1ECBA 1YGPA 2V9PA 4CL2A 3HXPA 4DBLC 5HQ3A 4LHXA 2QL5A 4PQFA 4TZTA 5K3OA 3UJ7A 1T6ZA 1X7WA 1HDGO 3L8DA 5JXIA 1CUEA 4OQXA 2ZYIA 1GJRA 2VQ3A 2AFRA 3B38A 3MJTA 1EFCA 1SPBS 5JSFA 4JX9A 1XRNA 4BVJA 4D25A 2GNPA 2PZBA 4DIDA 5BUSA 4HVTA 3DBVO 4E0BA 2JEYA 4Q3BA 3ASYA 5DHQA 4JR1A 4ZT3A 1F20A 5FIUA 3NPMA 3V1YA 5LXTA 3QLEA 2CVZA 2WPDD 5ALVA 5LP6C 4GNKA 1E0AA 4BP9A 1R66A 2VHQA 2H1IA 1U4OA 3GLSA 5DCLA 5ALEA 4JUDX 5H68A 2NZXA 5LZ9A 1U04A 3M5PA 1L5NA 2VWQA 4YMTA 3PZRA 1A77A 5COBA 1MW9X 4QHTA 3UKJA 1ZC3A 2VVTA 5JQWA 1P17A 4GD3Q 3GCXA 4F3YA 1YS9A 1Y63A 1N0WA 4DPMA 3LPNA 5F3DA 1XL1A 2ZB3A 2WZCA 1AN9A 1BJKA 2C9DA 2DFKB 1UBTS 3QENA 3RFTA 4X6UA 1FFXA 2RHRA 4YMVA 1NWHA 2HJGA 3FHTA 4UDXX 1FLDA 1Y81A 3PCRB 2QPLA 4ZOAA 4FI3F 1Y7LA 5B7GA 2Z8YM 1HH4A 2XX3A 3QWIA 2J6BA 3K73O 2XQKA 4N0DA 3W2EA 1T5IA 3QXXA 5FBQB 1XMOB 3L01A 2P69A 3WQHA 4IXWA 4TWZA 1NN3A 5ERXA 3W6UA 5DBIA 1NXVA 4O4IF 3CLTD 4Q18A 1P0CA 4P5EA 4C0JA 1Z47A 5ADWA 1AKWA 1FQKA 2GDZA 1LVUA 4NS1A 3VC2A 1GR0A 2A9OA 4HXYA 2FOLA 1K0UA 2XAAA 3R7NA 1PF7E 2XVYA 3SC3A 5CDTA 3P0JA 2WAOA 2QLLA 5CBPA 3L41A 5KNDH 4IUCS 4B74A 2I6TA 4LBWA 4OQPA 4TZ0A 4QGSA 1DQPA 2P2LA 3MWLA 1LC3A 4WOJA 1HRKA 2RE8A 3ICQB 4QPZA 1RHRA 3L2OB 3VFDA 4A4DA 1NRJB 5LYJF 2O05A 2C2XA 2F62A 3MRTA 1P3DA 1KPHA 2MIIA 3EZFA 3LX8A 4FZVA 4KQFA 4PZ9A 4MP3A 1T8PA 1X8XA 2UKDA 4LXTA 5EUMA 5H80A 3B20A 3U80A 3KOZA 1KFBB 2AIRA 4U7HA 4WXRA 4BGUA 3CLUD 1DINA 1G7CA 1WVGA 4EYKA 3DLAA 4MR7B 2HPVA 3EMDA 5FHQA 3E84A 1BE6A 2XIQA 2G0AA 4UD2A 3GT3A 3PRJA 4XWAA 1BRTA 1Z33A 3DWGA 1NN1A 1BCSA 1THTA 3KSDO 3TNFA 2QRUA 2VJMA 3P9QA 3PUZA 2JFBA 4REQB 3WQSB 1M8PA 3MD0A 3QEMB 3TAHA 1XK6A 1R0RE 3SY8A 1PR5A 2ECPA 1SVNA 5DLPA 4YXFA 4MWBA 5JO9A 4S35A 3R3JA 1U0TA 1XEAA 2OZVA 2YNMD 3ZWKA 3FOZA 3G0HA 2HHJA 4DXDA 3EGDA 4I1OA 5FUXA 2DBQA 4XCVA 3TB6A 1C3OB 3PTZA 1VE1A 2XUAA 1AF4A 3PNKA 4M0LA 4M6WB 1VLQA 3I6IA 1QBKC 2POQX 4ZEWA 4Z4HA 1JKXA 1GQQA 2UVPA 1PHRA 4M88A 3EZ6A 5ICMA 1PWYE 5DN6D 1JA0A 3PDWA 3L6EA 5GINE 2CB9A 4RY9A 1W4RA 3MBOA 2AC4A 3M34A 4RQUA 1QE3A 4LK3A 2I3GA 2H2GA 1WJGA 2H0QA 3N86A 4NATA 1V4BA 1IJEA 1WY7A 4CM9A 1ODCA 4CMIB 3GN1A 3WGUA 4TSKA 2UUAB 4CKBA 5C1DA 1R8SA 2JFXA 2J0VA 4NOKA 2ZUFA 1ES9A 1PEAA 2X7HA 2JRCA 3IH5A 4ZGBA 3KJFA 2X76A 1WB6A 3DBHB 4DYDA 1KOJA 3INRA 3N5CA 4N01A 2NV0A 4ZC8A 1DRVA 2NAPA 1ONNA 3Q3VA 5E6RA 1V1RB 4E13A 3V33A 2DF8A 3O92A 4HAOA 1GHTA 1HG0A 1OAOC 2HRZA 2PCJA 2GD2A 3GARA 4IDBA 4B3HA 1AKUA 3VPHA 1VB3A 3FRHA 4TMVA 3ZZNA 2GSDA 3FCYA 5FWYB 4BCDA 3V4SA 1W5EA 2I55A 2QKYA 3CXRA 5DIZA 3ZPXA 1RI3A 1A72A 1QGOA 3OQVA 4GP7A 1GPWB 1NXPA 4YT5A 5HRAA 3QIVA 4FYJA 1SMKA 4BO8A 1PBNA 3VO9A 2OPBA 5FOUA 2PBRA 6PFKA 4YAUA 4LAFA 1GGMA 4QU5A 3U26A 2VTBB 4J16C 2WTUA 3CIOA 2Q1XA 1UZLA 1JGTA 1OT5A 1SCNE 1YAJA 4Y9TA 5F77A 1NLYA 3UWDA 4D56A 2YOHA 5A2GA 9LDTA 5ILOA 2I9KA 1BE8A 2B2XA 3TOSA 2QRGA 1FUIA 1U28A 2FPMA 3TSWA 2UZ4A 3ADDA 1P1BA 4AX4A 2WMNB 1NJ8A 2CLSA 3ESDA 3N53A 1YB2A 1Y4DE 1YL7A 3NFRA 5GWXA 1QRTA 1TVKB 3NWBA 1A8QA 3ZWVA 4DV4B 4DA7A 3KR1A 1OH5A 1DSSG 4L4YA 3VNSA 3OA0A 4OH7A 1JDPA 1Z6YA 4RTJA 2CZQA 2DEUA 2XYRA 3O95A 3Q3GE 1WQ1R 2DPXA 3D3JA 5EGNA 2YW9A 1DVRA 4KFRA 1ZS9A 3DZFA 3HABA 1AA9A 1EFPA 2MR6A 2PA3A 5LBTA 4E4YA 1NDHA 3BMXA 2O2CA 1E1NA 1Z7EA 2AL7A 1XNGA 1AKQA 1JKFA 1XCJA 3OG9A 3ZDAA 3HSKA 2YIMA 2O23A 2F1KA 2DUUA 1O97D 1WD7A 5EP4A 1EH5A 4NONA 5I45A 5KQPA 1H4QA 3AFOA 5JBNA 3ZE8A 5GP1A 2PV0A 4UTNA 2I99A 1ZLXA 4MUMA 2GRUA 3CH4B 3IMGA 4BB9A 1UBCA 2YRFA 1W0KD 1Z28A 2CXXA 4HPJB 5FV7A 4US1R 2CEAA 2OYRA 2ZJ0A 3GMDA 3HWWA 5F2OA 5TXGA 4DXAA 1BKSB 2CJWA 4M8NE 4JOQA 2HK9A 1HEUA 5FXMA 4AJEA 1QF9A 4MYSA 5T3UA 3HZHA 4EB3A 8ABPA 5ANRB 1OWLA 2JHAA 5JCZA 5LQNA 4IQ8A 1Z5UA 5AFSA 1YMQA 4CTKA 3ORFA 1WXEA 2BWJA 5KHLB 3FYTA 1N8NA 2BJVA 4NZZA 4RORA 2I7CA 4DN6A 4IHKA 4WK0B 2YASA 3GJ7A 4IDEA 3RVBA 1QOZA 2B69A 3CNBA 3NONA 2PVCA 5ILGA 4KYTA 3V3KA 1C7JA 4A0RA 4RA6A 4PLPA 4QYMA 1QPGA 2I2CA 2IP1A 3T5DA 1ZIXA 5BWMA 1IOLA 3SSNA 2Z9DA 4TV9A 121PA 4A0FA 4ZU3A 5DYGA 4R1SA 3ABOB 1QVVA 4UHEA 5J1SB 2W37A 3RQSA 3TM4A 2PUFA 5CB4B 1H2WA 1AHNA 3B1YA 4JB8A 4F8EA 1LLFA 4KL8S 2LD4A 2B2CA 2PL3A 2QTRA 1J9ZA 5F3WB 1P7VA 2WSSD 5C52B 1MG0A 5JJLA 4NARA 3STXA 3GLIA 3QW4B 2NZUG 3TFWA 5FPQA 3RFVA 5C31A 4WGGA 5JATA 1XAJA 4DUYB 1YR3A 3TX6A 1NI5A 2PGIA 2W2MA 3W1VA 3N75A 2QTBA 2PUAA 1D8TA 2AYYA 4YRTA 2YJ6A 3IS3A 4FDTA 4BWGA 1F1BA 1RYDA 2C5SA 3DMFA 1U28C 1JDBB 3M9WA 4RY0A 2QQFA 4Z99A 4ZI5A 3RIEA 5ADUS 1PJ2A 4U7DA 3I2GA 3LP6A 3BXPA 2HWXA 3SS7X 1QFYA 1TKAA 5JH7B 3ABSB 1J8FA 4WKGA 1JPJA 3OMWA 4MXDA 4G84A 2BGNA 1J0XO 1R0ZA 2ZTUA 4GIBA 4X5OA 1GGNA 2HTEA 4KE9A 1YV9A 2A9JA 3EOZA 4R2IA 3ZXSA 2WUWE 4YCSA 2PN1A 4J4HA 2VF4X 3PRYA 1SVOA 3NASA 4R0MA 2CHVA 5AXDA 1M8JA 5IZCA 4OHZA 3E05A 1DELA 1O0SA 4QBGB 1HE8B 3HWX1 1A4UA 3P8ZA 5EIAA 4AWAA 2OFFA 5B4TA 3CZPA 5HJ2A 1Q17A 3I83A 3A1TA 2ZM6B 3BT7A 2Q2QA 3NV7A 3DWEX 5KQLA 3LT5A 4CMGA 1H5NA 3KOOA 2IDMA 3QY0A 4R1QA 3MS4A 3V4FA 4R8VA 1UWLA 3WGIA 3GUVA 2P67A 2GCEA 5K3EA 1JNYA 2ZYGA 4XJXA 3L1KA 3NOOA 3CVOA 2ZQZA 4FHZA 3OU2A 3SCZA 1VGRA 1DKPA 4OV6B 5DYNA 3HXKA 2OORA 2E4VA 2J46A 1C0LA 4UMDA 2PGAA 4DCJA 4HS9A 4K3VA 4O2RA 4JSYA 4AQ7A 2QVXX 4N8DA 1M66A 3RUHA 3ZK8A 2ERCA 4YAEA 2VJAA 4WVFA 4PHGA 1F06A 2YRWA 3C3PA 5KNCA 5K8IA 2CHEA 3C70A 3K5WA 1IZ0A 1TM3E 1E0SA 5E1MA 4H1VA 4MUAA 3QNWA 3OX1A 3U7EB 1Y3HA 3U0VA 1QFXA 4D3FA 1S2IA 5DSXA 1K4KA 2VCYA 2Q7XA 4Z0HO 1ZVMA 4BU1A 4MYDA 2I71A 2VP5A 3OPYB 3C41J 3C5CA 4K5QA 3NH9A 4MRMB 1F4PA 3MTIA 1AM4D 4EM6A 1HDCA 4JYCA 4DUGD 4NK5A 5J47A 1TAHA 1G291 4CDNA 2PKQO 3OCXA 1CUVA 2ZAOA 4FHGA 4O4JB 3QXSA 3IR5A 1JTVA 2EOAA 4XUCA 1OFUX 4CKEA 2IS2A 1ESZA 1T5BA 2R62A 1UBOS 3M7IA 4OP2A 1W49A 3MJHA 4BCBA 1HE3A 2QM3A 4BJHB 4RPKA 3AEZA 1Q1QA 1T2VA 2ZSJA 4QDZA 1ABFA 2O4UX 1DHRA 4LPSA 3QRWA 2PGNA 2WYOA 5I48A 3QOXA 2P35A 1WMAA 2QB5A 4I1VA 4YRJA 3RD5A 4UTVA 4TKZA 3HS3A 4RPCA 2QRHA 2GF9A 4TQGA 3WYNA 4D79A 1KEEA 1WSAA 1O87A 2UVQA 4QLOA 2QT0A 1PUJA 4Z5XA 1HRDA 3O8RA 3K0FB 4B3TB 1KWKA 2MYPA 3AJDA 2B4AA 2BSQA 2QGFA 4KDFA 1N5MA 4IUBS 1CHNA 4EAAA 5BN5A 1ADCA 1LVHA 1P5ZB 3L05A 5E6UA 2J4CA 2ZYWX 3QBJA 1IY1A 1INLA 2H2WA 3SF0A 2HWUA 4HWKA 2XZLA 1M5TA 2YYSA 2HMUA 2VHZA 2ZIXB 3C8ZA 4GGPA 1Z56C 3OTIA 1L8OA 4DCGA 5CXUA 2KS6A 1G59A 3IT2A 4YFYA 5ALNA 1G8GA 3U7QA 3BS4A 2IEBA 1SCDA 4G9GA 3RSFA 3GYGA 4KN6A 5IX8A 1KEPA 2CVOA 4NYIR 3SXJA 1OAOA 3D4NA 3B60A 1L8AA 2PKQP 2HMAA 1OI2A 2HSDA 2Y6UA 3QBTA 4WFIA 1KZYC 3FNRA 3E9DA 1K6EA 2X15A 5F7JA 1KIAA 1Y9ZA 1GU1A 5CXXA 1I7DA 1L9XA 5BOSA 1N2GA 1F2UA 4IQFA 2PUJA 4G5OA 2CUZA 3GN2A 2CXQA 2FR8C 3UPUA 1TM2A 1AE1A 2D1FA 1DQRA 4YI3A 4AO8A 1YB4A 4JLSA 5IJ9A 1JVSA 4B6GA 3L0BA 4B82A 4BQRA 1RWWA 4IEEA 1TMGE 4DIBA 4PGAA 2Y76A 4L50A 4GOKA 3UWOA 4YC7A 3EQ6A 5JXJA 2C8VA 2IRWA 4PXAA 4U3JA 4N6GA 2XXAA 2MR5A 4ND5A 1WBBA 2W4QA 1LD3A 3A37A 1UL1X 2HDOA 3TQQA 3I64A 2IGTA 3GH3A 1DAHA 3SMVA 1CT9A 3NDRA 4WCFC 3ZD6A 4D9BA 3A4NA 3EJWA 1ZESA 3IMCA 1Y82A 4JNCA 3TIVA 1GAEO 1D4OA 2WYUA 3C5HA 1UINA 1Z39A 3OIWA 1RPNA 5E6UB 1GPKA 4K05A 1E1CB 4MGEA 5JRJA 1CZUA 3V4PB 3D4BA 2Z2ZA 5FORA 2FN9A 2OFXA 1J00A 1P80A 2UYYA 1XAIA 1MH9A 3DH0A 3RFUA 3WYFA 3AF6A 4YIHA 4YUWA 3U1BA 2WIDA 4R1NA 3WOVA 1KSJA 3LVBA 4TXLA 2AI1A 3PSAA 1J2TA 1VIVA 2ADFA 4WVLA 5EHGA 1GSAA 2V6GA 5L3QB 4UAVA 3JQ9A 3Q41A 5DU2A 4RQBA 1NQOA 3KQTA 1SXPA 4DZZA 1B73A 1G8HA 2PAAA 4JU9A 4OLAA 3N7AA 4MIYA 4I1PA 2BHRA 1PEKE 5DHTA 1TFRA 1SB8A 3K2IA 3KYCA 4FHFA 2WI8A 4FZ3A 2AN4A 4LRYA 3HKEA 4P2BA 2AEMA 1QGUA 4WXPA 2V4UA 4DGQA 3P9KA 2PS1A 3OCZA 2OSVA 3STHA 4UUNA 3G1UA 4Q39A 3D7SA 2WJ6A 4WSOA 4B2PA 2WK1A 1EE1A 1GRNA 4OL0A 1WCWA 3HRHA 2IPMA 3H1GA 3GCZA 1F7VA 3QEJA 5IVKA 1YULA 2FK8A 4MUNA 3LUJA 3MJVA 4JJ6A 5J40A 5HXAA 2N0SA 1SBCA 3D3NA 4RK0A 3Q5DA 1PG0A 3REQB 1QOPB 4D9FA 2JD2A 1XNQB 4ONEA 5CEFA 4QM6A 1Z38A 2OV8A 3NEYA 4MEJA 4M0EA 4YJFB 4KV7A 4LEIA 4NMMA 1R6UA 3W4KA 1QVZA 3LLUA 3VH2A 4BNHA 4B09A 4ML3A 2WICA 1MKYA 1Z17A 3IRVA 3SX0A 2IHTA 3CMCO 1K27A 2Y0PA 1R9MA 3EULA 3CLSC 5FBKA 3SKYA 4LISA 1NWCA 4W9RA 2RD2A 2OSBA 2SICE 2P5SA 1E1CA 5DBEX 3V9AA 3RBAA 3KLPX 3AGQA 2CFRA 4Y18A 2OP1A 1UOOA 1HFWA 3OA2A 5TF4A 5H0IA 1TTTA 3ACBA 1X7YB 1NQXA 2ZU0C 4U0KA 4C7MA 3PVSA 5JEDA 1W5TA 1ATIA 2RHLA 3A0RB 4MS3A 4G26A 3QLVA 2M6SA 3KJHA 4ODIA 4IIUA 3OOHA 4MKGA 3BCRA 1P2SA 3B8HA 2ILVA 4F7WA 2BLNA 3LHSA 4C4SA 1O6ZA 2CNBA 5ECDA 1U8FO 2FF7A 2RSLA 1Y9EA 5IBRA 3TL3A 5B36A 1GRRA 2QE7D 3FPCA 1W85B 4Y6LA 4JQYA 2H5LA 1C3LA 4UZSA 5LU8A 3I9LA 4K6CA 2AJBA 4YT2A 1SUDA 3ZCQA 5FRDA 4D3YA 2FXVA 4DDWA 2P9HA 2QTNA 4Y6QA 1J1ZA 5HOQA 3PEFA 1UK8A 3DE4X 3OLYA 4YPOA 5J43A 3HLYA 3GHHA 4ALJA 4RPHA 2OB2A 1XXHA 4RVGA 2BHLA 4UBJA 1OC4A 3Q6IA 5GJBA 2VNHA 5J2UB 4BEVA 4L7QA 4PG8A 3GJ0A 4EMTA 4EY6A 1JZTA 4MKXA 4I81A 4S2EA 2XCQA 1B8VA 4CIDA 1H2BA 1P73A 1OU4A 1MPXA 4RZHA 1KEVA 1EG7A 2OGTA 3PI7A 5DO9A 1U3WA 3KZVA 4JI0B 3EGVA 1Z5GA 1DKLA 1QZUA 2ZDQA 1ZCZA 5F5XA 3AKYA 3DE0X 2XDQA 3OT1A 1U2GC 4C30A 3GU3A 1DRKA 1Y4SA 1Y5NA 2JFNA 4IHJA 2O3JA 4YVFA 2JHPA 1ULZA 3I58A 3ORHA 1VBKA 3CSDA 4XJSA 4PV7A 2GI4A 1PNTA 3HB5X 4ZN6A 2MSLA 2PRIA 2HADA 4RESA 3UHJA 1UWVA 2JDID 1GU7A 1LBIA 2JHFA 3DP9A 4U2DA 2W6ZA 5BN5B 2XZPA 4MJLA 2V98A 2GFQA 2HIGA 3DFKA 3GDFA 1V7PC 4KP7A 4UJ3A 4BOYA 1M2EA 4CEIB 4KG7A 5DGCA 1MU0A 3IDAA 1PSZA 4L4UA 1R27A 2CBZA 5EWMA 5HR5A 3VR4D 3LY5A 3QPCA 3NYWA 1YL6A 2CY0A 3M6WA 4RA6B 2WY2D 4AUEA 2XE4A 3WVNA 3CX8A 3F98A 4MQEA 5JSYA 3BMNA 4RU1A 2ZI9A 4Q3CA 4AS1A 1D4ZA 1WBDA 3WIDA 4E2WA 4ZJPA 2W93A 4QJ3A 3SBXA 3AVTA 2CNLA 4QUKA 4I6GA 3NTLA 4JEMA 4K28A 4FD2A 2WE7A 3IKJA 3A1EA 3LP5A 4WV3A 3I2FA 5H83A 2G0NA 2OY0A 2WFAA 1C1DB 1I4TD 1NQUA 3BF7A 3VHQA 1NN0A 4QLAA 4U6NA 5FTJA 2GXAA 4H6PA 4GYWA 4PY2A 2IPXA 1RVV1 1DQZA 1WBJB 1WDKA 3A6GA 1WUJS 2JVIA 3BWBA 3IERA 3EXAA 3QHQA 3OPYA 3MAAC 5GJCA 5A9TA 3MMPA 4EI9A 3QF4B 4MV4A 4EY4A 1B6RA 3SYTA 5A5FA 5E6SB 2IXFA 4R40A 1JQBA 2RG7A 3FOCA 5U9CA 4JS0A 1WRBA 2QY6A 1Q21A 1R2QA 3RSCA 5EQDA 4BX8A 3EFOB 1KYIA 4F2HA 2O8BA 1W30A 2AZMA 2GN9A 3FIUA 4PG6A 4RY8A 2H4ZA 5DX0A 4CT5A 4AJ2A 5HE9A 4GYYA 5TQJA 4Q4AB 4NZNA 1W88B 3VISA 2G17A 2VPWA 3WBJA 1HETA 4G97A 3RTBA 4B40A 4DJJA 2FEOA 4NCAA 4CIWA 4YJHB 2BTEA 3Q7SA 2VJQA 4G1CA 4HGNA 1Z6GA 2CCKA 3IAS1 4DHWA 3IPLA 3OHPA 5FUVA 3HL0A 4TWBA 2QRZA 3QLJA 4EA9A 2C8KA 4OKNA 2HBYA 3PWKA 4GX0A 4NU6A 2I4OA 4FBLA 1ZUWA 4JX8A 1JDSA 4J1TA 1E9FA 4ZQIA 1HDOA 2GPSA 2VO1A 3AR7A 4DBZA 4ZK2A 3LRXA 4YRNA 1O94D 3T06B 1ZJYA 2GR9A 1EB8A 3FKSA 3OIFA 3T7KA 2OGWA 2VUUA 3B48A 1XO1A 2EKDA 4FNOA 3GT0A 4ZAFA 1JHQA 1XYYA 1PJBA 5BRAA 3EMVA 3NM4A 2GQ0A 3W6ZA 2W8BA 3WDSA 1XJQA 3CX4A 3SR0A 3CZAA 3NBQA 3HDVA 1W4AA 1B93A 4EF4A 4KQKA 1MC1A 1CUXA 1LW7A 3AETB 3S5UA 3U6KA 1OFUA 4Q05A 2MJLA 4MUGA 2XGSA 3OY7A 1V4VA 3ELWA 1OA0A 4MEBA 4QWWA 3H1EA 2WIBA 3OCCA 2ZT6A 5FUYA 4LOAA 1QGAA 1O8BA 2WB4A 1SVLA 1KJYA 2I2FA 4P4SB 1EM8A 4W7HA 3TZEA 3WGTA 5C32A 2Q1WA 2C59A 4CL8A 2D3WA 3GLVA 1R10A 1PR3A 1AK1A 5F2EA 3TD2A 2FZCA 1A2OA 1RXCA 4PBSA 3IVGA 4V1CI 2CLIB 1TCCA 2F9FA 1SCJA 3FTCA 4R2MA 3WBBA 2R6R1 4F60A 1RRFA 2P2CA 2ZJ1A 3OIVA 1JECA 3F3MA 1N5DA 3CW2A 2JHGA 1PX0A 1ZHFA 3ISVA 3K8ZA 4EYSA 3M81A 1G60A 3PLNA 4PPGA 5CVUA 3E15A 1R8QA 1PVVA 1TEXA 4NVRA 5EINA 3TI7A 2MYUA 3UN1A 2IEDA 3WIBA 3F46A 1UKYA 4OGWA 3NIGB 3AVOA 3CG4A 4JJGA 4ASUA 3M83A 1VGVA 1JILA 4JBYA 1VG8A 1E7WA 3AIKA 1M2NA 2X5NA 3IP6A 3L7MA 3ZBTA 1GT6A 4RABA 1Q3KA 1Q2XA 3HBJA 3BBLA 1G1MA 3QOFA 1OYWA 2CNOA 3A04A 2AJ8A 2IC5A 1XMJA 3LAWA 2V97A 2RIRA 2YWBA 3N2ZB 1JDUA 4LWZA 5D8DA 5A6SB 1R6DA 1ZMOA 3CKLA 4ZI2A 2JG3A 1U0EA 2WIAA 3G9QA 2ZCVA 4U5QA 3UB4A 4EA6A 1AKTA 3WISA 2FDXA 3L7CA 4MO2A 5KJ1A 3T4XA 4OAPA 3AIIA 4K1XA 4CM9D 4BV3A 3G2KA 4PYLA 5SZJA 1FMTA 2F3QA 4N4AA 4P92A 3EQ9A 4QFMA 1O1YA 2YJ5A 3W5DA 2GTPA 2OAQ1 3EDOA 4BNYA 1DIGA 4GXQA 4TUYB 1PZEA 4CHTA 4DMMA 1Z2CA 2E9SA 2AX4A 1PJ3A 1XF9A 1U0JA 1U3CA 2DHDA 2OO5C 4GVLA 4JCCA 4MVJE 4YMWA 2UYOA 4UUBA 1QUEA 2NG1A 4C78A 4RCYA 5KDLA 4TOIA 3IHLA 3PT5A 2UXBB 3HDQA 1OLUA 3EW9A 2OYCA 3L1IA 5ALXA 1UC8A 4I19A 5B6IA 5AVTA 1T0UA 4ZOLA 2Z1NA 2C9YA 2W6JA 3DV0B 4RVNA 3M4YA 4F93B 2O1XA 3ITNA 2LUOA 2QNIA 1J49A 1D6JA 2QZJA 1SK8A 2B2NA 3CLRC 4WI1A 1C4OA 4CLRA 3TS1A 2C4NA 2CV1A 2ZYDA 1EIWA 2FWMX 1XFAA 2QMEA 5CJJA 4KSYA 5GQSA 5LL6P 5JWRA 4KZKA 5IJWA 2IVZA 3ZHQA 3JPYA 1QHIA 1FVOA 3EDYA 2ATEA 2HSGA 1RHJA 1SZPA 1H2AS 2JDIA 5HCNA 4W8GA 4MW1A 4RZXA 3R7AA 2QEQA 3A1CA 3N6RA 2FHSA 1L6IA 5JSKA 3D3WA 3NRCA 3OAAD 3B9PA 1EFTA 1AKNA 4ZOLF 4O2AA 4BO5A 3VR1A 3FGZA 1W1WA 1IEQA 3SJ7A 3UENA 1LK0A 2UUOA 4WKOA 1R3UA 3UQYS 3WE7A 4BFVA 1ULBA 1U3GA 2CMDA 3KEFA 2Y1EA 4OBEA 3C6QA 5BY2A 3OLVA 4ITVA 4EPWA 1L2TA 2FEWB 4LQDA 4NL4H 1WZ2A 3MCVA 4V0KA 4I3HA 4QYTA 4MAFA 3BL8A 2I2AA 5FP0A 1R0YA 5JVDB 1VPWA 5DM1A 5E4YA 3T35A 3C0KA 5BP7A 3RIHA 4OBWA 1X1QA 2HPHA 2FMTA 3TLKA 3SZLA 2V7VA 3DAYA 1YDHA 3RV3A 1L4EA 2V7XA 1R18A 4C4OA 1PR9A 2IDKA 1BSVA 4J7CA 2FG7C 2R8PA 3FX2A 5ITZB 4OL9A 2G9ZA 4A82A 3R6TA 4B8YA 4FDLA 1UKAA 3FWKA 4G2TA 1ZK0A 4ZVPA 4UDYX 4BMNA 1BTOA 4Y9SA 3E5MA 3OJWA 4EYQA 4LY9A 2GZSA 4URZR 5HUHA 2VXBA 3NAMA 4HF7A 3OPYI 4PIPA 4B3GA 2RG1A 2XZTA 1MR3F 4MH0R 5CT9A 2D6FA 2IZZA 3JVVA 2HK7A 4OMFG 3L8EA 3E53A 5J5AA 5A02A 4Y30A 2DTDA 5CDSA 3NKLA 3Q4GA 4XFJA 3UH0A 1HL3A 1T9GS 1ZSNA 2A1IA 4LCBA 1F6DA 3KEMA 5CFMA 3PWTA 3Q9LA 4WUVA 4P7JA 3OJEA 2AUTA 3EIUA 4I46A 2PVPA 1B26A 5K0GA 2I54A 1XEXA 3ANXA 3EBOA 1XD9A 5H02A 4TXJA 5AJYA 1GFWA 3FF4A 5KX5B 2XB2A 3AVWA 4LDPA 4R41A 4X90A 4EUKA 1TZ2A 4MPPA 3RC1A 4YRPA 5I7OA 3DEFA 1TQDA 2AG8A 3VNAA 4D45A 3LDHA 1J22A 1N2IA 4CW7A 2E7ZA 3RUDA 1V5FA 3G9TA 4Z9YA 4IS3A 4BNVA 2FRVA 2R6AA 3SHVA 4KBYA 2C5EA 4DR4B 5LYYA 1IAVA 2GF2A 4GGOA 3USES 4C2TA 2B7BA 2HWWA 3JQCA 2DPGA 1XKTA 3KT3A 4IV5A 4KQEA 4MPDA 4CM5A 5C35A 4A2PA 1L7AA 4FR2A 3BORA 4KAXA 3RFCA 2YJZA 4N5IX 4EQ6B 3HZOA 1J2UA 5ENZA 5CFZA 2A3RA 4TL8A 1KI6B 3UGQA 1G8SA 3SQWA 2P0YA 1LRJA 1MJ5A 3DT6A 3E6AA 2CUTA 4KVFA 1A97A 3V97A 1NW4A 3ZDFA 3DQZA 1IE3A 1UAYA 3FZGA 1YRLA 2NXJA 3IHWA 3OJ0A 3U7HB 3TE6A 1YVPA 1O9BA 4DZRA 1D4AA 1KVSA 2FPIB 1ZIDA 5KC8A 5JVDF 2XUPA 2W6JD 3MGAA 4J0HA 4F92B 1HKUA 1EP3B 3BJIC 3H8SA 3JALB 4US0R 3SQNA 3WNQA 5JANA 3LTNC 3KYBA 3OWOA 2CSUA 3H13A 4F1WA 5KOHA 4LE0A 1QZTA 1U02A 2XECA 3EA5A 1CLUA 2ABWA 5EIWA 2JB9A 1TXGA 1FDVA 5JDCC 3HA7A 3HWSA 3LUPA 5JQGA 2ZJAA 4YXWD 3WSTA 1RAGA 1PRYA 1ZUHA 3L6UA 4M8SA 4OYRA 4CL0A 4DF3A 1KI8A 4LFAB 4TXMA 2C7RA 3INNA 1FVXA 1QK4A 3K4HA 2I1WA 3HVJA 1XJ0A 3DFZA 3RVQA 1NI4A 1TT7A 1K6MA 3D5QA 3LBNA 2WJJA 3LWDA 4H31A 2DXIA 1IHPA 1UFVA 4CLRB 3AFIA 4G0ZA 5EGSA 1VYUA 4F9GA 4BV8A 3FOWA 1P9NA 4CRWB 4ES6A 5K3AA 1D5CA 1MXHA 1I7QB 4NQZA 5FOQA 3FVVA 3FUCA 4MI9A 5B1SA 3DOJA 2H0RA 5G4LA 2N42A 2XMCA 5FFMA 5K3SA 4C3OB 3J80A 2JS7A 3NAQA 1LF0A 2VRBA 5JXHA 1YO6A 4DLBA 5JD6A 2ZUVA 4KGZA 5EKXA 1PL6A 5HKLA 3TNLA 3IUPA 3OCYA 4CIBA 4PTZA 1CP2A 2PDAA 4NRDA 4OXYA 1KBZA 3EWSA 5JYDA 1KQFA 2PYDA 5G0VA 4OHYA 1GZHB 3OU7A 2VHTA 2PEZA 4NZ9A 1CIVA 1UC9A 1PYGA 4K03A 1JG4A 3WLMA 3RKSA 3AC0A 3I8OA 8ADHA 1Q1BA 1ORVA 1E62A 1LY1A 2J8ZA 3NUQA 1ICIA 1VKZA 1KH2A 4ZVTA 1Z88A 2OAP1 2EQ5A 5EWJB 1DBIA 2PRKA 3ZWAA 3FCUB 3RU3A 2R86A 4Y9UA 4B2YA 2EFGA 1DQSA 1X6VA 2AOUB 1A1SA 4TGLA 5ER6A 4EUFA 4HNVA 3IUSA 3DC7A 3M1AA 3WRXA 2H7CA 1NURA 1PGNA 3SOZA 2CLEB 4JUAA 1RXVA 4AF8A 3BMOA 5A4JA 2NUAB 5ECGC 3NHSA 1XHFA 2BKEA 4FI3C 4JLVA 4WADA 5SICE 5LOVB 4BKPA 2VCEA 4YAGA 1C2YA 4H1UA 4HDMB 4KMOA 4EHFA 3ORQA 1XZCA 1EK1A 2E1RA 2H8KA 4MQEB 4CFZA 2R8XA 1ZGBA 3JQDA 2UUPA 4FJ1A 3I9OA 4B9EA 4S05A 2FDCA 1NJ5A 2BUAA 2J5QA 4WLNA 4YAFA 2ZRBA 5EWMB 5CFOA 1GCGA 5LQAA 2GN2A 2IBMA 1ZK3A 5IZCC 2QTAA 1GNQA 4HDKB 4FOOA 1IZ9A 4RF3A 3OZFA 4BE7B 3WFZA 4CIVA 4GSKA 3HRIA 4N3AA 2GUGA 4JJ8A 1BKDR 1GAWA 3AF4A 4NOMA 3U7JA 5KJEA 2R6ZA 3AK4A 5BORA 1G20E 3F7OA 2YWFA 3FTNA 2ZG6A 1WZNA 1VG9B 2BM1A 1JXOA 2GK6A 2V5UA 2V6JA 2E5LB 1GG2A 3H75A 3PFKA 4FXOA 4PLYA 1ZY2A 3P2IA 3AR8A 2VJYA 4XEHA 1RLIA 4UTRA 1N2ZA 2JI4A 2WE8A 4P7KA 2P2YA 2X0JA 2OWDA 4ZVUA 2B1RA 3K31A 8AT1A 3D1VA 1EI9A 1KR2A 4P31A 4UM9D 3NS7A 4W8OA 3K2EA 3NAZA 3LUHA 1I3MA 1K7EB 4COOA 3FKQA 2BOVA 2Z1DA 3SZGA 4C7KA 4DY4A 1KIFA 3VYUB 1GGFA 2REOA 3FGOA 3U31A 4MS4B 1N2CB 2WWHA 1TI7A 1ZD3A 5AKKA 2B8EA 3ZY3A 5EXDA 3I61A 1KZ6A 5K4GA 2HXYA 3P9IA 3VPBA 2FSUA 2IQ5A 1GU0A 2V74B 1RQNA 5JNLA 4KR2A 4QARA 3T7DA 3AUSA 5LBUA 1H1TA 2ZJZA 1XKXA 2SHKA 2NTVA 2JCSA 4GVXA 3P0EA 5DT2A 2GFHA 3EBPA 2VT3A 1NXTA 5HUQA 4L51A 3OJOA 4UNIA 4JI8B 4MYRA 4C7JA 3CF4A 2PWAA 2WM3A 3LF2A 4ETMA 2WJAA 3PG5A 3PFCA 1JG6A 3N05A 1JWBB 4QA9A 2I6XA 1B6SA 3R44A 3GJ6A 3RDPA 1K0FA 3V6MA 1XZKA 5M3BA 4AJ4A 1FRVA 3CY6A 4EP1A 2DKFA 4CL3A 3FGPA 2YZMA 2Z5FA 3AP3A 4OG2A 3OIYA 3VKHA 4DV7B 2Z3ZA 1I01A 1F38A 3EMKA 1ZVJA 2QRVB 5ALMA 2VP2A 4YAWA 3LY8A 3RC7A 2V9ZA 1OILA 2I76A 3RTEA 2PGLA 1N0UA 1Z5OA 3DDCA 4LXIA 2CEKA 1SVUA 4RK5A 3F6PA 3WWDA 4LI0A 2O3UA 3DYVA 4MROA 1E2KA 2VAVA 3QYAA 5DLYA 2CB0A 4B83A 1G5PA 1RXIA 4TQAA 4DSAA 3FE2A 1Z7GA 3RRBA 1XJ5A 4RFSB 1WPXA 2ZM5A 3AZOA 3GGPA 3DTYA 2GKGA 1BE1A 1YVUA 3MGGA 5ERGB 3SQXA 4TYYA 5HJ5A 3REQA 4XIFA 3EUFA 1FQOA 4AP6A 1GLNA 2ONYA 2YXPX 4X6LA 4F46A 3AUAA 2ATVA 1C80A 1G2OA 1BDIA 1GPDG 3AI1A 3KDPA 3SC2A 3REGA 3MGKA 2HCRA 2FVXA 3B53X 2NSYA 2O1WA 3A26A 4WJZA 3PNOA 5ALKA 1YZQA 1ZD9A 4X1KB 3T5AA 1UJBA 1Q57A 2FEMA 4KIUA 3JZMA 4E2XA 2O5VA 4B4UA 3ZDZB 1ISSA 1N0IA 2CVHA 3L4JA 1TIKA 2OBMA 2GF0A 1JMVA 2G4VA 2IU0A 1V5IA 1TECE 4DIFA 2IIQA 2P1DA 1RM4A 2GVNA 3UGJA 2MTBA 3CBGA 4FE3A 1PQPA 1FFYA 3NIFB 1RRCA 3WLPA 5KYGA 2Y05A 1KL7A 1W2GA 4R2LA 3HP7A 2C42A 3T0GA 3YASA 4EEZA 1N32B 1BU8A 4M3NA 4WKNA 1O03A 1AJEA 5AHRA 1OHHD 2AW3A 1VPLA 1KVUA 2C3UA 5KNBA 2AC2A 2JH3A 3LUKA 4LYJA 3DNPA 2VF2A 1G6KA 3CZQA 2Q3EA 2P9TA 3FNFA 5DP2A 1Y3IA 5HCIA 3SJAA 4BO9A 3EUEA 4EQZA 1W581 4MUKA 1GYPA 3QFFA 1I10A 2ONJA 2QVLA 1NMSA 1WHTA 2Q4OA 4CMKA 4UEKA 2X77A 3KALA 1BVUA 1UK9A 2ZSAA 3ADKA 4EHKA 1RWXA 3WLTA 4OO3A 4U6SA 3GR6A 4BNKA 3NBUA 5KZMB 4L8WB 1F12A 5HM6A 1U2DC 2VOJA 1T2DA 1ADBA 4KXQA 4NDAA 4QFDA 3U19A 1U9IA 3K1ZA 2VDVE 5EI5A 5K3BA 2HDWA 2HIAA 1X13A 2VEDA 2BMVA 2CJFA 2D54A 3RBXA 4A26A 4B8WA 5FLEX 1W75A 5BN1A 3NHRA 4D41A 3GWZA 1MH1A 4LBZA 4Q3DA 5BRJA 5DYYA 1Z18A 4KU4A 1F2UB 4ZDIA 2ORVA 1