1JTTA

Degenerate interfaces in antigen-antibody complexes
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
133
structure length
133
Chain Sequence
DVQLQASGGGSVQAGGSLRLSCAASGYTIGPYCMGWFRQAPGKEREGVAAINMGGGITYYADSVKGRFTISQDNAKNTVYLLMNSLEPEDTAIYYCAADSTIYASYYECGHGLSTGGYGYDSWGQGTQVTVSS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Vh Single-Domain Antibody
publication title Degenerate interfaces in antigen-antibody complexes.
pubmed doi rcsb
source organism Camelus dromedarius
molecule tags Immune system, lysozyme
total genus 35
structure length 133
sequence length 133
ec nomenclature
pdb deposition date 2001-08-22
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1jttA00
1TXKA 2R39A 1CGSL 4ODVL 2ZOKB 4X4XB 3HC3H 4D9RD 4U1SB 1YECL 5ABDE 1XF3A 2SEBA 4JM2F 4X4MA 3UTSE 4P46B 1G84A 5INCB 4C4KT 4O2FB 1S9VB 5BMFH 3D85D 5T3ZH 4AQOA 1FCCA 5ESVB 4RWYH 5IVXB 4G8GE 2XZQH 4TYUA 3P9LA 1KJ2B 2JCCE 4HIHA 2IPKB 4UILH 4HKJB 3OR6B 3UX9B 3NACL 1OGAB 5F9JA 1OAQH 4KVCH 3HN3A 1P4LA 3ISWA 3MJ9L 3PDOB 2AJVH 4JFFB 1E4KC 4FQLL 4NKDB 2I60H 4U3HA 3L3JA 5D1XC 5DEFB 3QPXH 5HYSG 1DQDH 1ETZB 2G5BB 2OX5A 3PL6C 5EU4A 5C92A 1IAOB 1FZOA 1CK0H 5DT1L 3UO1L 3H7BB 4QYOA 1LO0L 3CXHJ 4Y5YC 5I1KH 5C71A 2VC2H 2IQAA 3X11B 4HPYH 3E8UH 4ODWA 4LSDA 1MFDL 4RFOH 3MFFB 1MPAH 3TT1H 1QFPA 4OI7A 5EZJA 3QUYA 4LOUD 1XZ0A 3WO4B 1Z9MA 2CLZB 4M7ZB 4JFHE 2DYPB 4IRSB 3MRBB 1QFWI 4OZIE 1MRCL 5JW4Q 3O2DA 1UB6B 4NQXB 4E0RB 3IJHB 4UTBL 1XF5A 3RWEB 4Y19D 4JAMA 4JKPL 3GHBH 3U1SH 4M7JH 1NJ9B 2AS5M 2NY4B 2VO5A 2QQQA 5FM5M 1QRNE 1UWXK 1EZVX 4OM1H 5D1XD 3GSRA 2XKNB 4ZUWB 3PL6D 4CMHC 1HXMA 4WTZG 3GUTA 3P77A 4HS3B 4H25B 2FX9H 4E41E 1AO7E 1VGKB 2AI0H 2I25N 4R8WL 1UH2A 3RZCC 2E7MA 3TBWA 3H9HB 2ZJSL 4GAYA 3GSWA 1PVHA 2N1KA 5FYJH 3QQ4B 4N8VA 5FF6A 4YXKL 4BM7A 4Q6IB 4YDJA 1I8IB 2WV3A 4ZOBA 3OKMA 4K7PL 1SMOA 2YBRB 5IW6B 4FRWA 1RURL 4YHZH 1FZMA 2LVCA 4PRDB 3OZ9H 4RX4D 4W4OA 3GB7B 4JRXA 5E6IC 4YQXL 3I6LE 1KN4H 5CGYC 4LPCA 5HYIA 1HI6B 1ZLUK 4MNHA 3KPSE 4XNQB 1AQKH 4X7TA 1D5MB 1MF2H 2KZWA 1T6VN 1YUHA 2Y7QB 4Z76B 2AJ3B 2CKBH 4XMLH 4R9HA 1XCQA 4NFDA 2IBZX 4ZDHB 4LEXH 1VERA 1OCWH 3TA3C 4U1GB 3T0EC 2NY0C 1IQWL 3O9WA 5AD0A 2QBWA 2FWOB 1HZHH 3I3DA 1PYWA 1V3MA 4ZD3H 4GG8B 4QHNA 3JVGC 1ZHLB 5C2BL 4WCYH 5KVEH 1AHWC 3MC0A 2FO4A 2Z0BA 2VJXA 3PP3K 5FYKE 5C9JB 1UWGL 3AS0A 3OG4B 3N1PC 4M48L 4LGPB 2Y1VA 1LO5B 4H88L 4LU5H 5IF0A 1GGBL 2LAAA 1QBML 1JNNL 4OD1L 4QCIB 4C83A 1MLBB 1URLA 2PXYC 3QDGD 5E8OB 2JELH 4LLQB 2R2BA 4Y2OA 5CGYD 2F19L 3MNZA 3T08A 3H8NA 1BQHB 2PR4H 3VFGH 1YPZA 2CKNA 5ADOH 4IM8A 1UENA 2O5XH 4Y16A 3RIAK 3WXWH 3QFJB 4MX7A 1T89C 2ADGB 4ODBD 3P4OB 2DQUH 3TGXA 3E6FA 2Q8BH 2OZ4A 2CLRA 2EE3A 3K74B 3EOTH 3TA3D 5IVXF 3ZDZE 4FFZH 2DL9A 1H3WM 2FJFB 4Y5VC 5ADPH 1G6RH 2WUBL 3D39A 1KLFA 5CILL 4X6EA 2I9TA 3MV7A 1XGTA 2HTKC 3RGVC 2GUOB 3L3OB 3CFJA 1JHKH 4X8JA 3IU4H 5CSGA 1XEDA 5EC1A 3V4PH 3NIDE 1A6ZB 3UTPD 4YGVB 4UUJB 1W72A 5F89A 4WWKB 3FQNA 2X4NB 3LN9A 2B8OT 4ZSOE 2X4PA 3RL1A 3O4OC 4XPTH 2ESVA 1FBIL 4F15C 1NUFA 3HHRB 4OLZL 4QY8B 2R0KL 5E4EB 3VGAC 1WSST 3CLEL 3AY4A 4NQUA 4PY7A 2KQNA 4P3CH 3H42L 4XP6H 1EMTL 4HKZA 2CRZA 6CGTA 3WSQH 1U92A 3SO3B 4QRRE 1G0YR 1MREH 2GAZB 4HEME 5MEQB 1DL7L 3JV6B 1OSZB 1R3JA 1L9NA 1NMCB 3K0WA 4CUCA 4PRHB 1MUJB 4KMLB 4JKMA 3S98A 4R4BB 1UZ8B 3KYMB 2HTKD 5CGMA 4OLWL 4J3SA 5FYKL 1I9IH 4JM2A 4HUWB 3RHWF 3MV11 3H3PL 5D8JL 3ARDC 4JFDB 5GGQL 4DFIA 3V52H 4YDKH 2PCPB 1S8DB 4KQ4H 1DEEA 2Y36H 1JRHH 3GIVB 3HI1B 4NO0B 3VXTB 4ODUB 4FG6C 3VE0B 2A6KA 4MCYB 1C5BH 2C3VA 2DDQL 2DOCA 2O61A 3O8XC 5B22A 1JFQH 4APQB 5E08L 5FM5O 1KCUH 4UB0L 2MSPA 1JGUL 3G6DL 2DWDB 3L5WB 4OD2A 1DE4A 4OF8A 1OWWA 3VWKC 5T1DL 2UYLA 5IVXE 4P2QD 4G6AC 5FO7A 3ALWA 1G7MB 4Z78A 3ARXA 2JKXA 2N56A 1C16B 5M7QA 1MCOL 2E6QA 4M7KL 1PW3A 2LQRA 4ZS7H 1PG7H 2V17L 4I18B 1M7DA 2WINB 3WS3A 3HAEA 4M6OL 4JFFE 4DGYH 1I8LA 5DD6A 1KJMA 4J4PD 2F54B 3QRGH 1F4XH 3RPIB 1MNUL 2WP3O 3WS6C 4M1GL 1JPST 4KUZL 5J11B 1A6UH 1NCTA 4Z95L 4WU7B 1Z9OA 3QHTC 2W0LA 4YDVB 3ILPA 3ARDD 1CZ8H 3AB0C 3P11L 4AIXA 5TQ2H 3EYSL 3GMRB 1IC4H 1GGIH 5TPWH 2JB6A 2VDQH 3FOLA 3G9AB 4G9FA 4ZUSA 4PD4K 5EZIH 1S7QA 4PRBB 1JWUB 4UINH 3W81A 1V5JA 2FYYB 3T0VA 3BSZL 1ZHNB 2Q86A 3BPCA 1OTSD 1PQZA 3W9DB 2EYTA 4KI5D 5JORB 4G6JH 1N4XL 3EJYC 4IRJB 1SYVA 3IT8D 1AR1D 2EDWA 4Q58C 4RGNE 1EJOL 1EVUA 4KKBD 2QSTA 4G6AD 3SE8L 3CFIC 5F9WB 1BZ7B 1MAJA 4JDZA 1RMFL 4V1DD 1VGEL 5F6HI 5JHDD 1BFVH 2VQUA 4IMKA 2DQTL 5I2IB 4D2NA 2BFVL 2DBJA 1BGXH 1LNUA 5DGRA 1P7QB 1JNLH 2FLRT 5IHUL 4OFVA 3S4SB 1K5NA 4KK5D 5DEZA 2YC1B 3I2CL 3RJQB 1R3LB 3ARGD 4P2YA 4K3EL 4MA1B 4C58B 4DGVH 3M07A 1PY9A 4Y4FA 4Q9BA 1TJHH 5HD8C 3SN6N 4R0LA 1S7XA 5J1AB 4NQDA 4Y89A 4MXQC 4F58L 4Q0XL 4PRNA 4AZ8A 3O0RH 4YHIB 1UXWA 2X1QA 5D1QC 5ACLA 1U8LB 4WEBH 1FG2B 1MFBL 1N6VA 4NZTL 5D1ZA 1MHPL 2WK2A 2D7TL 3GBML 4NC0B 2E7LC 1F3RB 4DEPB 2F53B 4PGCB 4ERSH 2W0FB 3S36X 2OTWA 4KY1H 4PJ9A 4HMEA 4PJXB 1KJ2L 2VAAB 4F9LA 3UZEA 1XGQA 5CWSB 3AU1B 3WHXB 2D7MA 5E4IA 1X7QB 3DRTB 4PBVC 3DHMA 1LDPH 1VHPA 3GJEB 4C56B 4QXGH 2VMFA 5EC2B 4LRIA 4JN2A 4CKVX 2F58L 4L8DB 3CFDA 3DMMC 3QEGL 5IHZA 2FB4L 4GLRH 3A67H 3NGBB 3KLHC 5C0JA 1WWCA 1A4JB 2NQCA 2X89D 2IQ9H 2QHRL 2ARJQ 4R26H 5DURD 1Q9LA 5D71H 3W0WB 5AAMA 3IVKB 2ZOKA 4NFCA 4X4XA 3TNMA 2IANB 3UJJL 3V4VL 4Z0BL 3TESA 1SVZA 5GRUH 3IETB 4P46A 1J05B 4FQCL 4O2FA 4HH8A 3VW3H 1S9VA 5DMIL 2HTLC 4XAKD 3QHZL 4NN7C 5EZOL 1RZ7L 1UADC 4XH2B 5IVXA 3QIBC 2AXGA 2X1PA 3JUZA 4DKFH 2IPKA 1OW0A 3QSKB 4HKJA 4WHYG 5H37G 1OGAA 2P5ED 4H8WH 3T4YB 4XC3L 1U3HC 5BV7B 2Y5TB 3PDOA 5KG9A 3LPGA 4NZJA 4OGYL 4YHML 3NIGE 4NKDA 3GMOB 3QQ9D 3SOBL 1D5XA 4Y8DC 3LPWA 4WI9A 4OLXL 1IAOA 3KLHD 1RVFL 1DN0A 5L88L 3SDXB 1HOCB 5KJRH 1VFMA 1P5UA 3UJTL 3UTTB 1MCJA 5BQ7B 3O3DB 1HSAB 4YHOL 5KN5B 4ZS6D 4OZ4B 3MFFA 1ND0B 4RSVA 4FFWC 2O93L 3K2MC 4TUOA 5DHVB 2XA3A 1A3LH 25C8L 1IAIL 2QTEA 4PFEA 1UC6A 3IRPX 4IRSA 2VABB 1HWHB 3C8KB 4JY4B 3ZYIA 1HILB 4L9DA 2OYPA 4FFVC 3IJHA 5CCKL 3L9RB 1NBZA 2QSCL 4LL9A 5I9QB 2V5RA 2Q76A 3HNVH 3LMJL 2VSDA 1I4FA 3L3IA 3NCJH 4HT1L 5FYLD 5F8QC 2ZUQB 1V8HA 1NJ9A 4OIIL 4PRHE 2I5YH 2CPCA 4Z7NF 2P4AB 5B39A 1P4BH 2YWYA 3PUCA 4ZUWA 2BHYA 2X4UB 1P4IL 4IOSD 3IXTB 4H25A 5A2IH 1F3DH 4JR9H 3H6JA 2XN9B 1VGKA 2F15A 2QLVB 4JFDE 2A1WH 5ITBH 4U0RB 4B50A 3S5LG 5D72H 3SJVB 1R5WB 3ZTJH 4JPIA 2NXZB 1FCGA 3LZFL 5CSZB 3BP4B 4Q6IA 1I8IA 3VXOB 5HHMD 1VEOA 1YMHB 2YBRA 5IW6A 4GBXD 4FFWD 3DVGB 4OJFH 1YC8A 3HE6C 4PRDA 3GB7A 3NH7H 1HI6A 4I0PB 4QRSB 15C8L 5IB1B 1XF4B 5TDNB 4LSRL 5KANI 2VDRH 4XNQA 3IFOA 3V0AC 1D5MA 4GKSB 1JP5A 1CU4L 2DM2A 3MRGA 2Y7QA 5JXEA 4Z76A 5D96C 3BN9C 2APVA 4ZDHA 4AT6B 2ZKHL 3QDMA 4QRUB 3RTQB 4PJXF 1YYLL 4X0KB 1CGUA 2MKWA 3VFPB 3HMXL 4S11A 1G0DA 2XTJB 3CU1A 5LAXA 1W0VA 3CX2A 1LE5B 2NY5H 4WI3A 4ZQKB 4TUJB 1NC4D 4ZODA 4KC3B 1CXLA 5FHAL 1QFWM 1DUZA 3BE1H 3MACL 3JV4A 1CLYH 1U8PB 1YNKL 2JIXA 5C9JA 3FO0H 3VWJC 1PGRB 2QQLL 3MCLH 4ONGL 3WUWA 4M61B 5E2WL 3K4DA 3VXSA 1QYGH 1HQ4A 4XPAH 1I9RH 4LRNH 1AIFB 3SGEH 1MLBA 5E8OA 4LLQA 3EO9H 2WUCL 1KEGL 1GIGH 4KKCD 3VFUB 4X7EC 1UKSA 4FQJH 1BQHA 2IGFH 3KNBA 3NVQA 4EQ2A 2M1KA 3QFJA 4Z7NE 4NN5C 4NNYB 3BN9D 3P4OA 3P0YH 1EJ6A 4X9GA 1DSFH 1JF1A 1BLNB 4HUKB 5T5FH 4R7DB 2ARJA 4G5ZH 4OCYH 5FDWA 1ONQB 4P57B 1YEFH 2AERT 2E9BA 1SMAA 3LD8B 4S1QL 1HHKB 2YZ1A 3CXDH 4OD3L 1OP9A 5DZNA 3AXLA 4LSQH 4NQEB 4P5TB 3WNPA 1A6ZA 3RUGA 3BPLB 5I8CB 4JFPB 5D6DA 4UUJA 5F7EH 1EBPA 4WWKA 3PXJA 3W11D 4BZ1L 3MMEB 2XZAH 3FZUC 3X3FH 4QY8A 3UTQA 3MRJB 3L6FA 1FIGH 2E5EA 1FH5L 1JVKA 4JB9L 3CH8A 4JCMA 4M43L 3TVMB 1J5OL 1NCAL 4PJXE 1CFVL 2PYEB 3ARUA 1QVOB 5E1AB 2AK4A 2DI8A 1G7JB 3REVB 5I73C 4XRCB 5F7DB 2GAZA 1HXYB 3TO4B 1BJ1H 5IWLA 1RHHB 2B1AH 3JV6A 1OSZA 1FHGA 1JHLL 1N7ML 4KRMB 4OZHB 3MV9D 1MUJA 4YDLC 4HWEL 3RWJB 4R4BA 1UZ8A 3T2QA 4F7PB 4H20H 3RVWD 3U9PH 4HUWA 3BYTA 3PNWA 4HULB 2EZ0C 3HI1A 2R56H 4YK4B 1GXEA 3GMQA 4M03A 4NO0A 2A2QT 3ARFA 3VRIB 5EOCL 1GZPB 1DBAH 2IANE 2D7OA 2XACC 4HSQA 1GOGA 1VA9A 1QR4A 1X44A 4APQA 4HW6A 2DJUA 4TOYH 4KGJA 3GSOB 2DWDA 2VXVL 3QULB 3ULVF 1FAKT 3MSPA 3VXRE 3UBXB 4HFWA 1INQA 5FK9B 3EJZC 4OFYD 1OAXH 1MRDH 1OY3B 5E56A 4K8RC 1QUNA 2HLFD 3OJ2C 3QEQD 1C16A 1WICA 4NZRL 4YUEL 5I19L 1Q9WA 4NP4L 4LQFL 3IAQA 1XR9A 5HVFB 3BFOA 2EH8L 2F54A 4RMSA 3RPIA 2B4CH 4NM8H 3PV6A 5JW3L 3VXMB 4OTXH 4EDXB 3DYOA 1FFRA 4DKDC 4H1LB 4WU7A 3SDXE 1NLDL 1A6TB 3DWTA 2VIRB 3HNTH 3GMRA 2AABH 3SKNB 4ZAKB 4MJID 2HFEB 1FZJB 1TNNA 2MHAB 4I3GA 4PRPD 4WI5A 1PEZA 4PRBA 1U8KB 1FL5B 5EDXA 4EN3C 2R15A 1ZHNA 1YNTB 3FRPA 4PR5A 5IGXL 4FQ1H 2E9WA 3W9DA 2EDXA 1AKJB 2AJYH 3VXUE 2OL3B 2HWZH 4UDUB 5D7SL 3LKQB 1IC7L 1RUPH 2BSRA 4XNUL 4HIEA 3WV0A 3LHPH 1KTLB 1BZ7A 1DJSA 1JPFB 1U2CA 2GT9B 1FVCA 1RIUL 2MCG1 1T7WA 2ICWA 3EOYG 4CMMB 1WWBX 4HQQL 3SE3C 1FO0H 4FNLH 4DZ8A 1QNZH 4K71C 4N9OB 4TQEH 4ODHL 4HMCA 1IILE 5TH2B 4RGMC 3CIQA 1P7QA 3FHAA 4ZXBD 3RVXD 1AJ7L 5A40E 1CL7L 1CDGA 1CN4A 3RIFK 1F13A 2DLFH 3S4SA 4GS7C 1MAML 1KPRB 4UIKL 2MQ3A 5KSBA 3WIHL 5J1AA 2XN9E 5D4QA 4DW2H 5C0DB 3SJVE 4MAUL 1OT2A 1KB5H 3B9VA 1K8DB 1GAFH 1U8LA 1FG2A 1FNHA 5DSCA 4HUXA 2BNQB 4M4RA 3PHOB 3V8CA 4UV4H 1Y6KR 2GY7B 3PGCB 4EN3D 1TZGH 4OGXH 2UZIL 2DJSA 1KB9J 1UB5B 2WWKO 4XT1C 2F53A 4GT7A 4PGCA 1L0QA 3SQOL 1ZS8B 3H0TB 2R9HD 5EOCJ 3P9MB 5I1CL 1NGZA 5I15L 4JRYE 2VAAA 5CWSA 4Z7WB 3AU1A 4DUWA 3QUYC 1S7RA 4AL8L 3QIWD 5E7BA 3OB0H 5BV7L 1NMBH 1KN2H 5DJDA 4OZGB 3UPRB 3GJEA 1TQBB 2DIAA 1LE9A 4WO4D 1U8NB 4C56A 5KVFL 4NSKA 2KL6A 4BQBA 5EC2A 5KSAB 1V7NL 3QT2A 2V2WB 4TSCH 4UQ3B 5BS0D 3DRQB 1VPOH 1X5IA 3U7WH 2APXA 2NNAB 2I9LA 4PJ8B 2J6EA 4OZHF 4L8SB 5L2JA 5EU7E 3W0WA 4G6MH 1YMME 4AG4H 3IJSB 1T66C 1NBQA 1RZJH 1BEYL 2P1YA 4P9ML 1LEIB 3QUXB 5HYSA 3A0OA 3H2WA 1YQVL 4IDJL 1X6LA 1TPXB 4QOKD 2QL1A 3FT2B 5E1HB 1DN2A 3EOBB 1ERNA 1Y0LB 5GSVA 2VDLL 4LQ1A 4FN0A 4KQ3L 3FMGH 4XH2A 3HCVB 1HHHB 3QUYD 4LLWB 4ACPA 4W4OC 32C2A 4Z7UB 3KG5A 3WKNA 3BPNB 3FQWB 5C70A 1PZ5B 4KAQL 5GJSH 5AAWA 1MI5D 1CIDA 3C6LB 3NFSL 2EDRA 4ZNEA 4WI8A 5DUML 3GMOA 2QKIB 1CGSH 3HG1E 1B3JA 3QIUD 4D94A 1YECH 5HHOD 3O9WC 1D9KB 4NQEE 5C0CD 5JOPE 1T04B 2BJMH 3UTTA 2WBJB 1ULVA 2OR9H 3Q3GB 4W70A 3HKFA 5BQ7A 2Y4SA 1T66D 3O6FB 1HSAA 5KN5A 1KGCD 4Y4HD 1ND0A 3TO2B 3SHSA 3L3GA 4WTZA 3SDDC 3X14B 3FFDB 3OKLB 4NJ9L 3SGDH 3Q5OA 2P8LA 5I16B 1TENA 5C1MB 2PYEE 2VABA 3MJ9H 3C8KA 4CN4A 4I0CC 4JY4A 4FQLH 2EKJA 5DJ2B 5AZEL 1QG3A 4XNYL 5ACZA 1ZLSL 3NA9L 5T3ZD 2EDFA 3FHQA 3L9RA 5GGTA 1A1NB 3KPRE 5GGSB 2MFNA 3MRQB 2N4IA 3S3SA 3DO7B 1CFBA 4Y16C 5DT1H 3HC4L 2P47B 3TYFB 3G5ZB 1V3JA 2ZG2A 1QSFD 3VCLB 4EOWL 3L3HB 3PHSA 1MY7A 4UBDD 1XF1A 5EOQL 4CW1B 2X4UA 3HNSL 3IXTA 1I9JL 1G9NC 1MFDH 3VRJA 3BKYL 3NMEA 3FB6A 5H8DA 1M4KA 5E9DD 1R5WA 3VXNB 4L3ED 4WRLA 4R97C 1JPGA 2FL5B 3BP4A 4KRPD 3EYOA 1IZKA 1HHJB 1BD2E 1MRCH 3U82B 2R0LL 3SDDD 4ENED 2VLRB 3PGDB 1MH5B 3VFNB 3U0PB 4UTBH 5C0BB 3ARED 4I0PA 1E4XI 4QRSA 3QAZB 5IB1A 4IBLT 4JKPH 1PEWA 3KJ4B 2H2SD 3ZE2F 3AY4C 4KPHL 1RJLB 4UDTB 4ZFGL 4AT6A 2CR3A 3JTTB 5TE7L 4GKOA 3AFLA 2LE9A 2WLZA 4X0KA 5I1DB 1G9MC 3VFPA 4Z7WF 3O3EB 3A6CL 4I9WD 4P5MA 4R8WH 3MPCA 3AM8A 5E2VL 2W60B 1F00I 3U30B 2YA0A 4KU1A 1LE5A 4YXKH 1KYOK 5DEGA 4K7PH 3ZSSA 3BXNB 2BVOA 4CU7A 4HK0B 1RURH 1DBJL 1ZVYA 1CFSB 3BP7A 4PGEB 3WN5A 4N0UB 4YQXH 2DN7A 4LKCB 2YN3A 4U6HB 4M61A 4QHKJ 1P84K 1F5WA 4JM2C 3FFCE 1EO7A 1I3RB 4GKZA 1AIFA 1UACL 5FYJD 4LVHB 1AXTL 3VD7A 4HWBA 2CLVB 2BSTA 3VFUA 1QSEB 4Q6YA 3MUJA 2OJZL 4PJ7B 2Q6WB 1IQWH 4WW1B 4XX1G 4JJ5A 2NX5D 3KXFE 2FCBA 3U36B 5DJAB 4NNYA 5K59F 2OLDA 2Q1EA 2PYFB 1CI5A 4GXUN 2PO6D 3JWDC 4KUCD 2AW2A 1JV5B 5DO2D 4Z7UF 1ONQA 1UWGH 3RWFA 1MQ8A 4RCAA 4P57A 2GJ6B 1FNLA 4H88H 4M6NL 5CINL 4OCXL 1HHKA 2CXKA 1GGBH 5DK0B 1Q9OA 4POYA 1FE8L 1I8LC 4WUUB 5FUCC 1QBMH 2XG5A 1JNNH 4LCWA 4OD1H 5FUOL 4R4ND 4P5TA 3FQXB 1LP9A 1QFUH 4JFPA 1BJMA 1P1ZA 2F19H 1EXUA 4OB5H 2BCKB 3K1DA 3OAZH 4FZ8L 2BNQE 2LFGA 1RZGB 1GCFA 3S37L 3ULUF 4KROD 2ZNXA 1MAKA 3QDJB 2IJ0C 4TTGA 5FO9B 4QTHB 1MJ8L 1NGXB 4BQ9A 3TVMA 2VLJB 1H5BB 1QVOA 2OI9B 3OF6A 4WTWA 5E1AA 1BX2A 3REVA 3F12B 4XRCA 3CK0L 2WUBH 3C5JB 3KLDA 5CILH 1HXYA 1EO5A 4OZGE 4KJYA 1XIWA 5I66B 5F93C 3G5YB 5K9JH 3OR7A 4OZHA 3PWPE 4IMKC 1FSKB 1BVLB 1MSPA 1H15B 2NW2B 2RBLA 3HUJF 5JO5B 4ZO6A 1F4WL 2DQDL 4L1DA 3N9GH 1FBIH 1WBZB 3EGSB 4OLZH 3I6GB 5C0GA 3TIDB 4OF3A 4FMFA 3LS5L 4PJHB 3TYGL 3P0VL 4D3CL 1MIML 4Y4FC 4Q2ZB 3VRIA 1LO4L 4H0HB 4R0LC 2VH5L 1GZPA 1EMTH 4HPOL 3WBDA 4MCZB 1WZLA 5E8EB 2OL3L 3ZHDA 2BVUA 3MOAL 4RMRA 2V5TA 3BIKB 5D1ZC 3G6JB 3B5GA 1DL7H 3TC9A 2W9LA 3QULA 1NLBL 3UBXA 4PJGB 4P4RB 1QO3A 3FT4B 4JKWA 2BHUA 2HT3C 1EEYB 5FK9A 1NGYB 4F7CA 1QLRA 3EW3B 2EDYA 4PJ9C 4F9LC 5DJ8A 4OLWH 4QRPA 5FYKH 4XC1L 1X3DA 1NC2A 2DM7A 5IR1B 5D8JH 1KCKA 4L9LA 1RY7B 5GGQH 2BSED 4L4VD 1U8OB 2ZCLL 2VXUL 4LRIC 3VXMA 4OCWL 5C7XL 4WHYH 5L6YL 5E08H 3D85B 1OP5H 1A6TA 1HQRB 4UB0H 1LD9A 2HRLA 2EIEA 4AM0A 5I8EB 2P24A 5E24E 3G6DH 5FGCB 4Y4FD 4ZAKA 2HFEA 1FZJA 5F97E 2MHAA 3OKDB 5EBMB 5T1DH 1GZQB 1NAMB 1G9EA 1FL5A 4M8QA 4NRZA 2M26A 1CR9L 3NPSC 4PGZA 3SDYL 3KHOA 1YNTA 4J3UA 3IDMB 4EI5A 3CSYA 1IEBB 4F7TB 1EFXD 5I74B 4UDUA 5JZ7D 3HPLB 2KKQA 1MCOH 3LKQA 3RVTD 3NN8B 4P46C 4RA0C 4ETYA 3MREB 2V17H 4M6OH 1IM9D 3SKOA 3DIFB 1CFQA 5MHSD 2GT9A 4EDWL 5LGKA 5DK3A 1MNUH 4ALAL 4OFIA 1UA6L 3GJFB 4HIJA 1BZQK 4M1GH 4M9PA 4X99A 1FDLL 4Z95H 4M1DL 3QXAB 2IPUG 4PJ7F 1OW0C 5M95B 3P11H 3V8OA 1NAKL 3EYSH 3QWRA 3VGBA 1KPRA 4F8QA 4P2RB 5JPMB 2BZDA 3KWWB 5IMOB 4I5BB 2X42A 5CIPA 1J0YA 2V5MA 3GSQB 4OAWA 5HYQA 3BSZH 3BIBX 3U83A 4JO4L 2D9CA 5DQJB 1EJOH 1EPFA 1K4CB 4RFEB 4XPBL 1ADQA 3PHOA 1S5HA 4YHKL 4EI6B 4YHYB 2C1OB 1CE1L 3SE8H 3TEUA 5C0AB 4RRPG 5I17B 4AEEA 4X98B 1UB5A 2VLRE 4U1JB 1VGEH 2DQTH 3S97C 3H0TA 2BFVH 3P9MA 1FL3B 3RWCB 4HFUL 4XPFL 4Z7WA 4MAYD 5D1XB 3O6KL 3V5HA 3PL6B 5IHUH 3F7QA 3WO4C 5F3HB 1N26A 5ID1B 4IRSC 4K3EH 5E8PB 5HGBB 3NA4A 4MJ2A 2AEQH 4Y5YB 5IESL 5KSAA 1G7IB 2V2XB 4M7LT 5I1JL 2EDDA 2I27N 5DD0L 2NY6C 4MQXC 1MFBH 4G7YL 4NZTH 1MHPH 3MOBL 3TZVA 3I3EA 4NYLB 1IC5L 2D7TH 3GBMH 2DTSA 1DLFL 4PJ8A 4LCYA 3I75B 4HXAL 4L8SA 5KBNC 4U3CA 3CSBA 4KRLB 4M5ZL 1FFPB 3EDDA 3C9NB 4XMPL 1J11A 2LU7A 3OXRB 1KJ2H 2YUVA 1LEIA 3PF2A 4NJAL 2ATKA 2ZUSA 5EU6A 3BAEL 3L5JA 3FT2A 5HYJD 4LSUL 4PJHF 2VLMD 3EOBA 4YNYB 4PJFB 4Q6IC 4WGVB 4F7MB 5E95B 3GMNB 3EYQC 3K8LA 1QSEE 2UY7A 5J3HD 5EH1A 2VDNL 3RWHB 4PJ7E 4RAUB 4LLWA 3Q5YA 4CMHB 2F58H 3L95B 3QISA 5T5NG 4Z7UA 1FVDA 3EO1B 2RAMA 3QEGH 1D6VL 2VQ1A 4U2ZA 5CD5D 3C60A 4XVJH 3BZFB 3P30L 1PZ5A 4PJGF 4U05A 1MHHB 5JXEC 1PAMA 5DUBB 3NAAL 2QHRH 4JO3L 3C6LA 1CXHA 5IB4A 2GFBB 2QKIA 3BQUD 1S78C 3V4VH 4W6YB 3LH2L 4YWGH 4Z0BH 4DOHE 1YEKL 4I3RL 1KXQE 1UM5L 3BZEB 4N1CA 1UWEL 3LV3B 4FQCH 2WBJA 3LKRB 5DMIH 3Q3GA 2O5ZL 3QHZH 2Y07L 1RZ7H 1GPOL 3MTRA 4HC1H 4XVTH 3FCTB 5DD3H 3NBNA 3TO2A 3DV4B 1T03L 2JLLA 5EPMB 5DA4A 5DJZA 3TA3B 4U1NB 3OKLA 2BVQB 5I16A 3S88L 1QLFB 5DUPL 4XAWL 4XC3H 5C09D 3GK8L 4OFDA 2V6HA 3S8WA 1VFUA 2AEPL 3JSSA 1BPVA 4OSUL 3JWOC 3BGFB 4YE4L 1JMZA 1OOAA 4OGYH 4YHMH 3WIIH 3CVHA 1IVLA 3HUJA 1U8JB 1A1NA 4OLXH 4MJ4A 5GGSA 4ODXB 4QLRA 1J8HD 2RCSL 1B6DA 1RVFH 3QUZA 3ZKSD 3DO7A 1YEJH 1QEWB 2EE6A 1IAMA 3TYFA 3TBYB 3UJTH 3VCLA 3L3HA 3QDMD 1EGJL 3ZYZA 4CW1A 4LPVA 2PXYB 5GS0L 4BUGA 5J6HB 4Y2DA 4DUXA 4YHOH 3DXAD 3J8F7 5C3TA 4LLYB 2LTQB 1LK3L 3RWIB 5D9SB 4FXLA 5SWQB 5IV2A 5JDJA 3VXNA 4KDWA 2LABA 2I26N 3P73B 4OCMC 2DD8H 1IAIH 3V6OE 2FL5A 4NCDA 1I1RA 2NZ9D 1HHJA 4DN4H 4JQXA 2QSQA 5I1IL 3L5HA 2A0LD 5D6DC 3PGDA 3VFNA 3QYCA 4U1MA 5CCKH 3G6JE 4GSDL 5C0BA 3U0PA 2QSCH 4D0CB 4PJGE 2MOVA 3LMJH 1OWRM 5E4EC 4HT1H 3GRWA 4OIIH 1JTTA 1RJLA 1S3KL 4MB5A 4UDTA 3LDBC 3WHE1 3JTTA 4R2GD 1HEZB 4MJ6A 4HIIB 1P4IH 5B3JF 3LQAH 3R06B 1L6XA 3O3EA 1XCTB 2W60A 5IWLC 1WBYB 3KYKL 4ELKA 1KIQA 2R2EA 2GKIA 1ZT4B 4NNPL 5FA3B 1VACB 2Z31C 3BXNA 2WBKA 1T2JA 4HK0A 3ARYA 4CU8A 4NC1E 1X5HA 1CFSA 2AQ1A 5AYQA 4P2QB 4PGEA 4N0UA 1T21B 4U6HA 1INEL 1MOEA 4N5UA 4LSRH 5FKAB 2XQYK 1FLRL 4EUPB 1I3RA 1QBLL 1JZ4A 3ARFC 5B8CA 1BREA 1I7ZB 1A1OB 2ZKHH 2CLVA 3UMTA 4APQC 3MODL 1CTNA 1B4JL 2Q6WA 1YN6A 5C6TL 1YYML 3OKYA 1MRFL 3HMXH 4JFED 4PREA 4WW1A 1BMGA 4HH9A 2HN7B 5DJAA 3ROOB 4DN3L 4XHJC 5CEYB 4PLKC 3N0PB 4G80B 2ZSWB 3ARDB 3MRFA 5DK2B 2HT2C 2HKHH 1T80A 1Z2KA 3N06B 4EBQL 3M17B 4ZO8A 5FHAH 2X41A 4X6DB 2X4SB 4FXGB 3MACH 1YNKH 1JV5A 4X6BB 2QQLH 4YPGA 4ONGH 4P2RE 2B1HL 2GJ6A 1T22A 2F5BL 3NFPB 5DQ9B 5E2WH 4A2LA 2DQHL 3EYVB 5DK0A 1A6AB 2Z31D 3CFCL 4WUUA 5EWIL 1NFKA 5GS1A 4LAJH 4PJCB 1BM3L 3VWKB 2X05A 1WFNA 5JA8B 1VFAB 2WUCH 3FO2B 5IEKA 1KEGH 3DGCR 2BCKA 3MRIB 2ITDB 3MXVL 4V1DB 5C8JB 4E5XB 5JHDB 5TDPB 5C0AE 3B5HA 2YPLE 3BEVB 3QDJA 2YD2A 3ARFD 4XP1H 5E94A 2AJSL 4KHXH 4LFHD 2B39A 1AR2A 1NGXA 4I48B 2VLJA 1H5BA 1N0LA 4JFXB 1UVQB 5F6HJ 3ARGB 3HMWL 3F12A 3O6MH 2Q7NA 4XI5D 3O3UN 5IBUB 1MWAB 4OI9A 4XHJD 3HZYA 2A77L 1AGEA 5J57B 3AB0B 5I66A 1UM4L 4OD3H 2X4OB 4NO2B 4NKMB 1A6VL 2YK1L 3BH9B 3G5YA 4LBEA 1ZSDB 2WQ8A 4MQTB 2NY2C 3GSNL 4EVNB 1DDHB 1DQJB 3RX7A 1H15A 5D7LD 2NW2A 7FABL 5LKNA 1MCLA 3ARBD 2XT1B 2NY3D 4BZ1H 4RAVB 5HHVH 5JDSA 3W39B 1A7QL 1ZA6A 3EGSA 3BI9X 3LSOB 3GGWB 4R6UA 1WZ1H 4PJHA 4MA1C 4A2MA 5MEOA 2QV2A 1CLOL 1FH5H 1NAML 4FOMA 1I85A 4EZMA 4JB9H 3VI4F 1HN1A 1J5OH 2DMCA 4KJQD 1NCAH 3H3BC 1JYXA 1CFVH 2XG4A 3UXFA 1YJDH 3EDJA 4MCZA 1XF2B 4EQ3A 3S36L 2E7HA 1T5WB 3D3VA 3DX7B 3BIKA 4PJFE 5IFJB 3RZWA 2W9DL 1JHLH 4P4RA 1AGDB 1MHEA 1NGYA 1PG7X 5DMJB 2DQIL 1IQDB 3IFLL 5DLML 4HWEH 3PQYD 3I3BA 4O02L 1MCNA 1F97A 4WVRA 1TZHB 2UZYB 1IM3B 2FNBA 5IR1A 1M6OB 1UQSB 3GMMB 2NY2D 4UIMB 4LHUD 4XBGB 5L8JB 1U8OA 2VISB 3RBSA 3B8SA 3L7FB 5C08D 5FV2A 3WIFB 5EOCH 3MCKB 1FORL 4AYFA 4JANB 4GMTL 5FA4B 2GEEA 2WIIB 2ZUYA 3I84A 3RWGB 3D85A 5F6IB 1HQRA 4UT9L 1HCFX 5I8EA 3NGBC 4Y4KD 5A2LH 2Q8AL 2VXVH 3TJHC 3OKDA 5EBMA 5BOPA 3HC0B 5SWZE 1WLHA 2RQ8A 2P5EB 3B2UD 1PSKH 3IXAB 3ZZ1A 1IEBA 3T0EE 4N8PA 4HZAA 3NN8A 5FM4A 1KUMA 4NZRH 4YUEH 1EBAA 1OQXA 3MREA 5I19H 4LQFH 4ESKA 5H2BB 3MLRL 1JYWA 3DIFA 1Q94A 3DSFL 2CR6A 3CUPB 4B53A 2EH8H 4NKIL 3CNKA 3X13A 3H9YA 2Z9TA 3GJFA 5JW3H 1R3HB 1YEDB 4U2YA 2YHGA 3QXAA 3H9SD 3KYNB 4JEGB 3MJ8A 5HDLA 5C2UB 1GC1C 5JPMA 3VFWB 3ORJA 1XGRB 4I5BA 3GSQA 5ANMB 1DLHA 3NZHH 2G75B 5IGXH 1EIBA 1JGDA 1B90A 2FIKA 5JNYA 3WFDL 3QIBB 4MZ3A 5DQJA 5D7SH 3MLXL 1IC7H 3UAJC 4XNUH 4KI5F 4EI6A 1UWXH 2MTPA 3TBTB 4HHAB 5I17A 1OM3L 2R4SL 4EIZC 4MVBC 4Y19A 4PJCF 4NWUL 1RIUH 4C59B 4U1JA 5L0QB 5IROA 3TP4A 3CPLB 4YHNB 5L2KE 1JIBA 5HVWA 4HDIB 4HQQH 5D7IB 1EDQA 1DBMH 4Y1AD 2ZUTA 3LKOB 3MLVH 3F62A 5FOJA 1FL3A 5TFSL 2OJEB 3RWCA 3MV8E 3P2TA 5D1XA 3PL6A 1CL7H 4Q9CA 2YD6A 4MMZC 1LVEA 5F3HA 3DARA 4P23D 4XCEB 2XRAL 4UIKH 3F8UB 2ADJA 3WIHH 1AXSA 4QWWD 5HGBA 2PW2B 4U6YB 1D5BB 4AJ0A 1JN6B 4OGAC 2UWEB 5GGRA 4RMQA 1ZLUH 5J1SC 1JE6A 3K7UA 4MAUH 1H3PL 2OS7A 5EUKB 1T1ZB 4LLVB 5I9QC 3GSXB 4GBXB 4LKXB 1OB1A 1P6FA 4NYLA 4RX4A 5KAQG 1BWWA 5EORL 3V5DA 4DAGL 2UZIH 4IOIB 3BGMB 2YD4A 3FQTB 5CHNB 3VFVB 5HGHB 4P2QE 1J0KA 3SQOH 1OAYL 3C9NA 1LEGB 1V3KA 3C87A 3TCLB 3T0DA 4XBPB 2GTWB 5F70A 3T77B 4N0FB 3MXWL 4J3OC 4KK8D 4AL8H 5F1IB 3ULVC 2NXZC 5DRZB 4HIXL 4YNYA 5BV7H 5T1MA 3IRZA 5BZWB 3OTTA 4F7MA 1UZ6E 3PP3H 5C07E 5KVFH 4Q7DA 3PWNA 4Z18A 1V7NH 3L95A 1NSNH 2J8UB 3EO1A 4I0PC 3T4AB 3KLAB 4PJIB 5JW5B 2JK5B 3EZJB 3SPVA 1CDJA 5K9OB 4WY7H 1D5ZB 2DIBA 4TVPE 1MHHA 5E5MB 4YXHL 3MBED 5DUBA 1FNSL 4X6DE 1MCHA 3HI5L 4GXUM 4P59L 1IGML 2GFBA 1FGNH 1L0XA 2AEIT 3FB5B 1BBJA 1U3ZA 1CVSC 4KRNA 3QDGA 4CJ1A 5IBLC 5GSRB 1BEYH 2XTJC 3QR2A 3AM8C 5DHVH 3EDEA 3BZEA 4PJCE 3QZWG 1YQVH 4Z7VB 1OARL 3CZFA 1HHGB 3LV3A 4N8CL 3O4LD 3OGCB 4P0DA 4CVUA 4PRIE 2VDLH 4KQ3H 4LARL 4JY6B 5CEZE 1CXKA 4MB3A 5JHDE 1DP0A 3FCTA 4WFEE 1TTFA 3PIQB 1DQTA 3WN5C 2AJXH 2G5RA 1CDUA 1E0OB 2Z93B 3QJFB 3TA3A 4U1NA 1AP2B 2BVQA 1F58L 5KANG 1SBBA 5GJTL 4KAQH 4Z7QE 1R3IL 4O2CA 1QFOA 2KPNA 5C0ND 4HJJL 1N6QL 3NFSH 3GNML 5DUMH 3GMLA 4HBCL 1U8JA 5DJ0A 3FKUS 3VFSB 1KACB 4R7NA 3DX9B 5EFIB 1QEWA 5KTEL 5D5ME 3TBYA 3QXUA 5D2NA 2VLKD 2H32H 5FECB 2EDLA 5IBLD 4GKNB 3BVNB 5AG8A 3E3QC 3SCMD 1BIIB 4LLYA 4UV7L 3V5KB 5D9SA 1HYSD 1P84J 5SWQA 4K3DL 3LD8C 4N0RA 3P73A 4NJ9H 2BDNH 1MFEL 1ITBB 5F7KC 2VTFA 1S9XB 4NN5B 4YJZL 4P5TC 3F6LA 3QJHB 5BW7A 1T7YA 3B2VL 3FB7B 5BRZE 1V05A 5AZEH 3TPKA 3OKNB 4XNYH 1S7WB 1ZLSH 3NA9H 3EHBD 5GRJL 5TJWK 2H2PC 1FNEB 2P5WE 4UT7L 2VZTA 2DQJL 4WEUD 4IIQA 1BVKB 5EO1A 5JUEL 3HC4H 2VL5B 3N1GC 4U6XB 4I3SL 1WIPA 3MRCB 4EOWH 1IAII 1JZ2A 3TVMC 4TVPL 3WJLA 2E3VA 5D7IF 1HEZA 4HIIA 3HNSH 3DX8B 5INDB 3R06A 2AXHA 5BXFA 1I9JH 1J0HA 3BKYH 2EO1A 1C8PA 4ODTL 1XCTA 4NQCD 3T0AA 4QTIL 1WBYA 2YD7A 1XIWC 3S96B 1XT5A 2X40A 3SY0B 6FABL 3MRMB 1VACA 3LAFA 3WE6B 1R5IB 4FQXC 2YEZB 2UWEF 1HSBB 2A6JB 1TCRB 4QXWA 4KTDH 5CEZL 3OV6A 1Q0YH 4P3DB 1EO8L 1T21A 3ZDXF 5I73B 4QHUB 3K1KC 5A2KH 1WEJH 5FKAA 4LCWD 3HE7D 4K7FA 1CQKA 4EUPA 3QEQB 1NDGB 4G6KH 4KPHH 3V6BR 1I7ZA 1AGBA 4OFKA 4ZFGH 3RI5K 4MNQA 4YBQD 5TE7H 4J4PA 1MWAL 5SWSB 2DQEH 3DGGA 5TQ0H 2YSSB 3BESR 4LSPH 4X6CB 5E2VH 4KJPD 2HN7A 3MX0A 4LP5A 2X5PA 5CEYA 4G80A 4HK3J 1II4E 5DK2A 1LHZA 4WU5B 5DFVD 4BFIB 2CDEA 2XXMB 3M17A 4MJIB 2R29L 4DGIL 2X4SA 1KIPA 4FXGA 4X6BA 2J8UF 5FCUL 4X5WB 2D4FA 3VRLF 3NFPA 12E8L 5T3XE 4NQVB 2C1PA 2VYRE 1A6AA 4L9LC 5ANME 4OZFB 3ZE1E 2HG5B 3PP4L 2BNUA 4FQXD 1UACH 2CIIA 1YDPB 1CXFA 1VFAA 5JHLL 1AXTH 3QNXB 1ZGLB 1Q9KB 2H6PB 3NCMA 1U95B 5DC0A 1SJEB 3MRIA 2ITDA 4U1KA 4NZDA 4V1DA 1LDSA 5C8JA 3HB3C 2HVKA 2OJZH 3AS2A 4G8GD 4Z7VF 2Q3AA 5DC9B 5HY9B 3FO1B 2R0WL 4ZXBB 4EI5C 4UNTA 1ZGLP 1I1FB 3ARGA 5EA0L 5IHLB 2J12B 5BZDB 2PF6A 5I30H 1MWAA 3T0XA 5C0FB 1MCWM 4M6NH 5CINH 4OCXH 1RZIB 4AIZA 2X4OA 1FE8H 4NO2A 2YWZA 3BH9A 1ZSDA 5FUOH 1NDMB 1DDHA 4GUPB 3RQ3A 1JZ8A 4B41A 1S7VB 4P9HH 1S5IL 3VG9B 4EN3B 1V7ML 4WFHE 4YFEA 1NUDA 1NC2D 4FZ8H 1A6PA 3TN0C 3W39A 2D03L 3LSOA 1R6VA 3KR3L 3WFCL 3LS4H 1J1OL 1KG0B 5D2LE 4BZYA 2HLAB 3QIWB 4PTTB 5H35B 3RVVC 5AUMA 1HH9B 4JFHD 1XF2A 4WDIA 3TH3T 4GXVL 5F88A 4MA8L 1UCBL 3CK0H 3DX7A 1PBYA 2NR6D 5IFJA 4RGMB 2GHWB 2W0KA 1XAUA 5SX5K 4QF1A 3UZVB 4O00A 2YRZA 1WF5A 5BS0B 1H8SA 1P4LB 2X09A 3RJDA 2YD9A 1IQDA 4PJIE 4H1LH 4HV8B 4TUKL 1F4WH 5HDBE 2DQDH 1TZHA 1IM3A 1E4JA 1NQBA 3DURA 3B9KD 4XBGA 4E41D 3CAFA 3LS5H 5T3XL 1AO7D 3TYGH 4QYOB 1QFWH 3S6CA 4D3CH 2VISA 2B2XL 1TQBC 1FLTX 1CDIA 5DJCA 1LO4H 4QOKB 5KSAC 4HPOH 4JANA 1L9MA 5EU5A 5FA4A 1BF2A 1JZ6A 3TN0D 4HG4J 2WIIA 2OL3H 1E4XL 3CZJA 3RWDA 4UI2A 3MOAH 4BKLB 4J2XA 3QUYB 3PDDA 1OSPL 3TZVC 4Q97A 3QPQD 1XZ0B 3MYZA 1NLBH 3Q5TA 3MRKA 4IJ3C 1NCNA 4PJ8C 3I6LD 4M4PA 3B6SB 3IDJA 4LSSL 4PLJC 1QLEL 4L8SC 2P5EA 3DO3A 3KPSD 4RNRB 3IXAA 2E6JA 2YPVL 1MI5B 3N1MC 4R4FH 1FP5A 4LHJB 5HDOA 4NRYB 4XC1H 1OGTB 1F45A 3NIFF 5DQDL 5KOMC 1TVHB 3QNZA 3CUPA 3D2UD 4KV5E 3MJ7B 3QIUB 5HHOB 1BFSA 4OLYL 3BKJH 2HJKB 5F7YC 2ZCLH 5C0CB 2ICWI 2VXUH 3DNKA 3GSRB 3CFBB 4YEEA 5C7XH 2EC8A 3O41B 5L6YH 4WFFE 4X5XA 3KYNA 3VFOB 3V0VA 3IDNA 4X6CF 3C60C 2D7QA 4Y4HB 1I7RB 3M1BB 5JW4M 1IGIL 1P5VA 1EUUA 1XGRA 5FYKD 1RUKH 2WLYA 1FV1A 5LGHH 2ED8A 4N8VB 4KJWC 5E7FA 3ECBB 3SDYH 4HUMB 1PX4A 2G75A 2K3TA 2XWTB 2AAVA 4XPHL 3C6SB 1JK8A 2CRIA 1NGPL 1FZMB 2XV6B 2X70A 1X4YA 2IBBA 3ULUC 2FEDD 2GSIB 2BY0A 4OLVL 2FO1A 4QKXB 1L0YA 1F2QA 4MNHB 4KI1A 4HHAA 2WBJC 1YUHB 4FXKA 4YHNA 3CPLA 2IMMA 4HDIA 4ALAH 5D7IA 5AWNL 3BGAA 3LKOA 4EEEA 1MHCB 2AJUL 2OJEA 5E5RB 1FDLH 4M1DH 2QSVA 3OKKA 2APWA 4LLMB 1NAKH 3HPJA 4JREB 4MA7H 1AH1A 1PJ9A 3DOSA 4LPWA 5E9DB 2JJWA 2PW2A 4U6YA 1N5YL 4G7VL 3ARSA 4L3EB 2P44B 2VR9A 1PYWB 1JWMB 2UWEA 4QHNB 2YA1A 3C60D 2FO4B 1T1ZA 1CFNB 4LLVA 4JO4H 3VH8G 5GS2H 1WZMA 3Q2CA 3TM6A 2FDBP 3GSXA 3QUZC 4GBXA 4OKDA 4ZUTB 2BVPB 3RGHA 1VESA 3SDDB 3IFNL 5IHBA 1WVZA 4YHKH 1CE1H 3E2HC 5IF0B 4YHLL 3BGMA 3FQTA 3U2SB 3VFVA 5HGHA 4FMKA 4X7SL 4C83B 1F6AA 2BNRE 4Y2DC 4KZDL 2R2BB 2VQTA 3TCLA 3MLUL 4MA3B 3NIFE 4XBPA 2GTWA 4HFUH 3UDWA 4XPFH 3T77A 3INUH 4N0FA 1MCWW 5F1IA 2NYYC 2BERA 5DRZA 3KPTA 3Q6FB 4JPKL 4QRRD 5DJYB 5D70L 5BZWA 3LB6C 1X5FA 4JQXC 1OTUC 2DS4A 5SWSE 5IESH 5GIRB 1X5XA 4HXBL 1QTYT 1QOKA 1HYRC 2J8UA 1NC4A 3T4AA 3KLAA 4XZUA 1NEZG 5DD0H 3QAZC 1WFUA 4QNPF 5I1LA 4G7YH 1QP1A 3KPLA 2I9TB 3MV7B 3MOBH 3UTZB 1XGTB 1J1XL 2X1OA 4PJ5E 1IC5H 5E5MA 1DLFH 2OR7A 3RHWK 4HXAH 1NMAL 5IJKA 1B2WH 4M5ZH 4Y0GA 5EC1B 2GJZB 3RY5A 3FB5A 3C09B 1BWMA 5B4MC 3CVIL 1I7UB 2Q3ZA 3IDXL 4BQCA 4NJAH 5ICYB 2WQRA 2E27H 1G7QA 4NOFA 1F42A 4Z7VA 4YLQT 3BAEH 1HHGA 1NBVL 4NCC1 4GRWE 3PWJB 1RZFL 1P6AB 3ZKNC 5IBTL 3VG0L 4UAOC 1NH6A 3BJ91 2VDNH 2PW1B 3PIQA 5B38G 1RZKH 1U92B 1D6VH 2Z93A 3QJFA 2ZUWA 1GGYA 3ZKQD 3UZQA 3P30H 4OQTA 4WFGE 1YEHL 3F5WB 5C6PB 4NWTL 2Y72A 3NAAH 5B8CC 3ZTJG 4JO3H 1GJIA 1BP3B 3EUUA 3OG6B 1WBXB 3QFDA 4OUUB 2H9GA 3W2DL 4P49A 3VFSA 3CH1A 3LH2H 4R3SA 4FABL 1YEKH 3FAXA 4I3RH 3DX9A 3WCYA 2HMIC 1UM5H 5KZCB 3DPBA 1UWEH 4JM2B 1BOGB 4H26B 2MKLC 3IU3A 4JDTL 4KROB 1DEEB 2O5ZH 5FECA 2Y07H 3GM0A 4XP9H 5M94B 3I02A 1GPOH 4GKNA 3BVNA 4NT6A 5DMGC 1IGJA 1Y6MR 5T1KD 2CD0A 1A7RL 3DETD 1T03H 5I75C 2BVEA 4X4ME 1A5FH 3WLWC 4PLOB 4RDQF 3UEZA 4NHUA 3S88H 5DUPH 1SY6L 4XAWH 3EFFA 3GK8H 1DE4B 5GS1C 4YX2L 4RGND 2CO6B 4OSUH 1ZHKA 2DYPD 2UYLB 3FB7A 4F80A 2ZUXA 4FFYL 3OKNA 2R1YA 1S7WA 5D7KE 1VDGA 4S0SD 4Z78B 3MV9A 3GSVB 2RCSH 3MLWL 5BS0E 4OI8A 2DIJA 3WLBB 2VL5A 5CJOL 1JF6A 3T2OA 1M7DB 3WS3B 2NY4D 1KJMB 1EGJH 1H5BC 4LFHG 5GS0H 3DX8A 5INDA 5J0BA 3GI9L 4XXDB 1LK3H 3QG7L 1PKOA 3D48R 43C9B 1AQDA 1XGUA 3O6LL 3ILPB 5DD5L 4IS6A 4HJ0D 4M93C 2ITCB 5ICXB 4D9LL 4BQ8A 3S96A 3IAGC 3SY0A 4J7RA 3ARPA 5I0ZA 3MRMA 5J12B 5FXCH 3MLPA 1RUQL 5IUSA 1R5IA 4G9FB 4S0TD 1S7QB 2FECI 2YEZA 3SDCD 2A6JA 1RI8A 1A9BA 4ODSL 5TDOA 4JN1L 2HH0L 1PQZB 4NUJA 4GSDH 4P3DA 2EYTB 2H8PB 4OFYA 2O26U 1SYVB 1JPSL 5K93A 3ALXA 1RQ5A 2XQYG 1GL4B 4KK6C 3C2SA 2AXFB 3QEQA 1I85C 4HUNB 2RFXA 2FSEA 5GRZA 2I24N 2XFXB 4W6XB 4L4VB 4S10A 1PY4A 4P99A 3MRLB 4F37F 2YSSA 4X6CA 5GGVY 3DI3B 3RX5A 1DUYB 3KYKH 3ZKMC 4ZFZA 4NNPH 1IGTA 1NKOA 5JMRA 4Y4FB 1NCDL 1WJ3A 4DZBB 4MJIA 4L8CA 4DVRL 4R0LB 1S7XB 4PRPA 5B21A 4HCRA 5FKPA 1KGCE 4X5WA 2VN4A 1INEH 5F44A 2DL2A 1FLRH 1EFXB 5D1ZB 2VNCA 3KGRA 5F9OL 3ZSTA 2HG5A 2EO9A 3UJIL 1QBLH 2ZUUA 4LHUG 3FOMB 1ZOXA 1OLLA 1RJCA 1IAIM 4JY5L 3QNXA 1T7XA 1CLCA 1IM9B 4POUB 4JRXE 1Q9KA 4GAFB 1U95A 1SJEA 4GRLD 3ROLB 2DB8A 3MODH 1B4JH 3Q6GL 4X7DC 5C6TH 1YYMH 1MRFH 2EECA 3DSNA 5HY9A 4DN3H 5GGRY 3WFBH 4ZXBA 1MIEL 3PWLA 5CKGA 1A9EA 1KT2A 2FRGP 4ZFOB 2DLGA 2DWEA 3D3VD 4EBQH 3QXVA 5I74C 2PNDA 4NGHL 4U7MA 1RZ8B 3RKDD 1Q8MA 1U8IA 3LCYA 5C0FA 3CFDB 4U3XA 3X3GL 4FQHB 4HWNA 2B1HH 3TBVB 2ZG1A 2F5BH 3VGFA 4Z7OF 4KUCF 2DQHH 3MFGB 5E99L 1P69B 3CFCH 2E8ZA 5EWIH 3L1OL 1BFOA 1EV2E 5DR5L 1L7TL 4GUPA 4O58H 5IT2L 3NPSB 1Q9LB 1YA5A 1Q72L 2FHFA 3MXVH 3TNMB 1MFAL 2Y25A 3D18B 3QDHA 1GGCL 3UC0L 5L7XL 4LGSB 1KG0A 2D0FA 4B0MM 2AJSH 4LOUC 1CDHA 2HLAA 4ZPVA 3QIWA 4PTTA 5ENWB 4XBEL 1KLUB 4Z5RB 5H35A 1KB9K 1ZLVK 1HH9A 1VSCA 3O2DL 1C08B 3SE3A 3HMWH 4O5LH 1ZLWK 1QACA 2AXGB 1YPZE 4WO4A 1UYWL 2IAMD 1QBBA 4L4TA 4YHYC 2UVFA 1UM4H 1Q0XL 2UVEA 3BZ4B 3B3IA 4PJBB 5BS0A 1A6VH 2WM0A 2YK1H 1MFCL 3BD3A 5IROC 3G08A 3UBXI 3GSNH 3B83A 1KC5L 2VRAA 2AJZB 1T5XB 3IKKA 5KG9B 1NGWA 4HV8A 1X5YA 2A9NL 3LKSB 1FFOB 7FABH 4LP4A 3D39E 4PRHD 5HGDB 3EKCA 3RVUD 4J6RL 2VDML 2EDHA 3MV7E 1D5XB 5SV3A 1A7QH 5AG9A 1DN0B 2MCPL 2DQCL 3VI3F 2LU3A 3WDHA 2VUYA 3QI9D 1CLOH 1NAMH 1I75A 4JFDD 1MEXL 4XB8A 3U7YL 4QOKA 5HYJB 1B0GA 3S36H 2ESVE 1N64H 2R1WB 5ETUB 4BKLA 4U6VL 3NTCH 5T3ZL 2H1PL 3G04B 4TUOB 2R69H 4AEHL 4RWYL 1E6JL 3NCYS 2W9DH 3MRNA 3B6SA 2D7NA 4X4YB 3QO0B 5H94A 5IMKB 4RNRA 3UYRL 3F58L 3IFLH 5DLMH 2EYSA 1MI5A 4ONHB 4KVCL 2XICA 5DRWA 4JHAL 4O02H 4KH2A 2Y6SD 4NRYA 1NBZB 1OGTA 4GMSL 3BQUB 4YFLF 2NY6B 2Q76B 1TVHA 1I4FB 2I60L 3EAKA 3L3IB 1CD8A 3T2NL 3MJ7A 3QIUA 3QPXL 4U49A 5HHOA 2HJKA 2DBLL 1JZ7A 4JQIL 5C0CA 2CMRL 1FORH 3OKOA 5B39B 4GMTH 2BMKB 3CFBA 3LVEA 3O41A 5I71B 3VFOA 3FT3A 5JQHC 4QT5B 4UT9H 2FIRT 2PETA 4Y4HA 2Q8AH 1I7RA 4HPYL 3M1BA 3DV6B 1O5DT 4JPIB 3MRDB 4MDIA 2HFGH 1MPAL 3TT1L 4PJDF 4B7IA 2C3XA 4UNUA 3ELAT 3ECBA 2CK2A 4TRPL 3U4BH 2XWTA 3C6SA 5C09B 3QO1A 2EYRA 4J3VA 4ZFFB 2J88L 4NNXA 1IL1A 2WWKT 2FJGB 3JV5A 4IRJD 2GSIA 1N2RB 2Z91B 2F8OA 3IFOB 3MLRH 2H3NB 3DSFH 1BOYA 1J8HB 1CF8L 2C4FT 3DLQR 3MRGB 2OZ4L 4LPYA 1MHCA 1QSFA 3QCUL 2A6IB 5HSFA 3QDMB 4AMKL 3TFKD 1G9NL 2E8YA 5LCVL 4MD4A 4LLMA 5HGGS 3DXAB 1SM3L 5FUCE 4LCCB 5LAXB 1W0VB 2FX9L 2XQBH 1FL6B 3BGFC 5E9DA 2DTML 4L3EA 5JIIA 1A6WL 1T1XB 1JWMA 4EXKA 5CBAB 1DUZB 1W72L 1JJUA 2IPTH 1CFNA 5CP3H 3JV4B 2JIXB 4ZUTA 3MLXH 2BVPA 3SDDA 1TETL 3WUWB 3MYJA 4G9FE 1NPUA 3AREA 1YY9D 5DVLA 3VXSB 3CSPA 2R4SH 3OAUL 1HQ4B 5D2NC 4NWUH 3U2SA 1KCSL 3N85L 1AQKL 1TZIB 1PFCA 5EBGA 4MA3A 4CBPA 2LTQC 5TFSH 1X5JA 4ZUUA 1D5IL 1QQDA 1G9ML 3T3MF 2AP2A 5J8OA 3KNBB 1AE6L 1VADB 2CH8A 3Q6FA 5DJYA 4D8PB 5IVOA 5BW7C 1T1YA 3ARVA 3IDIB 5GIRA 1JF1B 2DKUA 4K9EC 1H3PH 2IWGA 3D0VA 4HS8H 2ARJB 5EBLB 5FDWB 4IIQC 2QQKL 5LXGL 3UTZA 4OF7A 4MB4A 3T0BA 2CK0L 5EORH 2ZCHL 5EBWB 1N6UA 4PJBF 5ECJE 4NQDE 3WJLC 3ZYJA 4OV6F 4FQIL 3NCFB 3SGJA 1K3IA 4I2XB 3AXLB 5FV1L 4OF0A 2GJZA 4YDIL 3RUGB 1I7UA 1KIUA 2BRQA 5HHXL 3CX5J 5ICYA 3VA6A 3MXWH 2IAND 5KVGL 2JELL 3UTQB 3L6FB 3PWJA 1K8IA 4PP2A 4JFEB 2NX5A 4JVPA 3VDCA 3DI2B 3LDBB 4WHCA 3TH2T 3VXRD 2PW1A 2AK4B 1IT9L 3JWDL 2VDOL 2PKDA 4P5KA 1CLZL 2CKBA 1MCCA 2PO6A 3PHQB 1JGVL 1XGYL 4PV9B 3F5WA 4XTRC 4YXHH 1AD0B 5ADPL 1FNSH 2ILLA 3HI5H 3TV3L 4P59H 1YEGL 2Z31B 4PJAA 3R0MA 3U46A 1WBXA 4J4PC 3L5IA 2DAVA 3D0LB 4OUUA 1JHKL 1RJZB 5F1OB 2IALB 4JVWA 4HWUA 1BOGA 1MJJA 5HYFA 4H26A 4N8CH 5HHNB 1YC7A 3PNWB 4HAFA 5T1LD 3Q0HA 3O11A 1OTTD 4P48A 1P7HL 3MGTA 4LARH 3LN5B 3GMQB 3ARFB 3BRFA 1DVFD 1PKQB 3QWOB 3VA2C 4M1CC 2BVYA 2WZPD 4HGMA 1OTSC 1NCCH 1K6QL 4KI5C 2V7HB 1AR1C 4ZMAT 3S35X 3VXUD 3WSQL 3RA7L 1R3IH 4KKBC 3T2PA 4HLZG 5KSVA 4HJJH 4HFWB 1F8TH 1INQB 4GRMA 5BO1L 3S3PA 4TNWK 3GNMH 4QGYA 1NCUA 2HJLB 2ORBL 5JOFA 4K07A 2R4RL 1OGAE 1KNOB 2COQA 3GSVA 5IW3A 4XTRD 4PJBE 5D7LB 4YO0A 3WLBA 1CDCA 3ARBB 5KTEH 2E9IA 1Q9WB 2FBJL 4YAQB 2XPGA 1XR9B 2NY3B 4MNQD 2ZP0T 4S1SL 3X17A 4KK5C 1G6RA 3B9EA 3ARGC 4OLUL 2QQNL 3PV6B 1C7TA 4XXDA 3SEPA 2KQMA 4UV7H 3AMKA 43C9A 3UROR 2XN9D 4K3DH 5ICXA 2ITCA 2UUDK 3TF7C 3SJVD 1MFEH 1C5BL 1DBBL 4JVUA 1KOAA 1UM6L 4QHMA 3ZE0F 2HJFB 3B2VH 4I77L 3GM8A 3M8OL 5DC4B 4M1CD 4DCQB 3K8KA 4PR5B 2VITB 5GRJH 2H8PA 3SDAD 4P4KD 1U58A 2DQJH 3V0WL 2BSRB 1DANU 1MCRA 5JUEH 2AXFA 4HIEB 3GSUB 3MLZL 4I3SH 4JRYD 3KAAA 1B0WA 1M71A 1KPVA 4TVPH 2XFXA 4TTDC 1FVCB 3WEXB 2ICWB 1S7TB 2NY2B 2FHCA 4L4VA 4DZ8B 2X4RA 4OKVA 3VFRB 3MRLA 3RTQD 3VXQB 1GSMA 1A3QA 1DUYA 1JGLL 2IADB 2W07A 6FABH 3U7AA 1A3RH 1H9VA 4PJDA 5KSBB 4K94C 5J6GB 3HRZA 2V7NA 4DZBA 2JE8A 5HI4D 5TPWL 2ICEB 5CEZH 2VDQL 2V5YA 2NY1C 3HZKA 1IEAB 2ZSVB 1YMMD 1EFXA 5DSCB 1ZANL 3ESUF 4HUXB 3MLTB 3IB4A 5C09E 3FOMA 2IG2L 5IJVA 1X4XA 1IM9A 5IIEA 4PP1D 3RUGF 3ROLA 5F6IC 1MWAH 1NGZB 1S7RB 1BFVL 5FEBA 5JXAL 1RUAL 4TTDD 2ZUVA 3GZKA 1OAUL 4ZFOA 3QDME 5DJDB 1LE9B 2R29H 4DGIH 4NSKB 1RZ8A 4WNQB 5HBBA 4XVUD 4DGVL 5FCUH 4FQHA 1AGCB 3TBVA 5IOPB 12E8H 3QQ9C 4AEIL 5EIQA 1XGPB 1JTPA 2OTUB 5ID0A 3HG1D 4YH6A 4PLNC 2I9LB 3HAEG 1EX0A 5JHLH 4NQED 2JJUA 5L2JB 2NY1D 5JOPD 5EUOB 2A6DA 2DM4A 3FN0L 3D18A 2Z8RA 3VXSE 4Y1AB 4ZS6C 4ERSL 2FHBA 4RFNB 3MQIA 5HYSB 4MAYA 2R0WH 3VMPA 3MOQA 1SJHA 5ENWA 1KLUA 4Z5RA 1QZ1A 2GCYB 5GSVB 2Z8WC 1RULL 5BCAA 1C08A 3GKZA 2XWJA 1MY5A 5EA0H 2PYED 4ZUVA 5HI5D 3MNVA 4PJEA 1C5DB 32C2B 5EOTB 3QFJE 4Y88A 1FAIL 4MLIA 1NUGA 1FO0B 1K3ZA 3BZ4A 4PJBA 4XNZC 3KPRD 5L0QC 1T4KA 3FQUA 2AJZA 1T5XA 4AQ1B 3BD5A 3CU7A 1V7MH 3LKSA 2JTDA 1FFOA 1R24B 5HGDA 3HZMB 2FX8L 5JIPA 4JPWL 1S9WA 1JYVA 1ZHBB 3BKML 2IQ9L 2D03H 2ADFH 1EHXA 3KR3H 5GZND 3WFCH 1J1OH 1HNFA 4YZFF 4KZEH 3RUGE 4AK1A 4HUVB 5HYJA 1E6OL 2R8SH 5JW4R 3I50L 2OQJB 1KF9B 2P45B 3KPPB 4I8DA 4GXVH 4MA8H 1UCBH 1XH3A 2R1WA 1N3NA 5ETUA 1BD2D 2W9EL 5I1GL 4GBXC 1G7LA 3L3GB 3G04A 3L5XH 1I3UA 5E2TL 2PUQT 4LVEA 4UOW0 1DQMH 2P8LB 4X4YA 2XYCA 3QO0A 4TULL 2AK4E 3AAZB 5IMKA 2CUMA 4ONHA 5DVMA 2X4TB 3UDWC 5ACZB 1BZ9B 2VL4A 4TUKH 3KPNB 3BQUA 3WO3B 2GSGA 5T3XH 3S9DB 4CN1A 2B2XH 1U8MB 1VENA 1RIHL 2BMKA 3MA9L 1KXTB 3O4LB 2CDGA 3VD9A 1E4XH 1PZUB 4QT5A 5ESAA 3VRJB 3IDYC 3WJJA 5JOEA 3FB6B 3QCVL 1OSPH 3DV6A 5AZ2L 3TBSA 1H3GA 3MRDA 1JPGB 3TPUA 5KSBF 1QLEH 3OKEB 3EYOB 3JWOL 3FFCD 5IJKC 5C09A 5SV4A 2HT4D 2YPVH 1FVEB 2WSKA 4ZFFA 5ESQB 1JZ3A 4FP8H 1AKJD 2FJGA 1N2RA 2Z91A 4KKCC 3VH8A 2OXHA 4M6AA 5DQDH 2H3NA 1J8HA 1EEQA 1TJGL 4GG6B 3KXFD 3P4MB 2A6IA 5E2JA 1S9KC 4KHTL 1R0AL 2IBGA 4D9QE 2VLKB 4FQ2L 4A6YB 3V7AE 4P5MB 3DXAA 3SCMB 3KJ6L 1W8NA 2F54E 4LCCA 4ZTOL 4X6FB 4JR9L 1FL6A 3RP1A 3W82A 1T1XA 5DEGB 1BQUA 2IFFH 5CBAA 5FO8B 4XPHH 2BVOB 4NZUL 3BP7B 1KCRL 4OBRA 2W1NA 3WN5B 3C5ZD 1CDYA 4OLVH 4E42B 2BP3A 4RQQA 1HKLL 3DJ9A 3W11C 1GHFH 1JMXA 3PWUA 5F7HA 4GKZB 1M1SA 3UPCA 1KIRA 5ICZB 2E7CA 1I8MB 1EHAA 5AWNH 3MZGB 1TZIA 1IGCL 3VMOA 3WL9A 5HPMA 3CJJA 3QUMH 1Z3GL 5EUOF 4KKLC 4DWHA 2BSTB 4JGMA 1WWWX 4M00A 1VFBA 3MZTA 3NCYP 5CLTA 1VADA 4JJ5B 3GHEL 5IB3B 4D8PA 1MFNA 4DUVA 1N5YH 4G7VH 1DFBL 3IDIA 2NLJB 3V6FB 5F7FA 1B4RA 4X9HA 5EBLA 3PWPD 1X5AA 1RPQA 2ARWA 3RWFB 1ZKAA 1LK2B 4JLRB 3IFNH 5KSBE 3BWAB 5DF0A 3RVWC 5EBWA 4YHLH 1Q9OB 4N0CD 2P48B 2X7LB 4LCWB 4I2XA 3HE7B 1INDL 4X7SH 4KZDH 5IG7B 4K2UL 1LP9B 1P1ZB 2FJHA 3MLUH 5DYOA 5IB5B 1EXUB 1I9RL 3T3PF 3BHBB 1WAAF 1U41A 1PDKA 5GS2D 3QUXD 2C3HA 2CJUL 3BJLA 4MMXC 4JPKH 2F53E 5D70H 4JFEA 1KLGA 3QEHB 3KPQA 5C0RL 4KKLD 3LRSB 5F96L 1BX2B 4QXUL 4RISL 4RMUA 3VGHA 1KCVL 5I1HH 1A64A 3PHQA 4HAGA 2NXYD 2HLFC 4OCNC 4PV9A 1J1XH 5CSBA 4KJYB 1XIWB 1AD0A 4OCYL 4C56E 2AK1L 4YC2B 3OR7B 4PG2A 2Z31A 4FQXB 5LQBL 3D0LA 4I4WB 4G8EA 1A7NL 3CVIH 1RJZA 2IALA 3IDXH 5JA9A 3ZT6A 1CBVL 2WNGA 5C0GB 5HHNA 4LLUB 1NCWL 1ZMYA 1RZFH 1S7UA 3W0WE 5KS9F 3LN5A 5C0EB 1A47A 2JCCB 1PKQA 3QWOA 4GJTB 2V7HA 3FO9A 4JDVA 5IVZA 1YEHH 3B9AA 3LKPA 1KTKE 4NWTH 1LO3L 1I3GL 1QO3B 3OMZA 1IFHL 1J1PL 4JG0L 4F7CB 1QPXA 2HJLA 5DI8A 1QLRB 2P49B 3T1WA 2B1AL 4QHLA 2CUHA 5I76A 5DHXB 1RHFA 3W2DH 3BEWA 1HHIB 1KNOA 2Q7YA 4S2SA 4FABH 5DJ8B 4QRPB 4POZD 5D7LA 1FC2D 1IKNA 3ARBA 1BQHG 1NC2B 4Z6AT 4ZXBC 4YAQA 2C5DC 3RVXC 4CAGA 4L9LB 2C7UB 5EO9A 4ZNEE 4GG6F 3T3PE 2XZCL 4MNGA 4JRWA 5I1EL 2C3GA 4UTAH 4RBPK 2OK0L 1LD9B 1ORSA 4AM0B 3UTTE 2P24B 3FTGA 1SY6H 2YRPA 4GW1B 4YX2H 5HTSA 2WAHA 5F9DC 2HJFA 3QUKB 2N7AA 3VG9C 4M8QB 4FFYH 4NRZB 4DCQA 3WNNA 4EI5B 3ZKXB 2VITA 4ZPTA 3CSYB 2VLRD 4DTGL 1RFDL 3MLWH 1JYNA 3PQYA 3HR5B 2R9HC 1OAXL 2B0SL 3GSUA 3LKNB 5CJOH 4TNWF 3QIWC 3SKOB 1CFQB 2A38A 4OCSL 3WEXA 1S7TA 4LHUA 4U6TA 1AO7B 2VXTL 4HIJB 3O2WL 3GI9H 5C08A 4WO4C 3QG7H 3VFRA 4X99B 1N59A 3VXQA 1J9CT 1T0MA 2EDEA 3RDTC 3O6LH 5DD5H 2CGRH 4D9LH 3TN0B 4OZFH 2Y06L 2IADA 4MSWA 1MJUL 1U0QA 4M62L 4Y4KA 5E70A 3BO8B 2J6EL 5CIPB 5J6GA 1RUQH 4GRWH 3UP1A 1D3CA 3FL7A 4OAWB 2FEEI 3L3DA 5HYQB 5HDQL 5HJ3A 2HRPL 2ICEA 3IDUA 4MHHI 4ODSH 4JN1H 2Q20A 2O5YL 4J12A 4K8RH 5GS0D 3HZVB 1JPSH 1IEAA 1TTGA 3ULVE 2ZSVA 4XGZA 4HJGA 1N5AB 5DZOA 1S5HB 5CP7A 3MLTA 2OR8A 4PG9A 2HWZL 3H9ZA 5KSUA 4KVNL 5D7JD 3D2UB 1IKFH 5IP4A 1LP9F 1ZA3B 3LHPL 5HHQB 5FB8A 3TJEL 4TPRL 1KBGL 4JZNB 3V5HB 1FO0L 3DVNB 5HI3C 3PABB 3TWCL 1GC1L 3GBLA 3H9SA 1NFDA 2C9AA 1NCBL 1WWAX 1NCDH 1EUTA 3MGOA 4DVRH 5BVJB 4DK6A 3RDTD 2ICWJ 2VZSA 4WI7A 4BH7B 4WNQA 4L4TD 2XTJE 5TE6L 1AGCA 5IOPA 2XTLA 5J4MA 1UXSA 4C55A 2GJJA 2ED7A 1XGPA 1E28A 5F9OH 2OTUA 3UJIH 3QIUC 3TZVB 3NCBB 1WTGT 4IJ3B 4LCYB 4JKLA 1EA9C 1F6LL 2ERJC 1RIVL 2Y23A 5E00B 5EUOA 2H41A 3Q6GH 3K2UL 3WKMH 4Y1AA 4Y4HC 3WD5L 2R23B 2ATKB 4M7LL 5EU6B 4PBXA 1KTRL 3OPZL 4N5ED 1MIEH 2VWEC 4IEFB 4YHPA 2GCYA 3PG2A 4P23A 1T0PB 5A3ID 5K9KB 5C6WH 1WGOA 2JCCF 3KDMB 7CGTA 1KJVA 1J86A 1C5DA 3A6OA 4NIKB 5GGTL 3FRPG 5HI3D 5EOTA 3IS1X 1FVDB 3X3GH 1ORQB 5L8LB 1I8KB 5MP6L 3IYLW 2VQ1B 1OP3K 1A14H 1FO0A 3C60B 5E99H 4PGJA 3KLSA 5DR5H 1L7TH 4BYHA 1IJ9A 3E3QE 1UCTA 5IT2H 3BH8B 5IB4B 1R24A 3LRHA 4PRAB 4PBWD 1ZV5A 3HZMA 4UBDC 1A7PL 5EIIB 1ZHBA 3GJFK 4ODVH 1WAAA 2CXGA 1GGCH 1A2YA 4JREC 5HVHB 3ULVL 4LCWE 3EOAA 4J3WA 1CFTB 3S4SG 2P8MB 5ISZA 1KB5A 1LP9E 4XBEH 1TFHA 4HUVA 3O2DH 2OQJA 1ZVSA 2VZOA 4KRPC 3OQ3B 4QRRB 3KPPA 3EO0B 3ARZA 1H0DA 2VZUA 1FNAA 1UYWH 3TCXA 4OV5B 4ENEC 3G5XA 2ZCKL 4L1HA 4N90D 5DJZB 3NACH 4WUKL 3AREC 1Q0XH 4OZIF 4X4ZA 1MFCH 3AAZA 4WW2B 4QO1A 3N50A 1KC5H 2C4FU 2J8HA 2H2SC 2WANA 2A9NH 3MBEA 2X4TA 4A6YL 2HVJA 4J6RH 1BZ9A 2VDMH 5JIHA 1CICD 3CVHB 3HUJB 4MYWB 2IFGA 3KPNA 3VD4A 3FJTA 5CD3B 3CFEA 3QUZB 2MCPH 2DQCH 3UO1H 1B0RA 1AD9A 5JQ6L 4BSJA 4OZHE 5E2UL 1LO0H 4NDMB 3E2HB 1MEXH 2FECL 1U8MA 5KS9A 3U7YH 1RK1B 2ZOLA 1CQYA 3O4LA 4Y2DB 2BJML 2B5IB 2OR9L 1NBYB 4U6VH 5F3BB 2H1PH 5IV2B 4AEHH 4Z77A 1E6JH 1T2XA 2W92A 5T33L 2EDKA 4WEMB 3SGJC 3OKEA 1FJ1A 3I9GL 3F7YB 3D25B 4K3HA 5DD1L 1IC1A 3UYRH 2VZVA 5A43C 3C09C 3F58H 4U1HB 1FVEA 2CDFA 4HWBL 1W0WB 2HFFB 4HWZB 4JHAH 4U1MB 5ESQA 3FB8A 1H3TA 4GMSH 4ZOAA 1BQSA 5DA0B 4IOFD 3T2NH 5MENA 4GG6A 2DBLH 4JQIH 4Z8FL 3P4MA 2CMRH 5F7LB 4QRPE 2VLKA 4MJ6B 4A6YA 4KKNA 1QHPA 2PO6C 3U0WL 3SCMA 5DO2C 5T1KB 4HLZH 1TJIL 1DZBA 2ZJSH 4P2OA 4X6FA 4ELKB 1KIQB 5IK3B 2R2EB 2M2DA 2V9TA 4P2RD 2VZ3A 4XCFL 3VXME 1WK0A 2A74B 4TRPH 3SGKA 5FO8A 3MRRA 4JQVA 3REWB 3D1MC 4UAOB 4RGNB 4R4NC 5DRNB 3NZ8B 2J88H 4LSTL 1WISA 1KJ3L 4E42A 5GRVK 2Z92A 5FGBA 1ZWIA 1BVZA 4KROC 1CF8H 1U91B 2YRLA 5C0AD 5ICZA 1P7KA 2OZ4H 1I8MA 2YPLD 4ZO9A 2FGWL 5B8CB 5DRXB 4WJ5B 3QCUH 4AMKH 1G9NH 1H8NA 4HGWA 2D9QB 5LCVH 3MJ9A 4MQ7A 2AV7B 4DVBA 1YN6B 4PUBL 2XIDA 4PREB 3MBXL 5FDYA 2GY5A 1YY8B 1SM3H 2BY2A 4HH9B 4FTVA 5IB3A 2FR4B 1I1AA 2CIKB 2MMXA 4NQCA 2DTMH 5I1AA 3ZDZF 3MRFB 1A6WH 5JPNA 3QXDA 2NLJA 4M6ML 5C2BH 3V6FA 1ACYL 1W72H 3SDCB 4YPGB 4Z9KB 5I75B 1FYHB 1TETH 1LK2A 4JLRA 3CSGA 4M48H 3BWAA 1T22B 5JLZA 5JR1L 3BDYL 3OAUH 3NIDF 2X7LA 5GS1B 3HE7A 1FYTD 4YBLB 3LEVL 5IG7A 1DTUA 1KCSH 3N85H 2LU4A 5IEKB 5IB5A 4ZYKA 3BHBA 1D5IH 1G9MH 2ID5A 3AC0A 4F9PA 3ZE2E 1AE6H 2JB5L 5J12C 3EZ8A 5E94B 4DKAA 2R0ZL 3QEHA 2IH1B 1EK3A 1BAFL 1J7VR 3LRSA 3DUUB 4Z7WE 3AGVA 4QRTB 1U8HA 2QQKH 1RK0B 3E0GA 3DUHA 3GMPA 4J1UA 3HZYB 4ORGA 5DS8B 5LXGH 1H3VA 1T83A 1AGEB 2CK0H 4M93B 2ZCHH 1E4WL 2P7TA 3RZCD 4WW2F 4FQIH 4LBEB 4WV1C 3R1GL 3B8YA 1NANI 4YDIH 4FQXA 1FFQA 4W4NA 4I4WA 2IF7A 5CJBA 4CVZA 5MI0C 5HHXH 3UTSA 2PTTA 3OXSB 5KVGH 1G6VK 1N8ZA 4XNXL 4X80L 5J56B 5JDSB 1QFUL 1LILA 4GRLB 5E6ID 1ZA6B 4CU6A 5J13B 1OT1A 2R0KH 4OB5L 4LLUA 5MEOB 3CLEH 4G8GA 2KH2B 5C0EA 5CZXC 4RGOL 3H42H 2P42B 2JCCA 1IT9H 3JWDH 2VDOH 5SWZD 5EU6E 2QEJA 3WFHA 1CLZH 2ZWLT 3D3VB 2DQGL 4BH8A 1ZT1B 5K59E 5A2JH 3SE4C 5JZ7C 1JGVH 1XGYH 2IH3B 3HAEH 3T0ED 2NY0D 2YS4A 4J8RB 3V95A 3RVTC 1Z6JT 1KV3A 1MHEB 4KTYA 3C08L 3TV3H 4JG1L 1YEGH 1IZJA 4Z7UE 4I0KA 1JZ5A 2QADC 4JHBA 4LNVA 1A4KB 1HHIA 2X44D 5K9JL 2J7LA 1WCBB 4G6FD 5DJ6B 1ACZA 4MXVF 2ADIB 3H3PH 2OP4L 3HFML 5JTWA 5IQ9B 3ESVF 2C7UA 1UEMA 3N9GL 2PXYD 2A73A 2DDQH 3ULUE 3AMLA 3ET9F 5SX5H 2WBWB 3NFNB 3VD3A 2R1XB 1H3UA 3RU8L 3WNKA 2JF1A 1K6QH 1OPGL 1JGUH 1ADQL 3WNLA 1JI1A 4GW1A 4OZIA 3RA7H 5CZXD 2IAMB 1KEML 3QUKA 2EIZB 5BO1H 5J06A 4F7EA 2ORBH 3ARRA 1O0VA 5L2KD 2R4RH 3O2VL 5GHWL 3HR5A 3V6ZB 4M7KH 1CGYA 3LKNA 1K4DA 4MAYC 2FBJH 1QRNA 1RJYB 3MV8D 5CMAB 1Q94B 1CIUA 4XPGL 4S1SH 1LO2L 1OD9A 3RGVD 3LRGA 2QADD 2YR3A 1MJ7L 3B9KA 3UYPA 3X13B 4OLUH 4E41A 3HUJE 3QI9B 1AO7A 4MXWL 2QQNH 4KUZH 9CGTA 2NW3A 2J5LB 1T3FA 2P8PA 5D93B 3MJ8B 3MCG1 3TN0A 3ZL4L 2CO7B 1DBBH 2YPKA 1UM6H 3JTSA 3BO8A 5LG1A 3WDJA 4XP5L 1DLHB 4I77H 3M8OH 2YN5A 1BECA 1SEBA 1JGDB 4HG4K 3KPSA 2FIKB 3HZVA 1N4XH 5JNYB 3V0WH 3BT2L 3R8QA 1N5AA 1BBDL 3F7RA 1JPTL 3MLZH 4BSWB 3RNKB 4TSBL 3BDXA 3MRPB 4Y19B 4F8TA 1RMFH 2ENSA 3D2UA 5C0BE 1ZA3A 5HHQA 3KPMB 3V79C 1T20B 3DVIA 4PB0L 3P0GB 1YNLL 4L3AA 1Q1JL 4PS4L 5J3HC 5C07D 4MXVE 5HPOA 4CVXB 4JZNA 2DM3A 4JHZA 4X9FA 3DVNA 1JGLH 3PABA 1S9YA 4BFEA 3HLAB 1FZKB 1CXIA 3I2CH 5CD5C 4NBYB 2ADJB 1AXSB 3UBXG 1QSVA 3WXVL 1FPTL 5BVJA 3WFEL 1GOFA 4TVPD 4BH7A 3BPOB 4F58H 4Q0XH 1ODAA 1PLGL 5GGRB 3ULSA 1JNHB 4FG6D 4FQPA 4CADA 3ULUL 3BQUC 3O8XD 3LEXB 2YD5A 1HINL 1ZANH 1OB1B 1Z5LB 3O81A 3V5DB 3ARQA 1ZAGA 2IG2H 1A1MB 2YXMA 3VWKD 4N0UE 1UGNA 5I71C 1JGEA 3LY6A 5E00A 4PRID 1RU9L 4G42B 1OD7A 4Q74A 4NFBA 5AYUL 3WJJC 5CEZD 4H1LG 2R23A 5JXAH 1RUAH 4WFED 4KWUA 3SKMA 2VKXA 5T1MB 1OAUH 4P2CG 2IPUK 3DYPA 3KPOB 5K9KA 1TTUA 3KDMA 3PWNB 3CVHL 1CGVA 1Y18A 4KGLA 4GQ9L 1ORQA 1I8KA 4YGAB 2FB4H 1IGYA 1MCSA 2AEQL 3LN4B 3SPVB 4AEIH 1K2DA 5E8NA 4CL7A 2BSSB 4WENB 4Y5XB 2YXFA 2V9QA 2XNAB 1C5CL 4RIRB 3NIGF 3BP6B 3UYOD 3BH8A 4PRAA 4H8WC 4ZSOA 1FQ9C 3MLSL 3FAWA 5EIIA 1BBJB 2GJ6E 4C54A 3UJJH 3QDGB 1DR9A 4OT1L 3FN0H 3GI8L 3JZ7A 4WUUE 3EJYD 4F2MB 4MGXA 4LCCC 5A16A 1CFTA 3CZFB 2P8MA 2VLLB 5MEPA 1RULH 5EZOH 4QRRA 3EO0A 2NZ9C 5I6XC 2OXGA 2RB8A 2H26A 3IF1A 3Q1SL 3W9EA 2A0LC 5BRZD 4OV5A 4U31A 3QDJE 4IDLA 3TNNB 1F4YL 3MV01 1FAIH 3GRWL 2P5WD 3MJGX 3K4AA 3S5LA 2VLJE 3D69A 5F7NC 4JGUA 5F8RC 4WW2A 5F1NA 4O2CB 4XVJL 3MROB 1ED3B 5FYJU 1LQSR 3QNYB 3GMLB 5HD8D 2FX8H 3SOBH 4JPWH 4MXQD 3BKMH 1KXVC 5DJ0B 3ZDYF 4R2GC 4JM4L 4R7NB 3THML 5CD3A 5L88H 1T7ZA 5D1QD 4NRXB 5CJXA 3GEWB 4NDMA 5JW4N 4YR6B 1RK1A 4U1SA 4YWGL 5D2NB 3EDFA 1E6OH 3I50H 1JI2A 4O4YL 5INCA 1FC1A 4Z0XB 1QPPA 1NBYA 2W9EH 5I1GH 5F3BA 4PJHE 2GITB 3VXRB 5E2TH 4ONFL 3JXAA 5ESVA 4HC1L 4XVTL 25C8H 5DD3L 1VB9A 1AXIB 3OAYK 1KJ2A 2DLTA 4TULH 1OF2B 3D25A 3F7YA 4W68A 3OR6A 4TVSa 3QDAA 1D7FA 4U1HA 3D3VE 1D6EB 1W0WA 2HFFA 4HWZA 3QH3B 4ZOEA 4KKAC 1QKZL 4JFFA 3ZLQC