1JTXA

Crystal structure of the multidrug binding transcriptional regulator qacr bound to crystal violet
Total Genus 72
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
72
sequence length
186
structure length
186
Chain Sequence
NLKDKILGVAKELFIKNGYNATTTGEIVKLSESSKGNLYYHFKTKENLFLEILNIEESKWQEQWKKEQIKAKTNREKFYLYNELSLTTEYYYPLQNAIIEFYTEYYKTNSINEKMNKLENKYIDAYHVIFKEGNLNGEWSINDVNAVSKIAANAVNGIVTFTHEQNINERIKLMNKFSQIFLNGLS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural mechanisms of QacR induction and multidrug recognition.
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Transcription
molecule keywords HYPOTHETICAL TRANSCRIPTIONAL REGULATOR IN QACA 5'REGION
total genus 72
structure length 186
sequence length 186
chains with identical sequence B, D, E
ec nomenclature
pdb deposition date 2001-08-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00440 TetR_N Bacterial regulatory proteins, tetR family
A PF08360 TetR_C_5 QacR-like protein, C-terminal region
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 1jtxA01
1.10.357.10 Mainly Alpha Orthogonal Bundle Tetracycline Repressor; domain 2 Tetracycline Repressor, domain 2 1jtxA02
1UI6A 1VF9A 3CJDA 3O60A 3OOUA 2UXOA 4CYCA 3NRGA 2JMWA 3GTLJ 4KWAA 4XICA 3BTIA 1P7IA 2FBQA 3GBGA 2O8KA 3HOWJ 3G7RA 1WI3A 3GZIA 4FTHA 1SANA 2N8GA 3LSRA 1PUFA 2HOSA 4A3JJ 5E3LA 1RR7A 3BR5A 2TRTA 4IHWA 3HKZN 2L0KA 3HDDA 2DG8A 1Y1VJ 4UUSA 4QSHA 3JR9A 3CRJA 3BR6A 2NP5A 2IEKA 2G7GA 3BG5A 5EFYA 3T6NA 3K7AJ 1EF4A 3B6AA 1GT0C 3M4OJ 3VIBA 1POGA 4G12A 3BT9A 1H89C 3UKGA 1XS9A 2M34A 4DYQA 2OPTA 3VOXA 1RKWA 4L5EA 3RD3A 2D5VA 2DMPA 5M5XJ 3G1OA 4DYRA 5C3EJ 1R9TJ 4XRMA 1Z77A 4BY7J 3GEUA 4JX4A 2H1KA 1TWFJ 3HTIA 4ICHA 5EDNA 4B4CA 3BRUA 5FKMA 2DTZA 4XRSG 2G7LA 3RH2A 5FMPA 1APLC 5HAWA 1JT0A 3HOZJ 1RKTA 2XB0X 3QBMA 1UG2A 3ANGA 4I76A 3IH4A 2CQXA 4IHYA 2WGBA 2K40A 1IG7A 5IP9J 2ZCMA 2DA1A 4MLOA 2YUSA 3Q0VA 4B3AA 4GCTA 1UHSA 2PBXA 3HE0A 3O8GA 1YRNB 5BNGA 4D5CA 1SFOJ 1JTYA 4LOCA 3DPJA 1PUFB 1OFCX 3CMYA 2XB5A 4FE4A 2LR8A 5F1JA 2OI8A 1A6IA 3BQZA 2V57A 5F0FA 1BL0A 3JRBA 1JGGA 1DU6A 1A5JA 5FHPA 3MN2A 4AYBN 2AHQA 1JJ6C 4GCKA 3C2BA 2JWTA 3OSFA 2HDDA 3LWJA 3H3VK 4GCLA 3G1LA 1WH7A 5IP7J 3JREA 2JA7J 2EZIA 2DMNA 2EH3A 2NVYJ 2VUMJ 3PO3J 1ZK8A 3S2DJ 2DA4A 3BR3A 2DMUA 1P7JA 4IEJA 2MG4A 2XRLA 3FIWA 3NARA 3QPLA 4HKUA 1QPIA 5FGLA 2DA5A 4C3IJ 4MFDA 1W0UA 5D1RA 2K9QA 3ANPA 3TP3A 1FTTA 2MW8A 3LSPA 2QWTA 2QKOA 3W6VA 2LFBA 2XPUA 3GTOJ 1W0TA 3LNQA 1BA5A 2JJ7A 2ZOYA 2DMQA 3RQIA 2WUIA 3BCGA 5JLXA 1F36A 2GENA 5J1RA 2UXPA 1LE8A 3I4MJ 4M3DA 2R0QC 4BY1J 3VVXA 4FISA 4A3KJ 4M3BA 3M3YJ 1ETKA 2CUFA 2R92J 3JRCA 2DA7A 5GPCA 5M3FJ 3HOXJ 3DCFA 3WHBA 5DTDA 5EG0A 3BHQA 4MO7A 5IPAA 5EGOB 4I6ZA 2E1OA 2R5YB 1MNMC 4A3GJ 5F08A 3OSGA 4A69C 1I50J 5K7ZA 2X48A 1NK2P 4D5FA 4DZPA 1RPWA 2TCTA 4FE7A 3HTJA 4CYCB 2F07A 5IYCJ 1LFUP 2NS7A 2FJ1A 1ZTRA 4RDUA 1QVUA 2AO9A 4BBSJ 4M3FA 3SDGA 4DYCA 3NPIA 3C07A 2HXOA 4DZJA 1D5YA 2UXIA 2CU7A 1ZR4A 2XPVA 3S5RA 3FRQA 5J3LA 1RESA 2ECBA 4M6VA 1I6HJ 1JKPC 4A3BJ 2W48A 1QVTA 1MBHA 3HM5A 1YRNA 1NTCA 3BG3A 1ORKA 3EUPA 1JT6A 3KZ9A 2JA6J 5J1UA 5FLMJ 3BNIA 2FQ4A 1LE8B 1X2MA 2R5ZA 1T56A 3A01A 2GLOA 4M3GA 3SJMA 1WGXA 1VFCA 1IGNA 3PO2J 4W97A 3VW2A 3RZOJ 1VNDA 2IAIA 3B81A 3TP0A 3WHCA 4A3FJ 4FCYA 4JX5A 2RAEA 3TW7A 3HB9A 3BQYA 4C3JJ 4JNNA 2D6YA 2JA8J 4A3LJ 4X1EA 5E3NA 4IHVA 1E3OC 2W53A 3FISA 2Y9ZA 2GFNA 2QOPA 1JUPA 1AHDP 5DAJA 3TEDA 2XGCA 3ZQHA 3MKLA 2E19A 3Q0WA 5EF6A 2NVQJ 1IUFA 3JRAA 2QF7A 3JSJA 4XIDA 2G7SA 5JLWA 3VUQA 2DJNA 4NELA 4ACIA 4S0HB 3ZQIA 3I4NJ 4GFKA 4AC6A 1IC8A 4UUTA 2WAQN 3FK7A 4A3IJ 3CWRA 3JRHA 3S16J 5HSZA 3BR2A 2YU9J 4ME9A 4D7NA 1K83J 1VI0A 5M5WJ 1H8AC 3ON4A 3VVYA 4MFEA 2HKUA 5IYDJ 1JTXA 1JKRC 5FKLA 1G2HA 3V78A 3Q3SA 1FIAA 2CQQA 3PM1A 4RBOA 1ETWA 5EG0B 2JA5J 2XSDC 3NI7A 3S1RJ 1ETOA 3GTGJ 3HGYA 4A3CJ 2QTQA 5C4XJ 3A01B 3B6CA 1B8IA 1LFBA 2G3BA 2UXHA 3S1MJ 3JRIA 2GBYA 2CUEA 2L9RA 2M0CA 4M3EA 2LKXA 2OF7A 1FTZA 3HGGA 2RHAA 1SGMA 5C4YA 5HBUA 3COLA 2M2EA 5FKNA 3KKDA 1MBEA 2ZB9A 2R93J 1DU0A 1MBJA 3ZQLA 5E3MA 3ZQFA 3JRFA 2MSYA 5C4JJ 1ETVA 5EZGA 3BR1A 2ZOZA 3F0CA 2HOTA 5FJ8J 3HTHA 1NK3P 2O7OA 1TWGJ 5F0CA 3S14J 1GV5A 1BW6A 2PZ9A 3VW0A 2Y9YA 1HF0A 5CXIA 2JN6A 5CW8A 4NN1A 4X6AJ 3O8HA 2HQ5A 4A3DJ 1JJ8C 4JL3A 3D1NI 3KKCA 2EQRA 2EZKA 2EZLA 1BJZA 2KT0A 4JP0A 2ME6A 2KDZA 1TC3C 1TWHJ 3ZQGA 4XK4A 1GUUA 2LTPA 2O9LA 3H0GJ 1H88C 3ON2A 3A02A 4GFLA 3V6GA 2LD5A 2IBDA 5M3MJ 2LLKA 4C2MJ 4A3MJ 3HBLA 4J19A 2Q24A 3BG9A 1ETQA 5M5YJ 3PASA 1MBGA 2EZHA 4PXIA 4MIMA 2REKA 2YS9A 2NVXJ 1AKHB 3QKXA 1WCMJ 2G0EA 1OCPA 2I10A 5K58A 2Y0SN 2ID3A 3HOVJ 2DMTA 3VW1A 5FKKA 5F0HA 2VKEA 4BXXJ 1IV6A 3EGQA 1MH4A 2HXIA 5FLVA 5EGOA 2Y31A 2JK3A 4QIWN 4V2GA 4A3EJ 3NAUA 2NS8A 1QRYA 3S1NJ 5DS9A 5IOZA 3A03A 1ZGWA 1MH3A 3CQZJ 1FIPA 3VVZA 2M8GX 1MBFA 4ABZA 1JUMA 1TWCJ 1GVDA 2K9NA 3F1BA 2UXUA 3GTQJ 4V2FA 3CDLA 4EEFG 3RKQA 5GPAA 4QTRA 3IV5A 2P81A 3FK6A 3LSGA 5FKOA 1BW5A 2XDNA 2VI6A 1UMQA 1MSEC 3MNLA 2LY9A 1JUSA 1ZKGA 2YVHA 4JX6A 1U9OA 2COBA 1U78A 2NX4A 1IDYA 3BTJA 1GV2A 2E2HJ 2VPRA 2FX0A 4DW6A 3MVPA 2O7TA 3CCYA 1IDZA 2Y2ZA 1UI5A 1TWAJ 4NDLA 3HOYJ 2HYTA 3TW6A 3ZQCA 3S17J 2L7ZA 3HIMA 1X58A 1AU7A 3S2HJ 3GTJJ 4CGRA 4XRSA 1I3QJ 3E7LA 5EYRA 5F04A 5EZHA 3AQSA 3IUVA 1S7EA 2MGQA 5E3OA 5CXGA 2WB1N 5D19A 4BKXA 4W1UA 1O4XA 2IU5A 2ID6A 2PMZN 1GDTA 4B1RA 3QPSA 5J1YA 3KNWA 1B72A 2DA6A 2ECCA 1HDDC 1HOMA 2LK2A 1FEXA 3OIOA 4AUXA 3BR0A 4AF5A 4L62A 2B63J 5EEAA 5AQCA 2VKVA 2EBIA 5IOYA 1ENHA 4HNVA 2H8RA 2DG7A 2NOGA 5H9TA 5C44J 3E7QA 2K9SA 2OERA 3DEWA 4MXMA 1OJLA 3JRDA 3BJBA 1IJWC 5K7HA 1AKHA 4JYKA 2XGEA 5HODA 3GTMJ 3BTCA 1Q1VA 1JKQC 2YVEA 2CJJA 5K7FA 4C3HJ 1F43A 4BBRJ 3JRGA 4AC0A 3VOKA 2NVTJ 1U9NA 3HEFA 2RASA 3G1MA 1HLVA 2ZCXA 4JKZA 3FKIJ 3S15J 2GUHA 3AQTA 2LVSA 2ME0A 2M9HA 3LJLA 3RZDJ 3NNRA 3HOUJ 2HYJA 2L7MP 3GTPJ 1ZR2A 2XGDA 4GFBA 4YZEA 2R5ZB 1ETYA 1Z0XA 2LP0A 3VP5A 3LHQA 9ANTA 2WV1A 1HCRA 1B8IB 1JKOC 3ZOBA 4UDSA 4UUSB 2DN0A 5IYBJ 2DA3A 3LOCA 2L7FP 3Q0UA 1CQTA 2R7ZJ 2FD5A 1U8BA 1HDPA 2X6OA 4Y7NJ 1XG1A 1T33A 3IH2A 1K61A 2QCOA 2X9DA 5IP6A 2HI3A 3K2AA 1WPKA 1ETXA 1FJLA 2ELKA 2DA2A 2E2JJ 3SFIA 2GM4A 2HOAA 3S1QJ 5F27A 4A93J 3BTLA 1Y1WJ 4MK6A 2NP3A 1RETA 1ZQ3P 3LSJA 4IHXA 3HTAA 3VPRA 2ZCNA 3L1PA 3NXCA 3GTKJ 4Y52J 2CRGA 3PPBA 2E2IJ 2XPWA 1WH5A 2Y30A 1MSFC 3G56A 5D18A 2R5YA 1OCTC 3IH3A 3QQAA 1MBKA 3P9TA 4D7MA 1ITYA 1XC5A 1B72B 1IRZA 1X2NA 5GP9A 2QIBA
chains in the Genus database with same CATH superfamily
3E6BA 3O60A 3CJDA 1A04A 2PMHA 1J7KA 4I2OA 3H5AA 4KWAA 2CO5A 3MD2A 4XICA 4B43A 3G7RA 4B8XA 2X4HA 4IKFA 2K86A 4HLYA 2N8GA 2OD5A 1WJBA 4NUBA 1YITI 4LB5A 1ZHFA 2DFIA 1RR7A 1YYVA 2TRTA 3BR5A 4IHWA 4C30A 1HXDA 3S2WA 3HDDA 2NYXA 3RPUD 3HHGA 5E1ZB 5KCMA 3FXKA 3JR9A 3CRJA 3BR6A 2FXAA 3BG5A 1RIOH 3VSLA 2EFOA 3GZ6A 3B6AA 4KITB 3CMEI 2F4MB 5ICGA 4U0VA 1IN5A 4LLGF 1H89C 1XS9A 2EFQA 2VBYA 3P9KA 2OPTA 3SZTA 3CC2I 2BGCA 1RKWA 3RD3A 2IW5A 2DMPA 2HDCA 1BC7C 1HW5A 1Z77A 4ICHA 1IZ1A 1TWFJ 1YO5C 2PFVA 1MDMA 5FKMA 1Z3YA 4EM2A 2E35A 2VJ5A 1S6LA 4CCKA 3HOZJ 2MLKA 3LA3A 3C3WA 4WXHA 3W2VA 1N75A 2DA1A 2QZ8A 3RYRA 3Q0VA 4B3AA 4GCTA 3HSFA 2PBXA 2WADA 2BBYA 4WCGA 1YRNB 2BHZA 1D1BA 5BNGA 1NG6A 1SFOJ 2QA4I 4LOCA 4N0BA 3UNGC 1TP4A 5K5QA 3H0DA 2UUZA 2P7CB 2XB5A 1NHAA 1S9HA 3CJRB 5AONA 4ON0A 3VYRB 2OI8A 5FFXA 5HOOA 2V57A 5F0FA 3JRBA 2VKHA 2PFBA 4A0ZA 1A5JA 1J9IA 2KL4A 2F48A 2K02A 3MFKA 3QAHA 4XM3A 1DGWY 3H3VK 1P4AA 1WJDA 1K6OA 4S05A 2HGCA 2OZ6A 2E71A 3JREA 1QA6A 1BIAA 3FM5A 2LBFA 3KCCA 2VUMJ 1ZK8A 1A6QA 1XB4A 3BR3A 2GXBA 1P7JA 3WE3A 4O5VA 3MAJA 4IEJA 1NH3A 2BW3A 5B5EC 2ESHA 4P9UA 2FE3A 4ZYAA 1QPIA 5FGLA 2JPCA 2DA5A 1X1PA 4ZH4F 5D1RA 1YG2A 1RRJA 2PG4A 3ANPA 1SVLA 3TP3A 4P9FA 3LSPA 1YFHA 2H27A 2QENA 1VQ9I 3RDIA 1W0TA 2PBIA 3LNQA 1BA5A 2VE8A 3E6MA 2ZOYA 1DGRM 2GA1A 1ON2A 2WUIA 4IQJA 1OCOH 2JUGA 4XKCA 2RGVA 3ML6A 3J80K 1O3RA 5D6EA 5J1RA 2VASA 3WGHA 4XORA 5DM7F 3KE2A 4FISA 3M3YJ 1ETKA 4NC6A 1Z7LA 2VODA 3T0YA 1WJCA 3N4MA 3WHBA 2IA0A 4S04A 2O03A 2YX4A 3LSHA 3KPHA 3OSGA 2O61A 4LIUA 1D8JA 2XC7A 4UXNA 1PVEA 4F55A 5K7ZA 2LYCA 4DZPA 4L0ZB 5LGTA 3MZHA 4FE7A 2FJI1 1U8RA 2GXAA 3I4PA 2F07A 2KHMA 2OUMA 3CUQC 4RAZA 2FJ1A 2FA5A 3CC4I 1R1TA 4BBSJ 4IOCF 3ABUA 3SDGA 3UR3C 1CF7A 3NPIA 3ZMZA 1JXSA 1X1AA 2HOEA 1ZR4A 2XPVA 4ESBA 2ZXJA 4RGRA 3CO6C 1BN5A 1E0EA 2HKXA 3FMRA 4YFNF 5TRDA 3JSPA 1QVTA 1YRNA 2BXZA 2ADUA 2D45A 1XMKA 5J1UA 3BNIA 1X2MA 2R5ZA 3D5LA 3NWSA 3Q9VA 2FF4A 1EH6A 3C18A 3PO2J 1FSEA 4E7LA 1F5TA 3L2QA 3FDYA 2LKPA 3B81A 5DCFA 4LG0A 3OYLA 3WHCA 2HVQA 1T98A 2A3SA 2DOEA 3TW7A 4PJMA 5A2QK 2JA8J 3OYBA 2YR2A 4X1EA 5E3NA 5J40A 4A0XA 4PSXA 2KZGA 3F6VA 2QOPA 2W53A 1AHDP 2EWNA 2W24A 3G3ZA 1B59A 2BW3B 3OYEA 1MD0A 2NVQJ 1IUFA 4I98B 5HLIA 2L02A 2G7SA 5JLWA 4ACIA 1B1BA 3ABTA 4I0AA 3KP4A 3NWTA 4B44A 3I4NJ 3M7GA 4IHSA 2DQRA 3HKZA 3AAFA 3CCQI 3R0AA 3HRSA 5LHGA 3CESA 1BOBA 3FXJA 2DOFA 3M8JA 1X4PA 5GTIC 1VI0A 1IO2A 1XSDA 1H8AC 4KFCA 3ON4A 4LLLA 4MFEA 2HKUA 3CZ6A 5FFZA 4CDGA 1MGTA 3CP8A 3AKZA 2BY2A 2YSRA 2RNGA 1FIAA 5L3GA 4RBOA 3DP7A 1QHHD 1ETWA 3LSKA 2FOWA 1CGPA 3S1RJ 3KZZA 3HGYA 4XLHA 3OYFA 3G2BA 2JZYA 3AG1H 2QQAA 3BJOA 3F22A 3A01B 1B8IA 3LAJA 2W00A 2UXHA 3L7WA 1T0FA 1F4KA 3S1MJ 3JRIA 4J01A 2CUEA 1BM9A 2L9RA 2RDPA 3OYDA 3FHNA 4Z6YA 4IHTA 4G6TB 3S93A 1KYWA 2RHAA 2YVXA 4ANJA 1P2FA 3HUGA 1FZPB 2M2EA 4L5IA 2W7NA 2JRMA 3KKDA 3TDUC 2ZB9A 4GGGA 3RKWA 3V8KA 3ZRGA 1DU0A 3H5NA 2HR3A 5HLTA 2JQ7A 1ETVA 2DW4A 5EZGA 2ZOZA 3ZMDA 3HTHA 1NK3P 1TWGJ 5F0CA 3LSIA 1GV5A 3VW0A 5CXIA 2JN6A 5CW8A 4JL3A 3EQLF 1JJ8C 2HPMA 3KKCA 2GQQA 2EZKA 1B9NA 3CJNA 1TC3C 3DEUA 2ZFWA 1U5TC 2CH0A 1TNSA 2LTPA 2V9VA 2X1CA 4QLCU 1IRGA 3A02A 3WTSC 1UCRA 3S3MA 1MNEA 2LLKA 4C2MJ 5J4YA 1HW2A 1U5TB 2Y48A 2Q24A 5M5YJ 1MBGA 4EJTA 1HKQA 2IGKA 3QOPA 2LRDA 2ZJ2A 3DEEA 4E7KA 2B1EA 1AKHB 1Z91A 4E7ZA 4TV7A 1SVOA 2PEXA 1SD6A 3KEYA 1YS7A 2A69F 2K5CA 3EGQA 1MH4A 5FLVA 4ZTJA 1QNTA 3GWZA 4XRFA 1W36C 5HLHA 1G3WA 5FD5A 2NS8A 2PMZA 1FPQA 2GOMA 2MD0A 4EM0B 5F1RA 3S1NJ 3F8MA 4OD5A 2IA2A 1K78A 3FXMA 1MH3A 1Z21A 2MLGA 3ONQA 1FIPA 3CUOA 1S7OA 2K9NA 2IJLA 3DF8A 1QZZA 4NNJA 5E18F 4BYYA 1BI1A 2OV7A 3MZ8A 3J81Z 3RKQA 1LEBA 5KAFC 2IS2A 4HF2A 2RQQA 1TT0A 1UMQA 3BWGA 3MNLA 2LY9A 1JUSA 2E1NA 2YVHA 5KAIC 2COBA 3RJPA 2NX4A 2ZCWA 4BDYA 5D4SA 1YHQI 1QU3A 4CUGA 1AA7A 3OYAA 4ZYHA 1H9GA 4RS8A 1UFMA 2W82A 4QPQA 1W5CC 2CW8A 2XGXA 3K2ZA 4NQWB 3OYIA 1SVMA 4NDLA 3CCUI 1DP3A 1UI5A 3S17J 1X58A 1AU7A 3S2HJ 3GTJJ 4LB6B 3A0HC 5FLXK 1ZN2A 5EYRA 5F04A 3QU6A 4NHJA 1FNNA 3MZYA 4W1UA 2ID6A 4AD9A 2PN6A 1TQIA 4LITA 4G94A 2K4BA 4CCLA 1HOMA 2DA6A 1HDDC 1F9NA 3KYDB 4BJ6C 2W1OA 3KETA 1KQ8A 1LKXA 2MA3A 3M8EA 3BR0A 4RLFA 1EH8A 4AF5A 4GDFA 5AQCA 4HDVA 5IOYA 4GYGA 3CJQB 4MTDA 4BQQA 2ZNZA 1I27A 5C44J 2R7SA 4E7IA 2BYVE 2QSFX 2K27A 3DEWA 1QZYA 1LNWA 3EDPA 4MXMA 4AIJA 3IHUA 5J47A 4ZDOA 1BR1A 1IJWC 2L54A 2XGEA 1B6AA 5HODA 3GTMJ 4Q5SF 1XGMA 4R79A 1KA8A 1Q1VA 3V8JA 1BBYA 5K7FA 1DQUA 4U9LA 4XSXF 1U9NA 3K70D 2ZCXA 3FKIJ 3QP5A 2GUHA 4LK0F 1W7PD 4UV8A 3SEZA 4Z2YA 3DBHB 3NNRA 3FXRA 1Z67A 1ZR2A 4ASNA 2HZTA 4GFBA 4G7OF 3GCMA 2R5ZB 1UAAA 4RB0A 1B8IB 3BY6A 3ZOBA 4UUSB 4UDSA 1USSA 2XAJA 4LIVA 4KA4A 3L2WA 2L7FP 4ETSA 4MEYF 1U8BA 1OCZH 1S8NA 3IH2A 1YQAA 2IGMA 3DV8A 2HI3A 1ETXA 3LA7A 1FJLA 1XN7A 2UZKA 2HQAA 5HS9A 2DA2A 4V19K 2GM4A 4ZYDA 3S1QJ 1X19A 2KIUA 5F27A 1OCCH 2DFFA 2KQRA 4JOMA 3J7YJ 1ZQ3P 2NP3A 5FB2A 5HNFA 3ZQQA 2DFHA 3F3XA 3GX4X 3PPBA 4PDKA 5FLXZ 2JRTA 2K9LA 2FQ3A 4EM1A 2J5OA 2VKDA 3LA2A 4RLQA 3WTZA 2PQ8A 5TGTA 2DJIA 4D7MA 2R7XA 1XC5A 2EFWA 3HRTA 4OU0A 1G6NA 3LL7A 3E6CC 2QIBA 2R7OA 2NRAC 1E17A 3OOUA 2UXOA 3O6BB 3DXJF 3NRGA 2JMWA 3IAM2 2FBIA 5K1YA 4BXFA 3GBGA 3E5QA 2O8KA 3H1CA 1RNLA 3N97A 3HOWJ 3GZIA 3FKJA 1EH7A 2CQ7A 3LSRA 1ZG3A 3QOEA 4A3JJ 5E3LA 5DM6F 2V1XA 2QQ9A 3LWFA 4Q48A 5D8LB 1HW1A 2L0KA 1Y1VJ 4IJAA 2QLZA 2LY2A 3U9GA 1K78B 2NP5A 2G7GA 2M45A 5EFYA 4P1WA 4MGRA 3K7AJ 1EF4A 3WU1B 3M4OJ 2B0LA 3VWBA 4DYQA 2WB1A 3VOXA 1OCRH 5EEGA 4WF2A 5B3SH 1IV8A 3KP3A 4BY7J 3GEUA 2J5PA 5A2QZ 1K4SA 3PJRA 1HKTA 1MKMA 2DTZA 2G7UA 4AU7A 2R3SA 1FLIA 1YTYA 2ZMEB 1UG2A 4OAYA 2OC6A 4II3A 3ANGA 4I76A 4NQWA 1ZG1A 2WGBA 3K4CA 1FP1D 1IG7A 5IP9J 4MLOA 2DFEA 3OWTA 1UHSA 5LRRA 3O8GA 4FETA 1TQMA 1O3TA 2HYGD 3GLLA 4LLNA 5KK1A 2G9WA 4RM2A 3ZQ7A 3E5UA 1I3AA 2BY1A 2DU9A 2IXSA 2LR8A 1G3YA 1N77A 3BCBA 4DJAA 4BJ5C 3BQZA 2V1UA 5HDGA 4BL0B 2A5WA 1SFUA 4F93B 4N4NB 4XLFA 2BY3A 5FHPA 2AHQA 3AG2H 1FWZA 1TZLA 5IY5H 5CPRB 3OSFA 2STTA 3BJ6A 1MZBA 2ISYA 4HLXA 1HQCA 3R4KA 1Y0UA 5CVJA 2BE5F 3JCUC 2EZIA 2DMNA 2ZO4A 3S2DJ 2DO7A 3CCJI 2DA4A 3BZKA 4A5MA 2CV0A 1KQ0A 4LD5A 4KISA 4M9XA 4HPQA 2MYSA 2R7DA 1T0FC 1BR4A 4BAYA 4MFDA 5B66C 3QRFF 4BS9A 1WI9A 2K9QA 5D5XB 1FOXA 2FNAA 1FTTA 2EK5A 3M1CA 3W6VA 3DKXA 2LFBA 3MCZA 1TTYA 5FRNA 4L0YB 2DMQA 5L3EA 3BCGA 5JLXA 4XKBA 4PGHA 2ZNYA 3I4MJ 3TOAA 3VSKA 4BY1J 4A3KJ 2GWRA 4HQMA 2CUFA 1EKEA 2DI3A 3HOXJ 4WK8F 2Y69H 1UELB 5EG0A 4MO7A 2VOOA 2XAHA 5IPAA 1XMAA 4I6ZA 2R5YB 1OR7C 2RN7A 1IUYA 3I53A 4HBLA 4IQ4A 2BZTA 1I50J 3C7JA 2R7RA 2X6XA 3CDHA 1LB2A 2HYFA 4R8HA 1MJ9A 1XDUA 4AWXB 1FBSA 1ZAOA 1SFXA 2X48A 4D5FA 5D8KB 2KRFA 1RPWA 2ZXWH 2MD5A 2TCTA 4YIIA 3HC7A 1ZH5A 2COMA 3HTJA 2EPFA 3ZN0A 4U0YA 1MMSA 4Y33A 1QVUA 3QODA 2KISA 2DODA 1R1UA 4G8XA 4M3FA 4HF1A 5HNHA 1U5TA 3EUAA 3C07A 3OYHA 3D5SC 2ZJPF 2AQFA 4BHBA 4MQ9F 1L0OC 3I58A 3LFKA 5J3LA 1RESA 3K8PC 4XLPF 5LGNA 4G6QA 4A3BJ 3I56I 2W48A 1MBHA 3HM5A 1ORKA 1LJ9A 1JT6A 3I64A 5F6FA 2X1DA 3AG3H 4MQVA 2JA6J 2D1VA 4IOAF 1Z6RA 2VB6A 1R58A 5LBQA 2K3FA 2QGUA 3DLAA 5JVTA 1D3YA 2E36A 3HTUA 4M3GA 3T1BA 3H3UA 1VFCA 1IGNA 2QBYA 3CMAI 5E1XA 4PJNA 3RZOJ 2XAGA 3WTTC 1V54H 3BDDA 2KIQA 4KMUX 2JT1A 1FOYA 5CVIA 2EFNA 4FCYA 3BQYA 2IGNA 4JNNA 1W7PB 2RC4A 3EPZA 3T5XA 4IHVA 3BZ6A 4KIGA 1E3OC 4GXOA 1TT5B 3FISA 2GFNA 3BG7A 4U88A 3DQVC 1JHHA 3CD6I 2E19A 5EF6A 3CCSI 5J8CA 2RV8A 1RUOA 2MBFA 3E97A 3KLOA 4AVZA 3OYMA 4XIDA 4NELA 1FT9A 3CCRI 2UV1A 3A2KA 3QPTA 5CVRA 3WU0A 2DK8A 3ZGKA 3B73A 1K79A 1IC8A 1VQ6I 2AXTC 1D0ZA 5FGMA 2F5CA 4OIRF 1Q1HA 3T8RA 5HSZA 2VBXA 3BR2A 1R23A 4D7NA 4Q47A 5M5WJ 2OJED 4DBQA 3FMSA 3U1KA 3IWFA 1V5GA 2PJRB 4ENMA 5B1BH 4EV0A 3V78A 3Q3SA 2A6TA 4HA8A 2CQQA 1I39A 1LVAA 5EG0B 2Z3YA 2ZFUA 3GTGJ 2CV1A 3RQ4A 2QTQA 2WAEA 4PFOA 5C4XJ 1GHCA 3B6CA 2VONA 2Z16A 1LFBA 2G3BA 5GAEJ 1FBUA 3J7ZI 1WRJA 2GBYA 4OMZA 3V7CA 2ZKZA 3GFLA 2LKXA 4M3EA 4KT6A 1Y8QB 3RSNA 3ABKH 1SAXA 3COLA 1R5ID 5FKNA 1R00A 2A61A 3NEUA 3JAMK 1MBEA 2R93J 3R60A 4KIBA 3TOBA 5BS6A 2CS3A 2CW7A 2MSYA 1Y56A 2YPRA 2HZDA 3HYIA 3TO9A 4EJOA 3CTAA 2HOTA 4XN0A 5H20A 2IA1A 2ELJA 2ELHA 6PAXA 2A2FX 3K4KA 4E70A 4BQAA 2LKSA 3H9GA 1DDNA 3D1NI 4A12A 4CSWA 4A5NA 1MMAA 4BACA 2IVMA 1XDSA 3ZQGA 2HDWA 4HX4A 3H0GJ 3V8LA 4GRIA 5IT9Z 4KIFA 3HPGA 3E6DA 5M3MJ 5JHUA 1OYYA 3DLLF 3PSIA 3HBLA 2K4JA 1J59A 2QYOA 1VQ5I 4KDPA 3FHZA 3GXOA 3PASA 3DPTA 3H92A 1Y0NA 4PXIA 2V9PA 4P96A 2H6CA 2EA2A 5CVVA 5E79C 4OAZA 5FRMA 3K4MA 2P5LC 2IS1A 3QKXA 3WG9A 2G0EA 3KYLA 2Z5UA 3DTKA 4PZJA 2LSOA 2QUFA 2Y0SN 5ICEA 3HOVJ 5K58A 4EVIA 2DMTA 4OOIA 3U2RA 3VW1A 1E3PA 2VKEA 4YELA 1WZ2A 1VQNI 1GVJA 3PIPF 1XTAA 3V4GA 1T38A 1R4MB 1OYIA 2Y31A 4V2GA 3JTHA 2GXGA 2BHYA 3TL4X 3ZMVA 5DS9A 4ITVA 2QVOA 1J0RA 3IUOA 2BXYA 3GFJA 3A03A 3CQZJ 1MBFA 4ABZA 1JUMA 3DBLB 4J00A 2Z9OA 5DDGA 1LVKA 3MKWB 3FZVA 3CDLA 1BIBA 4EQQA 5CQEA 3O3KA 3NRVA 3KP2A 3C1DA 4RA2A 4M74A 1DPRA 1WJEA 2DYRH 3HL2A 1ZKGA 1U78A 3RPUA 2H1LA 2E2HJ 4BH9A 2ESNA 1VQKI 4PK4A 3MVPA 1IDZA 4KNYA 4ZYEA 3K1PA 4NC8A 3HOYJ 2HYTA 2LDUA 1SD4A 2R7VA 3HIMA 2V1DA 3DU6A 1ODDA 2KLOA 4XLAA 2KJCA 3QWLA 4XMYA 1I3QJ 3CLOA 2LOOA 5EZHA 3COAC 2VLAA 3IUVA 1S7EA 5E3OA 4ESJA 2Z99A 2FBHA 2WB1N 3KZIC 5LFAA 5D19A 1QBJA 1DPUA 2IU5A 2PMZN 1GDTA 3SDBA 2M87A 2A6EF 3QPSA 5J1YA 2FEZA 4XR6A 5DD4A 5L3BA 1B72A 3HRUA 3LFUA 1FEXA 2OQRA 4AUXA 2B63J 3DBRB 2M7AA 2EBIA 3QU3A 4IRVA 1S7AA 2E7XA 1ENHA 2DG7A 5AIPA 1R4NB 2CV2A 4I0BA 2M4KA 3E7QA 2RREA 3M07A 1TQPA 4EJUA 2YU3A 4MNUA 2JVHA 4XKWA 3RPQA 4G6DA 3BJBA 5L3CA 1MMDA 1FSHA 3CUQB 2IS6A 5DCMB 4JYKA 1IN8A 1FMVA 3H35A 3ISPA 1ZRFA 3ERMA 3BP8A 1JKQC 2CJJA 3ASOH 4D1QA 3K4LA 4BBRJ 3PL8A 3JRGA 2WA0A 1WJAA 1HLVA 4JKZA 1IXRC 4M72A 3SXYA 2KDOA 3GZNB 3VYTB 5J8FA 5DYMA 3AQTA 3PQKA 4IRGA 2LVSA 2ME0A 1S72I 2L7MP 4XL9A 3WTYC 1QQIA 3F23A 1ZRCA 4B48A 4YZEA 4WX9A 3LQQA 2UXXA 3TO7A 1ETYA 2LP0A 1XD7A 2V6CA 4L9TA 3OYGA 4HAMA 5IYBJ 2DAOA 3LOCA 3DWLE 2W85A 5H6RA 1GXQA 1CQTA 1FOWA 4WXDA 1IN6A 2X6WA 3IL2A 1K61A 2L2OA 2QCOA 5DCMA 5IP6A 1WPKA 4HG2A 2H6BA 1ZLKA 3CO7C 2KRHA 1V5EA 4IVNA 1BR2A 3HOSA 1G8XA 3MEXA 1TNTA 2UXNA 2VL8A 1Y1WJ 1RETA 2VQHA 4IHXA 3VPRA 3E1SA 3HSRA 1J5YA 4XOTA 1YJ9I 3NXCA 4Y52J 1FC3A 1N78A 2HNHA 2CRGA 3OL4A 2B7EA 2E2IJ 4HRIA 4CH7A 1MSFC 5D18A 2R5YA 1OCTC 4CCOA 2CFXA 3IP4B 3QQAA 4C2UA 1CF7B 4AIKA 2QKLB 3P9CA 2DDAA 1OKRA 1GLNA 3HXLA 5IT9K 5GP9A 3ZQLA 3WODF 1YW8A 1UI6A 1VF9A 2WAFA 2M5WA 4FASD 1FBQA 5LRSA 3F8BA 3OS0A 2FBQA 4ENKA 2RNJA 1FYMA 4U9NA 1XGOA 1PUFA 2HOSA 4C9YA 3HKZN 3E5XA 2DG8A 2HQNA 3WU2C 4QSHA 4UUSA 2WV0A 4Y3OA 1YIOA 2IEKA 3DKYA 4Q4ZF 1NG7A 3T6NA 1G4DA 2O5RA 1GT0C 3BPVA 2NAZA 4BEHB 3VIBA 4B09A 1POGA 4G12A 3BT9A 2K3PA 2M34A 1IRFA 3L2CA 1YOVB 1VQ8I 3HSEA 1X3UA 4ZDPA 4HV6A 5TJJA 1USTA 2D1HA 5C3EJ 1VQMI 1R9TJ 4DYRA 2Z33A 3HTIA 4XRMA 4HKUA 2VIXA 4I09A 4JX4A 2H1KA 1YX3A 3F72A 5HDNA 3BRUA 2Q0OA 4CGZA 4E7HA 2D2WA 3FMQA 5FMPA 4XKVA 2CWEA 5E17F 1JT0A 3EETA 3WTWC 3GW2A 2O6GE 1RKTA 2XAFA 1LEAA 1X3WB 2CQXA 4IHYA 2K40A 2L9VA 3AFHA 5L3DA 2ZCMA 2DBBA 2YUSA 1FP2A 5FROA 3HE0A 5BPIA 2R4GA 3EUHA 5K5RA 4D5CA 4P5OA 1JTYA 3QP6A 1T8IA 1OFCX 2JPBA 1OR7A 2H8WA 3CMYA 2FOKA 2LNBA 4FE4A 3W6KB 4HNTA 3LAPA 4EGYA 1YI2I 2EIMH 1A6IA 3RTRA 3GO5A 3IRRA 1YS6A 2XF6A 2GIVA 3OIPA 1HKSA 1JGGA 4A6EA 1DU6A 1Z3XA 4Y17A 1J09A 3F6OA 2JTVA 1L3LA 4CHUA 3K69A 1JJ6C 4GCKA 3KEOA 3E0JB 2HDDA 4XONA 1YIJI 3LWJA 2VXDA 3HJEA 3FXOA 3BOQA 5IP7J 1T2KA 2NVYJ 1R36A 3KFWX 3QYEA 3K0LA 4YFKF 2DMUA 4M9ZA 3KEQA 3CUQA 5DEQA 2MG4A 1PYVA 2BOLA 2X6YA 3TGNA 3NARA 2ZBKA 2CUZA 2P6SA 4DNCA 5LEJA 4F3QA 1TW3A 4C3IJ 4KN4X 2WBMA 1W0UA 1XCVA 4U0WA 5FD6A 3FXLA 2VJJA 4IPAA 4NC7A 4HQEA 1IXCA 4IRHA 2MW8A 3W3CA 3CCVI 2QKOA 2QWTA 4XN3A 2XPUA 4DBRA 2VQLA 4G7HF 1D0YA 4R1HA 3WTVC 2F2EA 2C6YA 3RQIA 2A5YB 1F36A 2JUCA 1G3SA 4BHPA 5GTHC 1LE8A 2UXPA 3R0JA 4M3DA 2Y0SA 2CW0F 2R92J 1T6SA 2DA7A 5M3FJ 3DCFA 5DUKA 2VE9A 2A07F 2Q2EB 3BHQA 3X2QH 2E1OA 1ZLJA 5LGUA 1MNMC 3R61A 4D9JA 3CP2A 2MFZA 4WIBA 3S3NA 1BC8C 1QGPA 1X1DA 2M0MA 4DGWB 4L18B 1G3TA 4KICA 1Y8RB 2R7TA 4KJZA 4UVCA 2DTRA 4CYCB 2I8DA 1P6RA 3SHFA 1IF1A 2NS7A 3GMEA 1FX7A 2AO9A 2CUJA 4RGXA 3NQOA 4DYCA 3ESWB 2HXOA 4HSTA 1D5YA 3GZ5A 3A4CA 1LFPA 1IN7A 5D5UB 4BDZA 2CU7A 2JSCA 1A36A 3WGIA 1P4XA 2GOXB 4I7HA 1B4AA 4RGUA 1DUXC 1JKPC 1AOYA 2EIKH 3BG3A 4IZZA 3ZR8X 3DU5A 3T8TA 2FQ4A 1YLFA 1T56A 3KIOA 2GLOA 1WGXA 2F5DA 1RZ4A 1SMTA 1JI8A 4F91B 2UWMA 4KN7X 4AIHA 4W97A 1ON1A 4AVPA 4NBQA 2IAIA 1FMWA 2LC2A 2FU4A 1WVRA 4HOBA 2LREA 3J80Z 3ERED 1TLHB 2RAEA 4C3JJ 3HB9A 4M73A 4HF0A 2D6YA 2NNNA 4OMYA 3VYUB 5HLGA 3AL0B 3OV8A 3TMOA 1RUNA 2QSHX 1JUPA 3DPLC 5DAJA 4LGWA 1LDKB 3SWHA 2XGCA 1HBXG 2H09A 2BY0A 2PI0A 1JHFA 1G59A 3TKYA 1AWCA 3VUQA 3ZQIA 2V6EA 3F8NA 3L09A 4UUTA 2EB7A 2WAQN 2XAUA 4Y4RA 2AXLA 2LMDA 3FK7A 2HKOA 4A3IJ 3HTSB 1FOKA 3S16J 3CWRA 4ME9A 2YU9J 2XRNA 4IF4A 1I5ZA 2TDXA 1SEUA 3S32A 1ZARA 4M71A 1QZEA 2NVUB 3D0SA 5IYDJ 1V4RA 5LD2C 4FX0A 3VFZA 1W1WE 3FXUA 3PM1A 4CXFA 4ENNA 1ZRDA 4Y15A 2FNPA 2Q2EA 2X0LA 2ISZA 1KQ9A 2XSDC 2VJIA 3EYYA 3PQJA 4G9YA 1ETOA 4A3CJ 1ZYRF 5FO5A 2OTJI 1ULYA 2XF7A 4ZYGA 1UHWA 2M3AA 4YIFA 5BPDA 4BNCA 2P7VB 4BHCA 3E3VA 3K4NA 2DPDA 1LQ1A 2OF7A 4HSRA 1FTZA 1LDJA 5HBUA 3A0BC 3I55I 4XLEA 1ERDA 3HZJA 2DYSH 2NOJB 1E2XA 4QPOA 2E5ZA 3M1EA 4UY8I 3DTEA 4QWQA 5D6FA 3J81K 3ZQFA 3JRFA 4HX8A 5C4JJ 1HA8A 3BR1A 3IC7A 1I1SA 3F0CA 5FJ8J 4DOZA 2O7OA 1TBXA 3S14J 2PZ9A 1W5TA 1PP7U 3Q9SA 1HF0A 3G71I 2X51A 4NN1A 4X6AJ 2HQ5A 2HTJA 4EJWA 2ZJQF 4A3DJ 2EQRA 2EZLA 2HTSA 2ME6A 3JAMZ 4XK4A 2E1CA 5EEHA 1GUUA 2O9LA 2IPQX 1H88C 3ON2A 1O7LA 2M4GA 3V6GA 2L7KA 2LD5A 1FYKA 4I99C 4JQFA 3VTIA 1T39A 1VQ4I 1H0MA 2DT6A 4L9VA 4A3MJ 2KPMA 3I59B 3QYFA 3CMMA 4UVAA 2ZXIA 4KYWA 3SYTA 2OCCH 3I71A 1W4MA 5F64A 2EIJH 2WTEA 1OLTA 4FX4A 2NVXJ 1OYWA 1I6XA 4XSZF 1OCPA 2I10A 1A35A 4UVBA 3ZN1A 2HQRA 1D8KA 5FKKA 5F0HA 3ELKA 2FUG2 1IV6A 2L4AA 3Q5FA 3ULQB 4UHTA 3NS4A 4BGDA 4A3EJ 3NAUA 2HPIA 2B3WA 1W5SA 2F5EA 3HPHA 3OYCA 5L3FA 4CZCA 3QYBA 5EJCA 3REOA 3RYPA 2VC0A 2DT5A 1TWCJ 3ZP5A 3F1BA 4GCVA 2P6TA 2UXUA 1LUJB 1BI2A 3LMMA 2OQGA 2XDVA 4QTRA 2HVRA 2BVMA 3FX3A 3PNVA 5FKOA 1BW5A 4CICA 1MSEC 3G4SI 5LHIA 3TBIA 2ZSIB 2K85A 3ABMH 3V7SA 2OAZA 2M30A 1QPMA 2WWYA 2VPRA 1REPC 1OQYA 3I3LA 4DW6A 3ZCOA 5GADJ 2E60A 2HU9A 2DXIA 3IAS2 1I1GA 1TWAJ 3RIRA 3ZQCA 3WG7H 1WKMA 3ASNH 4M9SA 5ERIA 1D0XA 4CGRA 4XOPA 2VPLA 3E7LA 4HX7A 4PJJA 4FT8A 5B1AH 3BJAA 2VC1A 1MW7A 4BKXA 1O4XA 1Z05A 2CG4A 4RAFA 1C0WA 3PNYA 1SD5A 2ZC2A 4B1RA 5DUIA 3CLQA 2MC4A 2KJBA 3HHHA 1FYLA 2WY7Q 1T08B 3KNWA 2P5KA 2ECCA 3SZPA 5CYVA 3OIOA 2W84A 4RB1A 3ECHA 5EEAA 2IGOA 1A31A 2VKVA 3V7RA 5K5OA 2NOGA 2ETHA 4CYDA 3K1NA 1X3ZB 3TDZC 4CCMA 2R7QA 4JK1X 1O3QA 2R7UA 3GF2A 1OJLA 3JRDA 3WTXC 3GVAA 1R49A 1AKHA 3FM3A 3I59A 4I01A 3W6JB 1YJWI 1XMXA 3P7NA 1EJ9A 5E8IA 4E7JA 4AC0A 4CA0A 4IL6C 1KYZA 2XAQA 4BXUA 3RCOA 4RAGA 2Q8KA 1SMYF 1UHMA 3HOUJ 2HYJA 2OTLI 3MMYB 1BI3A 2XGDA 4CZZA 4O6JA 2AS5F 2VT2A 4F52A 4RB2C 1Z0XA 4DIQA 4EGZA 3VP5A 3J7AO 2H94A 9ANTA 1HCRA 5ED4A 4BE1A 1JKOC 3K9TA 4WWCA 4E7SA 1Y6IA 2V79A 2VT3A 5D5VB 2DA3A 4BQNA 1HDPA 4YFXF 2X6OA 2XHKA 1SFKA 3I5UA 2F6CA 2XVCA 3K2AA 2NXNB 2XKPA 3GYHX 3OS1A 1IW7F 4DQ2A 2ZXHA 4LG0B 2WY8Q 3SFIA 2HOAA 3HUGB 4K2EA 3VDXA 3CC7I 4A0YA 3HRMA 1VZ0A 4A93J 4MK6A 2L01A 2XUBA 1EV7A 3LSJA 1E3HA 4HW0A 3L1PA 1JE8A 3L2RA 3GTKJ 1ACIA 2F5VA 2KIFA 3BROA 2HVSA 2KFDA 1VQOI 3IKTA 2XASA 3IH3A 1XSXA 1MBKA 1R7JA 2VBZA 3LSMA 1O7FA 1ITYA 1Z9CA 3ECOA 2OBPA 2E34A 1X2NA 3RKYA 1ZG5A 2QQBA 4YIRX 4CYCA 3H3ZA 3H9QA 2V26A 3GTLJ 3EUHC 3M9AA 5E8GA 1LDDA 2GZWA 3BTIA 4UB8C 1P7IA 3EYIA 3VYSB 3ZMTA 1WI3A 4FTHA 1SANA 3BC8A 3W2AA 1UG0A 4XQFA 4WXCA 2F5FA 4HNUA 3L9FA 3J7AY 4ESFA 5KHDA 2M7BA 3CF5F 1OISA 4BE2A 1O3SA 1XCBA 2P4WA 1S3JA 4L9NA 2B9SA 4ZDLA 3A1YA 1H9TA 2V9KA 3KP5A 3UKGA 2KRCA 2L5QA 2AQEA 3CDIA 4II2A 2PJRA 2M1BA 4L5EA 4PCQA 3M8FA 2D5VA 5M5XJ 3G1OA 3RI4A 3SEQA 3OIQA 1S29A 3OYNA 2FRHA 1UZCA 5EDNA 4B4CA 1KZHA 1F1ZA 4CO8A 4XRSG 2G7LA 3RH2A 1APLC 5HAWA 2XB0X 2QBYB 3QBMA 2HEOA 3IH4A 3C2GA 3L2UA 2KIMA 2EV5A 4HDUA 5GAHJ 2RVCA 3DPJA 4AIDA 1PUFB 4A6DA 1BJAA 1QO0D 1Z6TA 4RMNA 5F1JA 3HOTA 1PUEE 1BL0A 2Y0MA 1XSVA 3MN2A 4AYBN 5LEKA 2HWVA 2KMUA 3C2BA 2JWTA 4N9HA 5JVGF 4GCLA 3FBIB 2P0WA 4KT5C 2IRFG 3G1LA 1YX5A 1WH7A 2W25A 2JA7J 4I02A 2V1NA 2EH3A 1PDNC 5ILSA 4X0GA 3PO3J 2G7HA 2CQNA 2VQCA 2Z2SB 3GEZA 2WAQA 2MH9A 3ZMSA 2XRLA 4FQGA 3JSOA 3FIWA 2LY1A 1W7PA 1Z1DA 3QPLA 3H5RA 1PJRA 3K10A 2DOAA 2MH2A 1MMNA 2LBFB 1K6YA 1HSTA 1KU7A 3ZPLA 3F8CA 1WJFA 1OPCA 4KUMA 1FY7A 3LSTA 1R71A 2FSWA 3SFZA 4Y13A 3BLYA 3GTOJ 2DPUA 4PFPA 3L2VA 1WHUA 2JJ7A 1R6RA 4BQOA 2L4MA 2GENA 1M1EB 2R0QC 3VVXA 4M3BA 1WFXA 4RGSA 1PP8F 1OMIA 3JRCA 5HS7A 4B47A 5GPCA 2OCEA 5DTDA 4MTEA 1R5GA 5EGOB 2ICWG 4OWRB 4XLNF 4A3GJ 1RI7A 5IT3A 2L9SA 2EJRA 5F08A 1MJAA 4A69C 5J6XA 3AG4H 1WWXA 2PJPA 2F4OB 3FBNB 4GYIA 1NK2P 4UUVA 2BV6A 1KU3A 3U21A 3U1DA 5J4VA 1HC8A 2ZMEA 4E6KG 3JW4A 2E1MB 4LFUA 3I54A 1U2WA 1X4OA 2W57A 4NB5A 5IYCJ 1LFUP 4RDUA 1ZTRA 4U7DA 3MKYB 1B9MA 2QM3A 2IT0A 2L3DA 3VOEA 1J2XA 4DZJA 1D1AA 3CJTB 2UXIA 1V3FA 1MNDA 3LQRA 1U3EM 2FMLA 2O3FA 4AM3A 3S5RA 2NS0A 3PIOF 2NNYA 3FRQA 1X1CA 5GAGJ 3S8PA 2ECBA 4M6VA 2JSPA 3JTGA 3PFYA 4ZTFA 5CQGA 3HG9A 1I6HJ 5HVQC 2LF7A 1UB9A 1NTCA 3TQNA 1LPQA 1U0JA 3EUPA 3KZ9A 4U87A 1ONVA 5FLMJ 1LE8B 2WC2A 2V7FA 1ZELA 2BVLA 3A01A 4LMYA 3KP6A 3SJMA 3KX2A 1KU9A 3F8FA 1Y39A 1DP7P 2PX9A 3H9JA 3P9IA 2P8TA 3VW2A 3QPHA 1VNDA 4LG3A 3TP0A 4A3FJ 1K4TA 2LG4A 4JX5A 4A2UA 4RM3A 3VODA 5LHHA 3I9V2 4A3LJ 5LLQA 2L9NA 2R7FA 4O3MA 3OL3A 3K70C 4OD4A 2O8XA 4HZFA 3K4BA 5E20A 4YRVA 2Y9ZA 3GFMA 3TEDA 3ZQHA 3K1MA 3MKLA 3PSFA 4D0PA 5JR3A 3Q0WA 4EATA 2OU2A 1VQPI 2QKMB 3V42A 2DLLA 3JRAA 2QF7A 3JSJA 3CCMI 2Q1ZB 2DJNA 3RKXA 4S0HB 4GFKA 4AC6A 2JA2A 5KNLA 4LK1F 4ZC3A 5BOXA 5DV5A 3JRHA 3O2PE 2GIZA 1O57A 4ZZLA 1K83J 5D4RA 4JBAA 1P9QC 3VVYA 1R1VA 1MIJA 4ZZDA 3OYKA 2K9MA 1JTXA 1JKRC 5FKLA 1G2HA 3L00A 2KZVA 3ZMUA 2JA5J 3TO6A 3NI7A 1MMGA 1SD7A 2Z1DA 2CSOA 1QHGA 1MJBA 2OZUA 2VJ4A 3ROUA 4IO9F 4C2TA 1KU2A 5ICCA 4UNOA 2A6HF 4BEHA 4UB6C 2KP6A 2LH9A 2M0CA 5BQTA 2CGPA 3HGGA 4XLCA 1SGMA 5C4YA 5TISC 4RAYA 3PUFA 3KZYA 4ENJA 2DK5A 3K4JA 3GUDA 3OS2A 3GFIA 2PLYA 5CJ9A 1S5LC 1U6GA 1MBJA 4IXAA 3KLNA 5E3MA 3MWMA 2A05A 2VXZA 3VEPA 4OIOF 3OR2C 4BU2A 2GAUA 3OYJA 1KONA 4HYEA 2K7LA 4BE0A 3ZXSA 4H4KC 2E7WA 1P4WA 1BW6A 4PGGA 3PUBA 4CCNA 2Y9YA 1IAWA 2ZMEC 3O8HA 2XSJC 4AYBA 3ABLH 4JP0A 4OINF 1BJZA 2KT0A 5CVUA 2KDZA 2XROA 3WTUC 2X85A 3KYCB 1TWHJ 3OY9A 2IS4A 2DQLA 2CMPA 2CQKA 5H2FC 4XBFA 5KVRA 4GFLA 3SZGA 1W36D 4OIPF 2IBDA 5JI6A 5HS8A 2DCEA 4XNFA 1BI0A 4J19A 2CYYA 3BG9A 1ETQA 1SFEA 3PFIA 2EZHA 4L5JA 5CKTA 3CCLI 1TL8A 1R22A 1XGNA 4MIMA 2REKA 2YS9A 1V55H 1WCMJ 4GO1A 5ILVA 2ID3A 2YX7A 2I5UA 2BEOA 3CCEI 2EV0A 3HIFA 1IN4A 2A68F 4BXXJ 3FXQA 2HXIA 2P5VA 4RB3C 1UJ8A 3OOPA 3PNTA 5EGOA 2JK3A 3DPUA 4QIWN 5BMZA 3I0TA 1QRYA 3EUKL 2FBKA 4B3XA 1YE9A 2VN2A 5IOZA 4U7BA 1ZGWA 3G6EI 3VVZA 2M8EA 2M8GX 3F21A 5ILUA 1GVDA 3VB2A 1MDMB 4L9JA 3GTQJ 4V2FA 3KP7A 4EEFG 1ZREA 5GPAA 1VTNC 1VQLI 1WJ5A 3IV5A 5H6QA 2P81A 3FK6A 3LSGA 3IKVA 2EFPA 2F4IA 2XDNA 2VI6A 4FHTA 2LF8A 2XF5A 2KKOA 1U9OA 2EILH 4JX6A 1IDYA 3BTJA 2VBWA 1GV2A 2FX0A 1XX5A 2O7TA 4BJTA 3CCYA 2X1EA 2Y2ZA 1R5HA 1EA3A 3GLXA 3TW6A 3FWEA 2L7ZA 3C2HA 5E1WA 4XRSA 1HSJA 5CXGA 3AQSA 3D5RC 4E4HA 2MGQA 4PJLA 3G73A 1STZA 3R6SA 1K7AA 2E1MC 3DKWA 4YG2F 4DVYP 3H36A 1TW2A 1YW9A 2IP2A 1T95A 3MKZA 2LK2A 1WSUA 1SC7A 2Y75A 4L62A 2VOPA 2ACJA 3MQ0A 1IXSB 1YJNI 4F92B 2EA4A 3B02A 3CF2A 2ZY9A 4HNVA 2H8RA 4M6YA 1D1CA 2QSGX 5H9TA 2K9SA 1GXPA 2OERA 3P5JA 2W4SA 4H0EA 2DDBA 2QWWA 2XKOA 3S3OA 2CFOA 3IWZA 4UV9A 4OIQF 4P55A 5K7HA 3DFGA 3WGGA 3BTCA 3DTIA 3F9KA 2QQ8A 2YVEA 2STWA 2JVGA 3OMYA 1X1BA 4C3HJ 1F43A 1SAUA 2E5NA 2MABA 4MHGA 4IX7A 2NVTJ 3VOKA 3HEFA 3FF5A 2RASA 3G1MA 2R7WA 2XIGA 3S15J 3BPXA 2RKHA 2HS5A 4LJZF 3BZCA 5DD8A 1J75A 1KGSA 1BOAA 2M9HA 2HFHA 1YW7A 3WE2A 3RZDJ 3LJLA 3GTPJ 3IRQA 4M6XA 4C2MA 2ZJRF 4KMFA 2MC3A 3K6GA 3LHQA 4HEA2 2WV1A 1XGSA 4PUSA 2DT7B 2DN0A 2EINH 4IRIA 3BCAA 2VQGA 2QEXI 3BG6A 4G7ZF 3OR1C 3Q0UA 2R7ZJ 2FD5A 3W2WA 4BUPA 5CLSA 2EV6A 1XG1A 1T33A 4Y7NJ 4PJ0C 2X9DA 1V5FA 2RQPA 4N9IA 1Z7UA 2ELKA 1N25A 3N05A 2E2JJ 3AL0C 1JGSA 4MEXF 1RC9A 1WQ2A 1P92A 3BTLA 1D5VA 2OA4A 4HV5A 4EMSA 3HTAA 4PSWA 1ZGAA 2ZCNA 5D5WB 4F7ZA 5AIQA 2O0YA 5JHFA 2FMYA 4EJVA 4YEJA 5ICFA 1XPXA 2V4JC 2XPWA 1IRXA 1WH5A 4CCJA 2Y30A 3G56A 4N4OB 3SQNA 2PMUA 2GA2A 1ZGJA 5JFRA 3P9TA 1VQ7I 5HDKA 2XV4S 1RR8C 1B72B 1IRZA 2ZSHB 4ZJZA
chains in the Genus database with same CATH topology
1UI6A 1VF9A 3CJDA 3O60A 3OOUA 2UXOA 4CYCA 3NRGA 2JMWA 3GTLJ 4KWAA 4XICA 3BTIA 1P7IA 2FBQA 3GBGA 2O8KA 3HOWJ 3G7RA 1WI3A 3GZIA 4FTHA 1SANA 2N8GA 3LSRA 1PUFA 2HOSA 4A3JJ 5E3LA 1RR7A 3BR5A 2TRTA 4IHWA 3HKZN 2L0KA 3HDDA 2DG8A 1Y1VJ 4UUSA 4QSHA 3JR9A 3CRJA 3BR6A 2NP5A 2IEKA 2G7GA 3BG5A 5EFYA 3T6NA 3K7AJ 1EF4A 3B6AA 1GT0C 3M4OJ 3VIBA 1POGA 4G12A 3BT9A 1H89C 3UKGA 1XS9A 2M34A 4DYQA 2OPTA 3VOXA 1RKWA 4L5EA 3RD3A 2D5VA 2DMPA 5M5XJ 3G1OA 4DYRA 5C3EJ 1R9TJ 4XRMA 1Z77A 4BY7J 3GEUA 4JX4A 2H1KA 1TWFJ 3HTIA 4ICHA 5EDNA 4B4CA 3BRUA 5FKMA 2DTZA 4XRSG 2G7LA 3RH2A 5FMPA 1APLC 5HAWA 1JT0A 3HOZJ 1RKTA 2XB0X 3QBMA 1UG2A 3ANGA 4I76A 3IH4A 2CQXA 4IHYA 2WGBA 2K40A 1IG7A 5IP9J 2ZCMA 2DA1A 4MLOA 2YUSA 3Q0VA 4B3AA 4GCTA 1UHSA 2PBXA 3HE0A 3O8GA 1YRNB 5BNGA 4D5CA 1SFOJ 1JTYA 4LOCA 3DPJA 1PUFB 1OFCX 3CMYA 2XB5A 4FE4A 2LR8A 5F1JA 2OI8A 1A6IA 3BQZA 2V57A 5F0FA 1BL0A 3JRBA 1JGGA 1DU6A 1A5JA 5FHPA 3MN2A 4AYBN 2AHQA 1JJ6C 4GCKA 3C2BA 2JWTA 3OSFA 2HDDA 3LWJA 3H3VK 4GCLA 3G1LA 1WH7A 5IP7J 3JREA 2JA7J 2EZIA 2DMNA 2EH3A 2NVYJ 2VUMJ 3PO3J 1ZK8A 3S2DJ 2DA4A 3BR3A 2DMUA 1P7JA 4IEJA 2MG4A 2XRLA 3FIWA 3NARA 3QPLA 4HKUA 1QPIA 5FGLA 2DA5A 4C3IJ 4MFDA 1W0UA 5D1RA 2K9QA 3ANPA 3TP3A 1FTTA 2MW8A 3LSPA 2QWTA 2QKOA 3W6VA 2LFBA 2XPUA 3GTOJ 1W0TA 3LNQA 1BA5A 2JJ7A 2ZOYA 2DMQA 3RQIA 2WUIA 3BCGA 5JLXA 1F36A 2GENA 5J1RA 2UXPA 1LE8A 3I4MJ 4M3DA 2R0QC 4BY1J 3VVXA 4FISA 4A3KJ 4M3BA 3M3YJ 1ETKA 2CUFA 2R92J 3JRCA 2DA7A 5GPCA 5M3FJ 3HOXJ 3DCFA 3WHBA 5DTDA 5EG0A 3BHQA 4MO7A 5IPAA 5EGOB 4I6ZA 2E1OA 2R5YB 1MNMC 4A3GJ 5F08A 3OSGA 4A69C 1I50J 5K7ZA 2X48A 1NK2P 4D5FA 4DZPA 1RPWA 2TCTA 4FE7A 3HTJA 4CYCB 2F07A 5IYCJ 1LFUP 2NS7A 2FJ1A 1ZTRA 4RDUA 1QVUA 2AO9A 4BBSJ 4M3FA 3SDGA 4DYCA 3NPIA 3C07A 2HXOA 4DZJA 1D5YA 2UXIA 2CU7A 1ZR4A 2XPVA 3S5RA 3FRQA 5J3LA 1RESA 2ECBA 4M6VA 1I6HJ 1JKPC 4A3BJ 2W48A 1QVTA 1MBHA 3HM5A 1YRNA 1NTCA 3BG3A 1ORKA 3EUPA 1JT6A 3KZ9A 2JA6J 5J1UA 5FLMJ 3BNIA 2FQ4A 1LE8B 1X2MA 2R5ZA 1T56A 3A01A 2GLOA 4M3GA 3SJMA 1WGXA 1VFCA 1IGNA 3PO2J 4W97A 3VW2A 3RZOJ 1VNDA 2IAIA 3B81A 3TP0A 3WHCA 4A3FJ 4FCYA 4JX5A 2RAEA 3TW7A 3HB9A 3BQYA 4C3JJ 4JNNA 2D6YA 2JA8J 4A3LJ 4X1EA 5E3NA 4IHVA 1E3OC 2W53A 3FISA 2Y9ZA 2GFNA 2QOPA 1JUPA 1AHDP 5DAJA 3TEDA 2XGCA 3ZQHA 3MKLA 2E19A 3Q0WA 5EF6A 2NVQJ 1IUFA 3JRAA 2QF7A 3JSJA 4XIDA 2G7SA 5JLWA 3VUQA 2DJNA 4NELA 4ACIA 4S0HB 3ZQIA 3I4NJ 4GFKA 4AC6A 1IC8A 4UUTA 2WAQN 3FK7A 4A3IJ 3CWRA 3JRHA 3S16J 5HSZA 3BR2A 2YU9J 4ME9A 4D7NA 1K83J 1VI0A 5M5WJ 1H8AC 3ON4A 3VVYA 4MFEA 2HKUA 5IYDJ 1JTXA 1JKRC 5FKLA 1G2HA 3V78A 3Q3SA 1FIAA 2CQQA 3PM1A 4RBOA 1ETWA 5EG0B 2JA5J 2XSDC 3NI7A 3S1RJ 1ETOA 3GTGJ 3HGYA 4A3CJ 2QTQA 5C4XJ 3A01B 3B6CA 1B8IA 1LFBA 2G3BA 2UXHA 3S1MJ 3JRIA 2GBYA 2CUEA 2L9RA 2M0CA 4M3EA 2LKXA 2OF7A 1FTZA 3HGGA 2RHAA 1SGMA 5C4YA 5HBUA 3COLA 2M2EA 5FKNA 3KKDA 1MBEA 2ZB9A 2R93J 1DU0A 1MBJA 3ZQLA 5E3MA 3ZQFA 3JRFA 2MSYA 5C4JJ 1ETVA 5EZGA 3BR1A 2ZOZA 3F0CA 2HOTA 5FJ8J 3HTHA 1NK3P 2O7OA 1TWGJ 5F0CA 3S14J 1GV5A 1BW6A 2PZ9A 3VW0A 2Y9YA 1HF0A 5CXIA 2JN6A 5CW8A 4NN1A 4X6AJ 3O8HA 2HQ5A 4A3DJ 1JJ8C 4JL3A 3D1NI 3KKCA 2EQRA 2EZKA 2EZLA 1BJZA 2KT0A 4JP0A 2ME6A 2KDZA 1TC3C 1TWHJ 3ZQGA 4XK4A 1GUUA 2LTPA 2O9LA 3H0GJ 1H88C 3ON2A 3A02A 4GFLA 3V6GA 2LD5A 2IBDA 5M3MJ 2LLKA 4C2MJ 4A3MJ 3HBLA 4J19A 2Q24A 3BG9A 1ETQA 5M5YJ 3PASA 1MBGA 2EZHA 4PXIA 4MIMA 2REKA 2YS9A 2NVXJ 1AKHB 3QKXA 1WCMJ 2G0EA 1OCPA 2I10A 5K58A 2Y0SN 2ID3A 3HOVJ 2DMTA 3VW1A 5FKKA 5F0HA 2VKEA 4BXXJ 1IV6A 3EGQA 1MH4A 2HXIA 5FLVA 5EGOA 2Y31A 2JK3A 4QIWN 4V2GA 4A3EJ 3NAUA 2NS8A 1QRYA 3S1NJ 5DS9A 5IOZA 3A03A 1ZGWA 1MH3A 3CQZJ 1FIPA 3VVZA 2M8GX 1MBFA 4ABZA 1JUMA 1TWCJ 1GVDA 2K9NA 3F1BA 2UXUA 3GTQJ 4V2FA 3CDLA 4EEFG 3RKQA 5GPAA 4QTRA 3IV5A 2P81A 3FK6A 3LSGA 5FKOA 1BW5A 2XDNA 2VI6A 1UMQA 1MSEC 3MNLA 2LY9A 1JUSA 1ZKGA 2YVHA 4JX6A 1U9OA 2COBA 1U78A 2NX4A 1IDYA 3BTJA 1GV2A 2E2HJ 2VPRA 2FX0A 4DW6A 3MVPA 2O7TA 3CCYA 1IDZA 2Y2ZA 1UI5A 1TWAJ 4NDLA 3HOYJ 2HYTA 3TW6A 3ZQCA 3S17J 2L7ZA 3HIMA 1X58A 1AU7A 3S2HJ 3GTJJ 4CGRA 4XRSA 1I3QJ 3E7LA 5EYRA 5F04A 5EZHA 3AQSA 3IUVA 1S7EA 2MGQA 5E3OA 5CXGA 2WB1N 5D19A 4BKXA 4W1UA 1O4XA 2IU5A 2ID6A 2PMZN 1GDTA 4B1RA 3QPSA 5J1YA 3KNWA 1B72A 2DA6A 2ECCA 1HDDC 1HOMA 2LK2A 1FEXA 3OIOA 4AUXA 3BR0A 4AF5A 4L62A 2B63J 5EEAA 5AQCA 2VKVA 2EBIA 5IOYA 1ENHA 4HNVA 2H8RA 2DG7A 2NOGA 5H9TA 5C44J 3E7QA 2K9SA 2OERA 3DEWA 4MXMA 1OJLA 3JRDA 3BJBA 1IJWC 5K7HA 1AKHA 4JYKA 2XGEA 5HODA 3GTMJ 3BTCA 1Q1VA 1JKQC 2YVEA 2CJJA 5K7FA 4C3HJ 1F43A 4BBRJ 3JRGA 4AC0A 3VOKA 2NVTJ 1U9NA 3HEFA 2RASA 3G1MA 1HLVA 2ZCXA 4JKZA 3FKIJ 3S15J 2GUHA 3AQTA 2LVSA 2ME0A 2M9HA 3LJLA 3RZDJ 3NNRA 3HOUJ 2HYJA 2L7MP 3GTPJ 1ZR2A 2XGDA 4GFBA 4YZEA 2R5ZB 1ETYA 1Z0XA 2LP0A 3VP5A 3LHQA 9ANTA 2WV1A 1HCRA 1B8IB 1JKOC 3ZOBA 4UDSA 4UUSB 2DN0A 5IYBJ 2DA3A 3LOCA 2L7FP 3Q0UA 1CQTA 2R7ZJ 2FD5A 1U8BA 1HDPA 2X6OA 4Y7NJ 1XG1A 1T33A 3IH2A 1K61A 2QCOA 2X9DA 5IP6A 2HI3A 3K2AA 1WPKA 1ETXA 1FJLA 2ELKA 2DA2A 2E2JJ 3SFIA 2GM4A 2HOAA 3S1QJ 5F27A 4A93J 3BTLA 1Y1WJ 4MK6A 2NP3A 1RETA 1ZQ3P 3LSJA 4IHXA 3HTAA 3VPRA 2ZCNA 3L1PA 3NXCA 3GTKJ 4Y52J 2CRGA 3PPBA 2E2IJ 2XPWA 1WH5A 2Y30A 1MSFC 3G56A 5D18A 2R5YA 1OCTC 3IH3A 3QQAA 1MBKA 3P9TA 4D7MA 1ITYA 1XC5A 1B72B 1IRZA 1X2NA 5GP9A 2QIBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1UI6 A;  1VF9 A;  3CJD A;  3O60 A;  3OOU A;  2UXO A;  4CYC A;  3NRG A;  2JMW A;  3GTL J;  4KWA A;  4XIC A;  3BTI A;  1P7I A;  2FBQ A;  3GBG A;  2O8K A;  3HOW J;  3G7R A;  1WI3 A;  3GZI A;  4FTH A;  1SAN A;  2N8G A;  3LSR A;  1PUF A;  2HOS A;  4A3J J;  5E3L A;  1RR7 A;  3BR5 A;  2TRT A;  4IHW A;  3HKZ N;  2L0K A;  3HDD A;  2DG8 A;  1Y1V J;  4UUS A;  4QSH A;  3JR9 A;  3CRJ A;  3BR6 A;  2NP5 A;  2IEK A;  2G7G A;  3BG5 A;  5EFY A;  3T6N A;  3K7A J;  1EF4 A;  3B6A A;  1GT0 C;  3M4O J;  3VIB A;  1POG A;  4G12 A;  3BT9 A;  1H89 C;  3UKG A;  1XS9 A;  2M34 A;  4DYQ A;  2OPT A;  3VOX A;  1RKW A;  4L5E A;  3RD3 A;  2D5V A;  2DMP A;  5M5X J;  3G1O A;  4DYR A;  5C3E J;  1R9T J;  4XRM A;  1Z77 A;  4BY7 J;  3GEU A;  4JX4 A;  2H1K A;  1TWF J;  3HTI A;  4ICH A;  5EDN A;  4B4C A;  3BRU A;  5FKM A;  2DTZ A;  4XRS G;  2G7L A;  3RH2 A;  5FMP A;  1APL C;  5HAW A;  1JT0 A;  3HOZ J;  1RKT A;  2XB0 X;  3QBM A;  1UG2 A;  3ANG A;  4I76 A;  3IH4 A;  2CQX A;  4IHY A;  2WGB A;  2K40 A;  1IG7 A;  5IP9 J;  2ZCM A;  2DA1 A;  4MLO A;  2YUS A;  3Q0V A;  4B3A A;  4GCT A;  1UHS A;  2PBX A;  3HE0 A;  3O8G A;  1YRN B;  5BNG A;  4D5C A;  1SFO J;  1JTY A;  4LOC A;  3DPJ A;  1PUF B;  1OFC X;  3CMY A;  2XB5 A;  4FE4 A;  2LR8 A;  5F1J A;  2OI8 A;  1A6I A;  3BQZ A;  2V57 A;  5F0F A;  1BL0 A;  3JRB A;  1JGG A;  1DU6 A;  1A5J A;  5FHP A;  3MN2 A;  4AYB N;  2AHQ A;  1JJ6 C;  4GCK A;  3C2B A;  2JWT A;  3OSF A;  2HDD A;  3LWJ A;  3H3V K;  4GCL A;  3G1L A;  1WH7 A;  5IP7 J;  3JRE A;  2JA7 J;  2EZI A;  2DMN A;  2EH3 A;  2NVY J;  2VUM J;  3PO3 J;  1ZK8 A;  3S2D J;  2DA4 A;  3BR3 A;  2DMU A;  1P7J A;  4IEJ A;  2MG4 A;  2XRL A;  3FIW A;  3NAR A;  3QPL A;  4HKU A;  1QPI A;  5FGL A;  2DA5 A;  4C3I J;  4MFD A;  1W0U A;  5D1R A;  2K9Q A;  3ANP A;  3TP3 A;  1FTT A;  2MW8 A;  3LSP A;  2QWT A;  2QKO A;  3W6V A;  2LFB A;  2XPU A;  3GTO J;  1W0T A;  3LNQ A;  1BA5 A;  2JJ7 A;  2ZOY A;  2DMQ A;  3RQI A;  2WUI A;  3BCG A;  5JLX A;  1F36 A;  2GEN A;  5J1R A;  2UXP A;  1LE8 A;  3I4M J;  4M3D A;  2R0Q C;  4BY1 J;  3VVX A;  4FIS A;  4A3K J;  4M3B A;  3M3Y J;  1ETK A;  2CUF A;  2R92 J;  3JRC A;  2DA7 A;  5GPC A;  5M3F J;  3HOX J;  3DCF A;  3WHB A;  5DTD A;  5EG0 A;  3BHQ A;  4MO7 A;  5IPA A;  5EGO B;  4I6Z A;  2E1O A;  2R5Y B;  1MNM C;  4A3G J;  5F08 A;  3OSG A;  4A69 C;  1I50 J;  5K7Z A;  2X48 A;  1NK2 P;  4D5F A;  4DZP A;  1RPW A;  2TCT A;  4FE7 A;  3HTJ A;  4CYC B;  2F07 A;  5IYC J;  1LFU P;  2NS7 A;  2FJ1 A;  1ZTR A;  4RDU A;  1QVU A;  2AO9 A;  4BBS J;  4M3F A;  3SDG A;  4DYC A;  3NPI A;  3C07 A;  2HXO A;  4DZJ A;  1D5Y A;  2UXI A;  2CU7 A;  1ZR4 A;  2XPV A;  3S5R A;  3FRQ A;  5J3L A;  1RES A;  2ECB A;  4M6V A;  1I6H J;  1JKP C;  4A3B J;  2W48 A;  1QVT A;  1MBH A;  3HM5 A;  1YRN A;  1NTC A;  3BG3 A;  1ORK A;  3EUP A;  1JT6 A;  3KZ9 A;  2JA6 J;  5J1U A;  5FLM J;  3BNI A;  2FQ4 A;  1LE8 B;  1X2M A;  2R5Z A;  1T56 A;  3A01 A;  2GLO A;  4M3G A;  3SJM A;  1WGX A;  1VFC A;  1IGN A;  3PO2 J;  4W97 A;  3VW2 A;  3RZO J;  1VND A;  2IAI A;  3B81 A;  3TP0 A;  3WHC A;  4A3F J;  4FCY A;  4JX5 A;  2RAE A;  3TW7 A;  3HB9 A;  3BQY A;  4C3J J;  4JNN A;  2D6Y A;  2JA8 J;  4A3L J;  4X1E A;  5E3N A;  4IHV A;  1E3O C;  2W53 A;  3FIS A;  2Y9Z A;  2GFN A;  2QOP A;  1JUP A;  1AHD P;  5DAJ A;  3TED A;  2XGC A;  3ZQH A;  3MKL A;  2E19 A;  3Q0W A;  5EF6 A;  2NVQ J;  1IUF A;  3JRA A;  2QF7 A;  3JSJ A;  4XID A;  2G7S A;  5JLW A;  3VUQ A;  2DJN A;  4NEL A;  4ACI A;  4S0H B;  3ZQI A;  3I4N J;  4GFK A;  4AC6 A;  1IC8 A;  4UUT A;  2WAQ N;  3FK7 A;  4A3I J;  3CWR A;  3JRH A;  3S16 J;  5HSZ A;  3BR2 A;  2YU9 J;  4ME9 A;  4D7N A;  1K83 J;  1VI0 A;  5M5W J;  1H8A C;  3ON4 A;  3VVY A;  4MFE A;  2HKU A;  5IYD J;  1JTX A;  1JKR C;  5FKL A;  1G2H A;  3V78 A;  3Q3S A;  1FIA A;  2CQQ A;  3PM1 A;  4RBO A;  1ETW A;  5EG0 B;  2JA5 J;  2XSD C;  3NI7 A;  3S1R J;  1ETO A;  3GTG J;  3HGY A;  4A3C J;  2QTQ A;  5C4X J;  3A01 B;  3B6C A;  1B8I A;  1LFB A;  2G3B A;  2UXH A;  3S1M J;  3JRI A;  2GBY A;  2CUE A;  2L9R A;  2M0C A;  4M3E A;  2LKX A;  2OF7 A;  1FTZ A;  3HGG A;  2RHA A;  1SGM A;  5C4Y A;  5HBU A;  3COL A;  2M2E A;  5FKN A;  3KKD A;  1MBE A;  2ZB9 A;  2R93 J;  1DU0 A;  1MBJ A;  3ZQL A;  5E3M A;  3ZQF A;  3JRF A;  2MSY A;  5C4J J;  1ETV A;  5EZG A;  3BR1 A;  2ZOZ A;  3F0C A;  2HOT A;  5FJ8 J;  3HTH A;  1NK3 P;  2O7O A;  1TWG J;  5F0C A;  3S14 J;  1GV5 A;  1BW6 A;  2PZ9 A;  3VW0 A;  2Y9Y A;  1HF0 A;  5CXI A;  2JN6 A;  5CW8 A;  4NN1 A;  4X6A J;  3O8H A;  2HQ5 A;  4A3D J;  1JJ8 C;  4JL3 A;  3D1N I;  3KKC A;  2EQR A;  2EZK A;  2EZL A;  1BJZ A;  2KT0 A;  4JP0 A;  2ME6 A;  2KDZ A;  1TC3 C;  1TWH J;  3ZQG A;  4XK4 A;  1GUU A;  2LTP A;  2O9L A;  3H0G J;  1H88 C;  3ON2 A;  3A02 A;  4GFL A;  3V6G A;  2LD5 A;  2IBD A;  5M3M J;  2LLK A;  4C2M J;  4A3M J;  3HBL A;  4J19 A;  2Q24 A;  3BG9 A;  1ETQ A;  5M5Y J;  3PAS A;  1MBG A;  2EZH A;  4PXI A;  4MIM A;  2REK A;  2YS9 A;  2NVX J;  1AKH B;  3QKX A;  1WCM J;  2G0E A;  1OCP A;  2I10 A;  5K58 A;  2Y0S N;  2ID3 A;  3HOV J;  2DMT A;  3VW1 A;  5FKK A;  5F0H A;  2VKE A;  4BXX J;  1IV6 A;  3EGQ A;  1MH4 A;  2HXI A;  5FLV A;  5EGO A;  2Y31 A;  2JK3 A;  4QIW N;  4V2G A;  4A3E J;  3NAU A;  2NS8 A;  1QRY A;  3S1N J;  5DS9 A;  5IOZ A;  3A03 A;  1ZGW A;  1MH3 A;  3CQZ J;  1FIP A;  3VVZ A;  2M8G X;  1MBF A;  4ABZ A;  1JUM A;  1TWC J;  1GVD A;  2K9N A;  3F1B A;  2UXU A;  3GTQ J;  4V2F A;  3CDL A;  4EEF G;  3RKQ A;  5GPA A;  4QTR A;  3IV5 A;  2P81 A;  3FK6 A;  3LSG A;  5FKO A;  1BW5 A;  2XDN A;  2VI6 A;  1UMQ A;  1MSE C;  3MNL A;  2LY9 A;  1JUS A;  1ZKG A;  2YVH A;  4JX6 A;  1U9O A;  2COB A;  1U78 A;  2NX4 A;  1IDY A;  3BTJ A;  1GV2 A;  2E2H J;  2VPR A;  2FX0 A;  4DW6 A;  3MVP A;  2O7T A;  3CCY A;  1IDZ A;  2Y2Z A;  1UI5 A;  1TWA J;  4NDL A;  3HOY J;  2HYT A;  3TW6 A;  3ZQC A;  3S17 J;  2L7Z A;  3HIM A;  1X58 A;  1AU7 A;  3S2H J;  3GTJ J;  4CGR A;  4XRS A;  1I3Q J;  3E7L A;  5EYR A;  5F04 A;  5EZH A;  3AQS A;  3IUV A;  1S7E A;  2MGQ A;  5E3O A;  5CXG A;  2WB1 N;  5D19 A;  4BKX A;  4W1U A;  1O4X A;  2IU5 A;  2ID6 A;  2PMZ N;  1GDT A;  4B1R A;  3QPS A;  5J1Y A;  3KNW A;  1B72 A;  2DA6 A;  2ECC A;  1HDD C;  1HOM A;  2LK2 A;  1FEX A;  3OIO A;  4AUX A;  3BR0 A;  4AF5 A;  4L62 A;  2B63 J;  5EEA A;  5AQC A;  2VKV A;  2EBI A;  5IOY A;  1ENH A;  4HNV A;  2H8R A;  2DG7 A;  2NOG A;  5H9T A;  5C44 J;  3E7Q A;  2K9S A;  2OER A;  3DEW A;  4MXM A;  1OJL A;  3JRD A;  3BJB A;  1IJW C;  5K7H A;  1AKH A;  4JYK A;  2XGE A;  5HOD A;  3GTM J;  3BTC A;  1Q1V A;  1JKQ C;  2YVE A;  2CJJ A;  5K7F A;  4C3H J;  1F43 A;  4BBR J;  3JRG A;  4AC0 A;  3VOK A;  2NVT J;  1U9N A;  3HEF A;  2RAS A;  3G1M A;  1HLV A;  2ZCX A;  4JKZ A;  3FKI J;  3S15 J;  2GUH A;  3AQT A;  2LVS A;  2ME0 A;  2M9H A;  3LJL A;  3RZD J;  3NNR A;  3HOU J;  2HYJ A;  2L7M P;  3GTP J;  1ZR2 A;  2XGD A;  4GFB A;  4YZE A;  2R5Z B;  1ETY A;  1Z0X A;  2LP0 A;  3VP5 A;  3LHQ A;  9ANT A;  2WV1 A;  1HCR A;  1B8I B;  1JKO C;  3ZOB A;  4UDS A;  4UUS B;  2DN0 A;  5IYB J;  2DA3 A;  3LOC A;  2L7F P;  3Q0U A;  1CQT A;  2R7Z J;  2FD5 A;  1U8B A;  1HDP A;  2X6O A;  4Y7N J;  1XG1 A;  1T33 A;  3IH2 A;  1K61 A;  2QCO A;  2X9D A;  5IP6 A;  2HI3 A;  3K2A A;  1WPK A;  1ETX A;  1FJL A;  2ELK A;  2DA2 A;  2E2J J;  3SFI A;  2GM4 A;  2HOA A;  3S1Q J;  5F27 A;  4A93 J;  3BTL A;  1Y1W J;  4MK6 A;  2NP3 A;  1RET A;  1ZQ3 P;  3LSJ A;  4IHX A;  3HTA A;  3VPR A;  2ZCN A;  3L1P A;  3NXC A;  3GTK J;  4Y52 J;  2CRG A;  3PPB A;  2E2I J;  2XPW A;  1WH5 A;  2Y30 A;  1MSF C;  3G56 A;  5D18 A;  2R5Y A;  1OCT C;  3IH3 A;  3QQA A;  1MBK A;  3P9T A;  4D7M A;  1ITY A;  1XC5 A;  1B72 B;  1IRZ A;  1X2N A;  5GP9 A;  2QIB A; 
#chains in the Genus database with same CATH topology
 3E6B A;  3O60 A;  3CJD A;  1A04 A;  2PMH A;  1J7K A;  4I2O A;  3H5A A;  4KWA A;  2CO5 A;  3MD2 A;  4XIC A;  4B43 A;  3G7R A;  4B8X A;  2X4H A;  4IKF A;  2K86 A;  4HLY A;  2N8G A;  2OD5 A;  1WJB A;  4NUB A;  1YIT I;  4LB5 A;  1ZHF A;  2DFI A;  1RR7 A;  1YYV A;  2TRT A;  3BR5 A;  4IHW A;  4C30 A;  1HXD A;  3S2W A;  3HDD A;  2NYX A;  3RPU D;  3HHG A;  5E1Z B;  5KCM A;  3FXK A;  3JR9 A;  3CRJ A;  3BR6 A;  2FXA A;  3BG5 A;  1RIO H;  3VSL A;  2EFO A;  3GZ6 A;  3B6A A;  4KIT B;  3CME I;  2F4M B;  5ICG A;  4U0V A;  1IN5 A;  4LLG F;  1H89 C;  1XS9 A;  2EFQ A;  2VBY A;  3P9K A;  2OPT A;  3SZT A;  3CC2 I;  2BGC A;  1RKW A;  3RD3 A;  2IW5 A;  2DMP A;  2HDC A;  1BC7 C;  1HW5 A;  1Z77 A;  4ICH A;  1IZ1 A;  1TWF J;  1YO5 C;  2PFV A;  1MDM A;  5FKM A;  1Z3Y A;  4EM2 A;  2E35 A;  2VJ5 A;  1S6L A;  4CCK A;  3HOZ J;  2MLK A;  3LA3 A;  3C3W A;  4WXH A;  3W2V A;  1N75 A;  2DA1 A;  2QZ8 A;  3RYR A;  3Q0V A;  4B3A A;  4GCT A;  3HSF A;  2PBX A;  2WAD A;  2BBY A;  4WCG A;  1YRN B;  2BHZ A;  1D1B A;  5BNG A;  1NG6 A;  1SFO J;  2QA4 I;  4LOC A;  4N0B A;  3UNG C;  1TP4 A;  5K5Q A;  3H0D A;  2UUZ A;  2P7C B;  2XB5 A;  1NHA A;  1S9H A;  3CJR B;  5AON A;  4ON0 A;  3VYR B;  2OI8 A;  5FFX A;  5HOO A;  2V57 A;  5F0F A;  3JRB A;  2VKH A;  2PFB A;  4A0Z A;  1A5J A;  1J9I A;  2KL4 A;  2F48 A;  2K02 A;  3MFK A;  3QAH A;  4XM3 A;  1DGW Y;  3H3V K;  1P4A A;  1WJD A;  1K6O A;  4S05 A;  2HGC A;  2OZ6 A;  2E71 A;  3JRE A;  1QA6 A;  1BIA A;  3FM5 A;  2LBF A;  3KCC A;  2VUM J;  1ZK8 A;  1A6Q A;  1XB4 A;  3BR3 A;  2GXB A;  1P7J A;  3WE3 A;  4O5V A;  3MAJ A;  4IEJ A;  1NH3 A;  2BW3 A;  5B5E C;  2ESH A;  4P9U A;  2FE3 A;  4ZYA A;  1QPI A;  5FGL A;  2JPC A;  2DA5 A;  1X1P A;  4ZH4 F;  5D1R A;  1YG2 A;  1RRJ A;  2PG4 A;  3ANP A;  1SVL A;  3TP3 A;  4P9F A;  3LSP A;  1YFH A;  2H27 A;  2QEN A;  1VQ9 I;  3RDI A;  1W0T A;  2PBI A;  3LNQ A;  1BA5 A;  2VE8 A;  3E6M A;  2ZOY A;  1DGR M;  2GA1 A;  1ON2 A;  2WUI A;  4IQJ A;  1OCO H;  2JUG A;  4XKC A;  2RGV A;  3ML6 A;  3J80 K;  1O3R A;  5D6E A;  5J1R A;  2VAS A;  3WGH A;  4XOR A;  5DM7 F;  3KE2 A;  4FIS A;  3M3Y J;  1ETK A;  4NC6 A;  1Z7L A;  2VOD A;  3T0Y A;  1WJC A;  3N4M A;  3WHB A;  2IA0 A;  4S04 A;  2O03 A;  2YX4 A;  3LSH A;  3KPH A;  3OSG A;  2O61 A;  4LIU A;  1D8J A;  2XC7 A;  4UXN A;  1PVE A;  4F55 A;  5K7Z A;  2LYC A;  4DZP A;  4L0Z B;  5LGT A;  3MZH A;  4FE7 A;  2FJI 1;  1U8R A;  2GXA A;  3I4P A;  2F07 A;  2KHM A;  2OUM A;  3CUQ C;  4RAZ A;  2FJ1 A;  2FA5 A;  3CC4 I;  1R1T A;  4BBS J;  4IOC F;  3ABU A;  3SDG A;  3UR3 C;  1CF7 A;  3NPI A;  3ZMZ A;  1JXS A;  1X1A A;  2HOE A;  1ZR4 A;  2XPV A;  4ESB A;  2ZXJ A;  4RGR A;  3CO6 C;  1BN5 A;  1E0E A;  2HKX A;  3FMR A;  4YFN F;  5TRD A;  3JSP A;  1QVT A;  1YRN A;  2BXZ A;  2ADU A;  2D45 A;  1XMK A;  5J1U A;  3BNI A;  1X2M A;  2R5Z A;  3D5L A;  3NWS A;  3Q9V A;  2FF4 A;  1EH6 A;  3C18 A;  3PO2 J;  1FSE A;  4E7L A;  1F5T A;  3L2Q A;  3FDY A;  2LKP A;  3B81 A;  5DCF A;  4LG0 A;  3OYL A;  3WHC A;  2HVQ A;  1T98 A;  2A3S A;  2DOE A;  3TW7 A;  4PJM A;  5A2Q K;  2JA8 J;  3OYB A;  2YR2 A;  4X1E A;  5E3N A;  5J40 A;  4A0X A;  4PSX A;  2KZG A;  3F6V A;  2QOP A;  2W53 A;  1AHD P;  2EWN A;  2W24 A;  3G3Z A;  1B59 A;  2BW3 B;  3OYE A;  1MD0 A;  2NVQ J;  1IUF A;  4I98 B;  5HLI A;  2L02 A;  2G7S A;  5JLW A;  4ACI A;  1B1B A;  3ABT A;  4I0A A;  3KP4 A;  3NWT A;  4B44 A;  3I4N J;  3M7G A;  4IHS A;  2DQR A;  3HKZ A;  3AAF A;  3CCQ I;  3R0A A;  3HRS A;  5LHG A;  3CES A;  1BOB A;  3FXJ A;  2DOF A;  3M8J A;  1X4P A;  5GTI C;  1VI0 A;  1IO2 A;  1XSD A;  1H8A C;  4KFC A;  3ON4 A;  4LLL A;  4MFE A;  2HKU A;  3CZ6 A;  5FFZ A;  4CDG A;  1MGT A;  3CP8 A;  3AKZ A;  2BY2 A;  2YSR A;  2RNG A;  1FIA A;  5L3G A;  4RBO A;  3DP7 A;  1QHH D;  1ETW A;  3LSK A;  2FOW A;  1CGP A;  3S1R J;  3KZZ A;  3HGY A;  4XLH A;  3OYF A;  3G2B A;  2JZY A;  3AG1 H;  2QQA A;  3BJO A;  3F22 A;  3A01 B;  1B8I A;  3LAJ A;  2W00 A;  2UXH A;  3L7W A;  1T0F A;  1F4K A;  3S1M J;  3JRI A;  4J01 A;  2CUE A;  1BM9 A;  2L9R A;  2RDP A;  3OYD A;  3FHN A;  4Z6Y A;  4IHT A;  4G6T B;  3S93 A;  1KYW A;  2RHA A;  2YVX A;  4ANJ A;  1P2F A;  3HUG A;  1FZP B;  2M2E A;  4L5I A;  2W7N A;  2JRM A;  3KKD A;  3TDU C;  2ZB9 A;  4GGG A;  3RKW A;  3V8K A;  3ZRG A;  1DU0 A;  3H5N A;  2HR3 A;  5HLT A;  2JQ7 A;  1ETV A;  2DW4 A;  5EZG A;  2ZOZ A;  3ZMD A;  3HTH A;  1NK3 P;  1TWG J;  5F0C A;  3LSI A;  1GV5 A;  3VW0 A;  5CXI A;  2JN6 A;  5CW8 A;  4JL3 A;  3EQL F;  1JJ8 C;  2HPM A;  3KKC A;  2GQQ A;  2EZK A;  1B9N A;  3CJN A;  1TC3 C;  3DEU A;  2ZFW A;  1U5T C;  2CH0 A;  1TNS A;  2LTP A;  2V9V A;  2X1C A;  4QLC U;  1IRG A;  3A02 A;  3WTS C;  1UCR A;  3S3M A;  1MNE A;  2LLK A;  4C2M J;  5J4Y A;  1HW2 A;  1U5T B;  2Y48 A;  2Q24 A;  5M5Y J;  1MBG A;  4EJT A;  1HKQ A;  2IGK A;  3QOP A;  2LRD A;  2ZJ2 A;  3DEE A;  4E7K A;  2B1E A;  1AKH B;  1Z91 A;  4E7Z A;  4TV7 A;  1SVO A;  2PEX A;  1SD6 A;  3KEY A;  1YS7 A;  2A69 F;  2K5C A;  3EGQ A;  1MH4 A;  5FLV A;  4ZTJ A;  1QNT A;  3GWZ A;  4XRF A;  1W36 C;  5HLH A;  1G3W A;  5FD5 A;  2NS8 A;  2PMZ A;  1FPQ A;  2GOM A;  2MD0 A;  4EM0 B;  5F1R A;  3S1N J;  3F8M A;  4OD5 A;  2IA2 A;  1K78 A;  3FXM A;  1MH3 A;  1Z21 A;  2MLG A;  3ONQ A;  1FIP A;  3CUO A;  1S7O A;  2K9N A;  2IJL A;  3DF8 A;  1QZZ A;  4NNJ A;  5E18 F;  4BYY A;  1BI1 A;  2OV7 A;  3MZ8 A;  3J81 Z;  3RKQ A;  1LEB A;  5KAF C;  2IS2 A;  4HF2 A;  2RQQ A;  1TT0 A;  1UMQ A;  3BWG A;  3MNL A;  2LY9 A;  1JUS A;  2E1N A;  2YVH A;  5KAI C;  2COB A;  3RJP A;  2NX4 A;  2ZCW A;  4BDY A;  5D4S A;  1YHQ I;  1QU3 A;  4CUG A;  1AA7 A;  3OYA A;  4ZYH A;  1H9G A;  4RS8 A;  1UFM A;  2W82 A;  4QPQ A;  1W5C C;  2CW8 A;  2XGX A;  3K2Z A;  4NQW B;  3OYI A;  1SVM A;  4NDL A;  3CCU I;  1DP3 A;  1UI5 A;  3S17 J;  1X58 A;  1AU7 A;  3S2H J;  3GTJ J;  4LB6 B;  3A0H C;  5FLX K;  1ZN2 A;  5EYR A;  5F04 A;  3QU6 A;  4NHJ A;  1FNN A;  3MZY A;  4W1U A;  2ID6 A;  4AD9 A;  2PN6 A;  1TQI A;  4LIT A;  4G94 A;  2K4B A;  4CCL A;  1HOM A;  2DA6 A;  1HDD C;  1F9N A;  3KYD B;  4BJ6 C;  2W1O A;  3KET A;  1KQ8 A;  1LKX A;  2MA3 A;  3M8E A;  3BR0 A;  4RLF A;  1EH8 A;  4AF5 A;  4GDF A;  5AQC A;  4HDV A;  5IOY A;  4GYG A;  3CJQ B;  4MTD A;  4BQQ A;  2ZNZ A;  1I27 A;  5C44 J;  2R7S A;  4E7I A;  2BYV E;  2QSF X;  2K27 A;  3DEW A;  1QZY A;  1LNW A;  3EDP A;  4MXM A;  4AIJ A;  3IHU A;  5J47 A;  4ZDO A;  1BR1 A;  1IJW C;  2L54 A;  2XGE A;  1B6A A;  5HOD A;  3GTM J;  4Q5S F;  1XGM A;  4R79 A;  1KA8 A;  1Q1V A;  3V8J A;  1BBY A;  5K7F A;  1DQU A;  4U9L A;  4XSX F;  1U9N A;  3K70 D;  2ZCX A;  3FKI J;  3QP5 A;  2GUH A;  4LK0 F;  1W7P D;  4UV8 A;  3SEZ A;  4Z2Y A;  3DBH B;  3NNR A;  3FXR A;  1Z67 A;  1ZR2 A;  4ASN A;  2HZT A;  4GFB A;  4G7O F;  3GCM A;  2R5Z B;  1UAA A;  4RB0 A;  1B8I B;  3BY6 A;  3ZOB A;  4UUS B;  4UDS A;  1USS A;  2XAJ A;  4LIV A;  4KA4 A;  3L2W A;  2L7F P;  4ETS A;  4MEY F;  1U8B A;  1OCZ H;  1S8N A;  3IH2 A;  1YQA A;  2IGM A;  3DV8 A;  2HI3 A;  1ETX A;  3LA7 A;  1FJL A;  1XN7 A;  2UZK A;  2HQA A;  5HS9 A;  2DA2 A;  4V19 K;  2GM4 A;  4ZYD A;  3S1Q J;  1X19 A;  2KIU A;  5F27 A;  1OCC H;  2DFF A;  2KQR A;  4JOM A;  3J7Y J;  1ZQ3 P;  2NP3 A;  5FB2 A;  5HNF A;  3ZQQ A;  2DFH A;  3F3X A;  3GX4 X;  3PPB A;  4PDK A;  5FLX Z;  2JRT A;  2K9L A;  2FQ3 A;  4EM1 A;  2J5O A;  2VKD A;  3LA2 A;  4RLQ A;  3WTZ A;  2PQ8 A;  5TGT A;  2DJI A;  4D7M A;  2R7X A;  1XC5 A;  2EFW A;  3HRT A;  4OU0 A;  1G6N A;  3LL7 A;  3E6C C;  2QIB A;  2R7O A;  2NRA C;  1E17 A;  3OOU A;  2UXO A;  3O6B B;  3DXJ F;  3NRG A;  2JMW A;  3IAM 2;  2FBI A;  5K1Y A;  4BXF A;  3GBG A;  3E5Q A;  2O8K A;  3H1C A;  1RNL A;  3N97 A;  3HOW J;  3GZI A;  3FKJ A;  1EH7 A;  2CQ7 A;  3LSR A;  1ZG3 A;  3QOE A;  4A3J J;  5E3L A;  5DM6 F;  2V1X A;  2QQ9 A;  3LWF A;  4Q48 A;  5D8L B;  1HW1 A;  2L0K A;  1Y1V J;  4IJA A;  2QLZ A;  2LY2 A;  3U9G A;  1K78 B;  2NP5 A;  2G7G A;  2M45 A;  5EFY A;  4P1W A;  4MGR A;  3K7A J;  1EF4 A;  3WU1 B;  3M4O J;  2B0L A;  3VWB A;  4DYQ A;  2WB1 A;  3VOX A;  1OCR H;  5EEG A;  4WF2 A;  5B3S H;  1IV8 A;  3KP3 A;  4BY7 J;  3GEU A;  2J5P A;  5A2Q Z;  1K4S A;  3PJR A;  1HKT A;  1MKM A;  2DTZ A;  2G7U A;  4AU7 A;  2R3S A;  1FLI A;  1YTY A;  2ZME B;  1UG2 A;  4OAY A;  2OC6 A;  4II3 A;  3ANG A;  4I76 A;  4NQW A;  1ZG1 A;  2WGB A;  3K4C A;  1FP1 D;  1IG7 A;  5IP9 J;  4MLO A;  2DFE A;  3OWT A;  1UHS A;  5LRR A;  3O8G A;  4FET A;  1TQM A;  1O3T A;  2HYG D;  3GLL A;  4LLN A;  5KK1 A;  2G9W A;  4RM2 A;  3ZQ7 A;  3E5U A;  1I3A A;  2BY1 A;  2DU9 A;  2IXS A;  2LR8 A;  1G3Y A;  1N77 A;  3BCB A;  4DJA A;  4BJ5 C;  3BQZ A;  2V1U A;  5HDG A;  4BL0 B;  2A5W A;  1SFU A;  4F93 B;  4N4N B;  4XLF A;  2BY3 A;  5FHP A;  2AHQ A;  3AG2 H;  1FWZ A;  1TZL A;  5IY5 H;  5CPR B;  3OSF A;  2STT A;  3BJ6 A;  1MZB A;  2ISY A;  4HLX A;  1HQC A;  3R4K A;  1Y0U A;  5CVJ A;  2BE5 F;  3JCU C;  2EZI A;  2DMN A;  2ZO4 A;  3S2D J;  2DO7 A;  3CCJ I;  2DA4 A;  3BZK A;  4A5M A;  2CV0 A;  1KQ0 A;  4LD5 A;  4KIS A;  4M9X A;  4HPQ A;  2MYS A;  2R7D A;  1T0F C;  1BR4 A;  4BAY A;  4MFD A;  5B66 C;  3QRF F;  4BS9 A;  1WI9 A;  2K9Q A;  5D5X B;  1FOX A;  2FNA A;  1FTT A;  2EK5 A;  3M1C A;  3W6V A;  3DKX A;  2LFB A;  3MCZ A;  1TTY A;  5FRN A;  4L0Y B;  2DMQ A;  5L3E A;  3BCG A;  5JLX A;  4XKB A;  4PGH A;  2ZNY A;  3I4M J;  3TOA A;  3VSK A;  4BY1 J;  4A3K J;  2GWR A;  4HQM A;  2CUF A;  1EKE A;  2DI3 A;  3HOX J;  4WK8 F;  2Y69 H;  1UEL B;  5EG0 A;  4MO7 A;  2VOO A;  2XAH A;  5IPA A;  1XMA A;  4I6Z A;  2R5Y B;  1OR7 C;  2RN7 A;  1IUY A;  3I53 A;  4HBL A;  4IQ4 A;  2BZT A;  1I50 J;  3C7J A;  2R7R A;  2X6X A;  3CDH A;  1LB2 A;  2HYF A;  4R8H A;  1MJ9 A;  1XDU A;  4AWX B;  1FBS A;  1ZAO A;  1SFX A;  2X48 A;  4D5F A;  5D8K B;  2KRF A;  1RPW A;  2ZXW H;  2MD5 A;  2TCT A;  4YII A;  3HC7 A;  1ZH5 A;  2COM A;  3HTJ A;  2EPF A;  3ZN0 A;  4U0Y A;  1MMS A;  4Y33 A;  1QVU A;  3QOD A;  2KIS A;  2DOD A;  1R1U A;  4G8X A;  4M3F A;  4HF1 A;  5HNH A;  1U5T A;  3EUA A;  3C07 A;  3OYH A;  3D5S C;  2ZJP F;  2AQF A;  4BHB A;  4MQ9 F;  1L0O C;  3I58 A;  3LFK A;  5J3L A;  1RES A;  3K8P C;  4XLP F;  5LGN A;  4G6Q A;  4A3B J;  3I56 I;  2W48 A;  1MBH A;  3HM5 A;  1ORK A;  1LJ9 A;  1JT6 A;  3I64 A;  5F6F A;  2X1D A;  3AG3 H;  4MQV A;  2JA6 J;  2D1V A;  4IOA F;  1Z6R A;  2VB6 A;  1R58 A;  5LBQ A;  2K3F A;  2QGU A;  3DLA A;  5JVT A;  1D3Y A;  2E36 A;  3HTU A;  4M3G A;  3T1B A;  3H3U A;  1VFC A;  1IGN A;  2QBY A;  3CMA I;  5E1X A;  4PJN A;  3RZO J;  2XAG A;  3WTT C;  1V54 H;  3BDD A;  2KIQ A;  4KMU X;  2JT1 A;  1FOY A;  5CVI A;  2EFN A;  4FCY A;  3BQY A;  2IGN A;  4JNN A;  1W7P B;  2RC4 A;  3EPZ A;  3T5X A;  4IHV A;  3BZ6 A;  4KIG A;  1E3O C;  4GXO A;  1TT5 B;  3FIS A;  2GFN A;  3BG7 A;  4U88 A;  3DQV C;  1JHH A;  3CD6 I;  2E19 A;  5EF6 A;  3CCS I;  5J8C A;  2RV8 A;  1RUO A;  2MBF A;  3E97 A;  3KLO A;  4AVZ A;  3OYM A;  4XID A;  4NEL A;  1FT9 A;  3CCR I;  2UV1 A;  3A2K A;  3QPT A;  5CVR A;  3WU0 A;  2DK8 A;  3ZGK A;  3B73 A;  1K79 A;  1IC8 A;  1VQ6 I;  2AXT C;  1D0Z A;  5FGM A;  2F5C A;  4OIR F;  1Q1H A;  3T8R A;  5HSZ A;  2VBX A;  3BR2 A;  1R23 A;  4D7N A;  4Q47 A;  5M5W J;  2OJE D;  4DBQ A;  3FMS A;  3U1K A;  3IWF A;  1V5G A;  2PJR B;  4ENM A;  5B1B H;  4EV0 A;  3V78 A;  3Q3S A;  2A6T A;  4HA8 A;  2CQQ A;  1I39 A;  1LVA A;  5EG0 B;  2Z3Y A;  2ZFU A;  3GTG J;  2CV1 A;  3RQ4 A;  2QTQ A;  2WAE A;  4PFO A;  5C4X J;  1GHC A;  3B6C A;  2VON A;  2Z16 A;  1LFB A;  2G3B A;  5GAE J;  1FBU A;  3J7Z I;  1WRJ A;  2GBY A;  4OMZ A;  3V7C A;  2ZKZ A;  3GFL A;  2LKX A;  4M3E A;  4KT6 A;  1Y8Q B;  3RSN A;  3ABK H;  1SAX A;  3COL A;  1R5I D;  5FKN A;  1R00 A;  2A61 A;  3NEU A;  3JAM K;  1MBE A;  2R93 J;  3R60 A;  4KIB A;  3TOB A;  5BS6 A;  2CS3 A;  2CW7 A;  2MSY A;  1Y56 A;  2YPR A;  2HZD A;  3HYI A;  3TO9 A;  4EJO A;  3CTA A;  2HOT A;  4XN0 A;  5H20 A;  2IA1 A;  2ELJ A;  2ELH A;  6PAX A;  2A2F X;  3K4K A;  4E70 A;  4BQA A;  2LKS A;  3H9G A;  1DDN A;  3D1N I;  4A12 A;  4CSW A;  4A5N A;  1MMA A;  4BAC A;  2IVM A;  1XDS A;  3ZQG A;  2HDW A;  4HX4 A;  3H0G J;  3V8L A;  4GRI A;  5IT9 Z;  4KIF A;  3HPG A;  3E6D A;  5M3M J;  5JHU A;  1OYY A;  3DLL F;  3PSI A;  3HBL A;  2K4J A;  1J59 A;  2QYO A;  1VQ5 I;  4KDP A;  3FHZ A;  3GXO A;  3PAS A;  3DPT A;  3H92 A;  1Y0N A;  4PXI A;  2V9P A;  4P96 A;  2H6C A;  2EA2 A;  5CVV A;  5E79 C;  4OAZ A;  5FRM A;  3K4M A;  2P5L C;  2IS1 A;  3QKX A;  3WG9 A;  2G0E A;  3KYL A;  2Z5U A;  3DTK A;  4PZJ A;  2LSO A;  2QUF A;  2Y0S N;  5ICE A;  3HOV J;  5K58 A;  4EVI A;  2DMT A;  4OOI A;  3U2R A;  3VW1 A;  1E3P A;  2VKE A;  4YEL A;  1WZ2 A;  1VQN I;  1GVJ A;  3PIP F;  1XTA A;  3V4G A;  1T38 A;  1R4M B;  1OYI A;  2Y31 A;  4V2G A;  3JTH A;  2GXG A;  2BHY A;  3TL4 X;  3ZMV A;  5DS9 A;  4ITV A;  2QVO A;  1J0R A;  3IUO A;  2BXY A;  3GFJ A;  3A03 A;  3CQZ J;  1MBF A;  4ABZ A;  1JUM A;  3DBL B;  4J00 A;  2Z9O A;  5DDG A;  1LVK A;  3MKW B;  3FZV A;  3CDL A;  1BIB A;  4EQQ A;  5CQE A;  3O3K A;  3NRV A;  3KP2 A;  3C1D A;  4RA2 A;  4M74 A;  1DPR A;  1WJE A;  2DYR H;  3HL2 A;  1ZKG A;  1U78 A;  3RPU A;  2H1L A;  2E2H J;  4BH9 A;  2ESN A;  1VQK I;  4PK4 A;  3MVP A;  1IDZ A;  4KNY A;  4ZYE A;  3K1P A;  4NC8 A;  3HOY J;  2HYT A;  2LDU A;  1SD4 A;  2R7V A;  3HIM A;  2V1D A;  3DU6 A;  1ODD A;  2KLO A;  4XLA A;  2KJC A;  3QWL A;  4XMY A;  1I3Q J;  3CLO A;  2LOO A;  5EZH A;  3COA C;  2VLA A;  3IUV A;  1S7E A;  5E3O A;  4ESJ A;  2Z99 A;  2FBH A;  2WB1 N;  3KZI C;  5LFA A;  5D19 A;  1QBJ A;  1DPU A;  2IU5 A;  2PMZ N;  1GDT A;  3SDB A;  2M87 A;  2A6E F;  3QPS A;  5J1Y A;  2FEZ A;  4XR6 A;  5DD4 A;  5L3B A;  1B72 A;  3HRU A;  3LFU A;  1FEX A;  2OQR A;  4AUX A;  2B63 J;  3DBR B;  2M7A A;  2EBI A;  3QU3 A;  4IRV A;  1S7A A;  2E7X A;  1ENH A;  2DG7 A;  5AIP A;  1R4N B;  2CV2 A;  4I0B A;  2M4K A;  3E7Q A;  2RRE A;  3M07 A;  1TQP A;  4EJU A;  2YU3 A;  4MNU A;  2JVH A;  4XKW A;  3RPQ A;  4G6D A;  3BJB A;  5L3C A;  1MMD A;  1FSH A;  3CUQ B;  2IS6 A;  5DCM B;  4JYK A;  1IN8 A;  1FMV A;  3H35 A;  3ISP A;  1ZRF A;  3ERM A;  3BP8 A;  1JKQ C;  2CJJ A;  3ASO H;  4D1Q A;  3K4L A;  4BBR J;  3PL8 A;  3JRG A;  2WA0 A;  1WJA A;  1HLV A;  4JKZ A;  1IXR C;  4M72 A;  3SXY A;  2KDO A;  3GZN B;  3VYT B;  5J8F A;  5DYM A;  3AQT A;  3PQK A;  4IRG A;  2LVS A;  2ME0 A;  1S72 I;  2L7M P;  4XL9 A;  3WTY C;  1QQI A;  3F23 A;  1ZRC A;  4B48 A;  4YZE A;  4WX9 A;  3LQQ A;  2UXX A;  3TO7 A;  1ETY A;  2LP0 A;  1XD7 A;  2V6C A;  4L9T A;  3OYG A;  4HAM A;  5IYB J;  2DAO A;  3LOC A;  3DWL E;  2W85 A;  5H6R A;  1GXQ A;  1CQT A;  1FOW A;  4WXD A;  1IN6 A;  2X6W A;  3IL2 A;  1K61 A;  2L2O A;  2QCO A;  5DCM A;  5IP6 A;  1WPK A;  4HG2 A;  2H6B A;  1ZLK A;  3CO7 C;  2KRH A;  1V5E A;  4IVN A;  1BR2 A;  3HOS A;  1G8X A;  3MEX A;  1TNT A;  2UXN A;  2VL8 A;  1Y1W J;  1RET A;  2VQH A;  4IHX A;  3VPR A;  3E1S A;  3HSR A;  1J5Y A;  4XOT A;  1YJ9 I;  3NXC A;  4Y52 J;  1FC3 A;  1N78 A;  2HNH A;  2CRG A;  3OL4 A;  2B7E A;  2E2I J;  4HRI A;  4CH7 A;  1MSF C;  5D18 A;  2R5Y A;  1OCT C;  4CCO A;  2CFX A;  3IP4 B;  3QQA A;  4C2U A;  1CF7 B;  4AIK A;  2QKL B;  3P9C A;  2DDA A;  1OKR A;  1GLN A;  3HXL A;  5IT9 K;  5GP9 A;  3ZQL A;  3WOD F;  1YW8 A;  1UI6 A;  1VF9 A;  2WAF A;  2M5W A;  4FAS D;  1FBQ A;  5LRS A;  3F8B A;  3OS0 A;  2FBQ A;  4ENK A;  2RNJ A;  1FYM A;  4U9N A;  1XGO A;  1PUF A;  2HOS A;  4C9Y A;  3HKZ N;  3E5X A;  2DG8 A;  2HQN A;  3WU2 C;  4QSH A;  4UUS A;  2WV0 A;  4Y3O A;  1YIO A;  2IEK A;  3DKY A;  4Q4Z F;  1NG7 A;  3T6N A;  1G4D A;  2O5R A;  1GT0 C;  3BPV A;  2NAZ A;  4BEH B;  3VIB A;  4B09 A;  1POG A;  4G12 A;  3BT9 A;  2K3P A;  2M34 A;  1IRF A;  3L2C A;  1YOV B;  1VQ8 I;  3HSE A;  1X3U A;  4ZDP A;  4HV6 A;  5TJJ A;  1UST A;  2D1H A;  5C3E J;  1VQM I;  1R9T J;  4DYR A;  2Z33 A;  3HTI A;  4XRM A;  4HKU A;  2VIX A;  4I09 A;  4JX4 A;  2H1K A;  1YX3 A;  3F72 A;  5HDN A;  3BRU A;  2Q0O A;  4CGZ A;  4E7H A;  2D2W A;  3FMQ A;  5FMP A;  4XKV A;  2CWE A;  5E17 F;  1JT0 A;  3EET A;  3WTW C;  3GW2 A;  2O6G E;  1RKT A;  2XAF A;  1LEA A;  1X3W B;  2CQX A;  4IHY A;  2K40 A;  2L9V A;  3AFH A;  5L3D A;  2ZCM A;  2DBB A;  2YUS A;  1FP2 A;  5FRO A;  3HE0 A;  5BPI A;  2R4G A;  3EUH A;  5K5R A;  4D5C A;  4P5O A;  1JTY A;  3QP6 A;  1T8I A;  1OFC X;  2JPB A;  1OR7 A;  2H8W A;  3CMY A;  2FOK A;  2LNB A;  4FE4 A;  3W6K B;  4HNT A;  3LAP A;  4EGY A;  1YI2 I;  2EIM H;  1A6I A;  3RTR A;  3GO5 A;  3IRR A;  1YS6 A;  2XF6 A;  2GIV A;  3OIP A;  1HKS A;  1JGG A;  4A6E A;  1DU6 A;  1Z3X A;  4Y17 A;  1J09 A;  3F6O A;  2JTV A;  1L3L A;  4CHU A;  3K69 A;  1JJ6 C;  4GCK A;  3KEO A;  3E0J B;  2HDD A;  4XON A;  1YIJ I;  3LWJ A;  2VXD A;  3HJE A;  3FXO A;  3BOQ A;  5IP7 J;  1T2K A;  2NVY J;  1R36 A;  3KFW X;  3QYE A;  3K0L A;  4YFK F;  2DMU A;  4M9Z A;  3KEQ A;  3CUQ A;  5DEQ A;  2MG4 A;  1PYV A;  2BOL A;  2X6Y A;  3TGN A;  3NAR A;  2ZBK A;  2CUZ A;  2P6S A;  4DNC A;  5LEJ A;  4F3Q A;  1TW3 A;  4C3I J;  4KN4 X;  2WBM A;  1W0U A;  1XCV A;  4U0W A;  5FD6 A;  3FXL A;  2VJJ A;  4IPA A;  4NC7 A;  4HQE A;  1IXC A;  4IRH A;  2MW8 A;  3W3C A;  3CCV I;  2QKO A;  2QWT A;  4XN3 A;  2XPU A;  4DBR A;  2VQL A;  4G7H F;  1D0Y A;  4R1H A;  3WTV C;  2F2E A;  2C6Y A;  3RQI A;  2A5Y B;  1F36 A;  2JUC A;  1G3S A;  4BHP A;  5GTH C;  1LE8 A;  2UXP A;  3R0J A;  4M3D A;  2Y0S A;  2CW0 F;  2R92 J;  1T6S A;  2DA7 A;  5M3F J;  3DCF A;  5DUK A;  2VE9 A;  2A07 F;  2Q2E B;  3BHQ A;  3X2Q H;  2E1O A;  1ZLJ A;  5LGU A;  1MNM C;  3R61 A;  4D9J A;  3CP2 A;  2MFZ A;  4WIB A;  3S3N A;  1BC8 C;  1QGP A;  1X1D A;  2M0M A;  4DGW B;  4L18 B;  1G3T A;  4KIC A;  1Y8R B;  2R7T A;  4KJZ A;  4UVC A;  2DTR A;  4CYC B;  2I8D A;  1P6R A;  3SHF A;  1IF1 A;  2NS7 A;  3GME A;  1FX7 A;  2AO9 A;  2CUJ A;  4RGX A;  3NQO A;  4DYC A;  3ESW B;  2HXO A;  4HST A;  1D5Y A;  3GZ5 A;  3A4C A;  1LFP A;  1IN7 A;  5D5U B;  4BDZ A;  2CU7 A;  2JSC A;  1A36 A;  3WGI A;  1P4X A;  2GOX B;  4I7H A;  1B4A A;  4RGU A;  1DUX C;  1JKP C;  1AOY A;  2EIK H;  3BG3 A;  4IZZ A;  3ZR8 X;  3DU5 A;  3T8T A;  2FQ4 A;  1YLF A;  1T56 A;  3KIO A;  2GLO A;  1WGX A;  2F5D A;  1RZ4 A;  1SMT A;  1JI8 A;  4F91 B;  2UWM A;  4KN7 X;  4AIH A;  4W97 A;  1ON1 A;  4AVP A;  4NBQ A;  2IAI A;  1FMW A;  2LC2 A;  2FU4 A;  1WVR A;  4HOB A;  2LRE A;  3J80 Z;  3ERE D;  1TLH B;  2RAE A;  4C3J J;  3HB9 A;  4M73 A;  4HF0 A;  2D6Y A;  2NNN A;  4OMY A;  3VYU B;  5HLG A;  3AL0 B;  3OV8 A;  3TMO A;  1RUN A;  2QSH X;  1JUP A;  3DPL C;  5DAJ A;  4LGW A;  1LDK B;  3SWH A;  2XGC A;  1HBX G;  2H09 A;  2BY0 A;  2PI0 A;  1JHF A;  1G59 A;  3TKY A;  1AWC A;  3VUQ A;  3ZQI A;  2V6E A;  3F8N A;  3L09 A;  4UUT A;  2EB7 A;  2WAQ N;  2XAU A;  4Y4R A;  2AXL A;  2LMD A;  3FK7 A;  2HKO A;  4A3I J;  3HTS B;  1FOK A;  3S16 J;  3CWR A;  4ME9 A;  2YU9 J;  2XRN A;  4IF4 A;  1I5Z A;  2TDX A;  1SEU A;  3S32 A;  1ZAR A;  4M71 A;  1QZE A;  2NVU B;  3D0S A;  5IYD J;  1V4R A;  5LD2 C;  4FX0 A;  3VFZ A;  1W1W E;  3FXU A;  3PM1 A;  4CXF A;  4ENN A;  1ZRD A;  4Y15 A;  2FNP A;  2Q2E A;  2X0L A;  2ISZ A;  1KQ9 A;  2XSD C;  2VJI A;  3EYY A;  3PQJ A;  4G9Y A;  1ETO A;  4A3C J;  1ZYR F;  5FO5 A;  2OTJ I;  1ULY A;  2XF7 A;  4ZYG A;  1UHW A;  2M3A A;  4YIF A;  5BPD A;  4BNC A;  2P7V B;  4BHC A;  3E3V A;  3K4N A;  2DPD A;  1LQ1 A;  2OF7 A;  4HSR A;  1FTZ A;  1LDJ A;  5HBU A;  3A0B C;  3I55 I;  4XLE A;  1ERD A;  3HZJ A;  2DYS H;  2NOJ B;  1E2X A;  4QPO A;  2E5Z A;  3M1E A;  4UY8 I;  3DTE A;  4QWQ A;  5D6F A;  3J81 K;  3ZQF A;  3JRF A;  4HX8 A;  5C4J J;  1HA8 A;  3BR1 A;  3IC7 A;  1I1S A;  3F0C A;  5FJ8 J;  4DOZ A;  2O7O A;  1TBX A;  3S14 J;  2PZ9 A;  1W5T A;  1PP7 U;  3Q9S A;  1HF0 A;  3G71 I;  2X51 A;  4NN1 A;  4X6A J;  2HQ5 A;  2HTJ A;  4EJW A;  2ZJQ F;  4A3D J;  2EQR A;  2EZL A;  2HTS A;  2ME6 A;  3JAM Z;  4XK4 A;  2E1C A;  5EEH A;  1GUU A;  2O9L A;  2IPQ X;  1H88 C;  3ON2 A;  1O7L A;  2M4G A;  3V6G A;  2L7K A;  2LD5 A;  1FYK A;  4I99 C;  4JQF A;  3VTI A;  1T39 A;  1VQ4 I;  1H0M A;  2DT6 A;  4L9V A;  4A3M J;  2KPM A;  3I59 B;  3QYF A;  3CMM A;  4UVA A;  2ZXI A;  4KYW A;  3SYT A;  2OCC H;  3I71 A;  1W4M A;  5F64 A;  2EIJ H;  2WTE A;  1OLT A;  4FX4 A;  2NVX J;  1OYW A;  1I6X A;  4XSZ F;  1OCP A;  2I10 A;  1A35 A;  4UVB A;  3ZN1 A;  2HQR A;  1D8K A;  5FKK A;  5F0H A;  3ELK A;  2FUG 2;  1IV6 A;  2L4A A;  3Q5F A;  3ULQ B;  4UHT A;  3NS4 A;  4BGD A;  4A3E J;  3NAU A;  2HPI A;  2B3W A;  1W5S A;  2F5E A;  3HPH A;  3OYC A;  5L3F A;  4CZC A;  3QYB A;  5EJC A;  3REO A;  3RYP A;  2VC0 A;  2DT5 A;  1TWC J;  3ZP5 A;  3F1B A;  4GCV A;  2P6T A;  2UXU A;  1LUJ B;  1BI2 A;  3LMM A;  2OQG A;  2XDV A;  4QTR A;  2HVR A;  2BVM A;  3FX3 A;  3PNV A;  5FKO A;  1BW5 A;  4CIC A;  1MSE C;  3G4S I;  5LHI A;  3TBI A;  2ZSI B;  2K85 A;  3ABM H;  3V7S A;  2OAZ A;  2M30 A;  1QPM A;  2WWY A;  2VPR A;  1REP C;  1OQY A;  3I3L A;  4DW6 A;  3ZCO A;  5GAD J;  2E60 A;  2HU9 A;  2DXI A;  3IAS 2;  1I1G A;  1TWA J;  3RIR A;  3ZQC A;  3WG7 H;  1WKM A;  3ASN H;  4M9S A;  5ERI A;  1D0X A;  4CGR A;  4XOP A;  2VPL A;  3E7L A;  4HX7 A;  4PJJ A;  4FT8 A;  5B1A H;  3BJA A;  2VC1 A;  1MW7 A;  4BKX A;  1O4X A;  1Z05 A;  2CG4 A;  4RAF A;  1C0W A;  3PNY A;  1SD5 A;  2ZC2 A;  4B1R A;  5DUI A;  3CLQ A;  2MC4 A;  2KJB A;  3HHH A;  1FYL A;  2WY7 Q;  1T08 B;  3KNW A;  2P5K A;  2ECC A;  3SZP A;  5CYV A;  3OIO A;  2W84 A;  4RB1 A;  3ECH A;  5EEA A;  2IGO A;  1A31 A;  2VKV A;  3V7R A;  5K5O A;  2NOG A;  2ETH A;  4CYD A;  3K1N A;  1X3Z B;  3TDZ C;  4CCM A;  2R7Q A;  4JK1 X;  1O3Q A;  2R7U A;  3GF2 A;  1OJL A;  3JRD A;  3WTX C;  3GVA A;  1R49 A;  1AKH A;  3FM3 A;  3I59 A;  4I01 A;  3W6J B;  1YJW I;  1XMX A;  3P7N A;  1EJ9 A;  5E8I A;  4E7J A;  4AC0 A;  4CA0 A;  4IL6 C;  1KYZ A;  2XAQ A;  4BXU A;  3RCO A;  4RAG A;  2Q8K A;  1SMY F;  1UHM A;  3HOU J;  2HYJ A;  2OTL I;  3MMY B;  1BI3 A;  2XGD A;  4CZZ A;  4O6J A;  2AS5 F;  2VT2 A;  4F52 A;  4RB2 C;  1Z0X A;  4DIQ A;  4EGZ A;  3VP5 A;  3J7A O;  2H94 A;  9ANT A;  1HCR A;  5ED4 A;  4BE1 A;  1JKO C;  3K9T A;  4WWC A;  4E7S A;  1Y6I A;  2V79 A;  2VT3 A;  5D5V B;  2DA3 A;  4BQN A;  1HDP A;  4YFX F;  2X6O A;  2XHK A;  1SFK A;  3I5U A;  2F6C A;  2XVC A;  3K2A A;  2NXN B;  2XKP A;  3GYH X;  3OS1 A;  1IW7 F;  4DQ2 A;  2ZXH A;  4LG0 B;  2WY8 Q;  3SFI A;  2HOA A;  3HUG B;  4K2E A;  3VDX A;  3CC7 I;  4A0Y A;  3HRM A;  1VZ0 A;  4A93 J;  4MK6 A;  2L01 A;  2XUB A;  1EV7 A;  3LSJ A;  1E3H A;  4HW0 A;  3L1P A;  1JE8 A;  3L2R A;  3GTK J;  1ACI A;  2F5V A;  2KIF A;  3BRO A;  2HVS A;  2KFD A;  1VQO I;  3IKT A;  2XAS A;  3IH3 A;  1XSX A;  1MBK A;  1R7J A;  2VBZ A;  3LSM A;  1O7F A;  1ITY A;  1Z9C A;  3ECO A;  2OBP A;  2E34 A;  1X2N A;  3RKY A;  1ZG5 A;  2QQB A;  4YIR X;  4CYC A;  3H3Z A;  3H9Q A;  2V26 A;  3GTL J;  3EUH C;  3M9A A;  5E8G A;  1LDD A;  2GZW A;  3BTI A;  4UB8 C;  1P7I A;  3EYI A;  3VYS B;  3ZMT A;  1WI3 A;  4FTH A;  1SAN A;  3BC8 A;  3W2A A;  1UG0 A;  4XQF A;  4WXC A;  2F5F A;  4HNU A;  3L9F A;  3J7A Y;  4ESF A;  5KHD A;  2M7B A;  3CF5 F;  1OIS A;  4BE2 A;  1O3S A;  1XCB A;  2P4W A;  1S3J A;  4L9N A;  2B9S A;  4ZDL A;  3A1Y A;  1H9T A;  2V9K A;  3KP5 A;  3UKG A;  2KRC A;  2L5Q A;  2AQE A;  3CDI A;  4II2 A;  2PJR A;  2M1B A;  4L5E A;  4PCQ A;  3M8F A;  2D5V A;  5M5X J;  3G1O A;  3RI4 A;  3SEQ A;  3OIQ A;  1S29 A;  3OYN A;  2FRH A;  1UZC A;  5EDN A;  4B4C A;  1KZH A;  1F1Z A;  4CO8 A;  4XRS G;  2G7L A;  3RH2 A;  1APL C;  5HAW A;  2XB0 X;  2QBY B;  3QBM A;  2HEO A;  3IH4 A;  3C2G A;  3L2U A;  2KIM A;  2EV5 A;  4HDU A;  5GAH J;  2RVC A;  3DPJ A;  4AID A;  1PUF B;  4A6D A;  1BJA A;  1QO0 D;  1Z6T A;  4RMN A;  5F1J A;  3HOT A;  1PUE E;  1BL0 A;  2Y0M A;  1XSV A;  3MN2 A;  4AYB N;  5LEK A;  2HWV A;  2KMU A;  3C2B A;  2JWT A;  4N9H A;  5JVG F;  4GCL A;  3FBI B;  2P0W A;  4KT5 C;  2IRF G;  3G1L A;  1YX5 A;  1WH7 A;  2W25 A;  2JA7 J;  4I02 A;  2V1N A;  2EH3 A;  1PDN C;  5ILS A;  4X0G A;  3PO3 J;  2G7H A;  2CQN A;  2VQC A;  2Z2S B;  3GEZ A;  2WAQ A;  2MH9 A;  3ZMS A;  2XRL A;  4FQG A;  3JSO A;  3FIW A;  2LY1 A;  1W7P A;  1Z1D A;  3QPL A;  3H5R A;  1PJR A;  3K10 A;  2DOA A;  2MH2 A;  1MMN A;  2LBF B;  1K6Y A;  1HST A;  1KU7 A;  3ZPL A;  3F8C A;  1WJF A;  1OPC A;  4KUM A;  1FY7 A;  3LST A;  1R71 A;  2FSW A;  3SFZ A;  4Y13 A;  3BLY A;  3GTO J;  2DPU A;  4PFP A;  3L2V A;  1WHU A;  2JJ7 A;  1R6R A;  4BQO A;  2L4M A;  2GEN A;  1M1E B;  2R0Q C;  3VVX A;  4M3B A;  1WFX A;  4RGS A;  1PP8 F;  1OMI A;  3JRC A;  5HS7 A;  4B47 A;  5GPC A;  2OCE A;  5DTD A;  4MTE A;  1R5G A;  5EGO B;  2ICW G;  4OWR B;  4XLN F;  4A3G J;  1RI7 A;  5IT3 A;  2L9S A;  2EJR A;  5F08 A;  1MJA A;  4A69 C;  5J6X A;  3AG4 H;  1WWX A;  2PJP A;  2F4O B;  3FBN B;  4GYI A;  1NK2 P;  4UUV A;  2BV6 A;  1KU3 A;  3U21 A;  3U1D A;  5J4V A;  1HC8 A;  2ZME A;  4E6K G;  3JW4 A;  2E1M B;  4LFU A;  3I54 A;  1U2W A;  1X4O A;  2W57 A;  4NB5 A;  5IYC J;  1LFU P;  4RDU A;  1ZTR A;  4U7D A;  3MKY B;  1B9M A;  2QM3 A;  2IT0 A;  2L3D A;  3VOE A;  1J2X A;  4DZJ A;  1D1A A;  3CJT B;  2UXI A;  1V3F A;  1MND A;  3LQR A;  1U3E M;  2FML A;  2O3F A;  4AM3 A;  3S5R A;  2NS0 A;  3PIO F;  2NNY A;  3FRQ A;  1X1C A;  5GAG J;  3S8P A;  2ECB A;  4M6V A;  2JSP A;  3JTG A;  3PFY A;  4ZTF A;  5CQG A;  3HG9 A;  1I6H J;  5HVQ C;  2LF7 A;  1UB9 A;  1NTC A;  3TQN A;  1LPQ A;  1U0J A;  3EUP A;  3KZ9 A;  4U87 A;  1ONV A;  5FLM J;  1LE8 B;  2WC2 A;  2V7F A;  1ZEL A;  2BVL A;  3A01 A;  4LMY A;  3KP6 A;  3SJM A;  3KX2 A;  1KU9 A;  3F8F A;  1Y39 A;  1DP7 P;  2PX9 A;  3H9J A;  3P9I A;  2P8T A;  3VW2 A;  3QPH A;  1VND A;  4LG3 A;  3TP0 A;  4A3F J;  1K4T A;  2LG4 A;  4JX5 A;  4A2U A;  4RM3 A;  3VOD A;  5LHH A;  3I9V 2;  4A3L J;  5LLQ A;  2L9N A;  2R7F A;  4O3M A;  3OL3 A;  3K70 C;  4OD4 A;  2O8X A;  4HZF A;  3K4B A;  5E20 A;  4YRV A;  2Y9Z A;  3GFM A;  3TED A;  3ZQH A;  3K1M A;  3MKL A;  3PSF A;  4D0P A;  5JR3 A;  3Q0W A;  4EAT A;  2OU2 A;  1VQP I;  2QKM B;  3V42 A;  2DLL A;  3JRA A;  2QF7 A;  3JSJ A;  3CCM I;  2Q1Z B;  2DJN A;  3RKX A;  4S0H B;  4GFK A;  4AC6 A;  2JA2 A;  5KNL A;  4LK1 F;  4ZC3 A;  5BOX A;  5DV5 A;  3JRH A;  3O2P E;  2GIZ A;  1O57 A;  4ZZL A;  1K83 J;  5D4R A;  4JBA A;  1P9Q C;  3VVY A;  1R1V A;  1MIJ A;  4ZZD A;  3OYK A;  2K9M A;  1JTX A;  1JKR C;  5FKL A;  1G2H A;  3L00 A;  2KZV A;  3ZMU A;  2JA5 J;  3TO6 A;  3NI7 A;  1MMG A;  1SD7 A;  2Z1D A;  2CSO A;  1QHG A;  1MJB A;  2OZU A;  2VJ4 A;  3ROU A;  4IO9 F;  4C2T A;  1KU2 A;  5ICC A;  4UNO A;  2A6H F;  4BEH A;  4UB6 C;  2KP6 A;  2LH9 A;  2M0C A;  5BQT A;  2CGP A;  3HGG A;  4XLC A;  1SGM A;  5C4Y A;  5TIS C;  4RAY A;  3PUF A;  3KZY A;  4ENJ A;  2DK5 A;  3K4J A;  3GUD A;  3OS2 A;  3GFI A;  2PLY A;  5CJ9 A;  1S5L C;  1U6G A;  1MBJ A;  4IXA A;  3KLN A;  5E3M A;  3MWM A;  2A05 A;  2VXZ A;  3VEP A;  4OIO F;  3OR2 C;  4BU2 A;  2GAU A;  3OYJ A;  1KON A;  4HYE A;  2K7L A;  4BE0 A;  3ZXS A;  4H4K C;  2E7W A;  1P4W A;  1BW6 A;  4PGG A;  3PUB A;  4CCN A;  2Y9Y A;  1IAW A;  2ZME C;  3O8H A;  2XSJ C;  4AYB A;  3ABL H;  4JP0 A;  4OIN F;  1BJZ A;  2KT0 A;  5CVU A;  2KDZ A;  2XRO A;  3WTU C;  2X85 A;  3KYC B;  1TWH J;  3OY9 A;  2IS4 A;  2DQL A;  2CMP A;  2CQK A;  5H2F C;  4XBF A;  5KVR A;  4GFL A;  3SZG A;  1W36 D;  4OIP F;  2IBD A;  5JI6 A;  5HS8 A;  2DCE A;  4XNF A;  1BI0 A;  4J19 A;  2CYY A;  3BG9 A;  1ETQ A;  1SFE A;  3PFI A;  2EZH A;  4L5J A;  5CKT A;  3CCL I;  1TL8 A;  1R22 A;  1XGN A;  4MIM A;  2REK A;  2YS9 A;  1V55 H;  1WCM J;  4GO1 A;  5ILV A;  2ID3 A;  2YX7 A;  2I5U A;  2BEO A;  3CCE I;  2EV0 A;  3HIF A;  1IN4 A;  2A68 F;  4BXX J;  3FXQ A;  2HXI A;  2P5V A;  4RB3 C;  1UJ8 A;  3OOP A;  3PNT A;  5EGO A;  2JK3 A;  3DPU A;  4QIW N;  5BMZ A;  3I0T A;  1QRY A;  3EUK L;  2FBK A;  4B3X A;  1YE9 A;  2VN2 A;  5IOZ A;  4U7B A;  1ZGW A;  3G6E I;  3VVZ A;  2M8E A;  2M8G X;  3F21 A;  5ILU A;  1GVD A;  3VB2 A;  1MDM B;  4L9J A;  3GTQ J;  4V2F A;  3KP7 A;  4EEF G;  1ZRE A;  5GPA A;  1VTN C;  1VQL I;  1WJ5 A;  3IV5 A;  5H6Q A;  2P81 A;  3FK6 A;  3LSG A;  3IKV A;  2EFP A;  2F4I A;  2XDN A;  2VI6 A;  4FHT A;  2LF8 A;  2XF5 A;  2KKO A;  1U9O A;  2EIL H;  4JX6 A;  1IDY A;  3BTJ A;  2VBW A;  1GV2 A;  2FX0 A;  1XX5 A;  2O7T A;  4BJT A;  3CCY A;  2X1E A;  2Y2Z A;  1R5H A;  1EA3 A;  3GLX A;  3TW6 A;  3FWE A;  2L7Z A;  3C2H A;  5E1W A;  4XRS A;  1HSJ A;  5CXG A;  3AQS A;  3D5R C;  4E4H A;  2MGQ A;  4PJL A;  3G73 A;  1STZ A;  3R6S A;  1K7A A;  2E1M C;  3DKW A;  4YG2 F;  4DVY P;  3H36 A;  1TW2 A;  1YW9 A;  2IP2 A;  1T95 A;  3MKZ A;  2LK2 A;  1WSU A;  1SC7 A;  2Y75 A;  4L62 A;  2VOP A;  2ACJ A;  3MQ0 A;  1IXS B;  1YJN I;  4F92 B;  2EA4 A;  3B02 A;  3CF2 A;  2ZY9 A;  4HNV A;  2H8R A;  4M6Y A;  1D1C A;  2QSG X;  5H9T A;  2K9S A;  1GXP A;  2OER A;  3P5J A;  2W4S A;  4H0E A;  2DDB A;  2QWW A;  2XKO A;  3S3O A;  2CFO A;  3IWZ A;  4UV9 A;  4OIQ F;  4P55 A;  5K7H A;  3DFG A;  3WGG A;  3BTC A;  3DTI A;  3F9K A;  2QQ8 A;  2YVE A;  2STW A;  2JVG A;  3OMY A;  1X1B A;  4C3H J;  1F43 A;  1SAU A;  2E5N A;  2MAB A;  4MHG A;  4IX7 A;  2NVT J;  3VOK A;  3HEF A;  3FF5 A;  2RAS A;  3G1M A;  2R7W A;  2XIG A;  3S15 J;  3BPX A;  2RKH A;  2HS5 A;  4LJZ F;  3BZC A;  5DD8 A;  1J75 A;  1KGS A;  1BOA A;  2M9H A;  2HFH A;  1YW7 A;  3WE2 A;  3RZD J;  3LJL A;  3GTP J;  3IRQ A;  4M6X A;  4C2M A;  2ZJR F;  4KMF A;  2MC3 A;  3K6G A;  3LHQ A;  4HEA 2;  2WV1 A;  1XGS A;  4PUS A;  2DT7 B;  2DN0 A;  2EIN H;  4IRI A;  3BCA A;  2VQG A;  2QEX I;  3BG6 A;  4G7Z F;  3OR1 C;  3Q0U A;  2R7Z J;  2FD5 A;  3W2W A;  4BUP A;  5CLS A;  2EV6 A;  1XG1 A;  1T33 A;  4Y7N J;  4PJ0 C;  2X9D A;  1V5F A;  2RQP A;  4N9I A;  1Z7U A;  2ELK A;  1N25 A;  3N05 A;  2E2J J;  3AL0 C;  1JGS A;  4MEX F;  1RC9 A;  1WQ2 A;  1P92 A;  3BTL A;  1D5V A;  2OA4 A;  4HV5 A;  4EMS A;  3HTA A;  4PSW A;  1ZGA A;  2ZCN A;  5D5W B;  4F7Z A;  5AIQ A;  2O0Y A;  5JHF A;  2FMY A;  4EJV A;  4YEJ A;  5ICF A;  1XPX A;  2V4J C;  2XPW A;  1IRX A;  1WH5 A;  4CCJ A;  2Y30 A;  3G56 A;  4N4O B;  3SQN A;  2PMU A;  2GA2 A;  1ZGJ A;  5JFR A;  3P9T A;  1VQ7 I;  5HDK A;  2XV4 S;  1RR8 C;  1B72 B;  1IRZ A;  2ZSH B;  4ZJZ A; 
#chains in the Genus database with same CATH homology
 1UI6 A;  1VF9 A;  3CJD A;  3O60 A;  3OOU A;  2UXO A;  4CYC A;  3NRG A;  2JMW A;  3GTL J;  4KWA A;  4XIC A;  3BTI A;  1P7I A;  2FBQ A;  3GBG A;  2O8K A;  3HOW J;  3G7R A;  1WI3 A;  3GZI A;  4FTH A;  1SAN A;  2N8G A;  3LSR A;  1PUF A;  2HOS A;  4A3J J;  5E3L A;  1RR7 A;  3BR5 A;  2TRT A;  4IHW A;  3HKZ N;  2L0K A;  3HDD A;  2DG8 A;  1Y1V J;  4UUS A;  4QSH A;  3JR9 A;  3CRJ A;  3BR6 A;  2NP5 A;  2IEK A;  2G7G A;  3BG5 A;  5EFY A;  3T6N A;  3K7A J;  1EF4 A;  3B6A A;  1GT0 C;  3M4O J;  3VIB A;  1POG A;  4G12 A;  3BT9 A;  1H89 C;  3UKG A;  1XS9 A;  2M34 A;  4DYQ A;  2OPT A;  3VOX A;  1RKW A;  4L5E A;  3RD3 A;  2D5V A;  2DMP A;  5M5X J;  3G1O A;  4DYR A;  5C3E J;  1R9T J;  4XRM A;  1Z77 A;  4BY7 J;  3GEU A;  4JX4 A;  2H1K A;  1TWF J;  3HTI A;  4ICH A;  5EDN A;  4B4C A;  3BRU A;  5FKM A;  2DTZ A;  4XRS G;  2G7L A;  3RH2 A;  5FMP A;  1APL C;  5HAW A;  1JT0 A;  3HOZ J;  1RKT A;  2XB0 X;  3QBM A;  1UG2 A;  3ANG A;  4I76 A;  3IH4 A;  2CQX A;  4IHY A;  2WGB A;  2K40 A;  1IG7 A;  5IP9 J;  2ZCM A;  2DA1 A;  4MLO A;  2YUS A;  3Q0V A;  4B3A A;  4GCT A;  1UHS A;  2PBX A;  3HE0 A;  3O8G A;  1YRN B;  5BNG A;  4D5C A;  1SFO J;  1JTY A;  4LOC A;  3DPJ A;  1PUF B;  1OFC X;  3CMY A;  2XB5 A;  4FE4 A;  2LR8 A;  5F1J A;  2OI8 A;  1A6I A;  3BQZ A;  2V57 A;  5F0F A;  1BL0 A;  3JRB A;  1JGG A;  1DU6 A;  1A5J A;  5FHP A;  3MN2 A;  4AYB N;  2AHQ A;  1JJ6 C;  4GCK A;  3C2B A;  2JWT A;  3OSF A;  2HDD A;  3LWJ A;  3H3V K;  4GCL A;  3G1L A;  1WH7 A;  5IP7 J;  3JRE A;  2JA7 J;  2EZI A;  2DMN A;  2EH3 A;  2NVY J;  2VUM J;  3PO3 J;  1ZK8 A;  3S2D J;  2DA4 A;  3BR3 A;  2DMU A;  1P7J A;  4IEJ A;  2MG4 A;  2XRL A;  3FIW A;  3NAR A;  3QPL A;  4HKU A;  1QPI A;  5FGL A;  2DA5 A;  4C3I J;  4MFD A;  1W0U A;  5D1R A;  2K9Q A;  3ANP A;  3TP3 A;  1FTT A;  2MW8 A;  3LSP A;  2QWT A;  2QKO A;  3W6V A;  2LFB A;  2XPU A;  3GTO J;  1W0T A;  3LNQ A;  1BA5 A;  2JJ7 A;  2ZOY A;  2DMQ A;  3RQI A;  2WUI A;  3BCG A;  5JLX A;  1F36 A;  2GEN A;  5J1R A;  2UXP A;  1LE8 A;  3I4M J;  4M3D A;  2R0Q C;  4BY1 J;  3VVX A;  4FIS A;  4A3K J;  4M3B A;  3M3Y J;  1ETK A;  2CUF A;  2R92 J;  3JRC A;  2DA7 A;  5GPC A;  5M3F J;  3HOX J;  3DCF A;  3WHB A;  5DTD A;  5EG0 A;  3BHQ A;  4MO7 A;  5IPA A;  5EGO B;  4I6Z A;  2E1O A;  2R5Y B;  1MNM C;  4A3G J;  5F08 A;  3OSG A;  4A69 C;  1I50 J;  5K7Z A;  2X48 A;  1NK2 P;  4D5F A;  4DZP A;  1RPW A;  2TCT A;  4FE7 A;  3HTJ A;  4CYC B;  2F07 A;  5IYC J;  1LFU P;  2NS7 A;  2FJ1 A;  1ZTR A;  4RDU A;  1QVU A;  2AO9 A;  4BBS J;  4M3F A;  3SDG A;  4DYC A;  3NPI A;  3C07 A;  2HXO A;  4DZJ A;  1D5Y A;  2UXI A;  2CU7 A;  1ZR4 A;  2XPV A;  3S5R A;  3FRQ A;  5J3L A;  1RES A;  2ECB A;  4M6V A;  1I6H J;  1JKP C;  4A3B J;  2W48 A;  1QVT A;  1MBH A;  3HM5 A;  1YRN A;  1NTC A;  3BG3 A;  1ORK A;  3EUP A;  1JT6 A;  3KZ9 A;  2JA6 J;  5J1U A;  5FLM J;  3BNI A;  2FQ4 A;  1LE8 B;  1X2M A;  2R5Z A;  1T56 A;  3A01 A;  2GLO A;  4M3G A;  3SJM A;  1WGX A;  1VFC A;  1IGN A;  3PO2 J;  4W97 A;  3VW2 A;  3RZO J;  1VND A;  2IAI A;  3B81 A;  3TP0 A;  3WHC A;  4A3F J;  4FCY A;  4JX5 A;  2RAE A;  3TW7 A;  3HB9 A;  3BQY A;  4C3J J;  4JNN A;  2D6Y A;  2JA8 J;  4A3L J;  4X1E A;  5E3N A;  4IHV A;  1E3O C;  2W53 A;  3FIS A;  2Y9Z A;  2GFN A;  2QOP A;  1JUP A;  1AHD P;  5DAJ A;  3TED A;  2XGC A;  3ZQH A;  3MKL A;  2E19 A;  3Q0W A;  5EF6 A;  2NVQ J;  1IUF A;  3JRA A;  2QF7 A;  3JSJ A;  4XID A;  2G7S A;  5JLW A;  3VUQ A;  2DJN A;  4NEL A;  4ACI A;  4S0H B;  3ZQI A;  3I4N J;  4GFK A;  4AC6 A;  1IC8 A;  4UUT A;  2WAQ N;  3FK7 A;  4A3I J;  3CWR A;  3JRH A;  3S16 J;  5HSZ A;  3BR2 A;  2YU9 J;  4ME9 A;  4D7N A;  1K83 J;  1VI0 A;  5M5W J;  1H8A C;  3ON4 A;  3VVY A;  4MFE A;  2HKU A;  5IYD J;  1JTX A;  1JKR C;  5FKL A;  1G2H A;  3V78 A;  3Q3S A;  1FIA A;  2CQQ A;  3PM1 A;  4RBO A;  1ETW A;  5EG0 B;  2JA5 J;  2XSD C;  3NI7 A;  3S1R J;  1ETO A;  3GTG J;  3HGY A;  4A3C J;  2QTQ A;  5C4X J;  3A01 B;  3B6C A;  1B8I A;  1LFB A;  2G3B A;  2UXH A;  3S1M J;  3JRI A;  2GBY A;  2CUE A;  2L9R A;  2M0C A;  4M3E A;  2LKX A;  2OF7 A;  1FTZ A;  3HGG A;  2RHA A;  1SGM A;  5C4Y A;  5HBU A;  3COL A;  2M2E A;  5FKN A;  3KKD A;  1MBE A;  2ZB9 A;  2R93 J;  1DU0 A;  1MBJ A;  3ZQL A;  5E3M A;  3ZQF A;  3JRF A;  2MSY A;  5C4J J;  1ETV A;  5EZG A;  3BR1 A;  2ZOZ A;  3F0C A;  2HOT A;  5FJ8 J;  3HTH A;  1NK3 P;  2O7O A;  1TWG J;  5F0C A;  3S14 J;  1GV5 A;  1BW6 A;  2PZ9 A;  3VW0 A;  2Y9Y A;  1HF0 A;  5CXI A;  2JN6 A;  5CW8 A;  4NN1 A;  4X6A J;  3O8H A;  2HQ5 A;  4A3D J;  1JJ8 C;  4JL3 A;  3D1N I;  3KKC A;  2EQR A;  2EZK A;  2EZL A;  1BJZ A;  2KT0 A;  4JP0 A;  2ME6 A;  2KDZ A;  1TC3 C;  1TWH J;  3ZQG A;  4XK4 A;  1GUU A;  2LTP A;  2O9L A;  3H0G J;  1H88 C;  3ON2 A;  3A02 A;  4GFL A;  3V6G A;  2LD5 A;  2IBD A;  5M3M J;  2LLK A;  4C2M J;  4A3M J;  3HBL A;  4J19 A;  2Q24 A;  3BG9 A;  1ETQ A;  5M5Y J;  3PAS A;  1MBG A;  2EZH A;  4PXI A;  4MIM A;  2REK A;  2YS9 A;  2NVX J;  1AKH B;  3QKX A;  1WCM J;  2G0E A;  1OCP A;  2I10 A;  5K58 A;  2Y0S N;  2ID3 A;  3HOV J;  2DMT A;  3VW1 A;  5FKK A;  5F0H A;  2VKE A;  4BXX J;  1IV6 A;  3EGQ A;  1MH4 A;  2HXI A;  5FLV A;  5EGO A;  2Y31 A;  2JK3 A;  4QIW N;  4V2G A;  4A3E J;  3NAU A;  2NS8 A;  1QRY A;  3S1N J;  5DS9 A;  5IOZ A;  3A03 A;  1ZGW A;  1MH3 A;  3CQZ J;  1FIP A;  3VVZ A;  2M8G X;  1MBF A;  4ABZ A;  1JUM A;  1TWC J;  1GVD A;  2K9N A;  3F1B A;  2UXU A;  3GTQ J;  4V2F A;  3CDL A;  4EEF G;  3RKQ A;  5GPA A;  4QTR A;  3IV5 A;  2P81 A;  3FK6 A;  3LSG A;  5FKO A;  1BW5 A;  2XDN A;  2VI6 A;  1UMQ A;  1MSE C;  3MNL A;  2LY9 A;  1JUS A;  1ZKG A;  2YVH A;  4JX6 A;  1U9O A;  2COB A;  1U78 A;  2NX4 A;  1IDY A;  3BTJ A;  1GV2 A;  2E2H J;  2VPR A;  2FX0 A;  4DW6 A;  3MVP A;  2O7T A;  3CCY A;  1IDZ A;  2Y2Z A;  1UI5 A;  1TWA J;  4NDL A;  3HOY J;  2HYT A;  3TW6 A;  3ZQC A;  3S17 J;  2L7Z A;  3HIM A;  1X58 A;  1AU7 A;  3S2H J;  3GTJ J;  4CGR A;  4XRS A;  1I3Q J;  3E7L A;  5EYR A;  5F04 A;  5EZH A;  3AQS A;  3IUV A;  1S7E A;  2MGQ A;  5E3O A;  5CXG A;  2WB1 N;  5D19 A;  4BKX A;  4W1U A;  1O4X A;  2IU5 A;  2ID6 A;  2PMZ N;  1GDT A;  4B1R A;  3QPS A;  5J1Y A;  3KNW A;  1B72 A;  2DA6 A;  2ECC A;  1HDD C;  1HOM A;  2LK2 A;  1FEX A;  3OIO A;  4AUX A;  3BR0 A;  4AF5 A;  4L62 A;  2B63 J;  5EEA A;  5AQC A;  2VKV A;  2EBI A;  5IOY A;  1ENH A;  4HNV A;  2H8R A;  2DG7 A;  2NOG A;  5H9T A;  5C44 J;  3E7Q A;  2K9S A;  2OER A;  3DEW A;  4MXM A;  1OJL A;  3JRD A;  3BJB A;  1IJW C;  5K7H A;  1AKH A;  4JYK A;  2XGE A;  5HOD A;  3GTM J;  3BTC A;  1Q1V A;  1JKQ C;  2YVE A;  2CJJ A;  5K7F A;  4C3H J;  1F43 A;  4BBR J;  3JRG A;  4AC0 A;  3VOK A;  2NVT J;  1U9N A;  3HEF A;  2RAS A;  3G1M A;  1HLV A;  2ZCX A;  4JKZ A;  3FKI J;  3S15 J;  2GUH A;  3AQT A;  2LVS A;  2ME0 A;  2M9H A;  3LJL A;  3RZD J;  3NNR A;  3HOU J;  2HYJ A;  2L7M P;  3GTP J;  1ZR2 A;  2XGD A;  4GFB A;  4YZE A;  2R5Z B;  1ETY A;  1Z0X A;  2LP0 A;  3VP5 A;  3LHQ A;  9ANT A;  2WV1 A;  1HCR A;  1B8I B;  1JKO C;  3ZOB A;  4UDS A;  4UUS B;  2DN0 A;  5IYB J;  2DA3 A;  3LOC A;  2L7F P;  3Q0U A;  1CQT A;  2R7Z J;  2FD5 A;  1U8B A;  1HDP A;  2X6O A;  4Y7N J;  1XG1 A;  1T33 A;  3IH2 A;  1K61 A;  2QCO A;  2X9D A;  5IP6 A;  2HI3 A;  3K2A A;  1WPK A;  1ETX A;  1FJL A;  2ELK A;  2DA2 A;  2E2J J;  3SFI A;  2GM4 A;  2HOA A;  3S1Q J;  5F27 A;  4A93 J;  3BTL A;  1Y1W J;  4MK6 A;  2NP3 A;  1RET A;  1ZQ3 P;  3LSJ A;  4IHX A;  3HTA A;  3VPR A;  2ZCN A;  3L1P A;  3NXC A;  3GTK J;  4Y52 J;  2CRG A;  3PPB A;  2E2I J;  2XPW A;  1WH5 A;  2Y30 A;  1MSF C;  3G56 A;  5D18 A;  2R5Y A;  1OCT C;  3IH3 A;  3QQA A;  1MBK A;  3P9T A;  4D7M A;  1ITY A;  1XC5 A;  1B72 B;  1IRZ A;  1X2N A;  5GP9 A;  2QIB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...