1JTXA

Crystal structure of the multidrug binding transcriptional regulator qacr bound to crystal violet
Total Genus 72
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
72
sequence length
186
structure length
186
Chain Sequence
b'NLKDKILGVAKELFIKNGYNATTTGEIVKLSESSKGNLYYHFKTKENLFLEILNIEESKWQEQWKKEQIKAKTNREKFYLYNELSLTTEYYYPLQNAIIEFYTEYYKTNSINEKMNKLENKYIDAYHVIFKEGNLNGEWSINDVNAVSKIAANAVNGIVTFTHEQNINERIKLMNKFSQIFLNGLS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HYPOTHETICAL TRANSCRIPTIONAL REGULATOR IN QACA 5'REGION
publication title Structural mechanisms of QacR induction and multidrug recognition.
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Transcription
total genus 72
structure length 186
sequence length 186
chains with identical sequence B, D, E
ec nomenclature
pdb deposition date 2001-08-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00440 TetR_N Bacterial regulatory proteins, tetR family
A PF08360 TetR_C_5 QacR-like protein, C-terminal region
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 1jtxA01
1.10.357.10 Mainly Alpha Orthogonal Bundle Tetracycline Repressor; domain 2 Tetracycline Repressor, domain 2 1jtxA02
2QKOA 3B6AA 1JUMA 3NPIA 2LVSA 2ECBA 4DZJA 3NI7A 2EQRA 1IJWC 3FRQA 3IH4A 2RHAA 2E2JJ 4BBRJ 1BL0A 3A03A 1RETA 3HGYA 1GV5A 2PMZN 3TW6A 3GTJJ 5IPAA 3F1BA 3V6GA 5F08A 4A3DJ 1ETWA 3BHQA 1GDTA 4GFBA 2REKA 1A6IA 1EF4A 5F0HA 3HOZJ 2JA8J 2NVQJ 3BQZA 3KKCA 4A3KJ 2O9LA 4YZEA 4A3LJ 2DA4A 3QBMA 1SFOJ 4JX4A 4A3EJ 3MKLA 1UG2A 2CJJA 2CUFA 1ZQ3P 3GTLJ 2ZCXA 3VPRA 4RDUA 5HAWA 4AC0A 4V2GA 2Y0SN 5K7ZA 3ON4A 5J1RA 2XB5A 3FK6A 2R0QC 4GCKA 4BBSJ 4GCTA 1QVUA 5FJ8J 4FTHA 1JKRC 2WUIA 2IU5A 2NP5A 3GTKJ 4M6VA 3LOCA 5EFYA 2VUMJ 2EH3A 2JA6J 3HB9A 5E3NA 3RZDJ 1JTXA 1U9NA 2K9NA 3L1PA 3KNWA 3HEFA 2M34A 1MSEC 2OF7A 2N8GA 1JKPC 3HKZN 2KT0A 3CCYA 5EGOB 1OCTC 3RZOJ 1UI6A 2VI6A 1FIAA 5F04A 5IYBJ 5IP9J 2LD5A 2LK2A 3PO3J 3GZIA 4JNNA 4NDLA 3CRJA 4FE4A 2NX4A 2NP3A 1JT0A 3G1MA 3ON2A 2R93J 3G56A 2VKVA 2EZLA 3AQTA 2HXIA 2E19A 3HOYJ 2GUHA 3Q0UA 3FIWA 4X6AJ 1UMQA 3BTCA 2XGCA 5D19A 3MN2A 1ETXA 3BR0A 5IYCJ 2K9QA 1ETOA 1XG1A 2DA5A 2K9SA 2HKUA 3HE0A 3S2DJ 4M3GA 1BJZA 5JLWA 1F43A 4MK6A 3FK7A 1D5YA 2G7SA 4MLOA 3SFIA 2QCOA 5IP6A 2Y30A 2ME0A 3GTOJ 3NAUA 5DAJA 3D1NI 5FMPA 2HYTA 1B72B 2AHQA 1ZR4A 1RKTA 5DTDA 3VVXA 3AQSA 2Q24A 5M3FJ 3RKQA 4JKZA 2JWTA 4NN1A 1LFBA 2O7TA 2M2EA 2IBDA 4M3DA 1Z0XA 1MBHA 2CQQA 5F27A 1ZKGA 3A01B 1O4XA 2NVTJ 2EZHA 1DU6A 2OI8A 1P7JA 1ZGWA 1WH5A 4D7NA 2DJNA 2MSYA 3JSJA 4AUXA 3PO2J 2L7FP 2QIBA 4Y52J 2HOAA 3BR6A 1POGA 3S1QJ 2ELKA 1MBEA 3P9TA 3E7LA 3ZQFA 1HF0A 4ACIA 5FLVA 4MFEA 1JKOC 5EG0B 2FBQA 5DS9A 3T6NA 3NARA 2AO9A 1APLC 2YUSA 3S14J 1Z77A 5FKNA 1JGGA 5FLMJ 3TW7A 5K7HA 2M9HA 3HOXJ 1B72A 2HYJA 3B6CA 2R5ZB 1ETYA 3CDLA 3ZQLA 4ME9A 3Q3SA 3VP5A 2ID6A 2XB0X 1HDDC 3JRDA 1HCRA 4UUSA 3PASA 3ZQIA 2IAIA 3O8GA 3HOWJ 2QTQA 1FIPA 4A69C 2UXHA 2ZCNA 4QSHA 2OERA 2MG4A 3JRCA 2HOTA 3FKIJ 5CXGA 2LFBA 4G12A 4LOCA 4MO7A 1VF9A 3WHCA 5F1JA 3GTMJ 3NNRA 5D18A 3W6VA 3UKGA 3MNLA 1R9TJ 1GT0C 1FTTA 1U8BA 1UI5A 3S5RA 1H8AC 1PUFA 1FTZA 2D6YA 1RKWA 4IHYA 2LLKA 4D5CA 1T56A 5FKKA 2R7ZJ 4CYCB 4A3FJ 3LSPA 2DMQA 3ANGA 1AKHB 4A3GJ 1MH3A 4C3HJ 3JRGA 2GM4A 4C2MJ 2R5ZA 2R5YB 3M3YJ 1TWGJ 2DA7A 5FKLA 3BTLA 5E3LA 5GPCA 1LFUP 3G1OA 1JUPA 2P81A 3EGQA 2VKEA 3CMYA 1WCMJ 2XPWA 1HLVA 3HTIA 5BNGA 1OFCX 3ZOBA 1NK3P 4JP0A 2ZOZA 3NRGA 1ENHA 5F0CA 2NOGA 3HDDA 2M8GX 1TC3C 2Y9ZA 2FJ1A 4JL3A 3BT9A 3BTJA 1MH4A 2QF7A 2COBA 2L0KA 1U78A 2O8KA 2QWTA 2LKXA 2DA3A 3IV5A 4BY7J 1MSFC 4I6ZA 2OPTA 5C4JJ 1JUSA 2DMTA 4C3IJ 2ECCA 5IP7J 3HIMA 1A5JA 2LY9A 3BRUA 5M5XJ 3OSFA 2R5YA 3HTJA 2CU7A 2GBYA 2G7GA 2K40A 1QRYA 4BKXA 2DMPA 4W97A 5CXIA 2L7MP 1MNMC 1FEXA 2XRLA 1K61A 3GEUA 1TWFJ 1ETVA 4ICHA 1GV2A 3TP0A 5CW8A 2RAEA 5EEAA 1AU7A 1I3QJ 3S17J 2ZOYA 5JLXA 2LP0A 2CUEA 4A3BJ 3LNQA 5EF6A 2HXOA 1B8IB 4IHVA 1X58A 5F0FA 1JJ8C 1ETQA 2CQXA 3VUQA 1MBFA 3VVZA 1TWCJ 1WH7A 4CGRA 3K2AA 1Y1VJ 1Q1VA 3PM1A 5EGOA 3LSGA 2X48A 2GFNA 3O60A 3LHQA 2YS9A 3IH2A 3RH2A 3JRFA 1CQTA 3LJLA 3DEWA 5HSZA 3GBGA 3LSJA 1MBGA 4M3FA 3DCFA 3HGGA 5M5WJ 1IDYA 1GUUA 3DPJA 1JTYA 3CQZJ 2JMWA 3I4NJ 3MVPA 5HBUA 1P7IA 4UUTA 1NK2P 2FQ4A 3BTIA 1XC5A 1WGXA 4C3JJ 3BCGA 2B63J 3JRAA 3PPBA 2HI3A 3IUVA 2TCTA 5K7FA 3HM5A 4XIDA 2EBIA 4L5EA 4A93J 2XSDC 3BR2A 2WGBA 4J19A 1XS9A 5C44J 5IOYA 2DA2A 1YRNB 4FISA 2ZB9A 2JA7J 2JN6A 4XRSG 4GFLA 1G2HA 1RR7A 1MBKA 2WV1A 2XPVA 3A01A 3TP3A 2H1KA 3G7RA 4XK4A 2ID3A 1I6HJ 4UDSA 5D1RA 1RPWA 2MGQA 2WB1N 4DW6A 1X2NA 5K58A 5EDNA 4MIMA 5FHPA 3VIBA 2E2IJ 2DG8A 4DYRA 2FX0A 5EG0A 3S15J 3GTGJ 4AF5A 2H8RA 2WAQN 4JYKA 3BR3A 3VW1A 4A3JJ 1OJLA 2G7LA 3HOVJ 1Y1WJ 3OOUA 3ZQHA 2NVXJ 4RBOA 4M3EA 2DTZA 3S16J 1LE8B 2G3BA 4S0HB 3LSRA 3V78A 5EZHA 5E3MA 2XGEA 3O8HA 4IHWA 2XDNA 4AC6A 3GTPJ 2HDDA 4FE7A 3ZQGA 1IRZA 4A3MJ 4D7MA 3OSGA 4JX5A 1VFCA 3WHBA 4BY1J 4I76A 1TWHJ 3BG9A 4IHXA 1IC8A 4ABZA 1X2MA 2YVEA 2LTPA 3BR5A 3NXCA 2JA5J 3HOUJ 3M4OJ 4D5FA 1BW5A 5FGLA 2CRGA 3Q0WA 5EYRA 5GP9A 3OIOA 4L62A 1HDPA 4A3CJ 1E3OC 1JT6A 2Y9YA 1VI0A 4AYBN 1IGNA 5IOZA 3ANPA 1FJLA 4Y7NJ 1TWAJ 3BG5A 4CYCA 2HQ5A 1DU0A 2UXUA 2NS8A 4HKUA 4NELA 3Q0VA 2E2HJ 2NS7A 2JJ7A 1AKHA 2L9RA 4MFDA 3SJMA 2GLOA 3GTQJ 2IEKA 3TEDA 2DMUA 1IV6A 1LE8A 3I4MJ 1F36A 4DYQA 1WPKA 2EZKA 3QQAA 2E1OA 2MW8A 3ZQCA 2PBXA 3KZ9A 5C3EJ 5J1YA 2RASA 4GCLA 2ZCMA 4XRMA 4EEFG 2XGDA 3LWJA 4XRSA 3H0GJ 3S2HJ 3VVYA 2KDZA 3H3VK 2O7OA 3RQIA 1S7EA 4KWAA 1OCPA 1W0TA 4HNVA 2F07A 1ZK8A 3B81A 3S1MJ 1I50J 2DG7A 3JRIA 5J1UA 1SGMA 1HOMA 2YVHA 1ZR2A 2TRTA 2W53A 2NVYJ 1BA5A 5H9TA 2DN0A 2GENA 1IDZA 1UHSA 3A02A 1JJ6C 3QPSA 5FKMA 2PZ9A 1RESA 3BJBA 2FD5A 2UXIA 1MBJA 3C07A 2V57A 4M3BA 4DYCA 5M5YJ 4X1EA 5C4XJ 4BXXJ 4A3IJ 4GFKA 2R92J 3KKDA 3CWRA 2I10A 5J3LA 5C4YA 2X9DA 1W0UA 4IEJA 3JRHA 3VOXA 3VW2A 1IUFA 2DMNA 1B8IA 2UXOA 1GVDA 3C2BA 3F0CA 4JX6A 1ORKA 5M3MJ 4UUSB 3CJDA 3JREA 2DA6A 2LR8A 5HODA 2HOSA 3BNIA 3BG3A 2ME6A 1VNDA 1U9OA 2G0EA 2XPUA 2X6OA 5FKOA 2Y31A 4QIWN 1ETKA 4XICA 3BR1A 1K83J 4B3AA 2EZIA 1BW6A 3K7AJ 5E3OA 5GPAA 3SDGA 1QVTA 2L7ZA 3RD3A 1T33A 5IYDJ 1PUFB 4B1RA 3VW0A 2DA1A 3JRBA 3S1NJ 2UXPA 5AQCA 1ITYA 4W1UA 2W48A 5EZGA 3BQYA 3G1LA 4B4CA 1H89C 1SANA 2Y2ZA 4FCYA 4DZPA 1H88C 3QKXA 4QTRA 3JR9A 3QPLA 1ZTRA 3HBLA 2D5VA 3E7QA 1NTCA 3IH3A 3VOKA 2VPRA 2QOPA 1JKQC 4MXMA 1QPIA 4V2FA 4PXIA 2JK3A 3FISA 3EUPA 2YU9J 3HTAA 1WI3A 3HTHA 9ANTA 1AHDP 3COLA 1IG7A 2M0CA 1YRNA 3S1RJ
chains in the Genus database with same CATH superfamily
5HS8A 5D5XB 3EUKL 2L9SA 2W00A 5ILSA 1IN4A 2ZSHB 3AG4H 3FMQA 4AM3A 2QBYA 2PEXA 3IH4A 3QODA 4BBRJ 1BL0A 3CMAI 1PYVA 2VBZA 3I5UA 4A3DJ 5L3CA 2X4HA 1GDTA 2REKA 2Y0MA 5F0HA 5CVUA 3DEEA 3VYSB 2M45A 2D45A 3BQZA 3QPHA 3KKCA 2O9LA 4IZZA 4A3LJ 4XORA 3RDIA 3NS4A 3DXJF 1DP7P 3EUHC 4LGWA 4JX4A 3EPZA 2CJJA 2CUFA 5B66C 1SD5A 1RUNA 4AIJA 4OINF 2A6HF 3WTUC 5HAWA 5LHGA 5LRSA 2R7OA 1VQPI 3FXRA 3EYIA 4A2UA 4B43A 4GCTA 4ZTFA 1Z6TA 4LMYA 4WXHA 1JKRC 3KEYA 1ZG3A 2LY1A 3GTKJ 5CPRB 3J80K 4AIHA 1G3YA 3FBIB 3HB9A 3PQKA 5E3NA 4WWCA 1OMIA 5BOXA 1JTXA 1IW7F 3KNWA 1T98A 2WTEA 2RDPA 2N8GA 1FZPB 3L2QA 2JZYA 5ICGA 2E7WA 1OCTC 2VODA 3RZOJ 1UI6A 3E0JB 2CSOA 2QKMB 1FIAA 3PUFA 5F04A 3K0LA 1LVKA 3CP8A 5IP9J 4KMFA 2LK2A 4F3QA 3JSPA 3E5QA 1XMAA 3CRJA 2R4GA 1HW1A 2M3AA 4KITB 2QEXI 2R93J 3G56A 1P6RA 2EZLA 2HNHA 3BTCA 4BUPA 3MN2A 2ISYA 3BR0A 5GADJ 4PJJA 4EM1A 3M8FA 2X6XA 3T8TA 4DBRA 3S2DJ 4M3GA 2XAUA 3FK7A 2G7SA 1KGSA 4MLOA 3RI4A 2QCOA 3NAUA 2UXXA 3D1NI 3CCJI 5FMPA 3MKWB 4EJOA 3OYDA 1ZR4A 3S8PA 4IF4A 3HHGA 2JWTA 2HEOA 2MA3A 1LFBA 2O7TA 2M2EA 2HR3A 1ZGJA 1P7JA 3ZGKA 4D7NA 3MZHA 2DJNA 1VQKI 1LJ9A 4AUXA 4PK4A 2HKOA 4XKWA 3VEPA 1RI7A 3LSHA 4NC6A 3CCVI 1ZRDA 2BY0A 2R7SA 2HOAA 3BR6A 1POGA 1HBXG 1J75A 2ELKA 1RC9A 2YPRA 3KP7A 3MD2A 1P4AA 1HF0A 3V7CA 1Z7LA 4MFEA 1JKOC 1UELB 5E1WA 2ZNYA 5K5QA 1YQAA 2KRFA 3PIOF 5J4VA 2XC7A 3T6NA 2YUSA 3TDZC 3QPTA 2DT6A 3DU5A 2CW7A 1JGGA 4HSTA 2FE3A 2XSJC 1BBYA 1D1CA 4IQ4A 2HYJA 3I56I 2CO5A 2GIVA 4ME9A 3ZQLA 2GOXB 2YU3A 3KYLA 2P0WA 3OR1C 3PASA 2KPMA 2IAIA 4F93B 2UZKA 3TOBA 1J09A 3VSLA 3ZMSA 2ZCNA 3FKIJ 2LFBA 2EIMH 4OU0A 4MO7A 3RYPA 2LREA 3K1NA 2W57A 5D18A 3W6VA 3UKGA 3MNLA 1S9HA 4ZYDA 1R9TJ 1FTTA 1H8AC 1FTZA 1S6LA 3DKXA 1XX5A 1OCOH 3WTXC 4CYDA 2O6GE 2LLKA 1OPCA 4LK1F 2VC1A 4NC8A 3QWLA 2VBWA 3DEUA 5DD4A 5D8LB 2HQNA 1FSEA 2ZJ2A 3H36A 2V1UA 5EJCA 1WJ5A 3R0AA 4A3GJ 1S29A 3JRGA 3M3YJ 2G7GA 3E1SA 3FHZA 2W53A 1TWGJ 5FKLA 2XKOA 3G1OA 2DK8A 5HOOA 3C2HA 3O3KA 4BYYA 4XN3A 2L4MA 3F22A 1USTA 1UG0A 2XPWA 2KLOA 4F7ZA 1NK3P 1SEUA 1D1BA 2B0LA 4JP0A 2QENA 1SD6A 1REPC 2B3WA 1SMYF 4NC7A 1FYLA 4AD9A 1TL8A 3BT9A 2PFBA 1MH4A 2O8KA 2FNAA 1XSVA 2CMPA 2QWTA 1LFPA 2KIFA 2DA3A 1Z7UA 1EH8A 4CO8A 1ZRFA 5AONA 4I6ZA 5IP7J 3FXKA 3W6KB 4HDVA 2M30A 5M5XJ 3CCLI 4BXUA 3OSFA 1D0XA 3D5SC 1LEBA 1HA8A 2VASA 1W4MA 3N97A 2Q2EA 4BS9A 2GA2A 2L54A 4GRIA 2PFVA 1F5TA 2E34A 4HDUA 2HU9A 1IRGA 2XRLA 4ICHA 2OQRA 1TWFJ 1OYIA 3PNVA 1Z3YA 3PUBA 1UAAA 4OD5A 3D0SA 2QM3A 4N0BA 1BJAA 1Y56A 1ZRCA 1XMXA 1R58A 1IF1A 4A3BJ 2STTA 1YS6A 5EF6A 5FO5A 1GXQA 3BROA 1ZH5A 3E3VA 3IWFA 3ECHA 4ESFA 3VVZA 3VUQA 3K2AA 2YX4A 1IAWA 5EGOA 3PM1A 2X48A 1W5CC 4MTDA 4EV0A 3O60A 3LHQA 2OCEA 2KRHA 3A1YA 5B1AH 3DEWA 3GFJA 1EH7A 1H9GA 4CCMA 1QHGA 4ZYHA 3LSJA 1MBGA 3LQQA 4LITA 2EIKH 2BW3B 2W4SA 3KYDB 3NEUA 3TO7A 5M5WJ 1GUUA 2M1BA 3ML6A 4WXDA 4Q48A 5IT9Z 3MVPA 1P7IA 3DTIA 2VPLA 4LB5A 3TO6A 1WSUA 2IT0A 2LKPA 2PJRA 4RAGA 4XLCA 1ZLKA 2V1DA 4ANJA 3HRUA 1M1EB 5K7FA 4XIDA 1FYKA 1WRJA 1HSTA 3BR2A 2XASA 2RNGA 3GFLA 5D4SA 2EV5A 3M7GA 3QU3A 3OL4A 3HTSB 3A0HC 2ZB9A 2A6EF 4XRSG 3SXYA 3IKVA 1G2HA 5D5WB 2WV1A 3A01A 3G7RA 1DQUA 2KIUA 4WXCA 2MH2A 1SAXA 1O7LA 1PDNC 3L2VA 2HTSA 3RTRA 1O3RA 3ZP5A 2DQLA 4OAYA 3O6BB 1G4DA 1GHCA 3ZN1A 2IGOA 1WJBA 3VIBA 2Z1DA 2DG8A 1YX3A 3JTHA 3CUQB 3ZCOA 2H94A 4UXNA 4P96A 5EG0A 3G73A 3GTGJ 4AIKA 1J9IA 1P2FA 3BR3A 4IQJA 1C0WA 3PFYA 4A3JJ 2MC3A 2ZBKA 1VQ6I 2G7LA 3WTSC 2PQ8A 2BEOA 2J5PA 4RBOA 4UHTA 1V5EA 4M71A 1X1BA 3DKWA 3LMMA 1KA8A 2O3FA 3LSRA 5EZHA 3GCMA 4CICA 3SFZA 1I39A 2XGEA 4IHTA 4IHWA 4EGZA 3GUDA 5FLXK 4A3MJ 2B9SA 3H35A 2E7XA 4JX5A 3SQNA 2H27A 2XUBA 1P92A 2W85A 4BY1J 1CF7A 1YHQI 4I76A 1TWHJ 1IC8A 3ECOA 2GZWA 1NHAA 4G6TB 2LTPA 2V1XA 2M7BA 3FXMA 1T2KA 1BW5A 5FGLA 3E5XA 5E17F 5EYRA 4IRIA 2A05A 2A2FX 3GMEA 3F6OA 1FYMA 4AYBN 3RYRA 4HF0A 3CP2A 1DU0A 2UXUA 2E2HJ 4U9NA 1SAUA 1XD7A 2JJ7A 3IRRA 2IW5A 4MFDA 3SJMA 4LFUA 3EQLF 2K3FA 1AOYA 3F8MA 2NXNB 4UVAA 1BOBA 3I4MJ 1F36A 4IHSA 1QZZA 1KQ9A 3QQAA 2V9KA 3S3MA 1MMDA 3WTZA 4D9JA 1MNEA 5J1YA 2RASA 3CC4I 5F1RA 2ZCMA 4EEFG 4XKBA 2HOEA 5A2QK 3I54A 3I64A 2KIMA 4XKCA 1R5GA 3WU2C 4HNVA 3B81A 1I50J 3X2QH 4HF1A 4ZH4F 2YVHA 4L9NA 4RGUA 1XSDA 3PQJA 1FOYA 2HDWA 2DN0A 4EM2A 3V8KA 3BJBA 3QPSA 5FKMA 3B73A 4IVNA 4MQVA 2UXIA 3C07A 2V57A 5LHIA 1Y8RB 2BY2A 4P5OA 1F9NA 2DODA 1Z6RA 2A3SA 4DYCA 1K78A 4EJUA 5DYMA 4BXXJ 4A3IJ 3RKXA 1G6NA 3C1DA 3M9AA 3K69A 4R79A 4OIRF 1R5HA 3AKZA 4I02A 4C30A 1MKMA 4IEJA 1NG6A 2ZSIB 2DMNA 4H0EA 3WGIA 3EUHA 1A36A 1XSXA 2GXGA 1FBUA 1GVDA 1MW7A 2L9NA 3F0CA 4JX6A 5HS9A 3T0YA 4FQGA 5M3MJ 1D3YA 3JREA 1Y39A 1AA7A 2HOSA 3VSKA 1BR1A 3IKTA 2OQGA 1Z67A 2XPUA 3KEQA 2Q8KA 3JW4A 3OL3A 4ZZLA 3BR1A 3SHFA 4HZFA 2V79A 2EZIA 2VBXA 3K7AJ 2ZMEA 3CJTB 5GPAA 4Y13A 2BE5F 4OAZA 4PCQA 3M07A 2DPUA 5BMZA 2KRCA 1S72I 4CGZA 4XL9A 3ABTA 4OIQF 2UXPA 5E8GA 4WK8F 6PAXA 1IZ1A 1Y6IA 2DBBA 1Q1HA 2HWVA 4B4CA 1H89C 1W5TA 3S3NA 4P1WA 2VC0A 3R4KA 5DEQA 2Y2ZA 2NNYA 5ILUA 4FCYA 3QKXA 4QTRA 1MMNA 4NHJA 1R5ID 1Z3XA 1KQ0A 4UUVA 3HBLA 3E7QA 3VOKA 4HX4A 3HSRA 2QOPA 1HW2A 3DP7A 4HPQA 4MGRA 3QOPA 3HTAA 1LDKB 2ZKZA 4G6QA 4KISA 3TBIA 3COLA 4A5MA 2QSFX 2V9VA 4DYRA 1W1WE 4FT8A 3S1RJ 1TQMA 1TBXA 3B6AA 1JUMA 3FF5A 5GAGJ 1VQ5I 2QSGX 3NI7A 3KZZA 2Q0OA 1U8RA 1IJWC 5CJ9A 2RHAA 3A2KA 3A03A 4L9JA 2L2OA 1GV5A 3TW6A 3F1BA 1X4PA 1OQYA 1B59A 4ON0A 3C3WA 2FBIA 4NNJA 4E7JA 4GFBA 3JCUC 3I59A 1LDJA 4V19K 2NVQJ 4YZEA 3J7AO 4CCKA 4B44A 5E8IA 2CFOA 3PSFA 5CVIA 2ETHA 3KE2A 3PSIA 3GW2A 3GTLJ 2FMYA 2LF7A 2HS5A 2WAQA 1FX7A 2FA5A 3FHNA 1DGRM 2ZCXA 4AC0A 2E5ZA 5K7ZA 3ON4A 1T39A 3OWTA 4MEXF 2ELJA 3FXLA 4HRIA 4LG0B 2ESHA 2XB5A 3HIFA 3FK6A 2FNPA 4BBSJ 1QVUA 4NQWA 3CCMI 4XLPF 4FTHA 2JPBA 2NP5A 2WUIA 2JA6J 4XMYA 1HKSA 1Z1DA 4BGDA 1ZG5A 1L3LA 1X4OA 2K9NA 2KMUA 3L1PA 2OTLI 2F5FA 2M34A 3HEFA 4Y4RA 2XF7A 3J7YJ 5BQTA 4A5NA 3Q5FA 1MSEC 1HC8A 5HNFA 2DFFA 3G4SI 3HKZN 2QZ8A 5JI6A 2VI6A 2X1EA 3DBRB 1BIAA 5IYBJ 2LD5A 4E7IA 4JNNA 4P55A 1WI9A 3I55I 2NP3A 2CGPA 3FM5A 3IUOA 3ON2A 4PJLA 1TLHB 4KUMA 4PUSA 2VKVA 3AQTA 2Z33A 4I0BA 1TTYA 2DOAA 4BQNA 1V4RA 5D19A 3BPVA 5IYCJ 3L9FA 1DGWY 3GFIA 3HC7A 4DIQA 3QP5A 1Y0NA 1XG1A 3OYMA 2QQAA 3D5LA 2HKUA 1X3WB 1BJZA 4MK6A 1D5YA 4CZZA 3P9KA 2V9PA 1FWZA 2Y30A 2CUJA 1D5VA 2AHQA 3WU1B 3P9IA 4CCLA 1B6AA 5DTDA 2M8EA 3CUQC 3OYNA 5L3EA 3H0DA 2CV0A 2IS6A 4NN1A 4GDFA 4FX0A 3GFMA 5FD5A 4IO9F 3P9CA 5F27A 3T5XA 1ULYA 3J81K 2PG4A 2QSHX 3KZIC 1EKEA 4II2A 3JSJA 2EPFA 2L7FP 3PO2J 1EA3A 2QIBA 3K1PA 3OYCA 2FSWA 1BIBA 5J8CA 1EH6A 2E1MB 3F9KA 1MBEA 3VOEA 3CCEI 5ICEA 3ZQFA 5D8KB 2CQ7A 2LBFB 1PP8F 5FLVA 2H6CA 5FB2A 5DS9A 4D0PA 4BE1A 1ZHFA 3FXJA 1V54H 2OJED 4QPOA 3W6JB 4BU2A 4M9ZA 2XV4S 1OYYA 3KCCA 4DOZA 3KEOA 4HNUA 3P7NA 3L2RA 4EQQA 2VT3A 1WKMA 2D2WA 2W7NA 1KU2A 5D5VB 3VFZA 1ETYA 3VP5A 3W2VA 2HDCA 1HKTA 3W2WA 3JRDA 1HDDC 3K10A 3CDIA 3HOWJ 2Z9OA 1FIPA 2EV6A 2GAUA 2H8WA 2P7CB 4CUGA 5LEKA 2MG4A 2HOTA 3VYTB 5F1JA 1N78A 4M74A 3GTMJ 4MEYF 2VKHA 4KT5C 3OS2A 2MYSA 4U7DA 1U8BA 2UXNA 4G7HF 1PUFA 3Q9VA 2EA2A 2O8XA 5DDGA 2IP2A 1E3PA 4F55A 3TO9A 3PIPF 4D5CA 5LGTA 4I99C 4PGGA 1R49A 4HG2A 4CYCB 4C2UA 2CFXA 5IY5H 4G6DA 3LSPA 2RKHA 1WJCA 3ANGA 1AKHB 4IOCF 4C2MJ 2R5YB 5E3LA 3IHUA 3OYKA 4YFKF 1JUPA 2P81A 2E71A 2IPQX 1YI2I 3EGQA 2VKEA 1GVJA 1OFCX 2EILH 2Y48A 2L4AA 5D6EA 5BNGA 2LC2A 2MLKA 3DTEA 3DTKA 3NRGA 1ENHA 1UFMA 3M1EA 5F0CA 3F8BA 3CCQI 3HDDA 2VOOA 1KYWA 4FASD 3IRQA 1ERDA 3S32A 3WE2A 2Y9ZA 2QUFA 1LEAA 2ZMEC 2L0KA 1USSA 3I53A 1YO5C 3AG3H 1RRJA 5ILVA 4DGWB 4BY7J 1JUSA 4XLAA 4BH9A 1NH3A 3HIMA 3K4BA 1A5JA 2LY9A 4RGSA 4IRGA 4JQFA 4YIRX 3L2WA 2R5YA 4LG3A 2GBYA 3HTJA 4EMSA 2BHZA 5ED4A 1FBSA 1QRYA 3GXOA 5H6QA 3SZPA 4BKXA 3HYIA 3IAS2 1RNLA 1K61A 1YG2A 2X6YA 4ZYEA 1GV2A 4JBAA 5CW8A 2RAEA 2WY8Q 3GZNB 3N4MA 2FBKA 3OOPA 2O03A 2KJCA 3RCOA 1OCZH 1GLNA 2Y0SA 1A31A 3CMEI 2CUEA 1R1UA 4G8XA 5CYVA 1IXCA 1J59A 5DM6F 4RGRA 2EJRA 1YE9A 4ASNA 2EFOA 1WH7A 4HA8A 4B3XA 3FXUA 3NWTA 1BC8C 2HGCA 3IH2A 2F5VA 5EEGA 1D8KA 3HPGA 1UB9A 4KIFA 1H0MA 3K8PC 5HSZA 5JHUA 2M4GA 1BR4A 4U88A 3HGGA 1EV7A 1IDYA 2PMHA 4WF2A 3I4NJ 2G9WA 1NK2P 3ABMH 3DKYA 1WGXA 1WWXA 1YOVB 1T0FA 3BG7A 2ICWG 4RGXA 2R7QA 2HI3A 2IA0A 1Y0UA 2VJ4A 2TCTA 1XB4A 1XCBA 2EBIA 3IAM2 3ROUA 2XSDC 4PGHA 2QGUA 4OWRB 3DBHB 5B3SH 5IOYA 2DA2A 2OC6A 4ESBA 5ERIA 4FISA 2JA7J 3BY6A 3L2CA 5JR3A 3ZQQA 2QQBA 1RR7A 4I2OA 2G7HA 1MBKA 3TP3A 4BAYA 3F8NA 4XK4A 2ID3A 3LL7A 1I6HJ 3DF8A 2CYYA 3F3XA 1RPWA 1SC7A 5K58A 1RR8C 1YIJI 2UWMA 5HLTA 3HRSA 4KN7X 3H5NA 4AWXB 3S15J 3K4KA 3FZVA 5DCMB 1TT5B 4JK1X 4TV7A 2ZY9A 4Y17A 2W24A 3H3UA 4M3EA 4E7HA 2DTZA 4ENJA 2ZJPF 3H9GA 4HW0A 4L5JA 4AC6A 1DDNA 3GTPJ 3HSEA 1IRZA 2LRDA 4L0YB 2QQ8A 2IS4A 1VFCA 4EJTA 2ELHA 5HDGA 4BACA 1YX5A 4Q4ZF 2A5WA 1ZLJA 3BG9A 1DPUA 4ABZA 1ONVA 2OZUA 3I71A 3BR5A 2JA5J 3MMYB 4ETSA 3HOUJ 3CJQB 1Y8QB 1S7OA 3ZMZA 3EUAA 2Y9YA 3OMYA 2AXLA 1XGMA 1IGNA 4XLNF 3RQ4A 3ANPA 1TWAJ 4HKUA 2QVOA 2CW8A 4YIFA 1O3QA 5E1XA 4HSRA 2IEKA 2BZTA 1I27A 3K9TA 2WA0A 3GF2A 2EZKA 2P5KA 3OYBA 4RLFA 5K5OA 1J0RA 2PBXA 3BJ6A 3GLXA 1XGNA 1E17A 4OD4A 2HVSA 5EEHA 2VN2A 1S7EA 2GOMA 4KWAA 1W0TA 1OKRA 2O61A 2XRNA 1FOXA 3LSMA 4KA4A 3MEXA 5ICCA 1ZK8A 2DG7A 3LSTA 5J1UA 3JRIA 4FETA 4S04A 2ZFWA 1J7KA 3I3LA 4ITVA 2KP6A 2R3SA 3CZ6A 1ZN2A 2WADA 5H9TA 2CV1A 1UHSA 2OZ6A 1JGSA 2JSCA 4OIPF 2V4JC 2RN7A 4YFXF 4FX4A 1MBJA 3KPHA 3BG6A 1IV8A 2XGXA 3FWEA 2Q1ZB 1T8IA 5FROA 1VQOI 3OIQA 1K79A 2M0MA 4GGGA 4HV6A 1G3SA 3ABLH 2DYRH 5M5YJ 5C4XJ 1VQ8I 1BI2A 1ZYRF 1CGPA 4R8HA 2XROA 3ZPLA 5C4YA 5D5UB 3JRHA 2IA1A 3PNTA 2OAZA 3JAMZ 1IUFA 5FRMA 2KHMA 2RREA 2GA1A 4PJMA 1ORKA 4UUSB 3OIPA 4B48A 3T1BA 2LR8A 5BS6A 4RB3C 3BG3A 2F4IA 3UR3C 4KT6A 1U9OA 2G0EA 5FKOA 3G6EI 3MWMA 4QIWN 1ETKA 3MKYB 1E3HA 2A6TA 3HUGB 2BY3A 1MDMB 1ON1A 2F4MB 2OD5A 1PJRA 4RM3A 1WHUA 3VW0A 2ACJA 4W1UA 2W48A 5EZGA 2FRHA 2DAOA 3BQYA 2XDVA 4CA0A 2BW3A 4L18B 4CXFA 5IT9K 2VIXA 2GIZA 1YIOA 3DWLE 1WVRA 2XF6A 2Z3YA 1MJ9A 1ZTRA 2D5VA 1QNTA 4WCGA 1NTCA 4KMUX 4EM0B 3MZ8A 5JVGF 2NVUB 2HPIA 5LHHA 4GYGA 3GZ5A 3KYCB 1Z05A 2O5RA 4OOIA 5FLXZ 3G3ZA 4ZDPA 1IG7A 3FXOA 4DJAA 1TZLA 2CG4A 4XLHA 3TOAA 3U9GA 3NPIA 3MQ0A 2ECBA 2XKPA 1U6GA 3M8JA 5E20A 2EQRA 4DZJA 3C18A 4LK0F 4LB6B 1RETA 2E36A 3HGYA 2PMUA 2QQ9A 3DLAA 2P6TA 1STZA 3BHQA 1FOWA 2AXTC 2VT2A 2WB1A 3CUQA 3HOZJ 4U9LA 2M4KA 3FMSA 3R60A 3FKJA 2DA4A 1T0FC 1VZ0A 1SFOJ 4YG2F 1AWCA 4YIIA 3MKLA 1UG2A 4ZDLA 3JSOA 1ZQ3P 2P8TA 4EATA 3ZN0A 3OYFA 2DI3A 3VPRA 4RDUA 3CESA 1BR2A 4A0XA 1KU9A 2EFWA 2H1LA 4GCKA 1W36D 1K6YA 2EV0A 5FJ8J 1BI0A 3E6BA 3LWFA 3LQRA 2BGCA 1FMWA 2IU5A 4HEA2 4M6VA 5EFYA 2VUMJ 4XLFA 4AU7A 3VTIA 2MABA 3RZDJ 1X19A 2JPCA 3TMOA 3WE3A 3CMMA 2X51A 4XLEA 4DNCA 2HQRA 3CJNA 3H9QA 2ADUA 3CO6C 1K4TA 1V5GA 2OF7A 3KFWX 3PL8A 3CCYA 5KHDA 1K7AA 3ZQ7A 1G59A 2ZJQF 1T95A 4P9UA 3KIOA 5BPDA 4L9TA 3OYGA 1VQLI 2XAFA 4M9XA 3PO3J 4NDLA 2Y75A 4HLXA 4CH7A 3GZ6A 4FE4A 1JT0A 3G1MA 1TNSA 1YW9A 1ZGAA 1DPRA 2V26A 1IN8A 1K4SA 2E19A 3K4LA 3Q0UA 4N9IA 4XRFA 4X6AJ 2JQ7A 2XGCA 5DV5A 1U5TB 4ZJZA 2HQAA 3QOEA 2VB6A 1ZG1A 4RB1A 2DCEA 4XN0A 2NAZA 2M87A 5GTHC 2DA5A 2K9SA 2NYXA 1F43A 1D1AA 1SFUA 2QLZA 5B1BH 5HNHA 4DVYP 1I3AA 3K70C 2JT1A 2PN6A 3SFIA 2A68F 3HSFA 3ONQA 5DAJA 2IGNA 3H9JA 4UV9A 2IVMA 3DFGA 4LIUA 1TW2A 3VVXA 3AQSA 2Q24A 3S3OA 4JKZA 2IBDA 3CCRI 1Z0XA 4U87A 2CQQA 1DU6A 2AQFA 4K2EA 4XOPA 2OI8A 1ZGWA 1WH5A 4QLCU 5FRNA 1RIOH 1D8JA 4A0ZA 4XBFA 4Y52J 3B02A 3DBLB 1U5TA 2BHYA 4U7BA 2F48A 3O2PE 4A0YA 4IKFA 3S1QJ 3E7LA 4BEHB 5J8FA 2VONA 2RC4A 2DDBA 4IXAA 3CF2A 3NARA 1APLC 3S14J 2VJ5A 5FKNA 2M9HA 1T08B 3ASOH 2DPDA 4PFPA 3HOXJ 2IS1A 1Z9CA 2VE8A 2R5ZB 2UUZA 3CDLA 4II3A 2L9VA 4I01A 2XB0X 1MIJA 4MTEA 2QTQA 2F6CA 2HTJA 5H20A 3V8JA 4A69C 1V55H 2UXHA 1KU7A 2EB7A 3PFIA 1BM9A 3GWZA 4G12A 1VF9A 2K86A 5HLHA 4Q47A 1UJ8A 3NNRA 4C9YA 1HSJA 2V6EA 4BQOA 2CS3A 3K4NA 4OIOF 2LYCA 1UI5A 5K1YA 1LKXA 2D6YA 3WTWC 3OYIA 1RKWA 1A04A 1QGPA 4IHYA 2KJBA 1T56A 4CHUA 2R7ZJ 4O5VA 3UNGC 3RPUD 4A3FJ 3NRVA 3MKZA 2IJLA 2DMQA 2DXIA 1W7PB 1KONA 1XGOA 4C3HJ 4X0GA 2DDAA 2R5ZA 2EWNA 4BHCA 2DA7A 4RM2A 3BTLA 5D6FA 3SEQA 1LFUP 4O3MA 1XTAA 2CWEA 5HS7A 3BC8A 3E6CC 2J5OA 3A0BC 3BZKA 1WCMJ 3PNYA 4XKVA 5FFXA 1HLVA 1Z91A 4PJNA 3ZOBA 5DUIA 1OCCH 4ZZDA 3HTIA 2ESNA 4KICA 4ENMA 2ZOZA 2JUGA 2K7LA 3DU6A 1IN7A 2H6BA 3V8LA 2E35A 4BQAA 4BQQA 4U0VA 4JL3A 3FBNB 3BTJA 2LDUA 2R7XA 4DBQA 2COBA 2V7FA 3KP3A 1P4WA 2LKXA 1MSFC 2FOWA 1P4XA 1SD7A 2OPTA 5C4JJ 1A6QA 2DMTA 4C3IJ 4AVPA 2V6CA 2E60A 2FQ3A 2LNBA 3KP6A 5IT3A 3WTTC 1SFXA 4E4HA 2A69F 3IWZA 1QBJA 1WJDA 2P5VA 3U21A 3SZGA 1G3WA 1TQIA 2CU7A 2ZJRF 1MMSA 2OUMA 1X3ZB 4XR6A 2AQEA 3ERED 2DMPA 5CXIA 2L7MP 1MNMC 1FEXA 3GEUA 2VLAA 1BOAA 2BOLA 3K4JA 4BJ5C 4IL6C 3TP0A 4LG0A 4E70A 2DT7B 4XONA 5EEAA 1I3QJ 2FEZA 2K9LA 4AF5A 1RZ4A 1XN7A 2LP0A 1FNNA 4BHPA 3LNQA 2QYOA 2HXOA 4QPQA 1B8IB 4IHVA 1X58A 1G8XA 3RKWA 3AG2H 2DFIA 4IPAA 5TGTA 4RB2C 1JJ8C 3GO5A 1LNWA 2XIGA 3R61A 2P5LC 2CQXA 4KJZA 1MBFA 2CH0A 1Q1VA 4PSXA 2LY2A 1JI8A 4KNYA 4HBLA 2WWYA 3RH2A 4GO1A 1CQTA 3ZMTA 1PUEE 1VQ4I 5JHFA 3GBGA 3H3ZA 3U2RA 1P9QC 2ZXJA 2I5UA 4M3FA 3QYBA 2L7KA 2WV0A 2DTRA 1V5FA 4BDZA 3DPJA 3F6VA 3GX4X 5HBUA 4UUTA 2FQ4A 5GAEJ 2PX9A 1XC5A 2R7DA 3BTIA 4PSWA 5L3FA 3BCGA 5F6FA 1W5SA 2B63J 4CCOA 3D5RC 2X1DA 1ZAOA 1O57A 1OYWA 5HLGA 2WBMA 5HVQC 2WGBA 2OU2A 2ZNZA 5LRRA 3TGNA 4LIVA 5LLQA 5C44J 4J19A 4B8XA 2EFPA 1YRNB 5D4RA 5GAHJ 1MD0A 3RPUA 4GFLA 2K4BA 2RNJA 1L0OC 3ABKH 3SDBA 4BL0B 2QBYB 1R7JA 2CV2A 2XPVA 5FGMA 3C7JA 1DP3A 3H92A 4UDSA 3DPTA 3AG1H 3KP2A 2MGQA 3QYFA 2WY7Q 4C2MA 1LDDA 2K3PA 4AIDA 2FX0A 2LBFA 2KZGA 3GLLA 1BI3A 4GCVA 1FY7A 1ODDA 1WFXA 2WAQN 2XAQA 3ULQB 2H8RA 2HVRA 4KFCA 4IOAF 1OJLA 3W2AA 3M8EA 1X1PA 3S16J 2G3BA 3BJAA 5H6RA 3O8HA 2XDNA 3BOQA 2F5DA 1U2WA 2HDDA 4FE7A 2MD0A 3ZQGA 2MBFA 2DOEA 4OMYA 3CC7I 3JTGA 4L0ZB 3WHBA 2A07F 1TT0A 2EINH 1I1SA 3J80Z 1B1BA 2YVEA 1X1CA 3M4OJ 5CKTA 4D5FA 2PBIA 4FHTA 1FLIA 2JRTA 5GP9A 1HDPA 1U5TC 4UY8I 2HYGD 4A3CJ 1E3OC 2DFHA 4WIBA 3BPXA 1FJLA 4CYCA 3CD6I 2HQ5A 2NS8A 3Q0VA 3COAC 2GXAA 2NS7A 3CLQA 4IRVA 2PMZA 1OLTA 4MQ9F 1AKHA 3SWHA 3G2BA 5B5EC 1XPXA 3GTQJ 1E0EA 3K70D 2LOOA 2GQQA 1Z21A 2DMUA 2JUCA 1IV6A 4YRVA 4DYQA 4RLQA 2HZDA 2L02A 1MJAA 3RJPA 3HOTA 3BCBA 4LLGF 4U0YA 4UVBA 3KZ9A 4BNCA 4GCLA 2IGMA 4YFNF 2NS0A 3H0GJ 2LKSA 5J40A 3VVYA 3GVAA 2KDZA 2O7OA 2XAJA 4HX7A 4LLLA 2F07A 2VQCA 2EK5A 2LF8A 2KIQA 1KYZA 3EDPA 3S1MJ 4I0AA 1J5YA 4J00A 1SGMA 1HOMA 3AL0B 1ZR2A 2TRTA 3FM3A 2NVYJ 2YX7A 1W36C 1J2XA 3V4GA 1IDZA 3A02A 1JJ6C 2R7TA 2GENA 2PZ9A 1RESA 2ZO4A 4HAMA 3T8RA 2FD5A 3TL4X 4M9SA 3BWGA 2MC4A 2PLYA 2W1OA 2KISA 1KQ8A 5J47A 2B7EA 3KP4A 2BVMA 3CLOA 3LA7A 4RA2A 4WX9A 1KU3A 4JOMA 4GFKA 3I58A 3TKYA 2V1NA 1HQCA 2LSOA 3KKDA 3MAJA 4F92B 5HDKA 2FJI1 2I10A 2CQKA 2X9DA 4ZYAA 3TQNA 1ZREA 2LMDA 2UXOA 4UNOA 4HOBA 3HJEA 2OA4A 5HODA 2BY1A 3BNIA 4I98B 2ME6A 2JSPA 1VNDA 3FXQA 2VJJA 2QA4I 2Y31A 4XSXF 4XICA 1K83J 2RQQA 2R7WA 2IA2A 1O3SA 4ZDOA 4NBQA 1IN5A 2VXZA 2L7ZA 2M7AA 3E5UA 3IL2A 1YS7A 1T33A 4B1RA 2W25A 2XHKA 3JRBA 5AQCA 4CCJA 3EETA 3G71I 3QRFF 4Z6YA 1SANA 3NQOA 3LSIA 4BJ6C 1H88C 1B9NA 2W84A 1UHMA 3JR9A 4G9YA 3CUOA 2HPMA 2L3DA 3VODA 4HNTA 2VPRA 3J7AY 1JKQC 4MXMA 1QPIA 4V2FA 4PXIA 2KQRA 1FPQA 3FISA 3EUPA 3F8CA 3QU6A 3TDUC 3CCSI 1WI3A 1HW5A 1UZCA 3I4PA 5E18F 1AHDP 3F23A 4G94A 2M0CA 4PFOA 2QKOA 2RVCA 4OMZA 2LVSA 4HV5A 3CCUI 3FRQA 2P7VB 2E2JJ 1YJWI 3WG7H 1QO0D 3GYHX 1X3UA 1ZELA 2PMZN 3GTJJ 5IPAA 3V6GA 5F08A 4EJVA 4CCNA 1ETWA 2DW4A 3ZMUA 2NRAC 1A6IA 1EF4A 2VQLA 3W3CA 3ELKA 2JA8J 1ACIA 2D1VA 4A3KJ 1UHWA 2NNNA 4XNFA 3QBMA 5DCMA 3U1DA 1O3TA 2Q2EB 4A3EJ 2HKXA 3J7ZI 1MMGA 3WGHA 3MFKA 4M72A 4M73A 3LFKA 3LAJA 1XGSA 2HYFA 5DCFA 4V2GA 2CW0F 2Y0SN 1OCRH 1S3JA 2BYVE 1IO2A 5J1RA 3VB2A 4BXFA 2R0QC 5TRDA 3LSKA 3QAHA 5TISC 2FBHA 1XDSA 4NUBA 1ON2A 1HXDA 3LOCA 4E7ZA 4C2TA 2EH3A 4AVZA 1SVMA 3H5RA 3U1KA 1U9NA 3V7SA 3QP6A 2C6YA 1JKPC 5KAFC 4ESJA 2AS5F 1FP2A 2KT0A 2E1MC 5EGOB 3RKYA 1OISA 1R22A 3V42A 2XF5A 3WGGA 2DOFA 2E1NA 3E97A 4RAZA 4ENKA 3GZIA 2YR2A 5DD8A 3A4CA 1FP1D 3C2GA 2R7UA 2NX4A 4AYBA 1OR7A 4LJZF 4RAFA 2YVXA 3VYRB 2RV8A 2HXIA 3MCZA 1XDUA 3HOYJ 2GUHA 3FIWA 1UMQA 1HKQA 1ETXA 5CVVA 1GXPA 2K9QA 1ETOA 2FF4A 4LD5A 2PJRB 2DYSH 2R7RA 4H4KC 2PI0A 3HE0A 3VYUB 3QYEA 5JLWA 4IJAA 3F72A 5IP6A 3GTOJ 2ME0A 1VQMI 2I8DA 2EIJH 2HYTA 1B72B 1RKTA 3ESWB 5M3FJ 2UV1A 3RKQA 2MLGA 2P6SA 2XVCA 4M3DA 1QHHD 3OYLA 1MBHA 1IRXA 2L5QA 1WJEA 1ZKGA 3A01B 4ZTJA 2EZHA 2FXAA 1O4XA 1PP7U 2NVTJ 5KNLA 4BE2A 4I09A 2MSYA 3ERMA 1QU3A 2ISZA 2B1EA 1JHFA 2KZVA 3BZCA 1YW8A 3I9V2 1FMVA 5LEJA 4PJ0C 4E7LA 2XAHA 4QWQA 3P9TA 1B9MA 1R4NB 4ACIA 1H9TA 5AIPA 1TP4A 5EG0B 2FBQA 3HOSA 3HRMA 2HZTA 2AO9A 3RPQA 1Z77A 4U0WA 4MNUA 5FLMJ 3TW7A 5K7HA 2H09A 3HZJA 2COMA 3JAMK 1TNTA 1XCVA 1B72A 3B6CA 3KETA 2CUZA 3Q3SA 4RAYA 2ID6A 3REOA 1HCRA 4UUSA 1R36A 3ZQIA 3O8GA 1YJ9I 1T38A 3CDHA 1LQ1A 4QSHA 2OERA 1YLFA 5CLSA 3JRCA 5CXGA 1SFEA 1CF7B 3CJRB 3CO7C 5L3GA 3K4CA 4LOCA 3WHCA 5KVRA 1PVEA 3HUGA 3I0TA 5LGUA 1MDMA 1GT0C 1I1GA 3S5RA 2VQGA 4XOTA 3DPLC 4MHGA 4EJWA 4N9HA 5HDNA 2Y69H 5FKKA 2G7UA 2P4WA 3V7RA 4BJTA 1DUXC 2WAEA 1MH3A 4YEJA 2GM4A 2TDXA 3ZMDA 2YSRA 5GPCA 3BZ6A 3FMRA 1ZARA 2VJIA 3CMYA 1NG7A 3ZRGA 3AL0C 1S7AA 4P9FA 1F4KA 4HQEA 4HQMA 2NOGA 3F21A 2DU9A 3WG9A 4UVCA 2M8GX 1TC3C 2FUG2 1B4AA 2ZXHA 5A2QZ 2FJ1A 2QF7A 2WAFA 5KCMA 4RMNA 1U78A 4Q5SF 3N05A 1TQPA 3IV5A 5LFAA 2VKDA 3AFHA 1VQ9I 2ECCA 3OYHA 4IRHA 3ZR8X 1I5ZA 4B47A 4IX7A 3HRTA 3BRUA 1JXSA 1EJ9A 1E2XA 2W82A 3BDDA 5HLIA 3L7WA 2BXYA 2A5YB 2KKOA 2K40A 4XM3A 4Z2YA 3VDXA 4Y33A 1D0YA 1UCRA 1S8NA 4W97A 5DUKA 1R00A 4R1HA 5H2FC 1K78B 4KYWA 4UB6C 1ETVA 3KP5A 1SFKA 1R23A 1AU7A 3S17J 2ZOYA 1MJBA 2HVQA 2K27A 1W7PD 5JLXA 5K5RA 2CQNA 3CF5F 1WQ2A 4O6JA 3R6SA 4GXOA 5F0FA 5J4YA 3OS1A 1K6OA 1ETQA 5J6XA 1XMKA 2A61A 2BV6A 5CQGA 5FFZA 1TWCJ 2JA2A 5FD6A 4G7ZF 2JTVA 1Y1VJ 4HF2A 4CGRA 2RQPA 3HHHA 3MZYA 3LSGA 3LAPA 2F5EA 1MMAA 3L00A 3IP4B 4M6YA 4A6EA 2GFNA 2ZMEB 3HKZA 2YS9A 2DK5A 1FT9A 3JRFA 1A35A 3LJLA 2K4JA 2L01A 5E79C 2M5WA 1IUYA 3H1CA 4KIGA 5TJJA 3ZXSA 3DCFA 5KK1A 2EFQA 3GEZA 1JTYA 3CQZJ 2JMWA 2KFDA 1WZ2A 2BBYA 2OTJI 4C3JJ 1JE8A 3WTYC 2D1HA 2DO7A 3JRAA 3PPBA 3HTUA 3OV8A 3IUVA 4BDYA 4E7KA 2F2EA 2VXDA 4UV8A 4KDPA 3HM5A 3R0JA 3EYYA 4L5EA 2QKLB 2Z5UA 4A93J 4KN4X 1F1ZA 3K6GA 1XS9A 4BE0A 1X1DA 4ZYGA 1R6RA 1YYVA 2JN6A 5CVRA 1FOKA 1BN5A 2ZCWA 5CVJA 1S5LC 2OCCH 3CC2I 2H1KA 5D1RA 1TW3A 1U3EM 1OR7C 1QPMA 1U0JA 4DW6A 2WB1N 2PJPA 4N4NB 4G7OF 1X2NA 3LA2A 5EDNA 1N75A 4MIMA 4A12A 1YITI 5FHPA 3NWSA 2E2IJ 1FBQA 2ZFUA 3I59B 1BC7C 2ZXWH 1LUJB 2X6WA 3RSNA 4BEHA 3M1CA 3OR2C 4I7HA 3IC7A 1KZHA 4JYKA 4CSWA 4N4OB 1SD4A 3VW1A 3SZTA 4HLYA 2X1CA 2VL8A 2NOJB 3HOVJ 3CTAA 1IXRC 1YW7A 3OOUA 3ZQHA 1Y1WJ 2NVXJ 2FOKA 2HFHA 3OS0A 2E1CA 3E6DA 4M6XA 1LE8B 4S0HB 2K02A 2KDOA 2EFNA 5E3MA 3V78A 4ZC3A 3H5AA 4NQWB 3LFUA 3L2UA 4D7MA 1LB2A 3OSGA 3HL2A 2DLLA 3SYTA 3OYEA 4EGYA 4IHXA 4RS8A 1X2MA 1R71A 2RGVA 5LBQA 3NXCA 2Z16A 2CRGA 3Q0WA 2R7VA 2JVGA 3OIOA 4L62A 1MZBA 1JT6A 3Q9SA 1VI0A 3L09A 4DQ2A 5IOZA 3E6MA 3LA3A 3K1MA 3BG5A 4Y7NJ 4NELA 2IGKA 5JFRA 1LPQA 5ICFA 1MGTA 2JVHA 2ZC2A 3HXLA 2OBPA 1W7PA 2L9RA 4D1QA 3DLLF 1BI1A 2X0LA 2GLOA 4BHBA 2BXZA 3TEDA 2IXSA 3DQVC 1YTYA 4HX8A 1QA6A 1LE8A 2LH9A 1WPKA 4RB0A 5GTIC 4F91B 2MD5A 4A6DA 2STWA 3BCAA 2E1OA 2MW8A 4GYIA 3ZQCA 5LD2C 5C3EJ 2IS2A 2R7FA 1D0ZA 4Y15A 2EA4A 3WODF 2K85A 4XRMA 2XGDA 5F64A 3LWJA 4L5IA 5CQEA 4XRSA 3S2HJ 2XAGA 3H3VK 3KX2A 4NB5A 3RQIA 1WJFA 3ABUA 3KZYA 1OCPA 3BP8A 2DT5A 1N77A 2F4OB 3RIRA 4KIBA 4LLNA 1JHHA 3DPUA 3OYAA 1R1TA 1SVLA 1VQNI 1YJNI 3J81Z 1SMTA 4HYEA 1BA5A 3ISPA 1R1VA 1LVAA 5JVTA 1MNDA 3HG9A 4E6KG 1WJAA 3K2ZA 3ASNH 3K4MA 2KL4A 3SEZA 2ZXIA 1R4MB 4M3BA 4PZJA 1O7FA 2VBYA 4XSZF 3BLYA 1I6XA 3DV8A 3S2WA 2FU4A 3WTVC 2MH9A 1V3FA 4E7SA 3FDYA 4X1EA 1IN6A 3FX3A 2DFEA 5BPIA 2R92J 2O0YA 3CWRA 4ENNA 3F8FA 2WC2A 2LG4A 1FSHA 1IRFA 5J3LA 1SVOA 2DQRA 2FMLA 4YELA 1W0UA 3HPHA 3ZMVA 2VQHA 3VOXA 3VW2A 2K5CA 4PDKA 4F52A 1QQIA 1B8IA 3C2BA 2X85A 1QZEA 3CJDA 2DA6A 1VQ7I 2X6OA 5E1ZB 3OY9A 5AIQA 2GXBA 3P5JA 4L9VA 1IXSB 2E5NA 3WU0A 5KAIC 4B3AA 4CDGA 3KLNA 1BW6A 5E3OA 5L3DA 3SDGA 1QVTA 4XQFA 3RD3A 1RUOA 1N25A 3AAFA 3PJRA 1PUFB 5IYDJ 1X1AA 5L3BA 1G3TA 4J01A 1QZYA 2DA1A 3S1NJ 3S93A 1ITYA 3G1LA 2GWRA 2MFZA 3BJOA 4EVIA 3OYJA 2F5CA 5LGNA 4Y3OA 4DZPA 2JRMA 3QPLA 1FC3A 2DJIA 2VE9A 3IH3A 1VTNC 3VWBA 1YFHA 3KLOA 2OV7A 2JK3A 2IRFG 4UB8C 5DM7F 4B09A 4S05A 1T6SA 2YU9J 3HTHA 9ANTA 2K9MA 2VOPA 2BVLA 2Z99A 2QWWA 1YRNA 4CZCA 2Z2SB
chains in the Genus database with same CATH topology
2QKOA 3B6AA 1JUMA 3NPIA 2LVSA 2ECBA 4DZJA 3NI7A 2EQRA 1IJWC 3FRQA 3IH4A 2RHAA 2E2JJ 4BBRJ 1BL0A 3A03A 1RETA 3HGYA 1GV5A 2PMZN 3TW6A 3GTJJ 5IPAA 3F1BA 3V6GA 5F08A 4A3DJ 1ETWA 3BHQA 1GDTA 4GFBA 2REKA 1A6IA 1EF4A 5F0HA 3HOZJ 2JA8J 2NVQJ 3BQZA 3KKCA 4A3KJ 2O9LA 4YZEA 4A3LJ 2DA4A 3QBMA 1SFOJ 4JX4A 4A3EJ 3MKLA 1UG2A 2CJJA 2CUFA 1ZQ3P 3GTLJ 2ZCXA 3VPRA 4RDUA 5HAWA 4AC0A 4V2GA 2Y0SN 5K7ZA 3ON4A 5J1RA 2XB5A 3FK6A 2R0QC 4GCKA 4BBSJ 4GCTA 1QVUA 5FJ8J 4FTHA 1JKRC 2WUIA 2IU5A 2NP5A 3GTKJ 4M6VA 3LOCA 5EFYA 2VUMJ 2EH3A 2JA6J 3HB9A 5E3NA 3RZDJ 1JTXA 1U9NA 2K9NA 3L1PA 3KNWA 3HEFA 2M34A 1MSEC 2OF7A 2N8GA 1JKPC 3HKZN 2KT0A 3CCYA 5EGOB 1OCTC 3RZOJ 1UI6A 2VI6A 1FIAA 5F04A 5IYBJ 5IP9J 2LD5A 2LK2A 3PO3J 3GZIA 4JNNA 4NDLA 3CRJA 4FE4A 2NX4A 2NP3A 1JT0A 3G1MA 3ON2A 2R93J 3G56A 2VKVA 2EZLA 3AQTA 2HXIA 2E19A 3HOYJ 2GUHA 3Q0UA 3FIWA 4X6AJ 1UMQA 3BTCA 2XGCA 5D19A 3MN2A 1ETXA 3BR0A 5IYCJ 2K9QA 1ETOA 1XG1A 2DA5A 2K9SA 2HKUA 3HE0A 3S2DJ 4M3GA 1BJZA 5JLWA 1F43A 4MK6A 3FK7A 1D5YA 2G7SA 4MLOA 3SFIA 2QCOA 5IP6A 2Y30A 2ME0A 3GTOJ 3NAUA 5DAJA 3D1NI 5FMPA 2HYTA 1B72B 2AHQA 1ZR4A 1RKTA 5DTDA 3VVXA 3AQSA 2Q24A 5M3FJ 3RKQA 4JKZA 2JWTA 4NN1A 1LFBA 2O7TA 2M2EA 2IBDA 4M3DA 1Z0XA 1MBHA 2CQQA 5F27A 1ZKGA 3A01B 1O4XA 2NVTJ 2EZHA 1DU6A 2OI8A 1P7JA 1ZGWA 1WH5A 4D7NA 2DJNA 2MSYA 3JSJA 4AUXA 3PO2J 2L7FP 2QIBA 4Y52J 2HOAA 3BR6A 1POGA 3S1QJ 2ELKA 1MBEA 3P9TA 3E7LA 3ZQFA 1HF0A 4ACIA 5FLVA 4MFEA 1JKOC 5EG0B 2FBQA 5DS9A 3T6NA 3NARA 2AO9A 1APLC 2YUSA 3S14J 1Z77A 5FKNA 1JGGA 5FLMJ 3TW7A 5K7HA 2M9HA 3HOXJ 1B72A 2HYJA 3B6CA 2R5ZB 1ETYA 3CDLA 3ZQLA 4ME9A 3Q3SA 3VP5A 2ID6A 2XB0X 1HDDC 3JRDA 1HCRA 4UUSA 3PASA 3ZQIA 2IAIA 3O8GA 3HOWJ 2QTQA 1FIPA 4A69C 2UXHA 2ZCNA 4QSHA 2OERA 2MG4A 3JRCA 2HOTA 3FKIJ 5CXGA 2LFBA 4G12A 4LOCA 4MO7A 1VF9A 3WHCA 5F1JA 3GTMJ 3NNRA 5D18A 3W6VA 3UKGA 3MNLA 1R9TJ 1GT0C 1FTTA 1U8BA 1UI5A 3S5RA 1H8AC 1PUFA 1FTZA 2D6YA 1RKWA 4IHYA 2LLKA 4D5CA 1T56A 5FKKA 2R7ZJ 4CYCB 4A3FJ 3LSPA 2DMQA 3ANGA 1AKHB 4A3GJ 1MH3A 4C3HJ 3JRGA 2GM4A 4C2MJ 2R5ZA 2R5YB 3M3YJ 1TWGJ 2DA7A 5FKLA 3BTLA 5E3LA 5GPCA 1LFUP 3G1OA 1JUPA 2P81A 3EGQA 2VKEA 3CMYA 1WCMJ 2XPWA 1HLVA 3HTIA 5BNGA 1OFCX 3ZOBA 1NK3P 4JP0A 2ZOZA 3NRGA 1ENHA 5F0CA 2NOGA 3HDDA 2M8GX 1TC3C 2Y9ZA 2FJ1A 4JL3A 3BT9A 3BTJA 1MH4A 2QF7A 2COBA 2L0KA 1U78A 2O8KA 2QWTA 2LKXA 2DA3A 3IV5A 4BY7J 1MSFC 4I6ZA 2OPTA 5C4JJ 1JUSA 2DMTA 4C3IJ 2ECCA 5IP7J 3HIMA 1A5JA 2LY9A 3BRUA 5M5XJ 3OSFA 2R5YA 3HTJA 2CU7A 2GBYA 2G7GA 2K40A 1QRYA 4BKXA 2DMPA 4W97A 5CXIA 2L7MP 1MNMC 1FEXA 2XRLA 1K61A 3GEUA 1TWFJ 1ETVA 4ICHA 1GV2A 3TP0A 5CW8A 2RAEA 5EEAA 1AU7A 1I3QJ 3S17J 2ZOYA 5JLXA 2LP0A 2CUEA 4A3BJ 3LNQA 5EF6A 2HXOA 1B8IB 4IHVA 1X58A 5F0FA 1JJ8C 1ETQA 2CQXA 3VUQA 1MBFA 3VVZA 1TWCJ 1WH7A 4CGRA 3K2AA 1Y1VJ 1Q1VA 3PM1A 5EGOA 3LSGA 2X48A 2GFNA 3O60A 3LHQA 2YS9A 3IH2A 3RH2A 3JRFA 1CQTA 3LJLA 3DEWA 5HSZA 3GBGA 3LSJA 1MBGA 4M3FA 3DCFA 3HGGA 5M5WJ 1IDYA 1GUUA 3DPJA 1JTYA 3CQZJ 2JMWA 3I4NJ 3MVPA 5HBUA 1P7IA 4UUTA 1NK2P 2FQ4A 3BTIA 1XC5A 1WGXA 4C3JJ 3BCGA 2B63J 3JRAA 3PPBA 2HI3A 3IUVA 2TCTA 5K7FA 3HM5A 4XIDA 2EBIA 4L5EA 4A93J 2XSDC 3BR2A 2WGBA 4J19A 1XS9A 5C44J 5IOYA 2DA2A 1YRNB 4FISA 2ZB9A 2JA7J 2JN6A 4XRSG 4GFLA 1G2HA 1RR7A 1MBKA 2WV1A 2XPVA 3A01A 3TP3A 2H1KA 3G7RA 4XK4A 2ID3A 1I6HJ 4UDSA 5D1RA 1RPWA 2MGQA 2WB1N 4DW6A 1X2NA 5K58A 5EDNA 4MIMA 5FHPA 3VIBA 2E2IJ 2DG8A 4DYRA 2FX0A 5EG0A 3S15J 3GTGJ 4AF5A 2H8RA 2WAQN 4JYKA 3BR3A 3VW1A 4A3JJ 1OJLA 2G7LA 3HOVJ 1Y1WJ 3OOUA 3ZQHA 2NVXJ 4RBOA 4M3EA 2DTZA 3S16J 1LE8B 2G3BA 4S0HB 3LSRA 3V78A 5EZHA 5E3MA 2XGEA 3O8HA 4IHWA 2XDNA 4AC6A 3GTPJ 2HDDA 4FE7A 3ZQGA 1IRZA 4A3MJ 4D7MA 3OSGA 4JX5A 1VFCA 3WHBA 4BY1J 4I76A 1TWHJ 3BG9A 4IHXA 1IC8A 4ABZA 1X2MA 2YVEA 2LTPA 3BR5A 3NXCA 2JA5J 3HOUJ 3M4OJ 4D5FA 1BW5A 5FGLA 2CRGA 3Q0WA 5EYRA 5GP9A 3OIOA 4L62A 1HDPA 4A3CJ 1E3OC 1JT6A 2Y9YA 1VI0A 4AYBN 1IGNA 5IOZA 3ANPA 1FJLA 4Y7NJ 1TWAJ 3BG5A 4CYCA 2HQ5A 1DU0A 2UXUA 2NS8A 4HKUA 4NELA 3Q0VA 2E2HJ 2NS7A 2JJ7A 1AKHA 2L9RA 4MFDA 3SJMA 2GLOA 3GTQJ 2IEKA 3TEDA 2DMUA 1IV6A 1LE8A 3I4MJ 1F36A 4DYQA 1WPKA 2EZKA 3QQAA 2E1OA 2MW8A 3ZQCA 2PBXA 3KZ9A 5C3EJ 5J1YA 2RASA 4GCLA 2ZCMA 4XRMA 4EEFG 2XGDA 3LWJA 4XRSA 3H0GJ 3S2HJ 3VVYA 2KDZA 3H3VK 2O7OA 3RQIA 1S7EA 4KWAA 1OCPA 1W0TA 4HNVA 2F07A 1ZK8A 3B81A 3S1MJ 1I50J 2DG7A 3JRIA 5J1UA 1SGMA 1HOMA 2YVHA 1ZR2A 2TRTA 2W53A 2NVYJ 1BA5A 5H9TA 2DN0A 2GENA 1IDZA 1UHSA 3A02A 1JJ6C 3QPSA 5FKMA 2PZ9A 1RESA 3BJBA 2FD5A 2UXIA 1MBJA 3C07A 2V57A 4M3BA 4DYCA 5M5YJ 4X1EA 5C4XJ 4BXXJ 4A3IJ 4GFKA 2R92J 3KKDA 3CWRA 2I10A 5J3LA 5C4YA 2X9DA 1W0UA 4IEJA 3JRHA 3VOXA 3VW2A 1IUFA 2DMNA 1B8IA 2UXOA 1GVDA 3C2BA 3F0CA 4JX6A 1ORKA 5M3MJ 4UUSB 3CJDA 3JREA 2DA6A 2LR8A 5HODA 2HOSA 3BNIA 3BG3A 2ME6A 1VNDA 1U9OA 2G0EA 2XPUA 2X6OA 5FKOA 2Y31A 4QIWN 1ETKA 4XICA 3BR1A 1K83J 4B3AA 2EZIA 1BW6A 3K7AJ 5E3OA 5GPAA 3SDGA 1QVTA 2L7ZA 3RD3A 1T33A 5IYDJ 1PUFB 4B1RA 3VW0A 2DA1A 3JRBA 3S1NJ 2UXPA 5AQCA 1ITYA 4W1UA 2W48A 5EZGA 3BQYA 3G1LA 4B4CA 1H89C 1SANA 2Y2ZA 4FCYA 4DZPA 1H88C 3QKXA 4QTRA 3JR9A 3QPLA 1ZTRA 3HBLA 2D5VA 3E7QA 1NTCA 3IH3A 3VOKA 2VPRA 2QOPA 1JKQC 4MXMA 1QPIA 4V2FA 4PXIA 2JK3A 3FISA 3EUPA 2YU9J 3HTAA 1WI3A 3HTHA 9ANTA 1AHDP 3COLA 1IG7A 2M0CA 1YRNA 3S1RJ
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2QKO A;  3B6A A;  1JUM A;  3NPI A;  2LVS A;  2ECB A;  4DZJ A;  3NI7 A;  2EQR A;  1IJW C;  3FRQ A;  3IH4 A;  2RHA A;  2E2J J;  4BBR J;  1BL0 A;  3A03 A;  1RET A;  3HGY A;  1GV5 A;  2PMZ N;  3TW6 A;  3GTJ J;  5IPA A;  3F1B A;  3V6G A;  5F08 A;  4A3D J;  1ETW A;  3BHQ A;  1GDT A;  4GFB A;  2REK A;  1A6I A;  1EF4 A;  5F0H A;  3HOZ J;  2JA8 J;  2NVQ J;  3BQZ A;  3KKC A;  4A3K J;  2O9L A;  4YZE A;  4A3L J;  2DA4 A;  3QBM A;  1SFO J;  4JX4 A;  4A3E J;  3MKL A;  1UG2 A;  2CJJ A;  2CUF A;  1ZQ3 P;  3GTL J;  2ZCX A;  3VPR A;  4RDU A;  5HAW A;  4AC0 A;  4V2G A;  2Y0S N;  5K7Z A;  3ON4 A;  5J1R A;  2XB5 A;  3FK6 A;  2R0Q C;  4GCK A;  4BBS J;  4GCT A;  1QVU A;  5FJ8 J;  4FTH A;  1JKR C;  2WUI A;  2IU5 A;  2NP5 A;  3GTK J;  4M6V A;  3LOC A;  5EFY A;  2VUM J;  2EH3 A;  2JA6 J;  3HB9 A;  5E3N A;  3RZD J;  1JTX A;  1U9N A;  2K9N A;  3L1P A;  3KNW A;  3HEF A;  2M34 A;  1MSE C;  2OF7 A;  2N8G A;  1JKP C;  3HKZ N;  2KT0 A;  3CCY A;  5EGO B;  1OCT C;  3RZO J;  1UI6 A;  2VI6 A;  1FIA A;  5F04 A;  5IYB J;  5IP9 J;  2LD5 A;  2LK2 A;  3PO3 J;  3GZI A;  4JNN A;  4NDL A;  3CRJ A;  4FE4 A;  2NX4 A;  2NP3 A;  1JT0 A;  3G1M A;  3ON2 A;  2R93 J;  3G56 A;  2VKV A;  2EZL A;  3AQT A;  2HXI A;  2E19 A;  3HOY J;  2GUH A;  3Q0U A;  3FIW A;  4X6A J;  1UMQ A;  3BTC A;  2XGC A;  5D19 A;  3MN2 A;  1ETX A;  3BR0 A;  5IYC J;  2K9Q A;  1ETO A;  1XG1 A;  2DA5 A;  2K9S A;  2HKU A;  3HE0 A;  3S2D J;  4M3G A;  1BJZ A;  5JLW A;  1F43 A;  4MK6 A;  3FK7 A;  1D5Y A;  2G7S A;  4MLO A;  3SFI A;  2QCO A;  5IP6 A;  2Y30 A;  2ME0 A;  3GTO J;  3NAU A;  5DAJ A;  3D1N I;  5FMP A;  2HYT A;  1B72 B;  2AHQ A;  1ZR4 A;  1RKT A;  5DTD A;  3VVX A;  3AQS A;  2Q24 A;  5M3F J;  3RKQ A;  4JKZ A;  2JWT A;  4NN1 A;  1LFB A;  2O7T A;  2M2E A;  2IBD A;  4M3D A;  1Z0X A;  1MBH A;  2CQQ A;  5F27 A;  1ZKG A;  3A01 B;  1O4X A;  2NVT J;  2EZH A;  1DU6 A;  2OI8 A;  1P7J A;  1ZGW A;  1WH5 A;  4D7N A;  2DJN A;  2MSY A;  3JSJ A;  4AUX A;  3PO2 J;  2L7F P;  2QIB A;  4Y52 J;  2HOA A;  3BR6 A;  1POG A;  3S1Q J;  2ELK A;  1MBE A;  3P9T A;  3E7L A;  3ZQF A;  1HF0 A;  4ACI A;  5FLV A;  4MFE A;  1JKO C;  5EG0 B;  2FBQ A;  5DS9 A;  3T6N A;  3NAR A;  2AO9 A;  1APL C;  2YUS A;  3S14 J;  1Z77 A;  5FKN A;  1JGG A;  5FLM J;  3TW7 A;  5K7H A;  2M9H A;  3HOX J;  1B72 A;  2HYJ A;  3B6C A;  2R5Z B;  1ETY A;  3CDL A;  3ZQL A;  4ME9 A;  3Q3S A;  3VP5 A;  2ID6 A;  2XB0 X;  1HDD C;  3JRD A;  1HCR A;  4UUS A;  3PAS A;  3ZQI A;  2IAI A;  3O8G A;  3HOW J;  2QTQ A;  1FIP A;  4A69 C;  2UXH A;  2ZCN A;  4QSH A;  2OER A;  2MG4 A;  3JRC A;  2HOT A;  3FKI J;  5CXG A;  2LFB A;  4G12 A;  4LOC A;  4MO7 A;  1VF9 A;  3WHC A;  5F1J A;  3GTM J;  3NNR A;  5D18 A;  3W6V A;  3UKG A;  3MNL A;  1R9T J;  1GT0 C;  1FTT A;  1U8B A;  1UI5 A;  3S5R A;  1H8A C;  1PUF A;  1FTZ A;  2D6Y A;  1RKW A;  4IHY A;  2LLK A;  4D5C A;  1T56 A;  5FKK A;  2R7Z J;  4CYC B;  4A3F J;  3LSP A;  2DMQ A;  3ANG A;  1AKH B;  4A3G J;  1MH3 A;  4C3H J;  3JRG A;  2GM4 A;  4C2M J;  2R5Z A;  2R5Y B;  3M3Y J;  1TWG J;  2DA7 A;  5FKL A;  3BTL A;  5E3L A;  5GPC A;  1LFU P;  3G1O A;  1JUP A;  2P81 A;  3EGQ A;  2VKE A;  3CMY A;  1WCM J;  2XPW A;  1HLV A;  3HTI A;  5BNG A;  1OFC X;  3ZOB A;  1NK3 P;  4JP0 A;  2ZOZ A;  3NRG A;  1ENH A;  5F0C A;  2NOG A;  3HDD A;  2M8G X;  1TC3 C;  2Y9Z A;  2FJ1 A;  4JL3 A;  3BT9 A;  3BTJ A;  1MH4 A;  2QF7 A;  2COB A;  2L0K A;  1U78 A;  2O8K A;  2QWT A;  2LKX A;  2DA3 A;  3IV5 A;  4BY7 J;  1MSF C;  4I6Z A;  2OPT A;  5C4J J;  1JUS A;  2DMT A;  4C3I J;  2ECC A;  5IP7 J;  3HIM A;  1A5J A;  2LY9 A;  3BRU A;  5M5X J;  3OSF A;  2R5Y A;  3HTJ A;  2CU7 A;  2GBY A;  2G7G A;  2K40 A;  1QRY A;  4BKX A;  2DMP A;  4W97 A;  5CXI A;  2L7M P;  1MNM C;  1FEX A;  2XRL A;  1K61 A;  3GEU A;  1TWF J;  1ETV A;  4ICH A;  1GV2 A;  3TP0 A;  5CW8 A;  2RAE A;  5EEA A;  1AU7 A;  1I3Q J;  3S17 J;  2ZOY A;  5JLX A;  2LP0 A;  2CUE A;  4A3B J;  3LNQ A;  5EF6 A;  2HXO A;  1B8I B;  4IHV A;  1X58 A;  5F0F A;  1JJ8 C;  1ETQ A;  2CQX A;  3VUQ A;  1MBF A;  3VVZ A;  1TWC J;  1WH7 A;  4CGR A;  3K2A A;  1Y1V J;  1Q1V A;  3PM1 A;  5EGO A;  3LSG A;  2X48 A;  2GFN A;  3O60 A;  3LHQ A;  2YS9 A;  3IH2 A;  3RH2 A;  3JRF A;  1CQT A;  3LJL A;  3DEW A;  5HSZ A;  3GBG A;  3LSJ A;  1MBG A;  4M3F A;  3DCF A;  3HGG A;  5M5W J;  1IDY A;  1GUU A;  3DPJ A;  1JTY A;  3CQZ J;  2JMW A;  3I4N J;  3MVP A;  5HBU A;  1P7I A;  4UUT A;  1NK2 P;  2FQ4 A;  3BTI A;  1XC5 A;  1WGX A;  4C3J J;  3BCG A;  2B63 J;  3JRA A;  3PPB A;  2HI3 A;  3IUV A;  2TCT A;  5K7F A;  3HM5 A;  4XID A;  2EBI A;  4L5E A;  4A93 J;  2XSD C;  3BR2 A;  2WGB A;  4J19 A;  1XS9 A;  5C44 J;  5IOY A;  2DA2 A;  1YRN B;  4FIS A;  2ZB9 A;  2JA7 J;  2JN6 A;  4XRS G;  4GFL A;  1G2H A;  1RR7 A;  1MBK A;  2WV1 A;  2XPV A;  3A01 A;  3TP3 A;  2H1K A;  3G7R A;  4XK4 A;  2ID3 A;  1I6H J;  4UDS A;  5D1R A;  1RPW A;  2MGQ A;  2WB1 N;  4DW6 A;  1X2N A;  5K58 A;  5EDN A;  4MIM A;  5FHP A;  3VIB A;  2E2I J;  2DG8 A;  4DYR A;  2FX0 A;  5EG0 A;  3S15 J;  3GTG J;  4AF5 A;  2H8R A;  2WAQ N;  4JYK A;  3BR3 A;  3VW1 A;  4A3J J;  1OJL A;  2G7L A;  3HOV J;  1Y1W J;  3OOU A;  3ZQH A;  2NVX J;  4RBO A;  4M3E A;  2DTZ A;  3S16 J;  1LE8 B;  2G3B A;  4S0H B;  3LSR A;  3V78 A;  5EZH A;  5E3M A;  2XGE A;  3O8H A;  4IHW A;  2XDN A;  4AC6 A;  3GTP J;  2HDD A;  4FE7 A;  3ZQG A;  1IRZ A;  4A3M J;  4D7M A;  3OSG A;  4JX5 A;  1VFC A;  3WHB A;  4BY1 J;  4I76 A;  1TWH J;  3BG9 A;  4IHX A;  1IC8 A;  4ABZ A;  1X2M A;  2YVE A;  2LTP A;  3BR5 A;  3NXC A;  2JA5 J;  3HOU J;  3M4O J;  4D5F A;  1BW5 A;  5FGL A;  2CRG A;  3Q0W A;  5EYR A;  5GP9 A;  3OIO A;  4L62 A;  1HDP A;  4A3C J;  1E3O C;  1JT6 A;  2Y9Y A;  1VI0 A;  4AYB N;  1IGN A;  5IOZ A;  3ANP A;  1FJL A;  4Y7N J;  1TWA J;  3BG5 A;  4CYC A;  2HQ5 A;  1DU0 A;  2UXU A;  2NS8 A;  4HKU A;  4NEL A;  3Q0V A;  2E2H J;  2NS7 A;  2JJ7 A;  1AKH A;  2L9R A;  4MFD A;  3SJM A;  2GLO A;  3GTQ J;  2IEK A;  3TED A;  2DMU A;  1IV6 A;  1LE8 A;  3I4M J;  1F36 A;  4DYQ A;  1WPK A;  2EZK A;  3QQA A;  2E1O A;  2MW8 A;  3ZQC A;  2PBX A;  3KZ9 A;  5C3E J;  5J1Y A;  2RAS A;  4GCL A;  2ZCM A;  4XRM A;  4EEF G;  2XGD A;  3LWJ A;  4XRS A;  3H0G J;  3S2H J;  3VVY A;  2KDZ A;  3H3V K;  2O7O A;  3RQI A;  1S7E A;  4KWA A;  1OCP A;  1W0T A;  4HNV A;  2F07 A;  1ZK8 A;  3B81 A;  3S1M J;  1I50 J;  2DG7 A;  3JRI A;  5J1U A;  1SGM A;  1HOM A;  2YVH A;  1ZR2 A;  2TRT A;  2W53 A;  2NVY J;  1BA5 A;  5H9T A;  2DN0 A;  2GEN A;  1IDZ A;  1UHS A;  3A02 A;  1JJ6 C;  3QPS A;  5FKM A;  2PZ9 A;  1RES A;  3BJB A;  2FD5 A;  2UXI A;  1MBJ A;  3C07 A;  2V57 A;  4M3B A;  4DYC A;  5M5Y J;  4X1E A;  5C4X J;  4BXX J;  4A3I J;  4GFK A;  2R92 J;  3KKD A;  3CWR A;  2I10 A;  5J3L A;  5C4Y A;  2X9D A;  1W0U A;  4IEJ A;  3JRH A;  3VOX A;  3VW2 A;  1IUF A;  2DMN A;  1B8I A;  2UXO A;  1GVD A;  3C2B A;  3F0C A;  4JX6 A;  1ORK A;  5M3M J;  4UUS B;  3CJD A;  3JRE A;  2DA6 A;  2LR8 A;  5HOD A;  2HOS A;  3BNI A;  3BG3 A;  2ME6 A;  1VND A;  1U9O A;  2G0E A;  2XPU A;  2X6O A;  5FKO A;  2Y31 A;  4QIW N;  1ETK A;  4XIC A;  3BR1 A;  1K83 J;  4B3A A;  2EZI A;  1BW6 A;  3K7A J;  5E3O A;  5GPA A;  3SDG A;  1QVT A;  2L7Z A;  3RD3 A;  1T33 A;  5IYD J;  1PUF B;  4B1R A;  3VW0 A;  2DA1 A;  3JRB A;  3S1N J;  2UXP A;  5AQC A;  1ITY A;  4W1U A;  2W48 A;  5EZG A;  3BQY A;  3G1L A;  4B4C A;  1H89 C;  1SAN A;  2Y2Z A;  4FCY A;  4DZP A;  1H88 C;  3QKX A;  4QTR A;  3JR9 A;  3QPL A;  1ZTR A;  3HBL A;  2D5V A;  3E7Q A;  1NTC A;  3IH3 A;  3VOK A;  2VPR A;  2QOP A;  1JKQ C;  4MXM A;  1QPI A;  4V2F A;  4PXI A;  2JK3 A;  3FIS A;  3EUP A;  2YU9 J;  3HTA A;  1WI3 A;  3HTH A;  9ANT A;  1AHD P;  3COL A;  1IG7 A;  2M0C A;  1YRN A;  3S1R J; 
#chains in the Genus database with same CATH topology
 5HS8 A;  5D5X B;  3EUK L;  2L9S A;  2W00 A;  5ILS A;  1IN4 A;  2ZSH B;  3AG4 H;  3FMQ A;  4AM3 A;  2QBY A;  2PEX A;  3IH4 A;  3QOD A;  4BBR J;  1BL0 A;  3CMA I;  1PYV A;  2VBZ A;  3I5U A;  4A3D J;  5L3C A;  2X4H A;  1GDT A;  2REK A;  2Y0M A;  5F0H A;  5CVU A;  3DEE A;  3VYS B;  2M45 A;  2D45 A;  3BQZ A;  3QPH A;  3KKC A;  2O9L A;  4IZZ A;  4A3L J;  4XOR A;  3RDI A;  3NS4 A;  3DXJ F;  1DP7 P;  3EUH C;  4LGW A;  4JX4 A;  3EPZ A;  2CJJ A;  2CUF A;  5B66 C;  1SD5 A;  1RUN A;  4AIJ A;  4OIN F;  2A6H F;  3WTU C;  5HAW A;  5LHG A;  5LRS A;  2R7O A;  1VQP I;  3FXR A;  3EYI A;  4A2U A;  4B43 A;  4GCT A;  4ZTF A;  1Z6T A;  4LMY A;  4WXH A;  1JKR C;  3KEY A;  1ZG3 A;  2LY1 A;  3GTK J;  5CPR B;  3J80 K;  4AIH A;  1G3Y A;  3FBI B;  3HB9 A;  3PQK A;  5E3N A;  4WWC A;  1OMI A;  5BOX A;  1JTX A;  1IW7 F;  3KNW A;  1T98 A;  2WTE A;  2RDP A;  2N8G A;  1FZP B;  3L2Q A;  2JZY A;  5ICG A;  2E7W A;  1OCT C;  2VOD A;  3RZO J;  1UI6 A;  3E0J B;  2CSO A;  2QKM B;  1FIA A;  3PUF A;  5F04 A;  3K0L A;  1LVK A;  3CP8 A;  5IP9 J;  4KMF A;  2LK2 A;  4F3Q A;  3JSP A;  3E5Q A;  1XMA A;  3CRJ A;  2R4G A;  1HW1 A;  2M3A A;  4KIT B;  2QEX I;  2R93 J;  3G56 A;  1P6R A;  2EZL A;  2HNH A;  3BTC A;  4BUP A;  3MN2 A;  2ISY A;  3BR0 A;  5GAD J;  4PJJ A;  4EM1 A;  3M8F A;  2X6X A;  3T8T A;  4DBR A;  3S2D J;  4M3G A;  2XAU A;  3FK7 A;  2G7S A;  1KGS A;  4MLO A;  3RI4 A;  2QCO A;  3NAU A;  2UXX A;  3D1N I;  3CCJ I;  5FMP A;  3MKW B;  4EJO A;  3OYD A;  1ZR4 A;  3S8P A;  4IF4 A;  3HHG A;  2JWT A;  2HEO A;  2MA3 A;  1LFB A;  2O7T A;  2M2E A;  2HR3 A;  1ZGJ A;  1P7J A;  3ZGK A;  4D7N A;  3MZH A;  2DJN A;  1VQK I;  1LJ9 A;  4AUX A;  4PK4 A;  2HKO A;  4XKW A;  3VEP A;  1RI7 A;  3LSH A;  4NC6 A;  3CCV I;  1ZRD A;  2BY0 A;  2R7S A;  2HOA A;  3BR6 A;  1POG A;  1HBX G;  1J75 A;  2ELK A;  1RC9 A;  2YPR A;  3KP7 A;  3MD2 A;  1P4A A;  1HF0 A;  3V7C A;  1Z7L A;  4MFE A;  1JKO C;  1UEL B;  5E1W A;  2ZNY A;  5K5Q A;  1YQA A;  2KRF A;  3PIO F;  5J4V A;  2XC7 A;  3T6N A;  2YUS A;  3TDZ C;  3QPT A;  2DT6 A;  3DU5 A;  2CW7 A;  1JGG A;  4HST A;  2FE3 A;  2XSJ C;  1BBY A;  1D1C A;  4IQ4 A;  2HYJ A;  3I56 I;  2CO5 A;  2GIV A;  4ME9 A;  3ZQL A;  2GOX B;  2YU3 A;  3KYL A;  2P0W A;  3OR1 C;  3PAS A;  2KPM A;  2IAI A;  4F93 B;  2UZK A;  3TOB A;  1J09 A;  3VSL A;  3ZMS A;  2ZCN A;  3FKI J;  2LFB A;  2EIM H;  4OU0 A;  4MO7 A;  3RYP A;  2LRE A;  3K1N A;  2W57 A;  5D18 A;  3W6V A;  3UKG A;  3MNL A;  1S9H A;  4ZYD A;  1R9T J;  1FTT A;  1H8A C;  1FTZ A;  1S6L A;  3DKX A;  1XX5 A;  1OCO H;  3WTX C;  4CYD A;  2O6G E;  2LLK A;  1OPC A;  4LK1 F;  2VC1 A;  4NC8 A;  3QWL A;  2VBW A;  3DEU A;  5DD4 A;  5D8L B;  2HQN A;  1FSE A;  2ZJ2 A;  3H36 A;  2V1U A;  5EJC A;  1WJ5 A;  3R0A A;  4A3G J;  1S29 A;  3JRG A;  3M3Y J;  2G7G A;  3E1S A;  3FHZ A;  2W53 A;  1TWG J;  5FKL A;  2XKO A;  3G1O A;  2DK8 A;  5HOO A;  3C2H A;  3O3K A;  4BYY A;  4XN3 A;  2L4M A;  3F22 A;  1UST A;  1UG0 A;  2XPW A;  2KLO A;  4F7Z A;  1NK3 P;  1SEU A;  1D1B A;  2B0L A;  4JP0 A;  2QEN A;  1SD6 A;  1REP C;  2B3W A;  1SMY F;  4NC7 A;  1FYL A;  4AD9 A;  1TL8 A;  3BT9 A;  2PFB A;  1MH4 A;  2O8K A;  2FNA A;  1XSV A;  2CMP A;  2QWT A;  1LFP A;  2KIF A;  2DA3 A;  1Z7U A;  1EH8 A;  4CO8 A;  1ZRF A;  5AON A;  4I6Z A;  5IP7 J;  3FXK A;  3W6K B;  4HDV A;  2M30 A;  5M5X J;  3CCL I;  4BXU A;  3OSF A;  1D0X A;  3D5S C;  1LEB A;  1HA8 A;  2VAS A;  1W4M A;  3N97 A;  2Q2E A;  4BS9 A;  2GA2 A;  2L54 A;  4GRI A;  2PFV A;  1F5T A;  2E34 A;  4HDU A;  2HU9 A;  1IRG A;  2XRL A;  4ICH A;  2OQR A;  1TWF J;  1OYI A;  3PNV A;  1Z3Y A;  3PUB A;  1UAA A;  4OD5 A;  3D0S A;  2QM3 A;  4N0B A;  1BJA A;  1Y56 A;  1ZRC A;  1XMX A;  1R58 A;  1IF1 A;  4A3B J;  2STT A;  1YS6 A;  5EF6 A;  5FO5 A;  1GXQ A;  3BRO A;  1ZH5 A;  3E3V A;  3IWF A;  3ECH A;  4ESF A;  3VVZ A;  3VUQ A;  3K2A A;  2YX4 A;  1IAW A;  5EGO A;  3PM1 A;  2X48 A;  1W5C C;  4MTD A;  4EV0 A;  3O60 A;  3LHQ A;  2OCE A;  2KRH A;  3A1Y A;  5B1A H;  3DEW A;  3GFJ A;  1EH7 A;  1H9G A;  4CCM A;  1QHG A;  4ZYH A;  3LSJ A;  1MBG A;  3LQQ A;  4LIT A;  2EIK H;  2BW3 B;  2W4S A;  3KYD B;  3NEU A;  3TO7 A;  5M5W J;  1GUU A;  2M1B A;  3ML6 A;  4WXD A;  4Q48 A;  5IT9 Z;  3MVP A;  1P7I A;  3DTI A;  2VPL A;  4LB5 A;  3TO6 A;  1WSU A;  2IT0 A;  2LKP A;  2PJR A;  4RAG A;  4XLC A;  1ZLK A;  2V1D A;  4ANJ A;  3HRU A;  1M1E B;  5K7F A;  4XID A;  1FYK A;  1WRJ A;  1HST A;  3BR2 A;  2XAS A;  2RNG A;  3GFL A;  5D4S A;  2EV5 A;  3M7G A;  3QU3 A;  3OL4 A;  3HTS B;  3A0H C;  2ZB9 A;  2A6E F;  4XRS G;  3SXY A;  3IKV A;  1G2H A;  5D5W B;  2WV1 A;  3A01 A;  3G7R A;  1DQU A;  2KIU A;  4WXC A;  2MH2 A;  1SAX A;  1O7L A;  1PDN C;  3L2V A;  2HTS A;  3RTR A;  1O3R A;  3ZP5 A;  2DQL A;  4OAY A;  3O6B B;  1G4D A;  1GHC A;  3ZN1 A;  2IGO A;  1WJB A;  3VIB A;  2Z1D A;  2DG8 A;  1YX3 A;  3JTH A;  3CUQ B;  3ZCO A;  2H94 A;  4UXN A;  4P96 A;  5EG0 A;  3G73 A;  3GTG J;  4AIK A;  1J9I A;  1P2F A;  3BR3 A;  4IQJ A;  1C0W A;  3PFY A;  4A3J J;  2MC3 A;  2ZBK A;  1VQ6 I;  2G7L A;  3WTS C;  2PQ8 A;  2BEO A;  2J5P A;  4RBO A;  4UHT A;  1V5E A;  4M71 A;  1X1B A;  3DKW A;  3LMM A;  1KA8 A;  2O3F A;  3LSR A;  5EZH A;  3GCM A;  4CIC A;  3SFZ A;  1I39 A;  2XGE A;  4IHT A;  4IHW A;  4EGZ A;  3GUD A;  5FLX K;  4A3M J;  2B9S A;  3H35 A;  2E7X A;  4JX5 A;  3SQN A;  2H27 A;  2XUB A;  1P92 A;  2W85 A;  4BY1 J;  1CF7 A;  1YHQ I;  4I76 A;  1TWH J;  1IC8 A;  3ECO A;  2GZW A;  1NHA A;  4G6T B;  2LTP A;  2V1X A;  2M7B A;  3FXM A;  1T2K A;  1BW5 A;  5FGL A;  3E5X A;  5E17 F;  5EYR A;  4IRI A;  2A05 A;  2A2F X;  3GME A;  3F6O A;  1FYM A;  4AYB N;  3RYR A;  4HF0 A;  3CP2 A;  1DU0 A;  2UXU A;  2E2H J;  4U9N A;  1SAU A;  1XD7 A;  2JJ7 A;  3IRR A;  2IW5 A;  4MFD A;  3SJM A;  4LFU A;  3EQL F;  2K3F A;  1AOY A;  3F8M A;  2NXN B;  4UVA A;  1BOB A;  3I4M J;  1F36 A;  4IHS A;  1QZZ A;  1KQ9 A;  3QQA A;  2V9K A;  3S3M A;  1MMD A;  3WTZ A;  4D9J A;  1MNE A;  5J1Y A;  2RAS A;  3CC4 I;  5F1R A;  2ZCM A;  4EEF G;  4XKB A;  2HOE A;  5A2Q K;  3I54 A;  3I64 A;  2KIM A;  4XKC A;  1R5G A;  3WU2 C;  4HNV A;  3B81 A;  1I50 J;  3X2Q H;  4HF1 A;  4ZH4 F;  2YVH A;  4L9N A;  4RGU A;  1XSD A;  3PQJ A;  1FOY A;  2HDW A;  2DN0 A;  4EM2 A;  3V8K A;  3BJB A;  3QPS A;  5FKM A;  3B73 A;  4IVN A;  4MQV A;  2UXI A;  3C07 A;  2V57 A;  5LHI A;  1Y8R B;  2BY2 A;  4P5O A;  1F9N A;  2DOD A;  1Z6R A;  2A3S A;  4DYC A;  1K78 A;  4EJU A;  5DYM A;  4BXX J;  4A3I J;  3RKX A;  1G6N A;  3C1D A;  3M9A A;  3K69 A;  4R79 A;  4OIR F;  1R5H A;  3AKZ A;  4I02 A;  4C30 A;  1MKM A;  4IEJ A;  1NG6 A;  2ZSI B;  2DMN A;  4H0E A;  3WGI A;  3EUH A;  1A36 A;  1XSX A;  2GXG A;  1FBU A;  1GVD A;  1MW7 A;  2L9N A;  3F0C A;  4JX6 A;  5HS9 A;  3T0Y A;  4FQG A;  5M3M J;  1D3Y A;  3JRE A;  1Y39 A;  1AA7 A;  2HOS A;  3VSK A;  1BR1 A;  3IKT A;  2OQG A;  1Z67 A;  2XPU A;  3KEQ A;  2Q8K A;  3JW4 A;  3OL3 A;  4ZZL A;  3BR1 A;  3SHF A;  4HZF A;  2V79 A;  2EZI A;  2VBX A;  3K7A J;  2ZME A;  3CJT B;  5GPA A;  4Y13 A;  2BE5 F;  4OAZ A;  4PCQ A;  3M07 A;  2DPU A;  5BMZ A;  2KRC A;  1S72 I;  4CGZ A;  4XL9 A;  3ABT A;  4OIQ F;  2UXP A;  5E8G A;  4WK8 F;  6PAX A;  1IZ1 A;  1Y6I A;  2DBB A;  1Q1H A;  2HWV A;  4B4C A;  1H89 C;  1W5T A;  3S3N A;  4P1W A;  2VC0 A;  3R4K A;  5DEQ A;  2Y2Z A;  2NNY A;  5ILU A;  4FCY A;  3QKX A;  4QTR A;  1MMN A;  4NHJ A;  1R5I D;  1Z3X A;  1KQ0 A;  4UUV A;  3HBL A;  3E7Q A;  3VOK A;  4HX4 A;  3HSR A;  2QOP A;  1HW2 A;  3DP7 A;  4HPQ A;  4MGR A;  3QOP A;  3HTA A;  1LDK B;  2ZKZ A;  4G6Q A;  4KIS A;  3TBI A;  3COL A;  4A5M A;  2QSF X;  2V9V A;  4DYR A;  1W1W E;  4FT8 A;  3S1R J;  1TQM A;  1TBX A;  3B6A A;  1JUM A;  3FF5 A;  5GAG J;  1VQ5 I;  2QSG X;  3NI7 A;  3KZZ A;  2Q0O A;  1U8R A;  1IJW C;  5CJ9 A;  2RHA A;  3A2K A;  3A03 A;  4L9J A;  2L2O A;  1GV5 A;  3TW6 A;  3F1B A;  1X4P A;  1OQY A;  1B59 A;  4ON0 A;  3C3W A;  2FBI A;  4NNJ A;  4E7J A;  4GFB A;  3JCU C;  3I59 A;  1LDJ A;  4V19 K;  2NVQ J;  4YZE A;  3J7A O;  4CCK A;  4B44 A;  5E8I A;  2CFO A;  3PSF A;  5CVI A;  2ETH A;  3KE2 A;  3PSI A;  3GW2 A;  3GTL J;  2FMY A;  2LF7 A;  2HS5 A;  2WAQ A;  1FX7 A;  2FA5 A;  3FHN A;  1DGR M;  2ZCX A;  4AC0 A;  2E5Z A;  5K7Z A;  3ON4 A;  1T39 A;  3OWT A;  4MEX F;  2ELJ A;  3FXL A;  4HRI A;  4LG0 B;  2ESH A;  2XB5 A;  3HIF A;  3FK6 A;  2FNP A;  4BBS J;  1QVU A;  4NQW A;  3CCM I;  4XLP F;  4FTH A;  2JPB A;  2NP5 A;  2WUI A;  2JA6 J;  4XMY A;  1HKS A;  1Z1D A;  4BGD A;  1ZG5 A;  1L3L A;  1X4O A;  2K9N A;  2KMU A;  3L1P A;  2OTL I;  2F5F A;  2M34 A;  3HEF A;  4Y4R A;  2XF7 A;  3J7Y J;  5BQT A;  4A5N A;  3Q5F A;  1MSE C;  1HC8 A;  5HNF A;  2DFF A;  3G4S I;  3HKZ N;  2QZ8 A;  5JI6 A;  2VI6 A;  2X1E A;  3DBR B;  1BIA A;  5IYB J;  2LD5 A;  4E7I A;  4JNN A;  4P55 A;  1WI9 A;  3I55 I;  2NP3 A;  2CGP A;  3FM5 A;  3IUO A;  3ON2 A;  4PJL A;  1TLH B;  4KUM A;  4PUS A;  2VKV A;  3AQT A;  2Z33 A;  4I0B A;  1TTY A;  2DOA A;  4BQN A;  1V4R A;  5D19 A;  3BPV A;  5IYC J;  3L9F A;  1DGW Y;  3GFI A;  3HC7 A;  4DIQ A;  3QP5 A;  1Y0N A;  1XG1 A;  3OYM A;  2QQA A;  3D5L A;  2HKU A;  1X3W B;  1BJZ A;  4MK6 A;  1D5Y A;  4CZZ A;  3P9K A;  2V9P A;  1FWZ A;  2Y30 A;  2CUJ A;  1D5V A;  2AHQ A;  3WU1 B;  3P9I A;  4CCL A;  1B6A A;  5DTD A;  2M8E A;  3CUQ C;  3OYN A;  5L3E A;  3H0D A;  2CV0 A;  2IS6 A;  4NN1 A;  4GDF A;  4FX0 A;  3GFM A;  5FD5 A;  4IO9 F;  3P9C A;  5F27 A;  3T5X A;  1ULY A;  3J81 K;  2PG4 A;  2QSH X;  3KZI C;  1EKE A;  4II2 A;  3JSJ A;  2EPF A;  2L7F P;  3PO2 J;  1EA3 A;  2QIB A;  3K1P A;  3OYC A;  2FSW A;  1BIB A;  5J8C A;  1EH6 A;  2E1M B;  3F9K A;  1MBE A;  3VOE A;  3CCE I;  5ICE A;  3ZQF A;  5D8K B;  2CQ7 A;  2LBF B;  1PP8 F;  5FLV A;  2H6C A;  5FB2 A;  5DS9 A;  4D0P A;  4BE1 A;  1ZHF A;  3FXJ A;  1V54 H;  2OJE D;  4QPO A;  3W6J B;  4BU2 A;  4M9Z A;  2XV4 S;  1OYY A;  3KCC A;  4DOZ A;  3KEO A;  4HNU A;  3P7N A;  3L2R A;  4EQQ A;  2VT3 A;  1WKM A;  2D2W A;  2W7N A;  1KU2 A;  5D5V B;  3VFZ A;  1ETY A;  3VP5 A;  3W2V A;  2HDC A;  1HKT A;  3W2W A;  3JRD A;  1HDD C;  3K10 A;  3CDI A;  3HOW J;  2Z9O A;  1FIP A;  2EV6 A;  2GAU A;  2H8W A;  2P7C B;  4CUG A;  5LEK A;  2MG4 A;  2HOT A;  3VYT B;  5F1J A;  1N78 A;  4M74 A;  3GTM J;  4MEY F;  2VKH A;  4KT5 C;  3OS2 A;  2MYS A;  4U7D A;  1U8B A;  2UXN A;  4G7H F;  1PUF A;  3Q9V A;  2EA2 A;  2O8X A;  5DDG A;  2IP2 A;  1E3P A;  4F55 A;  3TO9 A;  3PIP F;  4D5C A;  5LGT A;  4I99 C;  4PGG A;  1R49 A;  4HG2 A;  4CYC B;  4C2U A;  2CFX A;  5IY5 H;  4G6D A;  3LSP A;  2RKH A;  1WJC A;  3ANG A;  1AKH B;  4IOC F;  4C2M J;  2R5Y B;  5E3L A;  3IHU A;  3OYK A;  4YFK F;  1JUP A;  2P81 A;  2E71 A;  2IPQ X;  1YI2 I;  3EGQ A;  2VKE A;  1GVJ A;  1OFC X;  2EIL H;  2Y48 A;  2L4A A;  5D6E A;  5BNG A;  2LC2 A;  2MLK A;  3DTE A;  3DTK A;  3NRG A;  1ENH A;  1UFM A;  3M1E A;  5F0C A;  3F8B A;  3CCQ I;  3HDD A;  2VOO A;  1KYW A;  4FAS D;  3IRQ A;  1ERD A;  3S32 A;  3WE2 A;  2Y9Z A;  2QUF A;  1LEA A;  2ZME C;  2L0K A;  1USS A;  3I53 A;  1YO5 C;  3AG3 H;  1RRJ A;  5ILV A;  4DGW B;  4BY7 J;  1JUS A;  4XLA A;  4BH9 A;  1NH3 A;  3HIM A;  3K4B A;  1A5J A;  2LY9 A;  4RGS A;  4IRG A;  4JQF A;  4YIR X;  3L2W A;  2R5Y A;  4LG3 A;  2GBY A;  3HTJ A;  4EMS A;  2BHZ A;  5ED4 A;  1FBS A;  1QRY A;  3GXO A;  5H6Q A;  3SZP A;  4BKX A;  3HYI A;  3IAS 2;  1RNL A;  1K61 A;  1YG2 A;  2X6Y A;  4ZYE A;  1GV2 A;  4JBA A;  5CW8 A;  2RAE A;  2WY8 Q;  3GZN B;  3N4M A;  2FBK A;  3OOP A;  2O03 A;  2KJC A;  3RCO A;  1OCZ H;  1GLN A;  2Y0S A;  1A31 A;  3CME I;  2CUE A;  1R1U A;  4G8X A;  5CYV A;  1IXC A;  1J59 A;  5DM6 F;  4RGR A;  2EJR A;  1YE9 A;  4ASN A;  2EFO A;  1WH7 A;  4HA8 A;  4B3X A;  3FXU A;  3NWT A;  1BC8 C;  2HGC A;  3IH2 A;  2F5V A;  5EEG A;  1D8K A;  3HPG A;  1UB9 A;  4KIF A;  1H0M A;  3K8P C;  5HSZ A;  5JHU A;  2M4G A;  1BR4 A;  4U88 A;  3HGG A;  1EV7 A;  1IDY A;  2PMH A;  4WF2 A;  3I4N J;  2G9W A;  1NK2 P;  3ABM H;  3DKY A;  1WGX A;  1WWX A;  1YOV B;  1T0F A;  3BG7 A;  2ICW G;  4RGX A;  2R7Q A;  2HI3 A;  2IA0 A;  1Y0U A;  2VJ4 A;  2TCT A;  1XB4 A;  1XCB A;  2EBI A;  3IAM 2;  3ROU A;  2XSD C;  4PGH A;  2QGU A;  4OWR B;  3DBH B;  5B3S H;  5IOY A;  2DA2 A;  2OC6 A;  4ESB A;  5ERI A;  4FIS A;  2JA7 J;  3BY6 A;  3L2C A;  5JR3 A;  3ZQQ A;  2QQB A;  1RR7 A;  4I2O A;  2G7H A;  1MBK A;  3TP3 A;  4BAY A;  3F8N A;  4XK4 A;  2ID3 A;  3LL7 A;  1I6H J;  3DF8 A;  2CYY A;  3F3X A;  1RPW A;  1SC7 A;  5K58 A;  1RR8 C;  1YIJ I;  2UWM A;  5HLT A;  3HRS A;  4KN7 X;  3H5N A;  4AWX B;  3S15 J;  3K4K A;  3FZV A;  5DCM B;  1TT5 B;  4JK1 X;  4TV7 A;  2ZY9 A;  4Y17 A;  2W24 A;  3H3U A;  4M3E A;  4E7H A;  2DTZ A;  4ENJ A;  2ZJP F;  3H9G A;  4HW0 A;  4L5J A;  4AC6 A;  1DDN A;  3GTP J;  3HSE A;  1IRZ A;  2LRD A;  4L0Y B;  2QQ8 A;  2IS4 A;  1VFC A;  4EJT A;  2ELH A;  5HDG A;  4BAC A;  1YX5 A;  4Q4Z F;  2A5W A;  1ZLJ A;  3BG9 A;  1DPU A;  4ABZ A;  1ONV A;  2OZU A;  3I71 A;  3BR5 A;  2JA5 J;  3MMY B;  4ETS A;  3HOU J;  3CJQ B;  1Y8Q B;  1S7O A;  3ZMZ A;  3EUA A;  2Y9Y A;  3OMY A;  2AXL A;  1XGM A;  1IGN A;  4XLN F;  3RQ4 A;  3ANP A;  1TWA J;  4HKU A;  2QVO A;  2CW8 A;  4YIF A;  1O3Q A;  5E1X A;  4HSR A;  2IEK A;  2BZT A;  1I27 A;  3K9T A;  2WA0 A;  3GF2 A;  2EZK A;  2P5K A;  3OYB A;  4RLF A;  5K5O A;  1J0R A;  2PBX A;  3BJ6 A;  3GLX A;  1XGN A;  1E17 A;  4OD4 A;  2HVS A;  5EEH A;  2VN2 A;  1S7E A;  2GOM A;  4KWA A;  1W0T A;  1OKR A;  2O61 A;  2XRN A;  1FOX A;  3LSM A;  4KA4 A;  3MEX A;  5ICC A;  1ZK8 A;  2DG7 A;  3LST A;  5J1U A;  3JRI A;  4FET A;  4S04 A;  2ZFW A;  1J7K A;  3I3L A;  4ITV A;  2KP6 A;  2R3S A;  3CZ6 A;  1ZN2 A;  2WAD A;  5H9T A;  2CV1 A;  1UHS A;  2OZ6 A;  1JGS A;  2JSC A;  4OIP F;  2V4J C;  2RN7 A;  4YFX F;  4FX4 A;  1MBJ A;  3KPH A;  3BG6 A;  1IV8 A;  2XGX A;  3FWE A;  2Q1Z B;  1T8I A;  5FRO A;  1VQO I;  3OIQ A;  1K79 A;  2M0M A;  4GGG A;  4HV6 A;  1G3S A;  3ABL H;  2DYR H;  5M5Y J;  5C4X J;  1VQ8 I;  1BI2 A;  1ZYR F;  1CGP A;  4R8H A;  2XRO A;  3ZPL A;  5C4Y A;  5D5U B;  3JRH A;  2IA1 A;  3PNT A;  2OAZ A;  3JAM Z;  1IUF A;  5FRM A;  2KHM A;  2RRE A;  2GA1 A;  4PJM A;  1ORK A;  4UUS B;  3OIP A;  4B48 A;  3T1B A;  2LR8 A;  5BS6 A;  4RB3 C;  3BG3 A;  2F4I A;  3UR3 C;  4KT6 A;  1U9O A;  2G0E A;  5FKO A;  3G6E I;  3MWM A;  4QIW N;  1ETK A;  3MKY B;  1E3H A;  2A6T A;  3HUG B;  2BY3 A;  1MDM B;  1ON1 A;  2F4M B;  2OD5 A;  1PJR A;  4RM3 A;  1WHU A;  3VW0 A;  2ACJ A;  4W1U A;  2W48 A;  5EZG A;  2FRH A;  2DAO A;  3BQY A;  2XDV A;  4CA0 A;  2BW3 A;  4L18 B;  4CXF A;  5IT9 K;  2VIX A;  2GIZ A;  1YIO A;  3DWL E;  1WVR A;  2XF6 A;  2Z3Y A;  1MJ9 A;  1ZTR A;  2D5V A;  1QNT A;  4WCG A;  1NTC A;  4KMU X;  4EM0 B;  3MZ8 A;  5JVG F;  2NVU B;  2HPI A;  5LHH A;  4GYG A;  3GZ5 A;  3KYC B;  1Z05 A;  2O5R A;  4OOI A;  5FLX Z;  3G3Z A;  4ZDP A;  1IG7 A;  3FXO A;  4DJA A;  1TZL A;  2CG4 A;  4XLH A;  3TOA A;  3U9G A;  3NPI A;  3MQ0 A;  2ECB A;  2XKP A;  1U6G A;  3M8J A;  5E20 A;  2EQR A;  4DZJ A;  3C18 A;  4LK0 F;  4LB6 B;  1RET A;  2E36 A;  3HGY A;  2PMU A;  2QQ9 A;  3DLA A;  2P6T A;  1STZ A;  3BHQ A;  1FOW A;  2AXT C;  2VT2 A;  2WB1 A;  3CUQ A;  3HOZ J;  4U9L A;  2M4K A;  3FMS A;  3R60 A;  3FKJ A;  2DA4 A;  1T0F C;  1VZ0 A;  1SFO J;  4YG2 F;  1AWC A;  4YII A;  3MKL A;  1UG2 A;  4ZDL A;  3JSO A;  1ZQ3 P;  2P8T A;  4EAT A;  3ZN0 A;  3OYF A;  2DI3 A;  3VPR A;  4RDU A;  3CES A;  1BR2 A;  4A0X A;  1KU9 A;  2EFW A;  2H1L A;  4GCK A;  1W36 D;  1K6Y A;  2EV0 A;  5FJ8 J;  1BI0 A;  3E6B A;  3LWF A;  3LQR A;  2BGC A;  1FMW A;  2IU5 A;  4HEA 2;  4M6V A;  5EFY A;  2VUM J;  4XLF A;  4AU7 A;  3VTI A;  2MAB A;  3RZD J;  1X19 A;  2JPC A;  3TMO A;  3WE3 A;  3CMM A;  2X51 A;  4XLE A;  4DNC A;  2HQR A;  3CJN A;  3H9Q A;  2ADU A;  3CO6 C;  1K4T A;  1V5G A;  2OF7 A;  3KFW X;  3PL8 A;  3CCY A;  5KHD A;  1K7A A;  3ZQ7 A;  1G59 A;  2ZJQ F;  1T95 A;  4P9U A;  3KIO A;  5BPD A;  4L9T A;  3OYG A;  1VQL I;  2XAF A;  4M9X A;  3PO3 J;  4NDL A;  2Y75 A;  4HLX A;  4CH7 A;  3GZ6 A;  4FE4 A;  1JT0 A;  3G1M A;  1TNS A;  1YW9 A;  1ZGA A;  1DPR A;  2V26 A;  1IN8 A;  1K4S A;  2E19 A;  3K4L A;  3Q0U A;  4N9I A;  4XRF A;  4X6A J;  2JQ7 A;  2XGC A;  5DV5 A;  1U5T B;  4ZJZ A;  2HQA A;  3QOE A;  2VB6 A;  1ZG1 A;  4RB1 A;  2DCE A;  4XN0 A;  2NAZ A;  2M87 A;  5GTH C;  2DA5 A;  2K9S A;  2NYX A;  1F43 A;  1D1A A;  1SFU A;  2QLZ A;  5B1B H;  5HNH A;  4DVY P;  1I3A A;  3K70 C;  2JT1 A;  2PN6 A;  3SFI A;  2A68 F;  3HSF A;  3ONQ A;  5DAJ A;  2IGN A;  3H9J A;  4UV9 A;  2IVM A;  3DFG A;  4LIU A;  1TW2 A;  3VVX A;  3AQS A;  2Q24 A;  3S3O A;  4JKZ A;  2IBD A;  3CCR I;  1Z0X A;  4U87 A;  2CQQ A;  1DU6 A;  2AQF A;  4K2E A;  4XOP A;  2OI8 A;  1ZGW A;  1WH5 A;  4QLC U;  5FRN A;  1RIO H;  1D8J A;  4A0Z A;  4XBF A;  4Y52 J;  3B02 A;  3DBL B;  1U5T A;  2BHY A;  4U7B A;  2F48 A;  3O2P E;  4A0Y A;  4IKF A;  3S1Q J;  3E7L A;  4BEH B;  5J8F A;  2VON A;  2RC4 A;  2DDB A;  4IXA A;  3CF2 A;  3NAR A;  1APL C;  3S14 J;  2VJ5 A;  5FKN A;  2M9H A;  1T08 B;  3ASO H;  2DPD A;  4PFP A;  3HOX J;  2IS1 A;  1Z9C A;  2VE8 A;  2R5Z B;  2UUZ A;  3CDL A;  4II3 A;  2L9V A;  4I01 A;  2XB0 X;  1MIJ A;  4MTE A;  2QTQ A;  2F6C A;  2HTJ A;  5H20 A;  3V8J A;  4A69 C;  1V55 H;  2UXH A;  1KU7 A;  2EB7 A;  3PFI A;  1BM9 A;  3GWZ A;  4G12 A;  1VF9 A;  2K86 A;  5HLH A;  4Q47 A;  1UJ8 A;  3NNR A;  4C9Y A;  1HSJ A;  2V6E A;  4BQO A;  2CS3 A;  3K4N A;  4OIO F;  2LYC A;  1UI5 A;  5K1Y A;  1LKX A;  2D6Y A;  3WTW C;  3OYI A;  1RKW A;  1A04 A;  1QGP A;  4IHY A;  2KJB A;  1T56 A;  4CHU A;  2R7Z J;  4O5V A;  3UNG C;  3RPU D;  4A3F J;  3NRV A;  3MKZ A;  2IJL A;  2DMQ A;  2DXI A;  1W7P B;  1KON A;  1XGO A;  4C3H J;  4X0G A;  2DDA A;  2R5Z A;  2EWN A;  4BHC A;  2DA7 A;  4RM2 A;  3BTL A;  5D6F A;  3SEQ A;  1LFU P;  4O3M A;  1XTA A;  2CWE A;  5HS7 A;  3BC8 A;  3E6C C;  2J5O A;  3A0B C;  3BZK A;  1WCM J;  3PNY A;  4XKV A;  5FFX A;  1HLV A;  1Z91 A;  4PJN A;  3ZOB A;  5DUI A;  1OCC H;  4ZZD A;  3HTI A;  2ESN A;  4KIC A;  4ENM A;  2ZOZ A;  2JUG A;  2K7L A;  3DU6 A;  1IN7 A;  2H6B A;  3V8L A;  2E35 A;  4BQA A;  4BQQ A;  4U0V A;  4JL3 A;  3FBN B;  3BTJ A;  2LDU A;  2R7X A;  4DBQ A;  2COB A;  2V7F A;  3KP3 A;  1P4W A;  2LKX A;  1MSF C;  2FOW A;  1P4X A;  1SD7 A;  2OPT A;  5C4J J;  1A6Q A;  2DMT A;  4C3I J;  4AVP A;  2V6C A;  2E60 A;  2FQ3 A;  2LNB A;  3KP6 A;  5IT3 A;  3WTT C;  1SFX A;  4E4H A;  2A69 F;  3IWZ A;  1QBJ A;  1WJD A;  2P5V A;  3U21 A;  3SZG A;  1G3W A;  1TQI A;  2CU7 A;  2ZJR F;  1MMS A;  2OUM A;  1X3Z B;  4XR6 A;  2AQE A;  3ERE D;  2DMP A;  5CXI A;  2L7M P;  1MNM C;  1FEX A;  3GEU A;  2VLA A;  1BOA A;  2BOL A;  3K4J A;  4BJ5 C;  4IL6 C;  3TP0 A;  4LG0 A;  4E70 A;  2DT7 B;  4XON A;  5EEA A;  1I3Q J;  2FEZ A;  2K9L A;  4AF5 A;  1RZ4 A;  1XN7 A;  2LP0 A;  1FNN A;  4BHP A;  3LNQ A;  2QYO A;  2HXO A;  4QPQ A;  1B8I B;  4IHV A;  1X58 A;  1G8X A;  3RKW A;  3AG2 H;  2DFI A;  4IPA A;  5TGT A;  4RB2 C;  1JJ8 C;  3GO5 A;  1LNW A;  2XIG A;  3R61 A;  2P5L C;  2CQX A;  4KJZ A;  1MBF A;  2CH0 A;  1Q1V A;  4PSX A;  2LY2 A;  1JI8 A;  4KNY A;  4HBL A;  2WWY A;  3RH2 A;  4GO1 A;  1CQT A;  3ZMT A;  1PUE E;  1VQ4 I;  5JHF A;  3GBG A;  3H3Z A;  3U2R A;  1P9Q C;  2ZXJ A;  2I5U A;  4M3F A;  3QYB A;  2L7K A;  2WV0 A;  2DTR A;  1V5F A;  4BDZ A;  3DPJ A;  3F6V A;  3GX4 X;  5HBU A;  4UUT A;  2FQ4 A;  5GAE J;  2PX9 A;  1XC5 A;  2R7D A;  3BTI A;  4PSW A;  5L3F A;  3BCG A;  5F6F A;  1W5S A;  2B63 J;  4CCO A;  3D5R C;  2X1D A;  1ZAO A;  1O57 A;  1OYW A;  5HLG A;  2WBM A;  5HVQ C;  2WGB A;  2OU2 A;  2ZNZ A;  5LRR A;  3TGN A;  4LIV A;  5LLQ A;  5C44 J;  4J19 A;  4B8X A;  2EFP A;  1YRN B;  5D4R A;  5GAH J;  1MD0 A;  3RPU A;  4GFL A;  2K4B A;  2RNJ A;  1L0O C;  3ABK H;  3SDB A;  4BL0 B;  2QBY B;  1R7J A;  2CV2 A;  2XPV A;  5FGM A;  3C7J A;  1DP3 A;  3H92 A;  4UDS A;  3DPT A;  3AG1 H;  3KP2 A;  2MGQ A;  3QYF A;  2WY7 Q;  4C2M A;  1LDD A;  2K3P A;  4AID A;  2FX0 A;  2LBF A;  2KZG A;  3GLL A;  1BI3 A;  4GCV A;  1FY7 A;  1ODD A;  1WFX A;  2WAQ N;  2XAQ A;  3ULQ B;  2H8R A;  2HVR A;  4KFC A;  4IOA F;  1OJL A;  3W2A A;  3M8E A;  1X1P A;  3S16 J;  2G3B A;  3BJA A;  5H6R A;  3O8H A;  2XDN A;  3BOQ A;  2F5D A;  1U2W A;  2HDD A;  4FE7 A;  2MD0 A;  3ZQG A;  2MBF A;  2DOE A;  4OMY A;  3CC7 I;  3JTG A;  4L0Z B;  3WHB A;  2A07 F;  1TT0 A;  2EIN H;  1I1S A;  3J80 Z;  1B1B A;  2YVE A;  1X1C A;  3M4O J;  5CKT A;  4D5F A;  2PBI A;  4FHT A;  1FLI A;  2JRT A;  5GP9 A;  1HDP A;  1U5T C;  4UY8 I;  2HYG D;  4A3C J;  1E3O C;  2DFH A;  4WIB A;  3BPX A;  1FJL A;  4CYC A;  3CD6 I;  2HQ5 A;  2NS8 A;  3Q0V A;  3COA C;  2GXA A;  2NS7 A;  3CLQ A;  4IRV A;  2PMZ A;  1OLT A;  4MQ9 F;  1AKH A;  3SWH A;  3G2B A;  5B5E C;  1XPX A;  3GTQ J;  1E0E A;  3K70 D;  2LOO A;  2GQQ A;  1Z21 A;  2DMU A;  2JUC A;  1IV6 A;  4YRV A;  4DYQ A;  4RLQ A;  2HZD A;  2L02 A;  1MJA A;  3RJP A;  3HOT A;  3BCB A;  4LLG F;  4U0Y A;  4UVB A;  3KZ9 A;  4BNC A;  4GCL A;  2IGM A;  4YFN F;  2NS0 A;  3H0G J;  2LKS A;  5J40 A;  3VVY A;  3GVA A;  2KDZ A;  2O7O A;  2XAJ A;  4HX7 A;  4LLL A;  2F07 A;  2VQC A;  2EK5 A;  2LF8 A;  2KIQ A;  1KYZ A;  3EDP A;  3S1M J;  4I0A A;  1J5Y A;  4J00 A;  1SGM A;  1HOM A;  3AL0 B;  1ZR2 A;  2TRT A;  3FM3 A;  2NVY J;  2YX7 A;  1W36 C;  1J2X A;  3V4G A;  1IDZ A;  3A02 A;  1JJ6 C;  2R7T A;  2GEN A;  2PZ9 A;  1RES A;  2ZO4 A;  4HAM A;  3T8R A;  2FD5 A;  3TL4 X;  4M9S A;  3BWG A;  2MC4 A;  2PLY A;  2W1O A;  2KIS A;  1KQ8 A;  5J47 A;  2B7E A;  3KP4 A;  2BVM A;  3CLO A;  3LA7 A;  4RA2 A;  4WX9 A;  1KU3 A;  4JOM A;  4GFK A;  3I58 A;  3TKY A;  2V1N A;  1HQC A;  2LSO A;  3KKD A;  3MAJ A;  4F92 B;  5HDK A;  2FJI 1;  2I10 A;  2CQK A;  2X9D A;  4ZYA A;  3TQN A;  1ZRE A;  2LMD A;  2UXO A;  4UNO A;  4HOB A;  3HJE A;  2OA4 A;  5HOD A;  2BY1 A;  3BNI A;  4I98 B;  2ME6 A;  2JSP A;  1VND A;  3FXQ A;  2VJJ A;  2QA4 I;  2Y31 A;  4XSX F;  4XIC A;  1K83 J;  2RQQ A;  2R7W A;  2IA2 A;  1O3S A;  4ZDO A;  4NBQ A;  1IN5 A;  2VXZ A;  2L7Z A;  2M7A A;  3E5U A;  3IL2 A;  1YS7 A;  1T33 A;  4B1R A;  2W25 A;  2XHK A;  3JRB A;  5AQC A;  4CCJ A;  3EET A;  3G71 I;  3QRF F;  4Z6Y A;  1SAN A;  3NQO A;  3LSI A;  4BJ6 C;  1H88 C;  1B9N A;  2W84 A;  1UHM A;  3JR9 A;  4G9Y A;  3CUO A;  2HPM A;  2L3D A;  3VOD A;  4HNT A;  2VPR A;  3J7A Y;  1JKQ C;  4MXM A;  1QPI A;  4V2F A;  4PXI A;  2KQR A;  1FPQ A;  3FIS A;  3EUP A;  3F8C A;  3QU6 A;  3TDU C;  3CCS I;  1WI3 A;  1HW5 A;  1UZC A;  3I4P A;  5E18 F;  1AHD P;  3F23 A;  4G94 A;  2M0C A;  4PFO A;  2QKO A;  2RVC A;  4OMZ A;  2LVS A;  4HV5 A;  3CCU I;  3FRQ A;  2P7V B;  2E2J J;  1YJW I;  3WG7 H;  1QO0 D;  3GYH X;  1X3U A;  1ZEL A;  2PMZ N;  3GTJ J;  5IPA A;  3V6G A;  5F08 A;  4EJV A;  4CCN A;  1ETW A;  2DW4 A;  3ZMU A;  2NRA C;  1A6I A;  1EF4 A;  2VQL A;  3W3C A;  3ELK A;  2JA8 J;  1ACI A;  2D1V A;  4A3K J;  1UHW A;  2NNN A;  4XNF A;  3QBM A;  5DCM A;  3U1D A;  1O3T A;  2Q2E B;  4A3E J;  2HKX A;  3J7Z I;  1MMG A;  3WGH A;  3MFK A;  4M72 A;  4M73 A;  3LFK A;  3LAJ A;  1XGS A;  2HYF A;  5DCF A;  4V2G A;  2CW0 F;  2Y0S N;  1OCR H;  1S3J A;  2BYV E;  1IO2 A;  5J1R A;  3VB2 A;  4BXF A;  2R0Q C;  5TRD A;  3LSK A;  3QAH A;  5TIS C;  2FBH A;  1XDS A;  4NUB A;  1ON2 A;  1HXD A;  3LOC A;  4E7Z A;  4C2T A;  2EH3 A;  4AVZ A;  1SVM A;  3H5R A;  3U1K A;  1U9N A;  3V7S A;  3QP6 A;  2C6Y A;  1JKP C;  5KAF C;  4ESJ A;  2AS5 F;  1FP2 A;  2KT0 A;  2E1M C;  5EGO B;  3RKY A;  1OIS A;  1R22 A;  3V42 A;  2XF5 A;  3WGG A;  2DOF A;  2E1N A;  3E97 A;  4RAZ A;  4ENK A;  3GZI A;  2YR2 A;  5DD8 A;  3A4C A;  1FP1 D;  3C2G A;  2R7U A;  2NX4 A;  4AYB A;  1OR7 A;  4LJZ F;  4RAF A;  2YVX A;  3VYR B;  2RV8 A;  2HXI A;  3MCZ A;  1XDU A;  3HOY J;  2GUH A;  3FIW A;  1UMQ A;  1HKQ A;  1ETX A;  5CVV A;  1GXP A;  2K9Q A;  1ETO A;  2FF4 A;  4LD5 A;  2PJR B;  2DYS H;  2R7R A;  4H4K C;  2PI0 A;  3HE0 A;  3VYU B;  3QYE A;  5JLW A;  4IJA A;  3F72 A;  5IP6 A;  3GTO J;  2ME0 A;  1VQM I;  2I8D A;  2EIJ H;  2HYT A;  1B72 B;  1RKT A;  3ESW B;  5M3F J;  2UV1 A;  3RKQ A;  2MLG A;  2P6S A;  2XVC A;  4M3D A;  1QHH D;  3OYL A;  1MBH A;  1IRX A;  2L5Q A;  1WJE A;  1ZKG A;  3A01 B;  4ZTJ A;  2EZH A;  2FXA A;  1O4X A;  1PP7 U;  2NVT J;  5KNL A;  4BE2 A;  4I09 A;  2MSY A;  3ERM A;  1QU3 A;  2ISZ A;  2B1E A;  1JHF A;  2KZV A;  3BZC A;  1YW8 A;  3I9V 2;  1FMV A;  5LEJ A;  4PJ0 C;  4E7L A;  2XAH A;  4QWQ A;  3P9T A;  1B9M A;  1R4N B;  4ACI A;  1H9T A;  5AIP A;  1TP4 A;  5EG0 B;  2FBQ A;  3HOS A;  3HRM A;  2HZT A;  2AO9 A;  3RPQ A;  1Z77 A;  4U0W A;  4MNU A;  5FLM J;  3TW7 A;  5K7H A;  2H09 A;  3HZJ A;  2COM A;  3JAM K;  1TNT A;  1XCV A;  1B72 A;  3B6C A;  3KET A;  2CUZ A;  3Q3S A;  4RAY A;  2ID6 A;  3REO A;  1HCR A;  4UUS A;  1R36 A;  3ZQI A;  3O8G A;  1YJ9 I;  1T38 A;  3CDH A;  1LQ1 A;  4QSH A;  2OER A;  1YLF A;  5CLS A;  3JRC A;  5CXG A;  1SFE A;  1CF7 B;  3CJR B;  3CO7 C;  5L3G A;  3K4C A;  4LOC A;  3WHC A;  5KVR A;  1PVE A;  3HUG A;  3I0T A;  5LGU A;  1MDM A;  1GT0 C;  1I1G A;  3S5R A;  2VQG A;  4XOT A;  3DPL C;  4MHG A;  4EJW A;  4N9H A;  5HDN A;  2Y69 H;  5FKK A;  2G7U A;  2P4W A;  3V7R A;  4BJT A;  1DUX C;  2WAE A;  1MH3 A;  4YEJ A;  2GM4 A;  2TDX A;  3ZMD A;  2YSR A;  5GPC A;  3BZ6 A;  3FMR A;  1ZAR A;  2VJI A;  3CMY A;  1NG7 A;  3ZRG A;  3AL0 C;  1S7A A;  4P9F A;  1F4K A;  4HQE A;  4HQM A;  2NOG A;  3F21 A;  2DU9 A;  3WG9 A;  4UVC A;  2M8G X;  1TC3 C;  2FUG 2;  1B4A A;  2ZXH A;  5A2Q Z;  2FJ1 A;  2QF7 A;  2WAF A;  5KCM A;  4RMN A;  1U78 A;  4Q5S F;  3N05 A;  1TQP A;  3IV5 A;  5LFA A;  2VKD A;  3AFH A;  1VQ9 I;  2ECC A;  3OYH A;  4IRH A;  3ZR8 X;  1I5Z A;  4B47 A;  4IX7 A;  3HRT A;  3BRU A;  1JXS A;  1EJ9 A;  1E2X A;  2W82 A;  3BDD A;  5HLI A;  3L7W A;  2BXY A;  2A5Y B;  2KKO A;  2K40 A;  4XM3 A;  4Z2Y A;  3VDX A;  4Y33 A;  1D0Y A;  1UCR A;  1S8N A;  4W97 A;  5DUK A;  1R00 A;  4R1H A;  5H2F C;  1K78 B;  4KYW A;  4UB6 C;  1ETV A;  3KP5 A;  1SFK A;  1R23 A;  1AU7 A;  3S17 J;  2ZOY A;  1MJB A;  2HVQ A;  2K27 A;  1W7P D;  5JLX A;  5K5R A;  2CQN A;  3CF5 F;  1WQ2 A;  4O6J A;  3R6S A;  4GXO A;  5F0F A;  5J4Y A;  3OS1 A;  1K6O A;  1ETQ A;  5J6X A;  1XMK A;  2A61 A;  2BV6 A;  5CQG A;  5FFZ A;  1TWC J;  2JA2 A;  5FD6 A;  4G7Z F;  2JTV A;  1Y1V J;  4HF2 A;  4CGR A;  2RQP A;  3HHH A;  3MZY A;  3LSG A;  3LAP A;  2F5E A;  1MMA A;  3L00 A;  3IP4 B;  4M6Y A;  4A6E A;  2GFN A;  2ZME B;  3HKZ A;  2YS9 A;  2DK5 A;  1FT9 A;  3JRF A;  1A35 A;  3LJL A;  2K4J A;  2L01 A;  5E79 C;  2M5W A;  1IUY A;  3H1C A;  4KIG A;  5TJJ A;  3ZXS A;  3DCF A;  5KK1 A;  2EFQ A;  3GEZ A;  1JTY A;  3CQZ J;  2JMW A;  2KFD A;  1WZ2 A;  2BBY A;  2OTJ I;  4C3J J;  1JE8 A;  3WTY C;  2D1H A;  2DO7 A;  3JRA A;  3PPB A;  3HTU A;  3OV8 A;  3IUV A;  4BDY A;  4E7K A;  2F2E A;  2VXD A;  4UV8 A;  4KDP A;  3HM5 A;  3R0J A;  3EYY A;  4L5E A;  2QKL B;  2Z5U A;  4A93 J;  4KN4 X;  1F1Z A;  3K6G A;  1XS9 A;  4BE0 A;  1X1D A;  4ZYG A;  1R6R A;  1YYV A;  2JN6 A;  5CVR A;  1FOK A;  1BN5 A;  2ZCW A;  5CVJ A;  1S5L C;  2OCC H;  3CC2 I;  2H1K A;  5D1R A;  1TW3 A;  1U3E M;  1OR7 C;  1QPM A;  1U0J A;  4DW6 A;  2WB1 N;  2PJP A;  4N4N B;  4G7O F;  1X2N A;  3LA2 A;  5EDN A;  1N75 A;  4MIM A;  4A12 A;  1YIT I;  5FHP A;  3NWS A;  2E2I J;  1FBQ A;  2ZFU A;  3I59 B;  1BC7 C;  2ZXW H;  1LUJ B;  2X6W A;  3RSN A;  4BEH A;  3M1C A;  3OR2 C;  4I7H A;  3IC7 A;  1KZH A;  4JYK A;  4CSW A;  4N4O B;  1SD4 A;  3VW1 A;  3SZT A;  4HLY A;  2X1C A;  2VL8 A;  2NOJ B;  3HOV J;  3CTA A;  1IXR C;  1YW7 A;  3OOU A;  3ZQH A;  1Y1W J;  2NVX J;  2FOK A;  2HFH A;  3OS0 A;  2E1C A;  3E6D A;  4M6X A;  1LE8 B;  4S0H B;  2K02 A;  2KDO A;  2EFN A;  5E3M A;  3V78 A;  4ZC3 A;  3H5A A;  4NQW B;  3LFU A;  3L2U A;  4D7M A;  1LB2 A;  3OSG A;  3HL2 A;  2DLL A;  3SYT A;  3OYE A;  4EGY A;  4IHX A;  4RS8 A;  1X2M A;  1R71 A;  2RGV A;  5LBQ A;  3NXC A;  2Z16 A;  2CRG A;  3Q0W A;  2R7V A;  2JVG A;  3OIO A;  4L62 A;  1MZB A;  1JT6 A;  3Q9S A;  1VI0 A;  3L09 A;  4DQ2 A;  5IOZ A;  3E6M A;  3LA3 A;  3K1M A;  3BG5 A;  4Y7N J;  4NEL A;  2IGK A;  5JFR A;  1LPQ A;  5ICF A;  1MGT A;  2JVH A;  2ZC2 A;  3HXL A;  2OBP A;  1W7P A;  2L9R A;  4D1Q A;  3DLL F;  1BI1 A;  2X0L A;  2GLO A;  4BHB A;  2BXZ A;  3TED A;  2IXS A;  3DQV C;  1YTY A;  4HX8 A;  1QA6 A;  1LE8 A;  2LH9 A;  1WPK A;  4RB0 A;  5GTI C;  4F91 B;  2MD5 A;  4A6D A;  2STW A;  3BCA A;  2E1O A;  2MW8 A;  4GYI A;  3ZQC A;  5LD2 C;  5C3E J;  2IS2 A;  2R7F A;  1D0Z A;  4Y15 A;  2EA4 A;  3WOD F;  2K85 A;  4XRM A;  2XGD A;  5F64 A;  3LWJ A;  4L5I A;  5CQE A;  4XRS A;  3S2H J;  2XAG A;  3H3V K;  3KX2 A;  4NB5 A;  3RQI A;  1WJF A;  3ABU A;  3KZY A;  1OCP A;  3BP8 A;  2DT5 A;  1N77 A;  2F4O B;  3RIR A;  4KIB A;  4LLN A;  1JHH A;  3DPU A;  3OYA A;  1R1T A;  1SVL A;  1VQN I;  1YJN I;  3J81 Z;  1SMT A;  4HYE A;  1BA5 A;  3ISP A;  1R1V A;  1LVA A;  5JVT A;  1MND A;  3HG9 A;  4E6K G;  1WJA A;  3K2Z A;  3ASN H;  3K4M A;  2KL4 A;  3SEZ A;  2ZXI A;  1R4M B;  4M3B A;  4PZJ A;  1O7F A;  2VBY A;  4XSZ F;  3BLY A;  1I6X A;  3DV8 A;  3S2W A;  2FU4 A;  3WTV C;  2MH9 A;  1V3F A;  4E7S A;  3FDY A;  4X1E A;  1IN6 A;  3FX3 A;  2DFE A;  5BPI A;  2R92 J;  2O0Y A;  3CWR A;  4ENN A;  3F8F A;  2WC2 A;  2LG4 A;  1FSH A;  1IRF A;  5J3L A;  1SVO A;  2DQR A;  2FML A;  4YEL A;  1W0U A;  3HPH A;  3ZMV A;  2VQH A;  3VOX A;  3VW2 A;  2K5C A;  4PDK A;  4F52 A;  1QQI A;  1B8I A;  3C2B A;  2X85 A;  1QZE A;  3CJD A;  2DA6 A;  1VQ7 I;  2X6O A;  5E1Z B;  3OY9 A;  5AIQ A;  2GXB A;  3P5J A;  4L9V A;  1IXS B;  2E5N A;  3WU0 A;  5KAI C;  4B3A A;  4CDG A;  3KLN A;  1BW6 A;  5E3O A;  5L3D A;  3SDG A;  1QVT A;  4XQF A;  3RD3 A;  1RUO A;  1N25 A;  3AAF A;  3PJR A;  1PUF B;  5IYD J;  1X1A A;  5L3B A;  1G3T A;  4J01 A;  1QZY A;  2DA1 A;  3S1N J;  3S93 A;  1ITY A;  3G1L A;  2GWR A;  2MFZ A;  3BJO A;  4EVI A;  3OYJ A;  2F5C A;  5LGN A;  4Y3O A;  4DZP A;  2JRM A;  3QPL A;  1FC3 A;  2DJI A;  2VE9 A;  3IH3 A;  1VTN C;  3VWB A;  1YFH A;  3KLO A;  2OV7 A;  2JK3 A;  2IRF G;  4UB8 C;  5DM7 F;  4B09 A;  4S05 A;  1T6S A;  2YU9 J;  3HTH A;  9ANT A;  2K9M A;  2VOP A;  2BVL A;  2Z99 A;  2QWW A;  1YRN A;  4CZC A;  2Z2S B; 
#chains in the Genus database with same CATH homology
 2QKO A;  3B6A A;  1JUM A;  3NPI A;  2LVS A;  2ECB A;  4DZJ A;  3NI7 A;  2EQR A;  1IJW C;  3FRQ A;  3IH4 A;  2RHA A;  2E2J J;  4BBR J;  1BL0 A;  3A03 A;  1RET A;  3HGY A;  1GV5 A;  2PMZ N;  3TW6 A;  3GTJ J;  5IPA A;  3F1B A;  3V6G A;  5F08 A;  4A3D J;  1ETW A;  3BHQ A;  1GDT A;  4GFB A;  2REK A;  1A6I A;  1EF4 A;  5F0H A;  3HOZ J;  2JA8 J;  2NVQ J;  3BQZ A;  3KKC A;  4A3K J;  2O9L A;  4YZE A;  4A3L J;  2DA4 A;  3QBM A;  1SFO J;  4JX4 A;  4A3E J;  3MKL A;  1UG2 A;  2CJJ A;  2CUF A;  1ZQ3 P;  3GTL J;  2ZCX A;  3VPR A;  4RDU A;  5HAW A;  4AC0 A;  4V2G A;  2Y0S N;  5K7Z A;  3ON4 A;  5J1R A;  2XB5 A;  3FK6 A;  2R0Q C;  4GCK A;  4BBS J;  4GCT A;  1QVU A;  5FJ8 J;  4FTH A;  1JKR C;  2WUI A;  2IU5 A;  2NP5 A;  3GTK J;  4M6V A;  3LOC A;  5EFY A;  2VUM J;  2EH3 A;  2JA6 J;  3HB9 A;  5E3N A;  3RZD J;  1JTX A;  1U9N A;  2K9N A;  3L1P A;  3KNW A;  3HEF A;  2M34 A;  1MSE C;  2OF7 A;  2N8G A;  1JKP C;  3HKZ N;  2KT0 A;  3CCY A;  5EGO B;  1OCT C;  3RZO J;  1UI6 A;  2VI6 A;  1FIA A;  5F04 A;  5IYB J;  5IP9 J;  2LD5 A;  2LK2 A;  3PO3 J;  3GZI A;  4JNN A;  4NDL A;  3CRJ A;  4FE4 A;  2NX4 A;  2NP3 A;  1JT0 A;  3G1M A;  3ON2 A;  2R93 J;  3G56 A;  2VKV A;  2EZL A;  3AQT A;  2HXI A;  2E19 A;  3HOY J;  2GUH A;  3Q0U A;  3FIW A;  4X6A J;  1UMQ A;  3BTC A;  2XGC A;  5D19 A;  3MN2 A;  1ETX A;  3BR0 A;  5IYC J;  2K9Q A;  1ETO A;  1XG1 A;  2DA5 A;  2K9S A;  2HKU A;  3HE0 A;  3S2D J;  4M3G A;  1BJZ A;  5JLW A;  1F43 A;  4MK6 A;  3FK7 A;  1D5Y A;  2G7S A;  4MLO A;  3SFI A;  2QCO A;  5IP6 A;  2Y30 A;  2ME0 A;  3GTO J;  3NAU A;  5DAJ A;  3D1N I;  5FMP A;  2HYT A;  1B72 B;  2AHQ A;  1ZR4 A;  1RKT A;  5DTD A;  3VVX A;  3AQS A;  2Q24 A;  5M3F J;  3RKQ A;  4JKZ A;  2JWT A;  4NN1 A;  1LFB A;  2O7T A;  2M2E A;  2IBD A;  4M3D A;  1Z0X A;  1MBH A;  2CQQ A;  5F27 A;  1ZKG A;  3A01 B;  1O4X A;  2NVT J;  2EZH A;  1DU6 A;  2OI8 A;  1P7J A;  1ZGW A;  1WH5 A;  4D7N A;  2DJN A;  2MSY A;  3JSJ A;  4AUX A;  3PO2 J;  2L7F P;  2QIB A;  4Y52 J;  2HOA A;  3BR6 A;  1POG A;  3S1Q J;  2ELK A;  1MBE A;  3P9T A;  3E7L A;  3ZQF A;  1HF0 A;  4ACI A;  5FLV A;  4MFE A;  1JKO C;  5EG0 B;  2FBQ A;  5DS9 A;  3T6N A;  3NAR A;  2AO9 A;  1APL C;  2YUS A;  3S14 J;  1Z77 A;  5FKN A;  1JGG A;  5FLM J;  3TW7 A;  5K7H A;  2M9H A;  3HOX J;  1B72 A;  2HYJ A;  3B6C A;  2R5Z B;  1ETY A;  3CDL A;  3ZQL A;  4ME9 A;  3Q3S A;  3VP5 A;  2ID6 A;  2XB0 X;  1HDD C;  3JRD A;  1HCR A;  4UUS A;  3PAS A;  3ZQI A;  2IAI A;  3O8G A;  3HOW J;  2QTQ A;  1FIP A;  4A69 C;  2UXH A;  2ZCN A;  4QSH A;  2OER A;  2MG4 A;  3JRC A;  2HOT A;  3FKI J;  5CXG A;  2LFB A;  4G12 A;  4LOC A;  4MO7 A;  1VF9 A;  3WHC A;  5F1J A;  3GTM J;  3NNR A;  5D18 A;  3W6V A;  3UKG A;  3MNL A;  1R9T J;  1GT0 C;  1FTT A;  1U8B A;  1UI5 A;  3S5R A;  1H8A C;  1PUF A;  1FTZ A;  2D6Y A;  1RKW A;  4IHY A;  2LLK A;  4D5C A;  1T56 A;  5FKK A;  2R7Z J;  4CYC B;  4A3F J;  3LSP A;  2DMQ A;  3ANG A;  1AKH B;  4A3G J;  1MH3 A;  4C3H J;  3JRG A;  2GM4 A;  4C2M J;  2R5Z A;  2R5Y B;  3M3Y J;  1TWG J;  2DA7 A;  5FKL A;  3BTL A;  5E3L A;  5GPC A;  1LFU P;  3G1O A;  1JUP A;  2P81 A;  3EGQ A;  2VKE A;  3CMY A;  1WCM J;  2XPW A;  1HLV A;  3HTI A;  5BNG A;  1OFC X;  3ZOB A;  1NK3 P;  4JP0 A;  2ZOZ A;  3NRG A;  1ENH A;  5F0C A;  2NOG A;  3HDD A;  2M8G X;  1TC3 C;  2Y9Z A;  2FJ1 A;  4JL3 A;  3BT9 A;  3BTJ A;  1MH4 A;  2QF7 A;  2COB A;  2L0K A;  1U78 A;  2O8K A;  2QWT A;  2LKX A;  2DA3 A;  3IV5 A;  4BY7 J;  1MSF C;  4I6Z A;  2OPT A;  5C4J J;  1JUS A;  2DMT A;  4C3I J;  2ECC A;  5IP7 J;  3HIM A;  1A5J A;  2LY9 A;  3BRU A;  5M5X J;  3OSF A;  2R5Y A;  3HTJ A;  2CU7 A;  2GBY A;  2G7G A;  2K40 A;  1QRY A;  4BKX A;  2DMP A;  4W97 A;  5CXI A;  2L7M P;  1MNM C;  1FEX A;  2XRL A;  1K61 A;  3GEU A;  1TWF J;  1ETV A;  4ICH A;  1GV2 A;  3TP0 A;  5CW8 A;  2RAE A;  5EEA A;  1AU7 A;  1I3Q J;  3S17 J;  2ZOY A;  5JLX A;  2LP0 A;  2CUE A;  4A3B J;  3LNQ A;  5EF6 A;  2HXO A;  1B8I B;  4IHV A;  1X58 A;  5F0F A;  1JJ8 C;  1ETQ A;  2CQX A;  3VUQ A;  1MBF A;  3VVZ A;  1TWC J;  1WH7 A;  4CGR A;  3K2A A;  1Y1V J;  1Q1V A;  3PM1 A;  5EGO A;  3LSG A;  2X48 A;  2GFN A;  3O60 A;  3LHQ A;  2YS9 A;  3IH2 A;  3RH2 A;  3JRF A;  1CQT A;  3LJL A;  3DEW A;  5HSZ A;  3GBG A;  3LSJ A;  1MBG A;  4M3F A;  3DCF A;  3HGG A;  5M5W J;  1IDY A;  1GUU A;  3DPJ A;  1JTY A;  3CQZ J;  2JMW A;  3I4N J;  3MVP A;  5HBU A;  1P7I A;  4UUT A;  1NK2 P;  2FQ4 A;  3BTI A;  1XC5 A;  1WGX A;  4C3J J;  3BCG A;  2B63 J;  3JRA A;  3PPB A;  2HI3 A;  3IUV A;  2TCT A;  5K7F A;  3HM5 A;  4XID A;  2EBI A;  4L5E A;  4A93 J;  2XSD C;  3BR2 A;  2WGB A;  4J19 A;  1XS9 A;  5C44 J;  5IOY A;  2DA2 A;  1YRN B;  4FIS A;  2ZB9 A;  2JA7 J;  2JN6 A;  4XRS G;  4GFL A;  1G2H A;  1RR7 A;  1MBK A;  2WV1 A;  2XPV A;  3A01 A;  3TP3 A;  2H1K A;  3G7R A;  4XK4 A;  2ID3 A;  1I6H J;  4UDS A;  5D1R A;  1RPW A;  2MGQ A;  2WB1 N;  4DW6 A;  1X2N A;  5K58 A;  5EDN A;  4MIM A;  5FHP A;  3VIB A;  2E2I J;  2DG8 A;  4DYR A;  2FX0 A;  5EG0 A;  3S15 J;  3GTG J;  4AF5 A;  2H8R A;  2WAQ N;  4JYK A;  3BR3 A;  3VW1 A;  4A3J J;  1OJL A;  2G7L A;  3HOV J;  1Y1W J;  3OOU A;  3ZQH A;  2NVX J;  4RBO A;  4M3E A;  2DTZ A;  3S16 J;  1LE8 B;  2G3B A;  4S0H B;  3LSR A;  3V78 A;  5EZH A;  5E3M A;  2XGE A;  3O8H A;  4IHW A;  2XDN A;  4AC6 A;  3GTP J;  2HDD A;  4FE7 A;  3ZQG A;  1IRZ A;  4A3M J;  4D7M A;  3OSG A;  4JX5 A;  1VFC A;  3WHB A;  4BY1 J;  4I76 A;  1TWH J;  3BG9 A;  4IHX A;  1IC8 A;  4ABZ A;  1X2M A;  2YVE A;  2LTP A;  3BR5 A;  3NXC A;  2JA5 J;  3HOU J;  3M4O J;  4D5F A;  1BW5 A;  5FGL A;  2CRG A;  3Q0W A;  5EYR A;  5GP9 A;  3OIO A;  4L62 A;  1HDP A;  4A3C J;  1E3O C;  1JT6 A;  2Y9Y A;  1VI0 A;  4AYB N;  1IGN A;  5IOZ A;  3ANP A;  1FJL A;  4Y7N J;  1TWA J;  3BG5 A;  4CYC A;  2HQ5 A;  1DU0 A;  2UXU A;  2NS8 A;  4HKU A;  4NEL A;  3Q0V A;  2E2H J;  2NS7 A;  2JJ7 A;  1AKH A;  2L9R A;  4MFD A;  3SJM A;  2GLO A;  3GTQ J;  2IEK A;  3TED A;  2DMU A;  1IV6 A;  1LE8 A;  3I4M J;  1F36 A;  4DYQ A;  1WPK A;  2EZK A;  3QQA A;  2E1O A;  2MW8 A;  3ZQC A;  2PBX A;  3KZ9 A;  5C3E J;  5J1Y A;  2RAS A;  4GCL A;  2ZCM A;  4XRM A;  4EEF G;  2XGD A;  3LWJ A;  4XRS A;  3H0G J;  3S2H J;  3VVY A;  2KDZ A;  3H3V K;  2O7O A;  3RQI A;  1S7E A;  4KWA A;  1OCP A;  1W0T A;  4HNV A;  2F07 A;  1ZK8 A;  3B81 A;  3S1M J;  1I50 J;  2DG7 A;  3JRI A;  5J1U A;  1SGM A;  1HOM A;  2YVH A;  1ZR2 A;  2TRT A;  2W53 A;  2NVY J;  1BA5 A;  5H9T A;  2DN0 A;  2GEN A;  1IDZ A;  1UHS A;  3A02 A;  1JJ6 C;  3QPS A;  5FKM A;  2PZ9 A;  1RES A;  3BJB A;  2FD5 A;  2UXI A;  1MBJ A;  3C07 A;  2V57 A;  4M3B A;  4DYC A;  5M5Y J;  4X1E A;  5C4X J;  4BXX J;  4A3I J;  4GFK A;  2R92 J;  3KKD A;  3CWR A;  2I10 A;  5J3L A;  5C4Y A;  2X9D A;  1W0U A;  4IEJ A;  3JRH A;  3VOX A;  3VW2 A;  1IUF A;  2DMN A;  1B8I A;  2UXO A;  1GVD A;  3C2B A;  3F0C A;  4JX6 A;  1ORK A;  5M3M J;  4UUS B;  3CJD A;  3JRE A;  2DA6 A;  2LR8 A;  5HOD A;  2HOS A;  3BNI A;  3BG3 A;  2ME6 A;  1VND A;  1U9O A;  2G0E A;  2XPU A;  2X6O A;  5FKO A;  2Y31 A;  4QIW N;  1ETK A;  4XIC A;  3BR1 A;  1K83 J;  4B3A A;  2EZI A;  1BW6 A;  3K7A J;  5E3O A;  5GPA A;  3SDG A;  1QVT A;  2L7Z A;  3RD3 A;  1T33 A;  5IYD J;  1PUF B;  4B1R A;  3VW0 A;  2DA1 A;  3JRB A;  3S1N J;  2UXP A;  5AQC A;  1ITY A;  4W1U A;  2W48 A;  5EZG A;  3BQY A;  3G1L A;  4B4C A;  1H89 C;  1SAN A;  2Y2Z A;  4FCY A;  4DZP A;  1H88 C;  3QKX A;  4QTR A;  3JR9 A;  3QPL A;  1ZTR A;  3HBL A;  2D5V A;  3E7Q A;  1NTC A;  3IH3 A;  3VOK A;  2VPR A;  2QOP A;  1JKQ C;  4MXM A;  1QPI A;  4V2F A;  4PXI A;  2JK3 A;  3FIS A;  3EUP A;  2YU9 J;  3HTA A;  1WI3 A;  3HTH A;  9ANT A;  1AHD P;  3COL A;  1IG7 A;  2M0C A;  1YRN A;  3S1R J; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...