1JTZX

Crystal structure of trance/rankl cytokine.
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
155
structure length
155
Chain Sequence
b'QPFAHLTINAASIPSGSHKVTLSSWYHDRGWAKISNMTLSNGKLRVNQDGFYYLYANICFRHHETSGSVPTDYLQLMVYVVKTSIKIPSSHNLMKGGSTKNWSGNSEFHFYSINVGGFFKLRAGEEISIQVSNPSLLDPDQDATYFGAFKVQDID'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords TUMOR NECROSIS FACTOR LIGAND SUPERFAMILY MEMBER 11
publication title Crystal structure of the TRANCE/RANKL cytokine reveals determinants of receptor-ligand specificity
pubmed doi rcsb
source organism Mus musculus
molecule tags Cytokine
total genus 29
structure length 155
sequence length 155
chains with identical sequence Y, Z
ec nomenclature
pdb deposition date 2001-08-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
X PF00229 TNF TNF(Tumour Necrosis Factor) family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.40 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 1jtzX00
1PK6A 4OUSA 1D0GA 1KD7A 1U5XA 2ZJCA 1PK6B 1D2QA 3ME2A 5KWRA 1TNRA 1A8MA 3MI8A 4QQOA 4KGGA 2JG9A 2QDNA 5BNQA 1IQAA 2RE9A 4RSUA 2JG9B 1PK6C 2HEWF 2RJLA 2E7AA 1JTZX 1KXGA 4N90A 1GR3A 4HT1T 1XU1A 4NN0A 1DG6A 4GIQA 2JG9C 1WCKA 2R30A 4D7YA 1RJ8A 1C3HA 2RJKA 3AB0A 3B93A 4EN0A 2R32A 2KA3A 5L19A 1ALYA 4QQLA 1DU3D 4MXVA 1OSGA 4OUMA 2Q8OA 2O0OA 3QBQA 2HEYF 4MXWA 2JG8A 3B9IA 3FC0A 3WD5A 4TWTA 3B94A 2TNFA 3V56A 2HEVF 1U5ZA 1XU2A 2TUNA 1OQEA 2WNVA 4G4FA 1U5YA 1TNFA 2Q1MA 5KC5A 4KGQA 1S55A 3TWIA 3K51A 3QD6A 2ZPXA 4TSVA 2AZ5A 3TYJA 5HBAA 3IT8A 4G3YC 2R6QA 4F3JA 4MXWB 3ALQA 2JG8B 3K48A 1JH5A 2WNUA 4OULA 4DB5A 5TSWA 2QE3A 2WNUB 4QQHA 1D4VB 4DOUA 2Z5WA 3URFA 2JG8C 1C28A 4J6GA 4KG8A 5CIRA 2WNVB 5L36A 2X29A 3LKJA 4QPYA 2WNUC 4QQPA 1I9RA 1RJ7A 2OIIA 4QQ2A 4E4DX 2WNVC 4E4SA 4MSVA 1OQDA 3L9JT 5KC6A 1O91A
chains in the Genus database with same CATH superfamily
4DY5A 1SHWB 3WP4A 4CXWA 2JDKA 3MIFA 2BGOA 4HSLA 4AHYA 1QNYA 3UJQA 1SFPA 3D6EA 1AF9A 2PAKA 3KGLA 1CZSA 2CU5A 4QPGC 1VIWB 1W6NA 2DUQA 3LEKA 5A3NA 4AI2A 5C6CA 3FLRA 2HWC2 2FDGA 4WM7B 2BUKA 1CESA 1BBT3 1UKGA 3RZJA 2B9UA 5I8SA 1EP0A 2YC4A 2PHFA 5LW9A 5HXVA 1UKRA 5FPXA 4EJRA 2IWGB 3AYEA 3AYDA 4MGTA 2D6LX 4QXCA 4LQRA 4WM7C 3M1HA 2YBPA 2IXJA 2RM21 3APBA 4FPFA 5CVRA 5JVVA 2E63A 2R062 4QPWA 4YVWA 4AVVA 3CIHA 3SCHA 4NE9A 2ET1A 1FOD1 1QJY1 3LQCA 4GZ9A 1TME3 5ANNA 3B93A 5E88A 3AZXA 3K77A 3KCYA 1DLLA 1FI2A 1AYN2 1LOGA 4P9GA 1YC61 4A3XA 1K12A 2FZ1A 3MF6A 4CEYB 2JE9A 1ZZ7A 4P5HA 5ACA1 3ACHA 4P5YA 2FDHA 3B9IA 1UAIA 4DEQA 2WZ8A 2VW2A 3WEZA 1US2A 1ND2B 1T6GC 4IV1A 3ZR5A 5F3GA 1PVC1 4CEYC 4YZ2A 3W58A 3KD4A 3ZO0B 1KFUL 1OI6A 2LW8A 3WXPA 3ACLA 2UWCA 2OPKA 2A6VA 3E6BA 2UYAA 5CZKA 3MUZ1 1Y9QA 1ND3A 1OUSA 2XLFA 2C24A 2PFWA 3N7KA 4UW5A 3UETA 4DO0A 1U0AA 3LA2A 3PVBB 1ZRDA 1WGPA 1YI7A 1OXCA 1QJEA 4XEZA 5JCTA 5BNPA 4JV4A 5AFEA 2ERFA 4FP2A 2D3RA 1IQDC 3IN9A 5DG2A 5EQUA 5FYHA 5C5UA 3RI8A 4Q0SA 4YW1A 1QWRA 2KXLA 1SBFA 2WA3A 1VLNA 2JENA 2ZGPA 5T55A 3JQXA 3O0WA 4F3JA 1AL23 3SITA 4XTPA 1JH5A 3WDYA 4D6RA 4OUEA 3AZYA 1C5HA 1N1VA 4QPIA 2QE3A 4B4PA 4EN6B 2WNUB 5B4XA 3D3AA 3OEBA 3WP5A 1UYYA 1F31A 3O0XA 2GDFA 3HNMA 4AI9A 2VVDA 4KG0A 2X09A 4MGIE 1DQ1A 1C8NA 1NT0A 3LD8A 1EY2A 2FBEA 1CZTA 3J7NA 3ZYBA 2RR11 5FZGA 1SLAA 2WNUC 3V64A 5JI9A 1SACA 4JDMA 1PM7A 1Z0HA 3CJIC 1J84A 4LOTA 1ODMA 4B29A 5J48A 1GQPA 2W2IA 3RI9A 1SEFA 3IPVA 2J1SA 4E4DX 4P08A 1DQ4A 4W4ZA 1YFUA 1IS4A 5J1XA 5F3CA 1OQDA 4NRMA 4QX8A 4V2WA 5FZMA 4YFWA 1W8ZA 2GSYA 1KGYA 4JDNA 1UOJA 1RMU3 2VTXJ 2GALA 1QJU3 4I02A 1DGRN 1V6MA 4XXAA 5LZ6A 1BMV2 1UPIA 5JR2A 5JUVA 3ZN4A 1BXHA 1RHI3 3F2ZA 3M3OA 4JTOA 4AGVA 1H1MA 2ZJCA 3HEIA 2AACA 3OYWB 1FXZA 5IUQA 1XE0A 1RL3A 3BTYA 1LOCA 4CCLA 5JXHA 2VCMA 3O1TA 5J3UA 2ZEXA 3QACA 4XUQA 5D2AA 3D0JA 2JICA 4HOOA 4K6BA 2JG9B 1S0GA 4GKXA 2ZGMA 4QDRA 1SFNA 2ZGSA 3H7YA 4LORA 4UW6A 1W6PB 4N90A 4XAAA 2GZWA 1AL22 4PI2A 3WW2A 4C1WA 5IATA 4HT1T 1ZM1A 1OF4A 4HLTA 3ZIXA 2DVBA 4IEYA 2JG9C 2XJSA 5DAVA 2C1FA 3ASIA 3PL0A 4E8CA 2NYYA 4A42A 5JZGB 1X50A 3NJVA 5HCFA 1K3IA 2IXCA 4XMAA 4ATEA 2P3JA 4ES9A 1LOFC 3U75A 3VN4A 4CDQC 4AVAA 3ZFGA 3OY8A 3DKQA 4CDUA 1XJAA 1GZ9A 5JZGC 3Q8FA 3VDBA 1OSGA 1O7FA 1YJKA 1AXKA 4Y22A 2DV9A 4PIZA 2LROA 1F4HA 3FC0A 1G9AA 1OKOA 1W8OA 1X9TA 1QJU2 1OPOA 2ZGOA 3AKQA 3NV3A 2WNOA 4CDXA 3ON7A 3SLIA 1K5MB 5KHGA 1OF3A 4FPEA 1LHOA 2H6CA 2MEV3 3KHBA 4AVBA 3GCXA 4YW2A 2PLV1 4K40A 4R8HA 3C7HA 3LEMA 3TN91 4F8AA 4N7UA 2ENRA 2J1RA 2CGPA 5F32A 3WF0A 1CIWA 1RUI3 3H42B 3KV5A 4RR3B 3VBFB 3S7IA 4OFGA 1VB4A 1OFNA 1W99A 1LKNA 3IWZA 1F8VA 3VBSA 4LJHA 3RZLA 1GNHA 4RGKA 2YV8A 4JKMA 3PURA 4C0HA 4RR3C 3VBFC 4YW7A 2R042 1OA3A 1DYPA 3VKLA 3K4DA 3Q8BA 2V72A 4NO4A 4BQ2A 4Y20B 5FYSA 3VBHB 1DGWX 2ZGUA 1MS3A 3I49A 4IDZA 2WL1A 3NRUA 5HCBA 3ZFEA 5ABJA 3P5BA 1K45A 5JOZA 4LHKA 5A3LA 4DOUA 2VO5A 4YW3A 4B1MA 5A70A 1AR92 3LIHA 4CEWA 2Z4FA 4CU7A 2NLRA 1G86A 3VBHC 3M2MA 2PHLA 5K8SA 1TEIA 2R1BA 2BFUS 1BK0A 2GN3A 2ZCWA 3WNXA 1UY2A 4BH9A 4N43B 1DIWA 5FZ0A 2PMWB 2WINB 3MV11 2ZHNA 4LBLA 3MPPG 1W2AX 1C8M1 4XF9A 2W39A 4LO4B 4QQ2A 2VOTA 3VD3A 3NWKA 2MHFA 4H2AA 4RHV1 5EYYA 4CP0A 3LAGA 3HN1A 3ZKYA 2QQWA 4N43C 5F2SA 5FZ8A 3WW4A 4XUNA 2W91A 3BKZA 2IFRA 2WSUA 4QX7A 1LJ7A 4FAGA 2K46A 2FDKA 5FYVA 1NA1B 5D8AA 1U5XA 1G9BA 1RUI2 1OOPA 1XE8A 3KMHA 1SLTA 3POJA 2HH9A 3OG2A 4FOVA 5C8WA 3VD9A 1S1AA 3JZVA 3BPZA 1AVBA 4BIFA 3THDA 2EAAA 5LRSA 1WW4A 3BU0A 3K2OA 1NA1C 2IFWA 3GZTB 3ROUA 2ZGTA 1W3XA 5J36A 4JVAA 1QJZA 2XXZA 3AM2A 1UW8A 2H0BA 1XPWA 1UOGA 3MEPA 4OHYA 2V73A 1GZWA 2VECA 3AL6A 5LY2A 1OHFA 4D7YA 3IB3A 2RMU1 5EJ1B 2DVFA 4QB6A 3J8F1 5FP9A 5KXEA 2EXIA 1FATA 1AX0A 1RUF1 2XBO1 2R32A 4Z1VA 1BEV3 2ZGQA 2GC2A 3JD73 2DVGA 3K4AA 1GOGA 2FZ2A 1MPXA 1VMFA 2GC3A 4G9SB 2K0GA 4JRAA 1MQTB 1EAH3 4YGBA 3UK9A 2VBDA 2WWUA 1CAWA 4DRRA 1QNWA 3U1XA 2X8KA 3B5LB 4QU1A 4QD2A 3GCWA 4FPLA 2QQJA 1MQTC 1LECA 2J7MA 2C5DA 3UV9A 4F7ZA 2ZABA 2Y0IA 4RS5A 1GWMA 1WD4A 5GZDA 3WDVA 3C8XA 3H8XA 2ARXA 1U5IA 4LE4A 4CCJA 4AQSA 1RITA 1GP5A 1URXA 3USSA 3RYPA 2QNKA 1Y9MA 2WRAA 3H3UA 3GHMA 2RS53 2ZX4A 3OD4A 5FLJA 2B42B 2JDZA 2IXKA 3AJZA 3AKPA 3I3EA 4PDWB 4R52A 1FOD3 1W05A 1JOJA 5F6KA 5A7WA 4IEOA 2TEPA 4GH4C 3HD8B 4XFAA 4QX2A 3IMNA 4DFSA 2OZJA 4DY3A 4AE2A 3G6JB 3V65A 1JYCA 5FOJB 1JYWA 5L7OB 3I59A 3RZKA 2YPJA 1UXZA 3ALQA 3K48A 3NKGA 4PDWC 1YNAA 5A7NA 1F35A 3I2DA 2FCUA 1BEV2 3SC7X 1SPPA 1CAXA 3VZKA 1UYPA 5L7OC 3K3OA 1V6IA 3NAPB 1NLRA 2G1MA 2WJSA 1NCQB 5LK7B 3TRSB 1C28A 3P1IA 5CEHA 5DZGA 3AXEA 4YPJA 5IAXA 3KCCA 3BUCA 1YFXA 4QPYA 1V6KA 2QQKA 3Q8EA 4CDWA 1HV0A 2UU8A 3NAPC 5K0UB 3BGAA 3HBZA 1NCQC 2WT2A 4TN7A 4PIYA 3DF0A 4TLGA 2R0HA 1W8UA 5FV3A 4LK6A 4LIVA 2VZVA 3U4XA 5DAQA 3AMQA 5BNOA 2G19A 5KC6A 3ZDSA 4UOJA 2XLGA 1EPZA 1X9PA 4IEXA 4YZ4A 5JXIA 3FZ3A 1BBT1 2SLIA 5FYBA 2P37A 2D97A 2W0XA 3CEWA 1VAMA 4GWIA 4W50A 3TOJA 4WBBA 2SBAA 2RS52 1LB2A 1STMA 5C9AA 1HB4A 1W6OB 5I0UA 2AR6A 1Q8PA 1FOD2 2QDNA 1QJY2 1VAKA 1WLDA 3DPRB 4Z8BA 5CNAA 3VL9A 1RVF3 1FNYA 3GZAA 2RE9A 3MFCA 3RMXA 2BJSA 4Q1PA 3GM8A 1ZZCA 2DWRA 5FBZA 4AHWA 3A0NA 1TME1 3RWNA 4ZHNA 1XU1A 4GQ7A 4L97A 3DPRC 5ACA2 1CD3G 1MZ6A 3ORJA 4KWJA 4TLFA 5FCCA 3ZXFA 4JCKA 4A44A 1TMF3 5C8CB 1PVC2 3VBOA 4AEDA 3IM0A 1VBE3 2VXJA 2W08A 3C7EA 5BNNB 5C5TA 4DUVA 1B35C 4O61A 4EYUA 1TG7A 4XF3A 1VP6A 2BVVA 4JDOA 4AL9A 2WZR3 3LA7A 2Q1FA 4LTAA 3SMHA 1WA6X 4HK8A 3ZPOA 1TE1B 4AI0A 5C8CC 3LPGA 5IT6A 3QBQA 1HDKA 3HJRA 4DIQA 5BNNC 4OMDA 3NV2A 4BCUA 3O1RA 4HBNA 1IPSA 3LPFA 3O12A 1BMV1 1G6NA 4QGLA 2YFZA 1A3KA 3CDZB 3QH6A 4BLIA 1MACA 2CGOA 2O14A 4KWKA 4LKEA 4P9XA 1W6MB 3RPQA 2VZUA 4AVSA 3AP7A 2YB7A 1RVF2 1W0OA 2D98A 1PGSA 1S55A 4Y33A 3NSTA 1AL21 3K51A 3NKTA 5FZEA 5FQ0B 3AFKA 4BE3A 1ST8A 2WO2A 1LU2A 1POV3 4AHXA 3I4IA 2AZ5A 4L11A 4GWJA 1GOFA 4BU2A 1UU6A 4XQ4A 2VW0A 5FK8A 3B00A 1Q8OA 4AAXA 2BTVC 3ES1A 2BNOA 2L9LA 3GNEA 4JKKA 5JAXA 5IHRA 4AI8A 2C4XA 3FBMA 5FZHA 1PMIA 2WQ8A 1QU0A 1H2KA 4K20A 1JS9A 1YEWA 3VL8A 5JI7A 2WZR2 3J7MA 3POBA 3IDAA 3MIBA 4RQPC 2ZAAA 3U07A 3A22A 3IIAA 5L9BA 4A41A 1V0AA 4M3CB 1N3PA 2BOIA 3N35A 4DXTA 2A3XA 3ZIWA 1RMU1 2PLV3 3N7JA 1QJU1 2FQPA 4Y5SA 2ZX3A 1R083 3UL2A 5CA6A 1RHI1 2OIIA 1H8VA 1F5JA 1H1AA 3GZEA 3TEWA 1Q8VA 4QMAA 5FZ7A 4L9BA 4N53A 5DABA 1PK6A 3AYCA 5DG1A 5FYIA 2B8MA 2A7AA 5LK5A 5FPUA 1RUH1 4XC9A 1GANA 1JU3A 2ZEZA 3IDBB 5FZOB 4JGYB 5FWJA 1WCDJ 1ZA4A 3O1MA 2FCTA 3VHRA 5H9RA 3WF4A 1IQAA 1IPJA 1FAYA 4XBQA 3WNNA 4EWEA 4HG6B 3H0OA 1CIYA 4HK9A 1GWLA 1RUG3 2D3PA 4CVUA 4JGYC 2E32A 3T09A 3RZHA 5CFCA 2VUDA 3RS6A 1IKPA 4QX3A 1H8TB 3MW3A 4LULA 5SV8A 2X10A 3MO4A 4NMIA 1CAVB 3LFIA 3AB0A 1LAJA 1C8M3 2FMYA 3UKTA 1W0PA 3C7OA 2D6KA 1W9TA 1S0CA 1H8TC 1WZXA 2IVJA 3AJYA 3H9AA 4UWDA 4BLJA 2P34A 1AXYA 2PLV2 5L19A 1QF3A 2A6XA 4DMIA 1R082 1RUE1 3TN92 5JXJA 3WW3A 3V0BB 5AVPA 2NP0A 2Q8OA 4A6SA 3X29B 2MEV1 2O0OA 3PDQA 2FDIA 1O4ZA 2HEYF 4NHMA 3S30A 4CCNA 2WO7A 5A32B 1SZBA 2DU1A 1LEDA 4EV0A 5JOXA 4CU8A 1W6QA 2VOWA 1KEXA 2YROA 5CKNA 1RUI1 1AJOA 2WBKA 3MIGA 1XBFA 2AC1A 5FKBA 1JN2P 1Y9GA 3B7MA 4OI4A 4AEJA 5T5LA 2HYKA 3ZMNA 3R4DB 2VMIA 2ZMLA 1DZTA 4EROA 3M8LA 3FUQA 4ET7A 4YGDA 3T4VA 2W5FA 4D94A 1IG3A 2EAKA 4FXKB 4LBJA 2A1XA 1RUG2 2D5HA 3OUHA 1CN1A 2JIJA 5E1RA 3WDTA 1CWPA 2IVIB 3H1YA 5FO8B 4QPGA 2Q30A 1MS4A 3J8F3 2WQ4A 4ITCA 4WVMB 3U14A 1RUF3 2DF7A 3N7LA 3NNMA 3VBRB 3WINE 2ETEA 1AL0G 4Q4Y1 1UU5A 3PMEA 3MYXA 4G3YC 3OBAA 4R9DA 5EFUA 2A3YA 3QOPA 2PHWA 3IAQA 3C7GA 3I54A 1QY4A 1SLCA 1C8M2 4XFCA 4YARA 3ACFA 2FHRA 3LCPA 4DB5A 3VBRC 4RHV2 3FBYA 5C71A 2PELA 5A6QA 2W3JA 1UMZA 4B1LA 2EXHA 4CP2A 4WM7A 5FJKA 1VBA3 2EA7A 4AAPA 4BQ3A 5JXGA 1JYVA 2WWSA 5FREA 3ZN6B 4C0BA 2VR4A 3M7AA 4BZ4A 5A1FA 2JJ6A 2WUHA 4CP9B 1UY4A 1SBDA 1QHDA 5IFPA 1LHUA 1FNZA 1XYPA 4OZXA 4YW5A 5FMOS 3VBUB 4XETA 5HCHA 5IK5A 1NXMA 1RXGA 1I9RA 3LE0A 3HAGA 4C8DA 1GSLA 3VKFC 4Y1YA 1LU1A 1MZEA 3ZDVA 5JOWA 1WMDA 1YXWA 3WR0A 4A2UA 5FMDA 4UF0B 1JW6A 5A7QA 2VOVA 3ZOIA 4X6RB 3HT1A 3VBUC 1HQWA 1DF0A 3AL5A 2VZQA 3RNSA 3MUY1 3EMRA 3POYA 4HKOA 1HV1A 2ARCA 3OBZA 5A3UA 4LOSA 1QMJA 3KSCA 3E5XA 4AG4A 5LEJA 2IUWA 3LDRA 2KR2A 4BQYA 3HNBM 2P6HA 2R16A 4PLMA 3J8F2 3CLPA 5F7UA 4LMFA 2EIBA 2XBO2 1RUF2 1W06A 4XJWA 1ND2A 3O1PA 1B09A 3S5AA 1L7QA 1YRZA 2JEMA 4NROA 3VZJA 4CPBD 5FZ6A 1AR83 3ZSKA 3MLKA 5FDBA 3ETQA 3TB0A 1TZOA 3QCWA 4RL7A 4Q4V3 3EQEA 4XJ9A 4Q0VA 4E4ZA 1BEV1 2VNVA 5E8AA 3JD71 5EHDA 3SNMA 4E2QA 2VZRA 3UGHA 1GQHA 2ZA9A 4IGQA 4MGSA 4NAMA 5FYCA 5LASA 2ZZQA 3UJOA 1NG0A 1EAH1 1VBA2 4PQ9A 3S5QA 1H6YA 5EXOA 1DQ2A 4LITA 2HBTA 3A4UA 4S2FA 4Y4YA 4D7SA 2JB8A 2ZOEB 2NMNA 3AKRA 2A71A 2ZGRA 3AMNA 4UW4A 5GLWA 1A78A 2ZACA 1M06G 2VUJA 4DUWA 3OUIA 5CKQA 4BISA 2X5IB 3LFMA 1S2KA 4Y1ZA 5EP9A 3TNPB 4DZGA 2DCKA 2QCSB 1ENSA 2QKDA 4KBBA 4OQ8A 2B7YA 4D0QA 4WM8B 3HPNA 2QBXA 1UMIA 3CJXA 3LDBA 3NNFA 3HIFA 3MPBA 4RFRB 4JHTA 3EO6A 2V09A 2X5IC 5IK4A 3W59A 3OOXA 4M4PA 4IERA 2RS51 4P9YA 1QQP3 3I2IA 5AC93 4WM8C 5SV5A 2Y6HA 4CCOA 2BDRA 2PYTA 5F37A 2YGLA 4Q2FA 3E5UA 4I09A 3AMPA 3DKWA 2Q1MA 3WY6A 1UZWA 5KC5A 3N9MA 1RUD3 4JGZC 1GZCA 5L73A 3HQXA 3TWIA 3K75B 1N3QA 1LENA 1AR82 1YI9A 2VCCA 2R49A 2WN2A 2D93A 3RG0A 2EALA 2HKXA 2BOJA 2YXSA 1UOFA 5IVCA 4ONUA 4Q8LA 2AYHA 1NYWA 1SLLA 3FFQA 5HCAA 4MXWB 4I01A 4BMBA 5IK8A 1BKZA 2Y0OA 3KZ4C 1RIRA 2VMEA 2VCAA 4H14A 2AUYA 2A6YA 4IEPA 5GALA 2Z5WA 3URFA 4V1PA 1E5SA 1NX9A 2BRTA 1HN1A 2QQVA 4O7XA 5CKMA 5FZCA 3T2TA 3DV8A 1BBT2 1NCRB 1W8TA 2DTWA 3IKWA 3RSJA 4NPMA 3SH3A 1BZWA 2ET7A 1W6PA 3LKJA 2WA4A 1VJ2A 5CB7A 5ERLA 2C0ZA 3KCXA 1LOFA 4LXLA 4FAHA 1J59A 3O0VA 1JOBA 1A8DA 4MH0E 1JMUB 1UZVA 1NCRC 3GBFA 4PQQA 5JZGA 1W2OA 3CNAA 3L9JT 4AK3A 1ZRIA 4XTMA 3LEGA 5AC92 4XZPA 2YGMA 2OT7A 3WQ1A 3ZFFA 5JSRA 1TME2 4RYDA 1RVF1 2N7GA 1RUD2 4YZ3A 2IZWA 3WZ1A 4CRQA 5A6ZA 3CJIB 3M70A 3MW2A 3TBDA 3SH4A 3I2FA 1UZZA 2GP5A 1D0HA 3BODA 5FZFA 5I91A 1CZVA 1W6NB 5HXMA 3RJRA 1BHGA 3CL1A 1WBFA 2HWD3 4RSUA 3TEYA 1ENRA 3PTRB 2VZSA 2PN5A 4IXLA 1TMF1 1K5MA 4OMCA 2HWB3 1VRBA 1GNZA 1VBE1 1EUTA 4LBQB 4QXBA 1QEXA 3WUCA 4CP1A 2UY9A 5H9SA 1ULGA 1JZ7A 3H3ZA 2WZR1 4ISQA 4D3WA 1DQ0A 5LBCA 1BJQA 2W1SA 4PCRA 4XJ8A 3T2PA 1QOSA 3T1MA 1FYUA 1FPN3 5DZEA 1Y4WA 1DLCA 3ZXJA 1BLZA 4CE8A 4FTBA 4KWUA 3FE5A 2VCBA 2W87A 1PVXA 3AMMA 3AFGA 3V0AA 4PF1A 4YM3A 4W8JA 2ZS6B 4XDQA 4BK5A 1F15A 4UFHA 5LBBA 3RQ0A 4C90A 3ETPA 3VBHA 4DXZA 1RUH3 5GZCA 3WLUA 4M00A 3HN3A 3WDXA 2QVSB 1DBNA 1VPHA 5BXXA 5FYYA 1UWWA 2VH9A 2BGPA 4CDQB 2I07B 4IV1B 2FDJA 4QHOA 4MYEA 4K8FA 3WP3A 2XL9A 1OC1A 4MHRA 3MBWA 1NLSA 5FK7A 3BOPA 4AOCA 3ZMOA 1O4YA 4M3CF 5BNQA 1FMD3 1POV1 4G4FA 2ILMA 1H0BA 1U5YA 3LB9A 2XWJB 3JXSA 3SISA 4BXSV 2XKOA 3BALA 1E5HA 4IV1C 5EYXA 2HWD2 2VZ3A 4ASKA 1PGL1 1K42A 1YQ6A 3THPA 2ARBA 2GMMA 1F5FA 3U11A 3ZXLA 3ZSLA 3MLJA 2W1UA 4GXLA 5CU1A 1UIJA 2HWB2 3M4FA 5BNPB 1MEC3 1RUC1 3AZVA 2BERA 1ND3C 4GA9A 3T0BA 1S0FA 4CU9A 1UY3A 4IEZA 4LPLA 1RMU2 2D43A 2VVEA 2JG8B 3P3PA 1W04A 1NA1A 4R4XA 1GYKA 1RUE3 1F2NA 2EICA 2JKXA 1RHI2 3U10A 4P9JA 4Q0UA 5BNPC 5JIUA 1YFWA 3IZOA 1CJDA 1FPN2 4QQHA 4JHZA 5FIXA 3P3NA 1R081 3WQ7A 3WVJA 4YNIA 2JG8C 2WAOA 2J1TA 1JUIA 2PA7A 5F39A 2WNVB 2OXBA 1WMEA 1OURA 1W8WA 4KQ7A 5FBJA 5IJRA 1QJX1 2GNBA 2GN7A 2JX9A 1AJKA 2EIGA 4L99A 4M0NA 1RUH2 3ILFA 3ZXKA 5CG9A 4M4RA 2VOXA 1KFXL 2WS93 3E6CC 2WNVC 3WG3A 2JDYA 3MIDA 1PX3A 2OW4A 2ZMKA 3IPVB 1QOTA 1JUHA 2Y38A 1P8JA 1VBD1 2D6PA 4NWVA 4S2DA 3TAYA 2BWAA 2OKXA 2YC2A 5C4WB 3HQRA 1FMD2 5GLUA 1CR7A 5A3TA 4YG3A 2QQMA 4Q4Y3 3ZSMA 1RUG1 1EV13 4HPKB 4DRVA 5F3EA 4KMQA 5C4WC 4URTA 5JMCA 4K21A 1S0JA 1MEC2 3I2GA 2CTVA 3AX4A 1X8EA 3AXDA 3VKNA 1HB2A 3WG1A 3WG4A 1GR3A 4FTEA 1LEMA 1RUE2 4LHSA 3MGUA 4ASLA 3R4SA 3U37A 5C3QA 1QXRA 3PVEA 1JZ2A 2UYBA 2MEV2 2GMPA 4OZOA 3O14A 1HW5A 4A45A 3L2YA 2E9QA 2RJKA 3N7MA 4QXHA 4SLIA 2WLPA 2W1QA 1BVVA 4C1XA 2ZMNA 1YQ2A 1ZVFA 1H9PA 2GAUA 1I5ZA 4I3GA 4AVCA 4GJYA 1OUXA 1EPWA 1SQ4A 3FLPA 1HLCA 4ARXA 5E16A 2WYSA 2LS6A 1DU3D 2OX0A 4ATFA 3ZFGB 3QLQA 1UIKA 5I8TA 3BTZA 5FZDA 4Z2WA 5L7OA 2XOMA 3O1OA 2WS92 2WZEA 1DCSA 4MZUA 3POGA 3N4MA 4Y22B 5FO9B 3HQUA 5CG8A 4NPLA 2VZOA 3B94A 1NXD1 4HSJA 1GV9A 3LF7A 3ZFGC 4CDUC 4IE4A 3K3NA 4YZ1A 5HV4A 2OYZA 3NAPA 3PVNA 4SBVA 1NCQA 1HN0A 4Q4Y2 1CONA 3J26N 2VTXA 1EV12 2ES3A 5FYMA 3EB7A 4XACA 3B02A 4FOWA 2WO1A 2E31A 2AH2A 4FFFA 4KGQA 3U78A 4IGPA 4X6QB 1GOHA 5K0UA 2B9VA 2NZ9A 4TXWA 2V4VA 3NL1A 3ZPYA 4ASMB 4ZKTB 2B46X 2VUCA 4DUXA 1GICA 1CVNA 4XFBA 2IXLA 2YZ4A 5FMBA 4H3WA 2ZPXA 3RGBA 4ZS3A 3ZYHA 1OD5A 2QQLA 3DYPA 3WQ0A 1S0BA 3IT8A 4FFHA 3DECA 1RGSA 1VBA1 1CQ9A 2Z79A 3JBG3 3N3HA 3T30A 5A33A 4XAEA 4OVEA 4COZA 5LWBA 4GMP3 5IFTA 2F6BA 2A75A 1ASJ3 2AREA 1SDDB 2PHRA 2QFEA 3VBSC 1W6OA 3UT0A 4AVTA 2ARAA 4NHXA 3ZVXA 2BWCA 2ZTNA 3ZFEB 3H8RA 1Z7S3 5ABJB 5F2WA 5F8PA 4GH4B 2CYFA 4YGEA 1DZRA 2WFF3 5G04L 5JIAA 4K9SA 1HQLA 5FYZA 4BWOA 1ZYBA 2GNDA 4LBNA 5FR3A 4EWAA 2R073 2VMGA 4MADA 4N8MA 3ZFEC 4DEVA 2EIEA 4XCBA 5FZ1A 3BPSA 4HFSA 4CA9A 5ABJC 2WQZC 4CUBA 4CCKA 1OPMA 2MPFA 1V00A 5A3MA 3DXUA 3I2JA 4CEWC 5J37A 4E4SA 4MSVA 1WCQA 3WSOA 4R4ZA 3PIJA 3POSA 4P00B 2ADDA 4LKDA 1O5UA 2ZZJA 5C8CA 4XUTA 1VBB3 2VBPA 4OUSA 1W39A 1Y3TA 4MG2A 4X8PA 1HX6A 3O1SA 1HB3A 3JD72 4J1XA 1GU3A 1AR81 2OVUA 5A80A 4AFBA 4FQ4A 5C70A 3ME2A 3BCWA 2YC0A 3VDDA 4Q4V1 2A3WA 1OOPB 4AYUA 3JUUA 1EAH2 1PNFA 3FHQA 2YG0A 4Q0PA 5FMCA 1IOAA 5JPNB 1ULEA 4Z2AA 3SKJE 2ZKNA 5D8AC 1ZRRA 2J42A 2XL7A 4BA6A 3FHIB 2NQYA 1OOPC 3ITQA 1XNKA 1O4TA 3CKHA 3D8CA 4XZUG 2F17A 1ASJ2 3ES4A 4NRQA 1W6MA 5D1IA 1ZZBA 2E53A 1O8SA 3N36A 1GZWB 2QDRA 5BY5A 2EF6A 1Z7S2 3B01A 1DGRA 3OB8A 4O9GA 1OVPA 2XB6C 1JXNA 1YLLA 2WFF2 1J3RA 2WN3A 2BFUL 2VNGA 5F5IA 1W9WA 1ALYA 5KR7A 2RS13 5T5JA 2HYXA 4AGGA 1LHVA 2WKKA 3ZKUA 4BQ5A 4UI9L 3ST7A 2X05A 1RUOA 3WCRA 1SFYA 1QQP1 5AC91 1JOPA 3LGRA 2P2KA 3T3YA 3K46A 1J1LA 1PZ9A 1CAWB 1VBB2 3RZMA 1AXZA 3POWA 3TNQA 1RUD1 5GJ6A 5JPMB 2CDOA 4RGGA 1B35B 1ZZ8A 3FL7A 4Q4W3 4WZCA 1UXXX 4A6OA 3KF3A 4HN1A 5EV7A 4YWAA 1IG0A 2PTMA 5AVAA 5LA0A 3ZYRA 2ORXA 4RS5B 4QHZA 4M3CA 3PHMA 3GDBA 1LOBA 3PMSA 3O1VA 1OH3A 4IETA 2W94A 3ACGA 4CCDA 2GC0A 3E1F1 2DBNA 4LKSA 1RXFA 5JDBA 1MS1A 2BVBA 1GKBA 2HLEA 2XR4A 5CAZA 4RS5C 5FTTC 3NJZA 4NWWA 5DAWA 5FWEA 1HQNA 4XJAA 5HBAA 3A7QA 4QDQA 2AENA 5A7WB 1XNTA 2XJRA 5DUUA 5KHIA 1FT9A 5FY7A 3WQBA 1COV3 3VD5A 3CBNA 1WCSA 1J1TA 1PMJX 2PAEA 3I59B 5EPAA 2XJQA 2OQ7A 4FFGA 5FZOA 4JGYA 4Q4X3 3M3QA 2O8OA 3POFA 4R9BA 2VBBA 2RS12 1HJGA 1SPPB 1CAXB 1UL9A 4JTNA 5CIRA 2WABA 4EZ4A 2VUAA 1JBCA 1BYHA 2X29A 3CF6E 2B39A 4LIUA 1LR5A 3VD7A 2FD8A 1VAVA 5LEKA 4IV3B 4E2SA 4M01A 1XNBA 1JYIA 4IW3A 1H8TA 1PIV3 2DVAA 1LRHA 1VB2A 4YG0A 1IS5A 4CDWB 5CFDB 1KS4A 2JKBA 4Y1XA 2W1WA 3FLTA 4HONA 4Q4W2 3NV4A 1SBEA 1M4WA 4MO3M 4PT6A 1POV0 2QQNA 3ATGA 3KLSA 1JHNA 4QB2A 4Y1UA 1SDWA 4FPOB 4IV3C 5F5QA 1SG3A 1CPMA 1QH7A 3OGJA 4LE3A 1TMF2 4RQPB 1WCUA 4XE9A 4ZONA 1LGCA 1VBE2 2HWD1 4CDWC 1RUC3 5CFDC 1W2NA 1ENXA 1WMFA 4QU2A 1N1SA 1YCIA 2DUOA 1LHNA 3BU7A 4D6QA 2HWB1 3MIHA 4IEQA 3OBTA 2C6SA 2VAUA 4LO7A 5BNOC 3BIWE 3KV6A 4AQ2A 3MIEA 2RS33 4I0AA 2YMZA 5GLZA 3OCPA 4IGOA 4YYOA 1COV2 4E2GA 3NJXA 4XURA 4NN0A 5T50A 1HXS3 1FPN1 4YSFA 4MOAA 3OTFA 4DINB 5C9AC 4LEJA 1RYYA 4XHXA 3OD0A 2BU9A 1QJX3 1WLWA 3R0RA 4Q4X2 1Q3EA 4LBMA 1NZIA 4AHZA 2O1QA 3KGZA 1XNAA 4NUBA 1UCXA 1SLIA 3PU3A 3S7EA 4EZHA 2H0VA 4NVPA 5JR7B 3VBOB 5L9RA 3ZYGA 2VQUA 4XILA 4WVMA 1VBD3 2YPDA 5FYTA 4OLLA 1V9U1 4XBNA 3VZNA 1UX6A 1OQ1A 1X82A 4ORFA 1C1LA 1PGL2 2JWPA 4LLFA 1H30A 4P9WA 1WWYA 3VBOC 3M3IA 3WD5A 3KV9A 1FMD1 2F4LA 2KD7A 4AFAA 1O3SA 1UNBA 3ZX7A 1WLTA 2VZPA 2CSGA 1ODNA 1QXPA 1RUC2 1WMXA 2ZHMA 1GMMA 3MLLA 3BTXA 1VBC3 4CCCA 3ZN6A 3ZYJB 1OQEA 3U0ZA 1POQA 4RGAA 5FZ3A 3MDPA 4BB3A 1F4AA 4CP9A 1MEC1 1CX4A 2YBSA 2BP6A 4DXRA 1H2LA 5GZGA 4UXAA 2RG4A 3VBUA 5APAA 1N1YA 5C33A 3FHAA 3BIEA 5C3PA 2RS32 4ZS2A 1UYZA 5T5PA 4BPZA 3WX5A 2ZKLA 1HJFA 4ZY9A 1HRV3 5LATA 2QZ3A 1KJLA 3A21A 4KBZA 4XMIA 3GYDA 3GJBA 2R6QA 2W46A 2XMLA 3D4KA 2VE1A 1QJX2 4WVZA 1AX2A 3POEA 4QKFA 3JB8A 1O6UA 4HXCA 4OULA 3IAPA 4L0PA 1UN1A 1YO8A 4GWMA 1PGW2 3FWEA 2JD9A 4FPCA 4YVSA 4AXOA 3VDCA 2J1VA 2ZGNA 4M0HA 4YGCA 1VBD2 3KF5A 1Q43A 2GNTA 2WS91 5H9QA 5AFBA 4N7IA 1ZBA3 2EXJA 1X7NA 1JYTA 2HWE3 3S6PA 1UPSA 2I2SA 5A7PA 3PIGA 3KVBA 2VVFA 4C91A 2A5ZA 1AYM1 1LCLA 4FPJA 4W6YA 3ZR6A 4AI1A 1EV11 1NE4A 2ZX0A 3EJKA 1DZQA 1GBGA 4J25A 4O65A 1VBC2 1XYNA 2XGXA 1A34A 3MFAA 1F9KA 4FOQA 2LM3A 4OQ9A 2BQPA 3L2HA 4GALA 4N53B 2UWAA 1PK6B 1D2QA 1VMHA 2D44A 3RWKX 4FPGA 5FZIA 1MS9A 5I93A 1TNRA 1X33A 3BYWA 5E89A 5FXWA 1FX5A 4EE2A 1IS3A 1OLRA 4NHKA 1HRV2 2BBVA 4WM8A 3OPWA 2XJTA 4N53C 4CYDA 4JZRA 2HEWF 1NQJA 1PK6C 1AX1A 2ZBJA 3BN6A 1VALA 1A6CA 1S0DA 2TBVA 2Z69A 4H7MA 5GKAC 3WT3A 5FOBB 5HPOA 2Y64A 5IK7A 2VG9A 1E57A 2A73B 4IE0A 3OPZA 5J98B 3USUB 2CWMA 2ZEYA 5B2GB 2HBUA 2P3IA 2G9GA 2P3KA 3CMGA 4XW3A 1IKQA 1LNSA 3UESA 2LTNA 2YDEA 4KU8A 4BIOA 2Q5TA 1YQCA 4YZ5A 5KHKA 4CEYA 4Z92B 2KA3A 2ADEA 1ACCA 4NR1A 5CFCC 2HWF3 1OH4A 4NIIA 2OS2A 4COUA 5HI0A 4GKYA 4MXVA 5T52A 2HWC3 4XFIA 1O3TA 2XG3A 4RA0A 1W8FA 1XC6A 1LGBA 3WNKA 3ECQA 4MXWA 4N9IA 1X8MA 4QM8A 4BM8A 4J1WA 4OYUA 5KBFA 1ZRCA 2EIDA 1UX7A 3M3CA 4XFGA 5FXZA 1NZCA 5CISA 2XUEA 4Y5Z0 3FFZA 3O1UA 4A7KA 4FP3A 1WLCA 4FI9A 3WV6A 1XOYA 3B3QE 4P14A 3T2OA 2RDNA 3OUJA 3DN7A 4HKLA 2HEVF 4LBQD 4Y4RA 5KXBA 1XU2A 4IE6A 5A7OA 1K5JA 1MZFA 3H1WA 2XQRA 4AFDA 1LHWA 3EBRA 4LO5B 3FJSA 4W6XA 2VTFA 2XVLA 1R091 5T5OA 1WW5A 3GBWA 3JBG1 4UFLA 4ZXEA 4A3ZA 3AVRA 2W9XA 3ZYFA 4GMP1 2OUJA 1XNDA 1ASJ1 5D21A 3BTAA 4YW6A 1ZRFA 5JLVA 1RUNA 5M0TA 2VJXA 3MZHA 1C5IA 3MV01 1Z7S1 1QIQA 3FX3A 4MGQA 1OBNA 1AR61 4COYA 3DL3A 2WFF1 2WNUA 1Z78A 4JGZB 2P4EA 4QGMA 4P9IA 3ENRA 2B45X 3CJIA 1YQ5A 1YIPA 2A6ZA 2CL2A 4CPBA 3LOBA 2R071 2HWF2 3T08A 1JZ5A 5LRRA 3N9NA 4DPNA 5BV6A 3BVCA 4KG8A 5JOYA 5I0RA 3PUHA 3NNLA 2VMFA 1ZNPA 3SCGA 4E4HA 3VD4A 1W2UA 4FXGB 1VBB1 2P5BA 2R7EB 2UY8A 1E5IA 4LBQA 4Q4V2 4AQTA 3R05A 3ZXEA 5FZLA 2ZHLA 5LBEA 2VGDA 3J9SA 1ULFA 4KI5M 2QQIA 2RV9A 4NHLA 3GZUC 3S57A 1HIXA 4MHUA 1DQ6A 3OYWA 1W8NA 3POIA 3W21A 4K1ZA 2Y6JA 3JCIA 1MS5A 2UWBA 1CPNA 2ZHKA 1Q8QA 5FPBA 4ZZ5A 5KWRA 3PVOA 4XYXA 5DUWA 1FV3A 2JG9A 3H8OA 4OI0A 3H50A 2V4AA 2VM9A 5I0SA 1I6XA 3KT7A 1DHKB 4GAZA 3F95A 2E7AA 5KHHA 5DDJ3 3U4SA 3ZXGA 3N9PA 1C4RA 1CAUB 3I2KA 2VNOA 1H4HA 4CUGA 1V6NA 3OF1A 4CDQA 3M3EA 4MX3A 4CUAA 3AP9A 3ACIA 3OPTA 2ZGLA 2WWJA 4E27A 5KXCA 3K4ZA 3UGFA 4UT5A 1WCKA 1QQP2 3I97A 2RS11 2BPA2 5DQ0A 4OHWA 4B4QA 1XQNA 4W65A 1ND2C 2PQSA 1RUJ3 2XH6A 1XRUA 1GUIA 1CJPA 4JC1A 4K8RB 4LO6B 4DS0A 1AUYA 4FCAA 3KS7A 4L2NA 2AEYA 5FMOL 5FPZA 3AZWA 4QQLA 3GF6A 3GGLA 1UY0A 5FY0A 3VHPA 5JSPA 3H8UA 2DBIA 4GB31 1ZREA 2VMHA 2VZTA 3HMYA 3LSEA 2WT1A 1L7LA 2W47A 3GALA 4IEVA 4XIKA 2B4KA 4Q4W1 1LODA 2JG8A 3RMYA 4AZZA 2B5HA 2D5FA 3IIIA 2D6MA 3WF2A 3PUIA 3NNGA 4TWTA 4NJ4A 5DUXA 1VRH3 4FOYA 5A6XA 5IVVA 4QB1A 2P6CA 4AQ6A 3IDCB 3KHCA 1REDA 1KITA 2TNFA 1U12A 1XE7A 3V56A 1H2NA 1AR71 2C26A 3TEZA 4YVWB 2YY1A 2WNVA 1S0EA 3C7FA 3PUQA 4GJZA 4RR3A 4QKDA 3VBFA 1WD3A 3W9AA 3DCQA 3MICA 3WCSA 2JE7A 4QT6A 4XCAA 1DQ5A 2JB4A 3OGGA 2W95A 5DDJ2 4NIAA 3W5MA 1GP6A 1COV1 4UAPA 2BV4A 1APNA 5GZEA 3RYKA 4YVWC 2W68A 2ZGKA 4AEKA 4GWNA 4BQ4A 5LCWL 5JWPA 1G9FA 4B7KA 3VHNA 5J09A 4Q4X1 4QGNA 2VQTA 4Y20A 5C4WA 3I3DA 1RC6A 2CHHA 3MF9A 5J7MA 1Q56A 2JECA 1PNGA 1V70A 4XFHA 1MS0A 3D5OA 1PM4A 3SCFA 1RUJ2 1V6LA 1V9U3 2OPWA 3SXWA 2WYFA 2VU9A 3PUSA 1PO23 2R0FA 2VL4A 3O5SA 4QKBA 5TSWA 4HPKA 1N3OA 1OMIA 3IDEA 5L9VA 3AC0A 4UYBA 2VULA 1S0IA 1PIV1 2DUPA 2WLQA 2WR9A 4BOWA 3FUOA 4N43A 2VNRA 2X53S 1DGLA 2WT0A 1N47A 1ND3B 1WUVA 2D6OX 4B8EA 3CZUA 4QX5A 2RDSA 3Q9OA 4ZU4A 4B7EA 3I2OA 3THCA 1RJ7A 4EN9B 2WNEA 1JI6A 1VRH2 3WNLA 4UFKA 1LOEA 1O8PA 2JXAA 2DURA 1KS5A 4QHBA 2R043 4OHXA 3VZMA 2XHKA 3OGSA 4TZDA 1D0GA 4ARYA 2DFCA 2K9ZA 2RHPA 4ZU5A 1YWKA 3ZFFB 1ULDA 3ZXDA 5CBLA 1LULA 1RTVA 2GU9A 2RS31 3KM5A 1PX4A 3GHNA 2JDMA 4MUVA 3PUAA 4QWNA 3T0AA 4QPIB 1AR93 3GBGA 3DYMA 3ZYIB 2E6VA 1A8MA 4QQOA 4LT5A 1S2EA 4KGGA 2QQOA 1PO11 1H1IA 5EWSA 1HXS1 3ELNA 2Y26A 1UY1A 4KNCA 4KH9A 2CNAA 1XB9A 3ZFFC 4Q29A 1JZ6A 1KXGA 4FO9A 5FUNA 3HOBA 3HR9A 3HVDA 4QPIC 1XYOA 1YJLA 2QJVA 4PJYA 2KM2A 4QX0A 4A7YA 1OVSA 1PGW1 1V9U2 1W9FA 1MR5A 2VMDA 4FQZA 4IEUA 1REFA 4XF1A 1PO22 3ZYPA 2A6WA 3D0SA 2C9AA 4YLZA 2W52A 1I5PA 2CAUA 1I1EA 3WW1A 1NY71 3WG2A 1AYM3 1D4M3 4EN0A 1SMVA 3OGVA 3EYPA 2PHTA 1K5MC 4PHZA 2LALA 1AHSA 1MQTA 4WZFA 3I3QA 4MLOA 5EJ3A 3CZJA 2D6NA 2GMEA 2MNGA 2Q4SA 3KQ4B 2VW1A 1QDOA 2LUWA 3VHOA 4W6WA 4N9HA 1H4GA 3SHRA 5IVYA 2ZX2A 4UFJA 4EN7B 1VBC1 4TTGA 3V0AB 5H9PA 1S4CA 4FPYA 4XQDA 1KDMA 1D2SA 1OKQA 3J7LA 1CX1A 3E97A 5LA2A 5CADA 3EXUA 3WF1A 4GULA 3H1MA 3IBMA 4HVOA 4GH4A 2W92A 4PF5A 4URAA 2WSVA 2VY0A 1HRV1 1OT5A 2D40A 4UFMA 4XQWA 5IAVA 1TNFA 1IGOA 5FP4A 1D7PM 1JZ8A 4PDWA 1OA2A 3GJAA 4Q26A 4XXPA 1US3A 2P1BA 2PHUA 1ZX5A 2DFBA 2G4IA 2YU1A 3FMGA 2JDUA 3OJBA 3OY8B 4CCEA 2Q1ZB 2DVDA 3WNPA 4CDUB 5I0DA 2ATFA 5J96B 1IZ3A 4B3NA 3TYJA 4AF9A 4ZZ8A 5IWFA 1ULOA 1XSQA 3RZZA 2CAVA 4ZU7A 3I2HA 3SQOA 4UFIA 4BYYA 1EYBA 3LA3A 2WC2A 4XVHA 2BNNA 5GZFA 4CZSA 2CWSA 5G05L 1Q8SA 4YW4A 2HJIA 2XJUA 1AYM2 1D4M2 1ZBA1 4FFIA 4JKLA 4Z82A 2K2SA 3NO8A 2HWE1 4CDXB 3P6BA 5C7GA 1D4VB 2DDUA 1R1A1 4Q0QA 4MGZE 4XUPA 2R1DA 4J6GA 4MGYE 4META 5FXVA 5FZ4A 5C3SA 2VZ1A 1TQ5A 2Z2SB 3DUIA 1QH6A 1JYXA 1PMHX 2WAAA 2Y33A 4CDXC 3W5NA 4Y5TA 5GM0A 5A7SA 4QQPA 1HRI3 2OA2A 2FMDA 5FZBA 3WNOA 4CXXA 4UBGA 2JDNA 1G7YA 2VQ0A 3AZZA 4IE5A 3DYOA 3VBSB 1G9CA 1UD1A 4FPKA 5FY5A 5FP8A 1MZ5A 1R093 3IMMA 1DFQA 3W20A 3Q8CA 3VLBB 1ONAA 4PIXA 5I8YA 2Q8DA 4JRLA 1KD7A 4JQTA 4KU7A 2XKPA 1VR3A 5K9YA 2PQQA 4LHNA 1ZBE3 2J22A 3ZM8A 2IC1A 2YU2A 5FUPA 2Y6FA 4GMP0 3DPRA 1UMHA 3MI8A 1AR63 4CEWB 3R6SA 2FDFA 1ZZ6A 5C3OA 5FLIA 4QX1A 4OHVA 2XWBB 4IL7A 1RINA 1Y7BA 4Q1RA 2OQ6A 3ILRA 5LB6A 1B35A 1DP0A 1LESA 4S2GA 4YM0A 3ZXAC 2NMOA 1J58A 2PXJA 3AKTA 4HVRA 4CCMA 4MGKE 4NRPA 3VB9A 2HWF1 5ISLA 2R30A 4L8QA 1RJ8A 1UU4A 5KXDA 3NW4A 2NN8A 3R4UA 5A6YA 3RYRA 4CSWA 4E8DA 2HWC1 1NAEA 5BNNA 2DCZA 5E6HA 2WIIB 1H9WA 1XNCA 2JDHA 3D82A 4BDVB 4IESA 2XVGA 2RM23 3LSDA 3S0MA 5D8AB 1WA4A 2VPVA 3J4UH 4CUCA 2Y6LA 5A3OA 2BYVE 4V2VA 1HRI2 2VC9A 1IHMA 2YFUA 1LGNA 3THTA 5EIYB 1I3HA 1QJY3 2XPJA 3I3MA 2Q0AA 2LRPA 2R061 4ISRA 3UGGA 1R092 1W8HA 3JBG2 2V5DA 4JAAA 2QZ2A 1SCRA 1JU4A 4OCTA 5IYYA 5FFOC 4BHPA 3VGIA 1ZBE2 1UOBA 4U2AA 4YM1A 3OEAA 5ACA3 1AYN1 4XOGA 3UKNA 4IE7A 3E6DA 1NOVA 1YFYA 1U5ZA 3T1LA 1RB8G 5FY4A 2XLAA 3BOWA 4K3UA 1AR62 3AP4A 4PLOA 1PVC3 1X36A 4R9AA 1NLQA 4D69A 4YG6A 4IV3A 4XBLA 5FQ0A 3LOIA 2EVXA 2RJ2A 4XDPA 4XABA 4XF0A 2IXIA 4BMEA 2EXKA 1GWKA 2R072 5C3RA 1S2BA 5CFDA 2V5YA 1SCSA 4HZFA 1KRIA 2DCJA 4FTSA 2XHNA 4OI2A 5F5CA 4HN0A 3H7JA 5FKCA 1ZZ9A 3HWJA 4RQPA 4K1YA 4YFZA 1W2TA 4PLNA 4XIOA 3SKVA 5FLHA 1GQGA 4Y26A 3G7DA 1W28A 2E51A 4GB33 4Y3OA 3EHKA 5K0UC 1V6JA 3NNJA 1JZ3A 1NQDA 1LOAA 1NUKA 5A33B 1YHFA 5IVEA 2RM22 4LKFA 1J3PA 1YUDA 4LBKA 5F6LB 5BPXA 5F5AA 4LBOA 3ZLIA 3UKVA 3LEIA 3DEMA 3A0KA 2CV6A 5FAXA 1OD3A 1L3JA 3WF3A 2QQPA 1BVP1 1R1ZA 5FPVA 4H7LA 4U36A 1PZ7A 2WZPP 4Q5OA 1AR73 2DCYA 1QKQA 5FY1A 3WDWA 4EWDA 4LNVA 3LZZA 4COVA 5A1AA 1N1TA 2J1UA 4NIHA 3AKSA 2RR13 3KVAA 2ZEWA 1DGWA 4MVTA 5T3NA 3I8TA 4L92A 4WVVA 5FPLA 5EZWA 5B4NA 5DDJ1 2DCTA 2NM1A 5DPNA 4XPVA 2DYCA 2E33A 5FJHA 2H6BA 3PNAA 1AZDA 1GP4A 3B9CA 4AWDA 1CGPA 1OLMA 3VDDB 1UZ0A 1OLQA 3I3BA 3AYAA 4BQWA 2BBAA 2RJLA 1JTZX 1UO9A 4HMZA 1DYKA 2P3YA 1RUJ1 4HANA 2A70A 4GB32 4JQRA 1CAVA 4CXYA 5FRAA 2VMCA 1KDKA 3VDDC 5FY9A 4P02B 4EN8B 4GIQA 3PJQA 2G9FA 4RFT0 1C3HA 4FT8A 5FY8A 1WBLA 3HNYM 4PBOA 5BNOB 1Y43B 1J3QA 1E5RA 2UURA 3B69A 3CO2A 1QOOA 2Q8CA 1VE0A 3UYJA 4AGRA 4A4AA 3ZN5A 2XDVA 3CHXA 3UNPA 2O8QA 2RDQA 1G8WA 3V0BA 2BEOA 2GNMA 1WW6A 4S2HA 1TVGA 1GLHA 2C9KA 5DN2A 1O3RA 1AR72 1DYOA 1VRH1 2F4PA 2OUHA 4AR2A 4UBHA 4IUGA 3WHTA 1QGLA 3JQWA 3AVSA 5A32A 3ZSJA 5IW0A 5C9AB 4Q8KA 1L7RA 1QDCA 2ORZA 2Y6GA 2Q8EA 2RR12 5FYUA 3MW4A 2YUEA 3AMHA 3LDKA 3WOGA 4D6SA 2JIGA 2YHJA 4I2OA 1MVQA 1PO13 2J1AA 1J83A 3WDUA 4XDOA 1IS6A 4XFFA 4ZXKA 1JZ4A 1O3QA 5FPAA 1WKYA 3BI3A 4LA3A 1KJRA 2TUNA 1W03A 2ID4A 4QAWA 3ILNA 1IPKA 5LY1A 1C57A 2E26A 1HKDA 2ZX1A 3AK0A 5FXXA 3VZLA 4LUKA 4DNYA 2QQUA 4AEDB 1LTEA 4R9CA 5F9TA 3KT1A 2VQAA 3QD6A 5K4LA 3VBRA 1OFSA 1T2XA 3TN93 1PIV2 1YYNA 2XUMA 4LR4A 1PO21 2E7QA 2QTWB 2NPIA 4BK4A 2Y34A 2P17A 1MS8A 2G9ZA 4BXFA 4Z07A 4AEDC 5KHJA 4PBPA 4FBFA 2I45A 4DQAA 4CU6A 4F83A 2JDAA 3C2UA 1JHJA 4BQXA 3RJ2X 4INDA 2BW8A 3GXUA 4XJUA 4Q27A 3JU9A 4I30A 4WVWA 1EUUA 4Y24A 3OGRA 3VV1A 1GNYA 1W9YA 5CYYA 2D7FA 2WFPA 2Y6KA 4FSJA 4I3PA 4LA2A 3WNMA 4PI0A 3N9OA 5IVJA 3N9LA 4XF4A 3KT4A 3AP6A 1UF2C 4FVVA 5L36A 1BCXA 1GFF2 4NIGA 2R041 5BUVA 1ENQA 4I0WB 2YBKA 1PHMA 4WV8A 2GH8A 3WUDA 2ZXQA 1JYNA 4NOTA 4UF0A 5LA1A 1PO12 1R64A 1V6OA 2RDRA 4H55A 5FZAA 1HXS2 4I0BA 4HETA 3USUA 4MV2A 2XJPA 4GD4A 1VMJA 4P9LA 3TEXA 1AR91 2PAMA 4DXSA 2DU0A 5BYNA 5JMOA 5F1RA 1SLBA 3RDIA 3CQOA 5EJZB 1MVEA 4QM9A 2CGNA 4KL1A 4RHV3 3VKMA 4LUMA 1YQ8A 3I7DA 3T4HB 2XVKA 3DGTA 4XUOA 1GZTA 4KWLA 5I0TA 4M3CE 3FN9A 4IQPA 1XSRA 2AGSA 2J1EA 3PJYA 1REEA 2XQXA 4EQVA 1NKGA 3Q8AA 1W0NA 2GC1A 3SEPA 1NY72 4ES8A 1WW7A 2JE8A 4YM2A 4A7ZA 5JSOA 1C1FA 1BQPA 1ULCA 4QXKA 4X8NA 1R1A3 2RVAA 3NVCA 1W3VA 4QDSA 4BQ1A 2D3SA 3ZSEA 1ULPA 5IVFA 1XXNA 1D4M1 3WP6A 4YRDA 2BNMA 3J7HA 3H3LA 3KB5A 4B4RA 3MHZA 5DAPA 5DXDA 1DG6A 1NE6A 2FCVA 4LHLA 3VZOA 5IVBA 4RD7A 3KWVA 3A23A 4D7TA 4O9EA 2GP3A 2VD7A 1ZA7A 4QKNA 3DXTA 3NQHA 4LLOA 4NPRA 3RRDA 1KQRA 5K7PA 3RFRA 3C3VA 4NHYA 2X5IA 3N9QA 4UW3A 2IXHA 2RMU3 3VDAA 3KV4A 1H2MA 1OLME 2Z42A 1O5LA 1UQXA 1FV2A 3OBRA 2ZAHA 3PTYA 4OUMA 3SH5A 3VKOA 5A1LA 3NV1A 2XBO3 1PZ8A 4Y1VA 4RN5A 5DAXA 5FUIA 4JGZA 5DUVA 2Y8KA 2XJVA 2WDBA 3LWCA 5GLVA 3QH7A 3O7OA 4D8MA 1DDLA 1QXJA 5CFCB 3JB4C 3BB6A 3KQRA 4OHZA 4CTEA 4XHBA 5A3WA 4AEMA 3T2QA 4K7JA 5HV0A 5LA9A 4BJ0A 4OI1A 1ZBA2 5GLTA 2PHXA 4HKWA 2AEZA 2HWE2 2OZ6A 1OA4A 1R1A2 1O59A 1W90A 5FP3A 5FP7A 2VOKA 1Q5OA 4FPHA 4TSVA 2VXRA 2PHDA 4AI3A 4AFMA 3OSDA 1HB1A 1G9DA 5DZFA 4COWA 4JX0A 5A3PA 3NJYA 3SEEA 3VUOA 2JD4A 2JDPA 1H6XA 4TYSA 1W6QB 4ZPIA 1UZYA 2R063 2E7TA 1UYXA 1HRI1 4NIDA 1NCRA 1JODA 1YIFA 3E5QA 3LIGA 3AP5A 4IEWA 2RMU2 3INAA 3NMBA 4YVSB 2BZDA 2Y60A 5FZ9A 5F3IA 2BGCA 4NAOA 4LK7A 5LBFA 4E9KA 1QJFA 2DTYA 5FO7B 1BK1A 4AFCA 3RZGA 5ANQA 5FZKA 1CAUA 3T0DA 2QUOA 3PU8A 1AYN3 2WO3A 2I74A 2GH2A 3ABZA 3WHUA 4HL0A 4XJZA 4LO8A 1W9SA 3HT2A 4YVSC 1ZBE1 2XONA 3RVHA 2YYOA 1T6BX 2CY6A 4QPGB 5DMYA 2CDPA 3PLQA 3CU7A 4AW7A 5T54A 4HVQA 1O91A 3HBKA
chains in the Genus database with same CATH topology
4DY5A 3WP4A 3MIFA 4HSLA 4AHYA 1QNYA 3UJQA 3D6EA 1AF9A 2PAKA 3KGLA 4QPGC 1VIWB 1W6NA 2DUQA 4AI2A 5C6CA 3FLRA 2HWC2 4WM7B 2BUKA 1CESA 1BBT3 1UKGA 2B9UA 5I8SA 1EP0A 2PHFA 5HXVA 1UKRA 5FPXA 4EJRA 2IWGB 3AYEA 3AYDA 2D6LX 4WM7C 3M1HA 2IXJA 2RM21 3APBA 4FPFA 5CVRA 5JVVA 2E63A 2R062 4YVWA 4AVVA 3SCHA 2ET1A 1FOD1 1QJY1 1TME3 3B93A 5E88A 3AZXA 3KCYA 1DLLA 1FI2A 1AYN2 1LOGA 4P9GA 4A3XA 2FZ1A 3MF6A 4CEYB 2JE9A 1ZZ7A 4P5HA 5ACA1 3B9IA 1UAIA 2VW2A 1ND2B 1T6GC 4IV1A 1PVC1 4CEYC 4YZ2A 3W58A 3KD4A 3ZO0B 1KFUL 1OI6A 3WXPA 3ACLA 2UWCA 2OPKA 2A6VA 3E6BA 2UYAA 1Y9QA 1ND3A 2XLFA 3N7KA 2PFWA 4UW5A 1U0AA 3LA2A 3PVBB 1ZRDA 1WGPA 1YI7A 4XEZA 5JCTA 5BNPA 4JV4A 5AFEA 2ERFA 4FP2A 2D3RA 3IN9A 5DG2A 3RI8A 4Q0SA 4YW1A 1QWRA 2KXLA 1SBFA 2WA3A 1VLNA 2JENA 2ZGPA 5T55A 3JQXA 3O0WA 4F3JA 1AL23 3SITA 4XTPA 1JH5A 3WDYA 3AZYA 1C5HA 1N1VA 4QPIA 2QE3A 4B4PA 4EN6B 2WNUB 3WP5A 1F31A 3O0XA 2GDFA 2VVDA 4KG0A 4MGIE 1DQ1A 1C8NA 1EY2A 2FBEA 2RR11 1SLAA 2WNUC 3V64A 5JI9A 1SACA 4JDMA 1PM7A 1Z0HA 3CJIC 4B29A 5J48A 3RI9A 1SEFA 3IPVA 4E4DX 1DQ4A 1YFUA 1IS4A 1OQDA 4YFWA 2GSYA 4JDNA 1RMU3 4I02A 2GALA 1QJU3 1DGRN 1V6MA 4XXAA 1BMV2 1UPIA 3ZN4A 1BXHA 1RHI3 3M3OA 4JTOA 4AGVA 1H1MA 2ZJCA 3OYWB 5IUQA 1FXZA 1RL3A 1LOCA 5J3UA 3QACA 3D0JA 2JICA 4K6BA 2JG9B 1S0GA 4GKXA 2ZGMA 3UKVA 1SFNA 2ZGSA 3H7YA 4UW6A 1W6PB 4N90A 2GZWA 1AL22 3WW2A 4C1WA 4HT1T 1ZM1A 3ZIXA 4HLTA 2DVBA 4IEYA 2JG9C 2XJSA 2C1FA 3ASIA 5JZGB 2NYYA 1X50A 5HCFA 2IXCA 4XMAA 4ATEA 2P3JA 4ES9A 1LOFC 3VN4A 4CDQC 4AVAA 3ZFGA 3OY8A 4CDUA 1GZ9A 5JZGC 1OSGA 1O7FA 1YJKA 1AXKA 4Y22A 2DV9A 4PIZA 3FC0A 1G9AA 1QJU2 1OPOA 2ZGOA 3AKQA 3NV3A 4CDXA 3SLIA 1K5MB 5KHGA 4FPEA 1LHOA 2H6CA 2MEV3 4AVBA 4YW2A 2PLV1 4K40A 4R8HA 3TN91 4F8AA 4N7UA 2ENRA 2CGPA 1CIWA 1RUI3 4RR3B 3VBFB 3S7IA 4OFGA 1VB4A 1OFNA 1LKNA 3IWZA 1F8VA 3VBSA 1GNHA 2YV8A 4C0HA 4RR3C 3VBFC 2R042 1OA3A 1DYPA 3VKLA 4NO4A 4Y20B 3VBHB 1DGWX 2ZGUA 1MS3A 2WL1A 5HCBA 3ZFEA 5ABJA 5JOZA 4LHKA 5A3LA 4DOUA 4YW3A 1AR92 4CEWA 2NLRA 1G86A 3VBHC 3M2MA 2PHLA 5K8SA 1TEIA 2R1BA 2BFUS 2GN3A 3WNXA 2ZCWA 4BH9A 4N43B 1DIWA 2WINB 4LBLA 2ZHNA 3MPPG 1C8M1 4XF9A 2W39A 4LO4B 4QQ2A 3NWKA 2MHFA 4RHV1 5EYYA 4CP0A 3LAGA 3HN1A 4N43C 3WW4A 2IFRA 2WSUA 1LJ7A 4FAGA 1NA1B 5D8AA 1U5XA 1G9BA 1RUI2 1OOPA 1XE8A 3KMHA 1SLTA 4FOVA 5C8WA 1S1AA 3JZVA 3BPZA 1AVBA 4BIFA 2EAAA 5LRSA 1WW4A 1NA1C 2IFWA 3GZTB 3ROUA 2ZGTA 5J36A 4JVAA 1QJZA 3AM2A 1UW8A 2H0BA 3MEPA 4OHYA 2V73A 1GZWA 2VECA 1OHFA 4D7YA 2RMU1 2DVFA 3J8F1 5KXEA 2EXIA 2XBO1 1FATA 1AX0A 1RUF1 2R32A 4Z1VA 1BEV3 2ZGQA 2GC2A 3JD73 2DVGA 2FZ2A 2GC3A 4G9SB 2K0GA 4JRAA 1MQTB 1EAH3 4YGBA 3UK9A 1CAWA 4DRRA 1QNWA 2X8KA 3B5LB 4QD2A 4FPLA 1MQTC 1LECA 2C5DA 3UV9A 4F7ZA 2ZABA 2Y0IA 4RS5A 3WDVA 1WD4A 5GZDA 2ARXA 1U5IA 4LE4A 4AQSA 1RITA 1URXA 3USSA 3RYPA 2QNKA 3H3UA 3GHMA 2RS53 2ZX4A 3OD4A 5FLJA 2B42B 2JDZA 2IXKA 3AJZA 3AKPA 4PDWB 4R52A 1FOD3 5F6KA 1JOJA 4IEOA 2TEPA 4GH4C 3HD8B 4XFAA 3IMNA 4DFSA 2OZJA 4DY3A 4AE2A 3G6JB 3V65A 1JYCA 5FOJB 5L7OB 3I59A 2YPJA 3ALQA 3K48A 3NKGA 4PDWC 1YNAA 3I2DA 1BEV2 1CAXA 3VZKA 5L7OC 1V6IA 3NAPB 1NLRA 2WJSA 1NCQB 5LK7B 3TRSB 1C28A 5DZGA 3AXEA 3KCCA 1YFXA 4QPYA 1V6KA 4CDWA 1HV0A 2UU8A 3NAPC 5K0UB 3HBZA 1NCQC 2WT2A 4PIYA 3DF0A 2R0HA 3U4XA 3AMQA 5BNOA 5KC6A 3ZDSA 2XLGA 1EPZA 4YZ4A 4IEXA 3FZ3A 1BBT1 2SLIA 2P37A 2D97A 2W0XA 3CEWA 1VAMA 3TOJA 4WBBA 2SBAA 2RS52 1LB2A 5C9AA 1W6OB 5I0UA 2AR6A 1Q8PA 2QDNA 1FOD2 1QJY2 1VAKA 1WLDA 3DPRB 4Z8BA 5CNAA 3VL9A 1RVF3 1FNYA 3GZAA 2RE9A 3MFCA 3RMXA 4Q1PA 5FBZA 1ZZCA 2DWRA 4AHWA 3A0NA 1TME1 3RWNA 1XU1A 4GQ7A 4L97A 3DPRC 5ACA2 1CD3G 1MZ6A 4KWJA 4TLFA 5FCCA 3ZXFA 4JCKA 1TMF3 5C8CB 1PVC2 3VBOA 4AEDA 3IM0A 1VBE3 2W08A 5BNNB 1B35C 4XF3A 1VP6A 2BVVA 4JDOA 2WZR3 3LA7A 4LTAA 3SMHA 5IT6A 4HK8A 4AI0A 1TE1B 5C8CC 3QBQA 1HDKA 5BNNC 3NV2A 4BCUA 4HBNA 3O12A 1BMV1 1G6NA 4QGLA 1A3KA 3QH6A 4BLIA 1MACA 2CGOA 4KWKA 4P9XA 1W6MB 3RPQA 4AVSA 3AP7A 1RVF2 1W0OA 2D98A 1PGSA 1S55A 3NSTA 1AL21 3K51A 3NKTA 5FQ0B 3AFKA 4BE3A 1LU2A 1POV3 4AHXA 3I4IA 2AZ5A 4L11A 1UU6A 4XQ4A 2VW0A 3B00A 1Q8OA 2BTVC 3ES1A 2BNOA 5JAXA 3GNEA 4AI8A 3FBMA 1PMIA 1QU0A 1H2KA 4K20A 3VL8A 5JI7A 2WZR2 3MIBA 4RQPC 2ZAAA 3U07A 3IIAA 4M3CB 1N3PA 3N35A 2A3XA 3ZIWA 1RMU1 2PLV3 3N7JA 1QJU1 2FQPA 2ZX3A 1R083 3UL2A 5CA6A 1RHI1 2OIIA 1H8VA 1F5JA 1H1AA 1Q8VA 4QMAA 4L9BA 4N53A 1PK6A 3AYCA 5DG1A 2B8MA 2A7AA 5LK5A 1RUH1 1GANA 3IDBB 4JGYB 1WCDJ 1ZA4A 3VHRA 5H9RA 1IQAA 1IPJA 1FAYA 4XBQA 4EWEA 3H0OA 4HK9A 1RUG3 2D3PA 4JGYC 5CFCA 3RS6A 1IKPA 1H8TB 3MW3A 4LULA 5SV8A 1CAVB 3AB0A 1C8M3 2FMYA 3UKTA 1W0PA 2D6KA 3AJYA 1S0CA 1H8TC 4BLJA 3H9AA 2P34A 1AXYA 2PLV2 5L19A 1QF3A 2A6XA 4DMIA 1R082 1RUE1 3TN92 3V0BB 3WW3A 5AVPA 2NP0A 2Q8OA 3X29B 2MEV1 2O0OA 1O4ZA 2HEYF 4NHMA 3S30A 5A32B 2DU1A 1LEDA 4EV0A 5JOXA 1W6QA 2VOWA 2YROA 1RUI1 1AJOA 3MIGA 4AEJA 1JN2P 3B7MA 4OI4A 5T5LA 2HYKA 3ZMNA 3R4DB 2VMIA 2ZMLA 1DZTA 4EROA 3M8LA 3FUQA 4YGDA 4D94A 2EAKA 4FXKB 4LBJA 1RUG2 2D5HA 5E1RA 1CN1A 3WDTA 3H1YA 5FO8B 4QPGA 2Q30A 1MS4A 3J8F3 2WQ4A 4ITCA 4WVMB 1RUF3 2DF7A 3N7LA 3VBRB 3WINE 2ETEA 1AL0G 4Q4Y1 1UU5A 3PMEA 3MYXA 4G3YC 4R9DA 5EFUA 2A3YA 3QOPA 2PHWA 3I54A 1QY4A 1SLCA 1C8M2 4XFCA 4YARA 2FHRA 3LCPA 4DB5A 3VBRC 4RHV2 3FBYA 2PELA 1UMZA 2EXHA 4CP2A 4WM7A 1VBA3 2EA7A 2WWSA 5FREA 3ZN6B 4C0BA 3M7AA 4BZ4A 2JJ6A 1SBDA 1QHDA 1LHUA 1FNZA 1XYPA 4OZXA 4YW5A 5FMOS 3VBUB 4XETA 5IK5A 1NXMA 1I9RA 3HAGA 1GSLA 3VKFC 4Y1YA 1LU1A 1MZEA 5JOWA 1WMDA 1YXWA 3WR0A 4A2UA 1JW6A 2VOVA 4X6RB 3HT1A 3VBUC 1HQWA 1DF0A 3RNSA 3POYA 4HKOA 1HV1A 1QMJA 3KSCA 3E5XA 4AG4A 5LEJA 2R16A 4PLMA 3J8F2 3CLPA 2XBO2 1RUF2 4XJWA 1ND2A 1B09A 1YRZA 2JEMA 3VZJA 1AR83 3ZSKA 3MLKA 5FDBA 3ETQA 3QCWA 4RL7A 4E4ZA 4Q4V3 3EQEA 4XJ9A 4Q0VA 1BEV1 5E8AA 3JD71 4E2QA 3SNMA 1GQHA 2ZA9A 2ZZQA 3UJOA 1NG0A 1EAH1 1VBA2 4PQ9A 5EXOA 1DQ2A 3A4UA 4Y4YA 4S2FA 4D7SA 3AKRA 2ZOEB 2NMNA 2A71A 2ZGRA 3AMNA 4UW4A 5GLWA 1A78A 2ZACA 1M06G 2VUJA 2X5IB 4Y1ZA 1S2KA 3TNPB 4DZGA 2DCKA 2QCSB 1ENSA 2QKDA 4KBBA 2B7YA 4WM8B 3CJXA 3HIFA 3MPBA 3EO6A 2V09A 2X5IC 5IK4A 3W59A 4IERA 2RS51 4P9YA 1QQP3 5AC93 4WM8C 5SV5A 2PYTA 2YGLA 4Q2FA 3E5UA 4I09A 3AMPA 3DKWA 2Q1MA 3WY6A 5KC5A 1RUD3 4JGZC 1GZCA 5L73A 3HQXA 3TWIA 1N3QA 1LENA 1AR82 1YI9A 2R49A 2D93A 3RG0A 2EALA 2HKXA 2YXSA 4ONUA 4Q8LA 2AYHA 1NYWA 1SLLA 3FFQA 5HCAA 4MXWB 4I01A 4BMBA 5IK8A 1BKZA 2Y0OA 3KZ4C 1RIRA 4H14A 2AUYA 2A6YA 4IEPA 5GALA 2Z5WA 3URFA 4V1PA 3T2TA 3DV8A 1BBT2 1NCRB 2DTWA 3IKWA 3RSJA 3SH3A 1BZWA 1W6PA 2ET7A 3LKJA 2WA4A 1VJ2A 5CB7A 2C0ZA 3KCXA 1LOFA 4FAHA 1J59A 3O0VA 1A8DA 4MH0E 1NCRC 3GBFA 5JZGA 3CNAA 3L9JT 4AK3A 4XTMA 5AC92 4XZPA 2YGMA 3WQ1A 3ZFFA 5JSRA 1TME2 1RVF1 2N7GA 1RUD2 4YZ3A 2IZWA 3WZ1A 4CRQA 3CJIB 3M70A 3MW2A 3TBDA 3SH4A 1UZZA 1D0HA 3BODA 5I91A 1W6NB 3RJRA 3CL1A 1WBFA 2HWD3 4RSUA 1ENRA 2PN5A 4IXLA 1TMF1 1K5MA 2HWB3 1GNZA 1VBE1 4LBQB 3WUCA 4CP1A 2UY9A 5H9SA 1ULGA 3H3ZA 2WZR1 4ISQA 4D3WA 1DQ0A 1BJQA 4PCRA 4XJ8A 1QOSA 3T1MA 1FYUA 1FPN3 5DZEA 3ZXJA 4FTBA 3FE5A 1PVXA 3AMMA 3AFGA 3V0AA 4YM3A 2ZS6B 4XDQA 4DXZA 4C90A 3RQ0A 3VBHA 1RUH3 3WLUA 4M00A 3WDXA 2QVSB 1DBNA 5BXXA 2VH9A 4CDQB 2I07B 4IV1B 4MYEA 4K8FA 3WP3A 2XL9A 1NLSA 3BOPA 3ZMOA 1O4YA 4M3CF 1FMD3 1POV1 4G4FA 2ILMA 1H0BA 1U5YA 3LB9A 2XWJB 3SISA 2XKOA 3BALA 4IV1C 5EYXA 2HWD2 1PGL1 3THPA 2ARBA 2GMMA 1F5FA 3U11A 3ZXLA 3ZSLA 3MLJA 4GXLA 5CU1A 1UIJA 2HWB2 3M4FA 5BNPB 1MEC3 1RUC1 3AZVA 1ND3C 4GA9A 1S0FA 4IEZA 1RMU2 2D43A 2VVEA 2JG8B 3P3PA 1NA1A 4R4XA 1GYKA 1RUE3 1F2NA 1RHI2 3U10A 4P9JA 4Q0UA 5BNPC 5JIUA 1YFWA 1CJDA 1FPN2 4QQHA 3P3NA 1R081 3WQ7A 3WVJA 4YNIA 2JG8C 2PA7A 1JUIA 2WNVB 1WMEA 4KQ7A 1QJX1 2GNBA 2GN7A 2JX9A 1AJKA 2EIGA 4L99A 4M0NA 1RUH2 3ILFA 3ZXKA 5CG9A 2VOXA 1KFXL 2WS93 3E6CC 2WNVC 3WG3A 3MIDA 2OW4A 2ZMKA 3IPVB 1QOTA 1JUHA 2Y38A 2D6PA 1VBD1 4NWVA 4S2DA 3TAYA 5C4WB 2BWAA 1FMD2 5GLUA 1CR7A 4YG3A 4Q4Y3 3ZSMA 1RUG1 1EV13 4HPKB 4DRVA 5C4WC 4URTA 5JMCA 4K21A 1S0JA 1MEC2 2CTVA 3AX4A 1X8EA 3AXDA 3VKNA 3WG1A 3WG4A 1GR3A 4FTEA 1LEMA 1RUE2 4ASLA 3MGUA 3R4SA 1QXRA 3PVEA 2UYBA 2MEV2 2GMPA 3O14A 1HW5A 3L2YA 2E9QA 2RJKA 3N7MA 4SLIA 2WLPA 1BVVA 4C1XA 2ZMNA 1ZVFA 1H9PA 2GAUA 1I5ZA 4I3GA 4AVCA 1EPWA 1SQ4A 3FLPA 1HLCA 5E16A 1DU3D 4ATFA 3ZFGB 3QLQA 1UIKA 5I8TA 4Z2WA 5L7OA 2WS92 4MZUA 3N4MA 4Y22B 5FO9B 5CG8A 3B94A 1NXD1 4HSJA 1GV9A 3ZFGC 4CDUC 4YZ1A 2OYZA 3NAPA 3PVNA 4SBVA 1NCQA 4Q4Y2 1CONA 3J26N 1EV12 2ES3A 3B02A 4FOWA 2AH2A 4KGQA 4X6QB 5K0UA 2NZ9A 4ZKTB 3NL1A 3ZPYA 4ASMB 2B46X 1GICA 1CVNA 4XFBA 2IXLA 2YZ4A 4H3WA 2ZPXA 1OD5A 3WQ0A 1S0BA 3IT8A 1RGSA 1VBA1 1CQ9A 2Z79A 3JBG3 3N3HA 5A33A 4OVEA 4COZA 4GMP3 2F6BA 2A75A 1ASJ3 2AREA 2PHRA 2QFEA 4AVTA 3VBSC 1W6OA 3ZVXA 2BWCA 2ZTNA 3ZFEB 1Z7S3 5ABJB 4GH4B 2CYFA 4YGEA 1DZRA 2WFF3 5JIAA 4K9SA 1HQLA 4BWOA 1ZYBA 2GNDA 4LBNA 4EWAA 2R073 2VMGA 3ZFEC 5ABJC 4HFSA 2WQZC 1OPMA 2MPFA 1V00A 5A3MA 4CEWC 5J37A 4E4SA 4MSVA 4R4ZA 3POSA 1O5UA 2ZZJA 5C8CA 1VBB3 4OUSA 1W39A 1Y3TA 4X8PA 1HX6A 4AFBA 3JD72 4J1XA 1AR81 2OVUA 4FQ4A 3ME2A 3BCWA 2YC0A 3VDDA 4Q4V1 2A3WA 1OOPB 4AYUA 3JUUA 1EAH2 1PNFA 4Q0PA 1IOAA 5JPNB 1ULEA 2ZKNA 5D8AC 1ZRRA 2XL7A 4BA6A 3FHIB 2NQYA 1OOPC 1XNKA 1O4TA 3D8CA 3ES4A 1ASJ2 1W6MA 5D1IA 1ZZBA 2E53A 3N36A 1GZWB 2QDRA 5BY5A 2EF6A 1Z7S2 3B01A 1DGRA 4O9GA 2XB6C 1JXNA 1YLLA 2WFF2 1J3RA 2BFUL 2VNGA 1ALYA 2RS13 5T5JA 4AGGA 1LHVA 2WKKA 3ST7A 1RUOA 3WCRA 1SFYA 1QQP1 5AC91 3LGRA 2P2KA 1J1LA 1PZ9A 1CAWB 1VBB2 1AXZA 3POWA 3TNQA 1RUD1 5GJ6A 5JPMB 4RGGA 1B35B 1ZZ8A 4Q4W3 4WZCA 4HN1A 5EV7A 2PTMA 5AVAA 3ZYRA 4RS5B 4M3CA 3PHMA 1LOBA 3PMSA 4IETA 2GC0A 5JDBA 1MS1A 2BVBA 1GKBA 5CAZA 4RS5C 5FTTC 3NJZA 4NWWA 5HBAA 1HQNA 4XJAA 2AENA 2XJRA 5DUUA 5KHIA 1FT9A 1COV3 1WCSA 1J1TA 2PAEA 3I59B 2XJQA 4JGYA 4Q4X3 3M3QA 2O8OA 4R9BA 2RS12 1CAXB 1UL9A 4JTNA 5CIRA 2VUAA 1JBCA 1BYHA 2X29A 3CF6E 2B39A 1LR5A 1VAVA 5LEKA 4IV3B 4E2SA 4M01A 1XNBA 1JYIA 1H8TA 1PIV3 2DVAA 1LRHA 1VB2A 4YG0A 1IS5A 4CDWB 5CFDB 1KS4A 2JKBA 4Y1XA 3FLTA 4Q4W2 3NV4A 1SBEA 1M4WA 3TB0A 1POV0 3ATGA 3KLSA 1JHNA 4Y1UA 1SDWA 4FPOB 4IV3C 5F5QA 3RYRA 1CPMA 1QH7A 3OGJA 4LE3A 1TMF2 4RQPB 4XE9A 1LGCA 1VBE2 2HWD1 4CDWC 1RUC3 5CFDC 1ENXA 1WMFA 4QU2A 1N1SA 1YCIA 2DUOA 1LHNA 3BU7A 2HWB1 3MIHA 4IEQA 3OBTA 4LO7A 5BNOC 3BIWE 4AQ2A 3MIEA 2RS33 4I0AA 2YMZA 5GLZA 3OCPA 4YYOA 1COV2 4E2GA 4NN0A 5T50A 1HXS3 1FPN1 4YSFA 3OTFA 4DINB 5C9AC 4LEJA 4XHXA 3OD0A 4Q4X2 1QJX3 1WLWA 3R0RA 1Q3EA 4LBMA 4AHZA 2O1QA 3KGZA 1UCXA 1SLIA 3S7EA 2H0VA 4NVPA 5JR7B 3VBOB 3ZYGA 4XILA 4WVMA 1VBD3 4OLLA 1V9U1 4XBNA 3VZNA 1UX6A 1OQ1A 1X82A 4ORFA 1C1LA 1PGL2 4LLFA 1H30A 4P9WA 3VBOC 3M3IA 3WD5A 1FMD1 4AFAA 1O3SA 3ZX7A 1WLTA 1RUC2 1QXPA 2ZHMA 3MLLA 1VBC3 3ZN6A 3ZYJB 1OQEA 3U0ZA 4RGAA 3MDPA 1MEC1 1CX4A 5GZGA 1H2LA 4UXAA 3VBUA 1N1YA 5C33A 2RS32 5T5PA 4BPZA 3WX5A 2ZKLA 1HRV3 2QZ3A 1KJLA 4XMIA 3GYDA 2R6QA 3D4KA 4WVZA 1QJX2 1AX2A 3JB8A 4OULA 1UN1A 1YO8A 4GWMA 1PGW2 3FWEA 4FPCA 4YVSA 4AXOA 2ZGNA 4M0HA 4YGCA 1VBD2 1Q43A 2GNTA 2WS91 5H9QA 5AFBA 4N7IA 1ZBA3 2EXJA 1X7NA 2HWE3 3S6PA 1UPSA 2I2SA 2VVFA 4C91A 2A5ZA 1AYM1 1LCLA 4FPJA 4W6YA 4AI1A 1EV11 1NE4A 2ZX0A 3EJKA 1DZQA 1GBGA 1VBC2 1XYNA 2XGXA 3MFAA 1F9KA 4FOQA 2LM3A 2BQPA 3L2HA 4GALA 4N53B 2UWAA 1PK6B 1D2QA 2D44A 4FPGA 1MS9A 5I93A 1TNRA 1X33A 5E89A 1FX5A 1IS3A 1OLRA 4NHKA 1HRV2 2BBVA 4WM8A 4N53C 2XJTA 4CYDA 1NQJA 1PK6C 2HEWF 1AX1A 2ZBJA 5GKAC 1VALA 1A6CA 1S0DA 2TBVA 2Z69A 4H7MA 3WT3A 5FOBB 5IK7A 2VG9A 1E57A 2A73B 3OPZA 5J98B 3USUB 2CWMA 5B2GB 2P3IA 2G9GA 2P3KA 4XW3A 1IKQA 2LTNA 2YDEA 4KU8A 4BIOA 2Q5TA 4YZ5A 5KHKA 4Z92B 4CEYA 2KA3A 4NR1A 5CFCC 2HWF3 4COUA 5HI0A 4GKYA 4MXVA 5T52A 2HWC3 4XFIA 1O3TA 2XG3A 4RA0A 1LGBA 3ECQA 4MXWA 4N9IA 1X8MA 4QM8A 4BM8A 4J1WA 5KBFA 1ZRCA 3M3CA 4XFGA 1NZCA 4Y5Z0 3FFZA 4A7KA 4FP3A 1WLCA 3WV6A 3B3QE 4P14A 3DN7A 4HKLA 2HEVF 4LBQD 5KXBA 1XU2A 1MZFA 3H1WA 4AFDA 1LHWA 3EBRA 4LO5B 3FJSA 4W6XA 2XVLA 1R091 5T5OA 1WW5A 3GBWA 3JBG1 4GMP1 2OUJA 1XNDA 1ASJ1 1ZRFA 3BTAA 5JLVA 1RUNA 3MZHA 1C5IA 1Z7S1 3FX3A 1AR61 4COYA 3DL3A 2WFF1 2WNUA 1Z78A 4JGZB 4QGMA 4P9IA 3ENRA 2B45X 3CJIA 1YIPA 2A6ZA 2CL2A 3LOBA 2R071 2HWF2 5LRRA 4DPNA 5BV6A 4KG8A 5JOYA 5I0RA 3SCGA 1ZNPA 1W2UA 4FXGB 1VBB1 2UY8A 4LBQA 4Q4V2 4AQTA 3R05A 3ZXEA 2ZHLA 2VGDA 3J9SA 1ULFA 4NHLA 3GZUC 1HIXA 1DQ6A 3OYWA 4K1ZA 3JCIA 1MS5A 2UWBA 1CPNA 2ZHKA 1Q8QA 5KWRA 3PVOA 4XYXA 5DUWA 1FV3A 2JG9A 4OI0A 3H50A 5I0SA 1I6XA 3KT7A 1DHKB 5KHHA 2E7AA 5DDJ3 3ZXGA 1C4RA 1CAUB 2VNOA 1H4HA 1V6NA 3OF1A 4CDQA 3M3EA 4MX3A 3AP9A 2ZGLA 4E27A 5KXCA 1WCKA 1QQP2 2RS11 2BPA2 4OHWA 4B4QA 1XQNA 4W65A 1ND2C 1RUJ3 2XH6A 1XRUA 4JC1A 1CJPA 4LO6B 4DS0A 1AUYA 4FCAA 3KS7A 4L2NA 5FMOL 5FPZA 3AZWA 4QQLA 3GF6A 5JSPA 1ZREA 3VHPA 3H8UA 4GB31 2VMHA 3HMYA 3LSEA 2WT1A 4IEVA 3GALA 4XIKA 4Q4W1 1LODA 2JG8A 3RMYA 2B5HA 2D5FA 2D6MA 4TWTA 5DUXA 1VRH3 4FOYA 4AQ6A 3IDCB 1REDA 1KITA 2TNFA 1U12A 1XE7A 3V56A 1H2NA 1AR71 4YVWB 2YY1A 2WNVA 1S0EA 4RR3A 3VBFA 3W9AA 1WD3A 3WCSA 3MICA 2JE7A 4QT6A 1DQ5A 3OGGA 5DDJ2 1COV1 1APNA 5GZEA 3RYKA 4YVWC 2W68A 2ZGKA 4AEKA 4GWNA 5JWPA 1G9FA 4B7KA 3VHNA 5J09A 4Q4X1 4QGNA 4Y20A 5C4WA 1RC6A 3MF9A 5J7MA 1Q56A 2JECA 1PNGA 1V70A 4XFHA 1MS0A 3D5OA 3SCFA 3SXWA 1RUJ2 1V6LA 1V9U3 2VU9A 1PO23 2R0FA 3O5SA 5TSWA 4HPKA 1N3OA 1OMIA 3IDEA 2VULA 1S0IA 1PIV1 2DUPA 2WLQA 4BOWA 3FUOA 4N43A 2VNRA 2X53S