1JTZX

Crystal structure of trance/rankl cytokine.
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
155
structure length
155
Chain Sequence
QPFAHLTINAASIPSGSHKVTLSSWYHDRGWAKISNMTLSNGKLRVNQDGFYYLYANICFRHHETSGSVPTDYLQLMVYVVKTSIKIPSSHNLMKGGSTKNWSGNSEFHFYSINVGGFFKLRAGEEISIQVSNPSLLDPDQDATYFGAFKVQDID
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords TUMOR NECROSIS FACTOR LIGAND SUPERFAMILY MEMBER 11
publication title Crystal structure of the TRANCE/RANKL cytokine reveals determinants of receptor-ligand specificity
pubmed doi rcsb
source organism Mus musculus
molecule tags Cytokine
total genus 29
structure length 155
sequence length 155
chains with identical sequence Y, Z
ec nomenclature
pdb deposition date 2001-08-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
X PF00229 TNF TNF(Tumour Necrosis Factor) family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.40 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 1jtzX00
1WCKA 1I9RA 3V56A 2Z5WA 4TSVA 1U5XA 1PK6C 2WNVB 2ZJCA 3LKJA 3MI8A 1D0GA 3ME2A 1PK6A 2X29A 4E4DX 4D7YA 4MXWB 2HEWF 3AB0A 3URFA 1JTZX 1O91A 2QDNA 2QE3A 2JG9B 1KD7A 4OULA 3B94A 1C28A 4KGGA 4E4SA 2TUNA 4KG8A 1GR3A 1RJ8A 5KC6A 2OIIA 1DG6A 1TNFA 2Q1MA 4GIQA 3TWIA 4J6GA 4QQLA 4TWTA 5L19A 4QQPA 4KGQA 3B9IA 1PK6B 2TNFA 4G3YC 2ZPXA 4F3JA 4RSUA 1U5ZA 4OUMA 4DOUA 2RJLA 1XU1A 3B93A 2E7AA 3IT8A 2AZ5A 3L9JT 3FC0A 2R30A 3QD6A 4NN0A 2WNUC 5HBAA 1IQAA 2O0OA 1D4VB 2WNUA 4MXVA 2JG8C 4DB5A 4QQHA 2RE9A 5L36A 4QQ2A 2JG8A 2R32A 1JH5A 3K51A 2KA3A 1KXGA 2Q8OA 5TSWA 3ALQA 4QPYA 3QBQA 2WNVC 1XU2A 1DU3D 3TYJA 3K48A 5KWRA 2WNVA 2HEVF 1S55A 4EN0A 2RJKA 4G4FA 1U5YA 5BNQA 4HT1T 1D2QA 2WNUB 4MXWA 1OQDA 1A8MA 2JG9C 5KC5A 3WD5A 2R6QA 2JG8B 2JG9A 1OQEA 4N90A 1OSGA 1RJ7A 5CIRA 1ALYA 2HEYF 1C3HA 4OUSA 4QQOA 1TNRA 4MSVA
chains in the Genus database with same CATH superfamily
4BU2A 1ZVFA 2VUJA 1W2NA 1ZBE2 3MBWA 3NO8A 4R8HA 4QPIA 4UYBA 3VBHC 1HKDA 3A0NA 4NHKA 4AZZA 5I8TA 3ZR6A 1W9FA 5JDBA 3DV8A 2ZMKA 2RR11 4W50A 4GA9A 4P9XA 2ILMA 5H9QA 2ZJCA 3MI8A 3POYA 3WEZA 2ZHKA 5J48A 4C90A 2J1RA 3PVEA 1A6CA 2K46A 4UI9L 2OVUA 2WUHA 4I02A 4LK7A 4XUPA 5DAPA 4YVSC 4JGZB 4OHZA 4GALA 4M01A 3ZXFA 2ET1A 2A1XA 1FX5A 2XGXA 4LORA 1O5LA 1ZBA1 4OI4A 2W1SA 1XBFA 5HXMA 2X53S 2A7AA 3HWJA 5C3OA 5C71A 1QJU3 2I2SA 4PDWA 2XH6A 5F32A 1HV0A 4CDXB 1Z7S1 2YC2A 1CIYA 3R05A 4K3UA 4YWAA 4E8CA 5FMBA 2WS92 3CF6E 1X82A 1A8DA 2QZ2A 1QXJA 2WZR1 3N9PA 4H7MA 3ZDVA 2GN3A 4BQXA 3Q8CA 4CVUA 4YW7A 4PLNA 1VAMA 4QKBA 2VW0A 2WO7A 4QX2A 1GP6A 4M0NA 5FTTC 4AEDA 5IFTA 2NQYA 3DECA 1W6QA 1H6YA 1XRUA 2C5DA 2XJQA 5CKMA 5BNNB 4FCAA 1S0EA 5CKNA 3KLSA 3SH5A 1NT0A 2WFF1 4NRQA 2B46X 1CGPA 5A3OA 1SZBA 3WP3A 4AL9A 2ZMLA 3AZXA 4TLFA 4V1PA 3L2HA 3ZN6B 4HVRA 1Y43B 1PMJX 2UWBA 2W5FA 3NSTA 1V6KA 4WZFA 3EYPA 3MUZ1 1US3A 2BZDA 1VBE3 2XUEA 2VM9A 1FNZA 2R062 1O6UA 2YGLA 5FO7B 4NIIA 3BIEA 2WABA 3B02A 2JDMA 2ZCWA 4UF0B 4YVWC 3MDPA 4GB32 2EA7A 2RE9A 5IATA 5CBLA 1CAVB 3KF3A 4AI1A 4AAPA 3FJSA 4Y24A 3AYDA 1R092 3ZYHA 1QJU1 2OQ6A 4AFBA 4F83A 5JXJA 1GP4A 4LUKA 4D6SA 3POEA 3M1HA 3NQHA 1RYYA 4AI8A 3UGHA 1K5MB 1YFUA 4CUGA 2RM22 3OYWA 1J3RA 2ZKLA 5T50A 1NY72 2AEYA 3ABZA 3AKSA 1JOJA 1O59A 3GNEA 3K3NA 1VBB1 3PVNA 4LO8A 2D43A 2YBPA 4R4XA 3TB0A 2WNEA 2H6BA 5F2SA 3SCGA 4ZY9A 2JDYA 2DBIA 5FMOL 1G9FA 5EIYB 4C8DA 5KWRA 5GALA 2Q4SA 1CAXB 3GF6A 3LWCA 4KU8A 4CEYA 1YNAA 4Y5TA 5AC92 3VUOA 5CFCA 1LAJA 4YM0A 3NKTA 5FO8B 4QU2A 1K5JA 1VJ2A 2A70A 4Y1VA 5E89A 4CZSA 2Y6LA 4LK6A 5IK8A 1IGOA 1H6XA 2O8QA 3AC0A 1JZ2A 1EV11 1HXS3 2H6CA 2VOVA 2VTXJ 1IPKA 3J8F3 3U0ZA 3BI3A 5BUVA 4XJZA 5LBEA 3SITA 5A32A 2VY0A 2A5ZA 1TNRA 3M3IA 3USUA 1W8HA 3HD8B 4FPEA 2E53A 2VTFA 4XDOA 1MVEA 2YFZA 3AP4A 4ASKA 3AMHA 4EZ4A 4NUBA 2V73A 4W8JA 1H8TC 4KBZA 5IAXA 4MLOA 4HG6B 3WF2A 2C26A 1PIV3 4LOTA 3H9AA 2FMDA 3S30A 4JDNA 3WDVA 1MZ6A 1QJX2 4XJAA 4JZRA 2Y8KA 2JJ6A 3KGLA 4LA2A 4RGAA 1SFYA 4HN0A 4F8AA 1B09A 3KWVA 2RS33 1APNA 1YO8A 1W3VA 4GMP0 4CDQC 2WBKA 1KDMA 2XG3A 3MHZA 4QXKA 4FO9A 5AVAA 2IC1A 1GWMA 2J1VA 3BCWA 5FZ0A 1GZWA 1OLRA 5A3PA 3RZZA 3N4MA 1ONAA 2Q5TA 2JIGA 4XFCA 4XQDA 2WT1A 1RUF2 2NMNA 2WNOA 2ZGTA 1E5IA 4IEWA 2XVLA 3T4VA 3H7YA 4ASLA 4HFSA 2JE8A 1FPN3 4NROA 2VMIA 4CEWB 2E26A 1NCQC 1HQWA 3OBTA 1POV1 4IV3A 5DDJ1 2XJVA 3J8F1 5FXVA 5C70A 4S2FA 4P9IA 5FKBA 1WCSA 4XTMA 5HCBA 3RS6A 5EFUA 4BOWA 1IG0A 4M00A 1O8SA 4PQ9A 3AJZA 2ZABA 3AFKA 1FOD2 1IPJA 1D0HA 5A33A 3NV3A 1K45A 4QHOA 4EJRA 3IPVB 2FCUA 1H1MA 1NUKA 3PUHA 2VCAA 5DAVA 4D6RA 1YFWA 3T09A 5BNPA 2FDIA 4ITCA 2XQRA 4ISRA 5JXHA 1ZRFA 5K0UC 3TEZA 3PTRB 1OXCA 3U4XA 3SCHA 2P3KA 2O0OA 2R0HA 1H4GA 4UT5A 4ET7A 4RR3C 5L9VA 4GH4B 1E5RA 4AOCA 2J1TA 4DY5A 3HQUA 5DQ0A 5FKCA 3WHUA 5FO9B 1VBD1 4XXPA 1QH6A 3O0WA 2P1BA 4XJWA 1RUD2 3IDEA 3OEBA 1FMD2 4JRAA 2ZEZA 3UKVA 4YARA 1JH5A 1GMMA 2JIJA 3OGSA 4L8QA 4Q2FA 1ENXA 3UESA 3PHMA 4YSFA 3J4UH 5FZBA 1REFA 2ET7A 1OI6A 3CL1A 2XWJB 4B4QA 1BEV3 4NOTA 3VD4A 3U07A 2Z69A 3BB6A 3HEIA 4FPCA 1BXHA 3C7FA 3APBA 5GLVA 2XONA 4FPJA 4MZUA 4PQQA 4LHKA 1DU3D 3B3QE 5HXVA 5CFDB 1V9U2 4NVPA 3WDTA 3HN1A 3NKGA 4W65A 4LHSA 3PTYA 3P1IA 4JAAA 3ITQA 5F39A 2WO3A 3DUIA 4HVQA 5J37A 4IV1A 1D2QA 4LXLA 1TZOA 4SBVA 2DVBA 4UFLA 3U10A 3VD7A 3O1OA 4FPFA 3MW2A 3FLTA 5BYNA 2P6CA 3HBKA 2A6YA 2JDHA 4QKFA 5JIUA 2F6BA 1W8NA 1WLCA 2FDGA 2BEOA 4CCOA 3ZXJA 1AYM2 2E6VA 3BVCA 4FFIA 4NPLA 4XJUA 4Y26A 5JIAA 3UYJA 4OQ8A 5JZGB 3VBRB 2XKPA 3WNKA 1C3HA 3W59A 5EQUA 2RS53 2EAAA 3N3HA 3RMYA 2CWSA 5F3CA 5FPAA 1EYBA 1J83A 4PCRA 1CZVA 3VDCA 2VG9A 1RUC1 2LALA 1IKPA 2QQLA 3CDZB 4X8PA 1US2A 5FK8A 2HWF1 3HN3A 4QX1A 3AP6A 4Q0UA 3ME2A 1JODA 2D3PA 2FCTA 3KM5A 3WW3A 2KD7A 3ZFGA 3LD8A 4IUGA 2OPKA 5EP9A 1WMFA 3AFGA 4H2AA 4OI1A 3WNNA 2D6KA 1QJEA 4XFBA 1O91A 2NLRA 1HQNA 5C9AA 5EJZB 3HPNA 2JG9B 3MPBA 4QPWA 4ZU4A 4YW2A 5FYBA 3BKZA 3CKHA 4OULA 1QJY2 1XNBA 3LFMA 4LO7A 4UW6A 4WM8C 1QMJA 1U5IA 5DUUA 3UV9A 2CU5A 2HJIA 2Y6HA 2QVSB 3AJYA 4CUCA 1XNDA 4IEPA 5FQ0A 5JPNB 1B35C 1DGRA 4Y1UA 3HNMA 2Q1MA 4C91A 5J7MA 5FMCA 4KNCA 2ZX4A 4BH9A 4EN6B 3KZ4C 1W6OA 1SBEA 1QIQA 5A80A 2VXJA 2CL2A 4QX3A 2D3SA 4U2AA 5FOJB 1QF3A 3F2ZA 3SCFA 4BIFA 4E8DA 1TME2 2IFWA 4QQPA 1FV2A 5FY4A 4META 5FY0A 3WDWA 1F2NA 1HRI2 1TQ5A 1XSRA 2I45A 4RSUA 4RQPB 1S2KA 5LBCA 2XHKA 3ZFEB 4PBPA 1I5PA 4IE7A 4LMFA 3DN7A 5IUQA 4DQAA 3I3EA 4RS5C 3S7IA 2VVEA 1ZZ7A 4JC1A 4D69A 3QD6A 1UOGA 1WZXA 2WN3A 3M3CA 5FV3A 1LOFA 4FPYA 5FDBA 5DG2A 3H0OA 1JZ8A 1EUUA 3DYMA 2D6NA 2QTWB 2PLV2 2JG8C 3FN9A 3VD5A 3R6SA 4DINB 3FLRA 5BNOA 2UYBA 1YLLA 1W9YA 3ZIWA 1UY4A 1DIWA 2BGCA 4XF1A 4D6QA 1QH7A 3LIHA 1W8OA 2Q8OA 1RUI2 4FXGB 4XCAA 3UJQA 3OB8A 5KXEA 3VHOA 2DU0A 2DBNA 3B69A 3ACLA 2IXLA 2B45X 1YQ2A 1U0AA 3C2UA 4N53C 5F3GA 4R4ZA 1PO23 1TMF3 2P3IA 3RI8A 4CYDA 3ZLIA 1RUG2 3KCCA 1WMEA 2HKXA 1NYWA 1S0IA 4LEJA 4JGYC 1DCSA 1YJLA 1IS3A 4JGZA 5H9SA 2XL9A 4P9WA 2JECA 3BTAA 5LRSA 2RMU2 3HNYM 2K2SA 3AVRA 1XNKA 1N3OA 2NM1A 4PT6A 4GKXA 4YFZA 1LU2A 4KBBA 5FP4A 1NCRC 4N90A 1OSGA 2Y26A 2EXIA 4FPHA 3O12A 3ELNA 4AQTA 5GJ6A 3WP4A 3N36A 5T3NA 2ZEWA 3IWZA 2D5HA 5HV0A 1UN1A 4WVVA 4AW7A 5D21A 4M3CB 2W3JA 4TZDA 3PMEA 4XFIA 1XPWA 2Z5WA 3GZTB 3RMXA 3WNXA 2GSYA 3E6CC 5C4WC 5L7OC 2R1BA 4N43C 4Q4Y2 5IYYA 4EWDA 4OI2A 1KRIA 4RN5A 1AR71 1STMA 2CV6A 5KXCA 1FNYA 3ILRA 4AI3A 4LBQB 2FQPA 1PGL2 3Q8AA 2EXHA 4BPZA 2X5IC 3E5XA 3A22A 3LA2A 4ARXA 2R042 2DVFA 2JD9A 3ZN6A 2DURA 1FAYA 5FK7A 3FZ3A 2VMEA 5KHHA 1UOBA 4COZA 2B7YA 4HKOA 3BU7A 4ES9A 5KHGA 4FFFA 1GQHA 1KITA 1EP0A 1XC6A 4IEZA 3KMHA 4BCUA 1FT9A 3I2OA 4K1ZA 4UF0A 4Y22B 5A3WA 1SMVA 3AKPA 2YPJA 2PHUA 1S1AA 2Q8DA 4LULA 4I01A 1LOEA 1CAVA 1VALA 5A6XA 2P3YA 3AMPA 4BQ3A 1AYN3 1V6NA 4QKDA 4PLMA 4MUVA 2D6LX 4PIXA 5CAZA 1JYCA 3A23A 3I2DA 1K5MA 3T30A 5ACA2 1X8EA 3IDCB 4OUMA 1LOCA 1WBFA 2BJSA 3AMQA 4D8MA 1GP5A 1G9DA 1QNYA 4XJ9A 3THPA 4XCBA 2NPIA 3NJYA 4I0AA 3A4UA 5E1RA 2PHWA 1DBNA 2QBXA 4IL7A 4EN9B 2WNUC 1CAXA 4J1WA 1LENA 1CZTA 5C33A 1YQCA 1UKRA 2BOIA 5CKQA 1D4VB 4CCMA 1VBC2 4MGKE 3DYPA 1W6MB 4Z82A 1P8JA 2VQ0A 3E97A 5FZ4A 4E4HA 4HPKB 1ND3C 3IN9A 1UU4A 3IBMA 1JOBA 1N3PA 3DPRC 1UZ0A 3GCXA 1DGWA 1EPZA 3EJKA 4JKMA 4UXAA 5IVVA 2QJVA 3TEXA 1YI7A 4FSJA 1C8M1 1UZYA 2ZS6B 1W8UA 4XFFA 3D0SA 4OHXA 1W0PA 2VQAA 1AR92 4GD4A 3J7HA 1AYN1 1SBDA 2VZVA 1FATA 4FPOB 4O65A 5DUWA 5IVCA 4QX5A 5FZIA 1KS5A 2B4KA 4IW3A 1I6XA 1L7RA 3BODA 4GJZA 2W52A 5LEKA 1SFNA 1YJKA 2ZGNA 2BUKA 3H42B 3ZSLA 3WOGA 5CVRA 3ZSJA 5IT6A 2XLAA 4XBQA 2CDOA 4Q4V1 5FYYA 3ZYIB 4S2DA 3KF5A 4XTPA 1LECA 3V0BB 3L2YA 4KWKA 3M3QA 2DUOA 2WZ8A 2BNNA 1XJAA 3BGAA 2J1UA 3IB3A 4QDQA 5FWEA 3D8CA 3OBAA 4MSVA 1E5SA 1R083 2J1EA 2NZ9A 3GCWA 4HONA 1DGWX 1OD5A 4CEWA 1MQTC 1MZFA 4GXLA 5FUNA 3T1MA 4AEDC 2NP0A 2J1SA 4R9CA 5A7SA 1PK6C 4A44A 1BJQA 3SQOA 3O0XA 4NAMA 5A70A 1RINA 2OZ6A 1VBA2 2X29A 3MFCA 3PU3A 1ZRCA 4MXWB 4BLJA 1OOPB 4EN8B 2BVBA 3LAGA 2OA2A 4ASMB 2YBSA 3IPVA 5IK7A 3VHPA 1GOGA 1OC1A 1GZTA 3TN91 3MIDA 4E4SA 3WQ7A 2ZGMA 3THDA 2TUNA 4EWEA 1ZRDA 5A3UA 2PHLA 1GOHA 2WL1A 2G4IA 1LEDA 5FP3A 3VBSC 2WZEA 4UOJA 2W39A 1LGBA 1H30A 3ACFA 1DG6A 4K21A 3LFIA 3WX5A 3T08A 4GH4A 1LB2A 1W6PA 3FMGA 4JRLA 3VBHB 4I2OA 4IGPA 4DEQA 3MPPG 5FYVA 5FP8A 4I3GA 4N9IA 3POSA 1LHOA 1OA3A 1WW6A 3G6JB 3N9LA 4XF0A 4D3WA 1ULCA 2FMYA 5H9PA 2MEV2 2C9KA 4DPNA 4HLTA 4Q4X3 1YIPA 2VOTA 1C5HA 3D82A 1XU1A 4YVSB 4E9KA 1RUH3 1ASJ2 1VRH3 3FLPA 2ORXA 3NV1A 2R30A 4NN0A 5F5IA 3OGRA 4YPJA 5CFDA 3JD73 1HN1A 5CFCC 4Q8KA 2BPA2 1DHKB 1OT5A 1W05A 5GM0A 3RI9A 3T3YA 4DNYA 5FZ7A 1VR3A 1UW8A 2FDFA 1VRBA 3T0BA 1IS4A 3PUQA 5FJHA 4AFMA 4DXSA 1PO13 1PZ8A 3I3DA 2OQ7A 3KCYA 1SLBA 2CGPA 4D7SA 5CNAA 3MIEA 4Y4YA 1OMIA 1RHI3 3RZHA 5GZEA 2HWC1 3ROUA 5JZGA 4GMP1 1PNGA 2EF6A 2UY9A 4QPYA 1TE1B 1LOGA 2OZJA 2R072 3TAYA 2VNGA 1GANA 3FL7A 3WNPA 2XJPA 4CCJA 5FWJA 2WA3A 2WNVC 2GAUA 5FZLA 3ZFFC 4EV0A 1UIJA 1CAWB 4O9GA 2AR6A 1YQ5A 3POGA 3ZSEA 1BQPA 3ACHA 5FP7A 4QMAA 4FPKA 5CA6A 2HWB3 3WQ1A 4YW1A 3R4SA 4XZUG 1GOFA 1EY2A 1X9PA 1YEWA 3VGIA 1C1LA 2K9ZA 2R6QA 1QQP2 1RUH1 4XAEA 4YVWB 1LNSA 4O7XA 1NLRA 4JQRA 2JG9A 1W90A 1HB3A 2VJXA 3P3NA 2E7TA 2WS93 1HQLA 3CHXA 4QQOA 5JMCA 5E16A 4IE4A 5LA9A 4IEXA 4OCTA 4LR4A 4QPGC 4X6RB 2DUQA 1PO11 1WLWA 1ZBE1 1UZWA 4P9YA 2E31A 5D1IA 4CCCA 2YHJA 4NR1A 4ZU5A 3QACA 1ZBA3 1RHI1 2IVJA 3THTA 1OA2A 2RDRA 3FE5A 3JBG2 3N7LA 2X05A 3N9QA 1RTVA 3ZXDA 1DYOA 3I3BA 3WUDA 1HRV2 2XUMA 1PVXA 3N7KA 3PVOA 5GZGA 4CRQA 3BYWA 1WA4A 3ZFEA 5B2GB 3SH4A 4NMIA 4Q4W2 3NW4A 4BK5A 2VZRA 1ZRRA 1KD7A 4UW3A 1R1A2 3IMMA 5A3TA 3B01A 4CUAA 5K7PA 3B7MA 2BBVA 2D5FA 2BW8A 4YW5A 1R64A 3MF6A 4H3WA 1H9WA 3C3VA 3ZX7A 2WFF3 3E6DA 5A3NA 1EAH2 3TRSB 3HBZA 4QB6A 3VDBA 2Y6KA 3FHIB 2ZGOA 1AR82 3VDDB 5A3MA 4IESA 4DRVA 3SEEA 4FQ4A 4QQLA 3K2OA 2WS91 4LHLA 3WSOA 1H8TB 4EE2A 1MEC3 4G3YC 3I2JA 3W5MA 1BBT2 4LE4A 5JSOA 5F5AA 1HW5A 3POBA 3BTXA 3P6BA 5FXWA 1OURA 1H1IA 4MGZE 5EZWA 3RJRA 2CDPA 5CB7A 2RV9A 2WA4A 4CDQB 2VUAA 4LUMA 2VOWA 2QZ3A 5L73A 3U14A 4AHZA 4RHV2 1CJPA 1DQ4A 2AENA 2RDNA 2JDAA 4NHLA 3I2GA 1N3QA 5EWSA 1UL9A 1VBB3 4DXZA 4GB31 4N7UA 2FZ2A 3VKNA 2WZPP 1NCQB 4IDZA 1W9WA 4FOWA 2GMEA 4H7LA 2JDNA 3T0AA 1S4CA 5FMOS 2VBDA 4ISQA 2QQJA 1BK0A 3ZO0B 1R091 4C1XA 4XILA 1CWPA 4LIVA 1W6NA 2QCSB 5F37A 1YC61 1D4M2 4LLOA 2XLFA 4M3CA 1SLTA 2RR12 3KHCA 2UWCA 1NY71 2WO1A 3O1TA 2GP3A 4OUEA 1EV13 2ZZQA 4LQRA 4W6XA 2VD7A 4OZOA 1T6GC 1MEC1 4Y33A 1FYUA 1WMDA 3IMNA 5K0UB 3ZFGC 3W9AA 2YC0A 4LBQA 1U12A 1LEMA 2IXIA 3U78A 4S2HA 5AC91 4Y20B 5FIXA 4Z2WA 4OZXA 1BVVA 4FOQA 4RR3B 1ZZ9A 4YW4A 3VBUC 2J1AA 1MR5A 1DGRN 5CISA 2RS12 4XFHA 4HETA 1SEFA 3C7HA 1ALYA 3ZN5A 3H8UA 4IEOA 1X8MA 2Y64A 3O14A 4CCLA 4B3NA 1V00A 4Y22A 2B42B 2VCCA 1UQXA 2WZR2 3D5OA 5I8YA 4DUXA 5DUXA 5DZGA 4L11A 2A71A 1U5XA 2KXLA 3P3PA 5DUVA 1UU5A 5FYSA 3POJA 1C57A 1MACA 1VMFA 2SBAA 3MLJA 3PDQA 4A2UA 5I0RA 4CPBA 4CTEA 5I91A 3AZVA 1RXFA 4OMCA 3PMSA 4Q1RA 1MS0A 3A21A 4IEVA 1GU3A 1HN0A 1O5UA 2VZTA 4XHBA 1WMXA 5IAVA 4AGRA 2IXHA 3KT7A 1DYKA 1POV3 1S0GA 2YDEA 1COV2 2DTWA 2YMZA 4PF1A 5DDJ3 4Y1ZA 4B8EA 3AL6A 1X36A 1OPOA 2IXJA 3IIAA 3CZUA 4BXFA 1C28A 4D0QA 3LSDA 5C3PA 4IGOA 4E4ZA 3O1SA 4LTAA 1GR3A 4MVTA 4M3CE 3OBZA 3DKWA 1KGYA 4XQWA 5FYMA 2QQOA 4LO5B 5KR7A 1W6MA 4JHTA 5GLZA 1KDKA 1UU6A 1O4TA 4RGGA 4HPKA 1ZZ6A 2YC4A 1QJU2 3HQXA 2X10A 4P00B 5I0UA 5LASA 5KXBA 4A45A 2A3YA 2WYSA 3RQ0A 4CDUC 4B7KA 2HYKA 4COVA 1PM4A 2V09A 1W8FA 3SH3A 2VZ3A 1O7FA 2XQXA 3VZNA 3I49A 2WLPA 1FOD1 2B5HA 2W68A 3ZYFA 4BK4A 2FHRA 1VBD3 3IT8A 3RDIA 1C5IA 2V5YA 3ZSMA 1BMV2 4JTOA 2OKXA 5HBAA 3AXEA 4AWDA 2W47A 1QKQA 4GWIA 1VAKA 3AYAA 4EWAA 5HCFA 1YFYA 4WM8B 2VGDA 1WWYA 5JWPA 3UT0A 5H9RA 3LDBA 1W99A 1ENRA 4JHZA 1VPHA 5ANQA 1LR5A 1ENQA 1RMU2 1BCXA 1WKYA 1VBE2 1GLHA 2D6MA 1DQ5A 1LTEA 4Y5Z0 1ND2C 2ZMNA 3I2IA 5FZCA 5IFPA 3LEMA 5JOWA 3POIA 4QGMA 4QX7A 4RGKA 1RUD1 3V0BA 1FMD1 3H1MA 5A7PA 4TN7A 2XJSA 3VLBB 5FPXA 1XNAA 4OYUA 3M2MA 5LA0A 3PURA 3QBQA 1NA1A 3KQ4B 3T2TA 3JCIA 5LRRA 1Q5OA 1QDCA 1QY4A 2UURA 4XAAA 2LRPA 3OTFA 4NRMA 1UYYA 3K4DA 2D6PA 4RS5B 4KWUA 3UETA 1YRZA 3ZYRA 3TNQA 4TYSA 1ZREA 1F9KA 2IVIB 5JXIA 4YFWA 3S6PA 4MXWA 1A8MA 1OOPA 1BZWA 3O1PA 3MUY1 1Y9MA 5FPLA 1RUC3 2HBTA 1OVPA 5J3UA 2JG8B 3WF0A 2PQSA 3N7JA 1EPWA 1LRHA 1LHWA 1RUJ3 1RUE3 2K0GA 2HWF3 1LHUA 1JMUB 3SNMA 5CIRA 2BWCA 4CCNA 4QXCA 4IGQA 5FZGA 2WSVA 1IKQA 1JHNA 1ODMA 5FYUA 2VH9A 1F4HA 2GZWA 1HXS2 1XYPA 4ATFA 4TSVA 4Q0QA 5JOYA 3VBHA 4A6SA 3H8OA 1JZ3A 1YUDA 4FAHA 2Q8EA 3VZJA 5A6YA 4LBMA 2A3XA 4MOAA 4N53B 2BP6A 1HB4A 1S0DA 3R4UA 4WV8A 4WZCA 5F6KA 5L9RA 2NYYA 2DDUA 4RYDA 2BTVC 1PIV2 2WQ4A 4P08A 4YGCA 4YVSA 4KGGA 3UKTA 1WBLA 2XVGA 5FCCA 1AZDA 3QH7A 2WYFA 3IAPA 2ZOEB 1NCRB 4BXSV 4QWNA 2RS32 2W92A 4C0HA 4EZHA 4BISA 3IAQA 4QXBA 1V6IA 3TWIA 2Y6FA 2ZAHA 4AEMA 2YU1A 2AH2A 1RUJ1 1RUE1 2GC0A 2VL4A 3M4FA 4HKWA 3JQWA 4AGVA 5J96B 5L19A 4MYEA 1Y3TA 5C4WB 4OI0A 4XFGA 4N43B 5L7OB 1FPN2 3AZYA 4NJ4A 1TME1 3NV4A 2GNBA 2DWRA 2PXJA 3WR0A 4ZKTB 4HOOA 1GKBA 2EIEA 2E9QA 1HRI1 1ZM1A 2J7MA 1PZ9A 5FZ3A 2VZOA 4XFAA 1LHNA 1UX6A 3MIGA 3NNFA 4CP9A 1REDA 1GWLA 4UAPA 2X5IB 2VZSA 1DDLA 4AHWA 5T5PA 5C5TA 1CAWA 5LB6A 1Q8QA 1X7NA 5GLWA 1QNWA 1F15A 3MIFA 4AAXA 4INDA 1IQAA 3OEAA 5JR2A 5D8AC 3NAPC 4IXLA 2WC2A 4YZ1A 1J59A 2PTMA 5T52A 2PELA 3WV6A 5LA1A 2PHFA 3SISA 2P4EA 2PLV1 3MO4A 4YVWA 2C4XA 4YW3A 3N35A 1Z0HA 1QXRA 4L99A 1SCSA 3BOWA 3LE0A 2C1FA 1PVC3 1KJRA 2A6WA 4YZ4A 1LULA 4IEQA 3S7EA 1K12A 3X29B 1PNFA 3WG3A 2UWAA 5FLIA 5AFBA 2BU9A 2VULA 4CXXA 4OHYA 1ZZ8A 2A73B 3B9CA 2XBO3 4N7IA 5GZFA 3T2OA 5FZ9A 4CU7A 3ZKUA 4DUWA 1KJLA 2OW4A 2SLIA 2VQUA 4P5YA 5ERLA 1UY1A 3HQRA 2Q8CA 3S0MA 5FY1A 1I1EA 3OY8B 3WHTA 2A75A 2GMPA 4LBJA 1U5YA 4WM7C 2PMWB 1H4HA 1BEV2 4XIOA 2WNUB 4AYUA 4PLOA 2BDRA 5KHJA 4J1XA 3VL9A 1RUG1 5FZHA 5C3QA 2PN5A 3O7OA 4JKKA 5FY5A 5K4LA 5C3RA 3NRUA 4ORFA 5DPNA 4LKEA 4OHVA 4RD7A 2RMU1 1AF9A 1LESA 1O4YA 1AR73 4NIDA 2RDSA 1PMHX 4HSLA 4XW3A 5JCTA 1ND3B 5IHRA 4OUSA 1ZA4A 3CU7A 3DPRB 4K20A 2VCBA 1UXZA 4YGBA 2A3WA 4AR2A 3CJIB 1H2NA 2YV8A 2FDKA 4FAGA 1CONA 2CYFA 3GDBA 3LPGA 5BXXA 4MX3A 5HCHA 1SFPA 2OUHA 4UFIA 4A4AA 3LF7A 3K75B 3VDDA 1AXZA 1WUVA 3RVHA 2E33A 4BJ0A 4BZ4A 1NE6A 1AVBA 1PVC1 1Q3EA 1HV1A 2RS52 1H8TA 1C4RA 4Q27A 2VMDA 2XBO1 1Y4WA 1Y9QA 4LE3A 5T5JA 3VD3A 3T1LA 2WQZC 1HB2A 4S2GA 2QDNA 2QE3A 2ERFA 3M8LA 3VBOC 2MPFA 2ZX1A 1N1TA 4RL7A 4QX0A 2Y34A 4Y1XA 3B00A 4RA0A 4CDWC 1AR63 2ID4A 4CDXA 1OF3A 4QAWA 1XE7A 1G9AA 4IQPA 3GHMA 1GQPA 3I2KA 2AREA 3ZXKA 5JR7B 2HWD3 1OD3A 4LBLA 3R0RA 1KEXA 2DFBA 3ZMNA 1OUSA 2ZX2A 2XWBB 2DCKA 4KG0A 3O1UA 3RZJA 1MQTB 2YU2A 3ZYGA 5BNNA 5IVFA 4AEDB 4TTGA 4JVAA 1XOYA 5FPZA 1PK6B 4BM8A 1GBGA 3LOIA 3DCQA 3MW3A 4F3JA 1UYXA 3S5QA 1OPMA 1H2LA 2QQWA 3PJYA 3E5QA 3QOPA 3WF1A 3ZXLA 1HDKA 4BDVB 2E51A 3CBNA 4FOYA 1Z78A 2JDZA 3B93A 3PUAA 4URAA 4KMQA 5C8CB 5KHKA 2AZ5A 4PI2A 3FC0A 3T2PA 2A6ZA 5FFOC 2V5DA 3VZKA 5I0TA 5HPOA 3BTYA 2GH8A 1QU0A 4LBKA 2W1QA 5K0UA 5IK4A 4RFRB 4NRPA 1C8M3 5JMOA 5DAXA 3VBSB 4XDQA 4BE3A 4O9EA 4PIZA 1JHJA 4DS0A 2WT0A 4Y20A 2D97A 4QQ2A 5ABJC 5L36A 2VMCA 3VHRA 4FPLA 4RR3A 3ZYJB 5LZ6A 2CTVA 3PJQA 2C24A 2D6OX 3PNAA 1AR61 4GAZA 1NZIA 2R7EB 3JZVA 4LBOA 3H1YA 3WDYA 5I8SA 4CP2A 4E2GA 2HWD1 1HIXA 4XMIA 4DIQA 1JN2P 3EMRA 4HXCA 3O0VA 1AX2A 4A3ZA 1JYVA 1IZ3A 1MS4A 2I74A 5CU1A 5FPBA 4YGEA 3FFQA 2EALA 3MV11 1UF2C 3S5AA 3PIGA 4P9GA 4GULA 4LO6B 3V64A 4DEVA 4Q4V3 1SG3A 2VZUA 3OF1A 4QB1A 1AR91 1OQ1A 2LS6A 3H3LA 1FV3A 4I0BA 3RWNA 3E1F1 2YXSA 1POQA 3FBMA 1S55A 2Z4FA 2RJKA 3I59B 4P5HA 2HWE3 1E5HA 1PGW2 4KWJA 3VBFC 5G04L 2G9ZA 2Q1FA 4I0WB 5T5LA 3RSJA 1SLAA 3POWA 4DXTA 4DUVA 1W2UA 4A7KA 3WXPA 3SHRA 1NE4A 1PO22 1TMF2 2CAVA 2VZPA 4K1YA 1ULPA 3MICA 5LWBA 1V6MA 4ES8A 3KS7A 4YM1A 1S0BA 2BRTA 5J98B 4KWLA 1AXYA 4QPIC 4YZ3A 4CSWA 2WO2A 2XL7A 3AXDA 5T55A 2P17A 5FYTA 4XQ4A 4FQZA 2R16A 2BGOA 3GHNA 4HMZA 5K8SA 1I9RA 4NHYA 3V56A 2DCYA 1G7YA 1J3QA 4KH9A 1JS9A 3HR9A 1C8NA 1MS9A 3AVSA 4MGYE 4R52A 2WNVB 3TN93 4MHRA 1QEXA 3ZFFB 2ZZJA 1KQRA 1O3RA 4AVTA 1W39A 2CNAA 1W03A 4E4DX 4D7YA 3AL5A 2HLEA 2QFEA 3ETQA 1JTZX 3NNLA 1W2AX 2VC9A 4PI0A 1PHMA 5KHIA 2DUPA 2UYAA 3ZKYA 3O1MA 4PDWC 2EAKA 1HX6A 1ST8A 3GBGA 2HWE1 4UBHA 2Z2SB 4P14A 2OPWA 2YB7A 1Q8VA 3CNAA 5FZOB 4AI0A 3OBRA 1YI9A 4WM8A 2ZX3A 1SPPB 3WT3A 5KC6A 1YIFA 1DGLA 1OLMA 3DYOA 5EJ3A 1F31A 4QPGB 4BQ2A 4E2QA 3C7GA 3WW2A 5KXDA 3NNMA 1H9PA 1TEIA 2BWAA 3ZDSA 4KL1A 2C6SA 2B39A 2PA7A 3U11A 3W20A 2TBVA 1O3TA 4CU8A 3K4ZA 4QHBA 1DLCA 1RVF3 2FDJA 3D0JA 3ACIA 5FY8A 3ES4A 1Q8SA 1SLLA 2GNDA 4Q0PA 1UOFA 2MEV1 2PAMA 3WY6A 4AFDA 1AYN2 1WLTA 3Q8BA 1F5FA 5FYIA 1J3PA 1DLLA 2DCTA 3KV9A 4XIKA 1L3JA 4RS5A 1ASJ1 1OFSA 2QQNA 2HWC3 5FXXA 2BYVE 3SLIA 1OVSA 5CG9A 4GMP3 2QQKA 2JKXA 2PHTA 1CESA 4YM2A 2VBBA 4AE2A 1OBNA 2ZHNA 2VUCA 5F2WA 4QQHA 5LA2A 3RRDA 5DG1A 4A7ZA 4MGTA 2ZA9A 3T0DA 3DEMA 2BNMA 1J1TA 2JG8A 4M4RA 5C5UA 4XYXA 4PF5A 1JYTA 1CVNA 1UYPA 3AYEA 4UFMA 1O3SA 3N9MA 1PZ7A 3GALA 2V4AA 5F3IA 4GJYA 2Y0OA 5LBBA 3SXWA 2AEZA 1W8TA 3ZXEA 3J9SA 2MNGA 3WCSA 1N1SA 4Q5OA 5DMYA 2O1QA 1RUOA 3SMHA 2W91A 1AJKA 1JOPA 3FX3A 1AL0G 2R071 4LA3A 3C8XA 4CEYC 4SLIA 3ZPYA 3KSCA 4XOGA 3RGBA 1RVF1 3IIIA 1CZSA 3ZYBA 4J25A 4AQ2A 1BVP1 2VO5A 4CCEA 1VE0A 4N53A 4M4PA 1DZRA 3QCWA 3UGFA 1XQNA 2BGPA 3BN6A 2XMLA 1SHWB 2W95A 4ONUA 3VHNA 1KFUL 2GC3A 1ZBE3 4ARYA 4M0HA 3ETPA 2QUOA 1VMHA 2ADDA 1RB8G 1OQEA 2BFUS 4MO3M 3VBRA 4AK3A 1WD3A 1AR83 5C3SA 1HJGA 3AKRA 1NCRA 5A7WB 2GNMA 2WWJA 2XLGA 4QXHA 4QHZA 1ZZCA 1OA4A 2GNTA 1ULEA 2KR2A 2BVVA 4AG4A 1UZZA 2ZEYA 4HANA 2YBKA 3LZZA 5F9TA 1R082 4Y1YA 4MADA 5FZFA 4Z07A 5L7OA 2VCMA 4N43A 3VZMA 4QM9A 3JBG1 2QDRA 4LHNA 3E6BA 1VB2A 1HRV1 1W0NA 5FBZA 3ZFGB 4LPLA 1QWRA 4NWVA 3VZLA 4Z1VA 1QOSA 5FZEA 1SDWA 2E7QA 2X5IA 4KI5M 4BQ5A 4AVSA 3D4KA 1UY2A 3VBUB 1Q8PA 4GKYA 3RZGA 2XR4A 4QGNA 3ZMOA 2CGOA 4IV3C 3OD4A 4TLGA 3RWKX 2HH9A 2ZGPA 3KD4A 4LITA 5JI9A 4B29A 3C7EA 4GIQA 1H8VA 2A6XA 3RNSA 1RXGA 1EAH1 2BFUL 3N7MA 4K6BA 4HN1A 4LKSA 4LNVA 5FREA 3ZOIA 1W9SA 4XUQA 1UYZA 2ZXQA 1AR81 3GJBA 5B4NA 2G9FA 1OKOA 3AP5A 3ILNA 2TNFA 3EB7A 1NA1C 2ZPXA 4RQPA 2AACA 2YPDA 2VU9A 3N9NA 5F6LB 1UY0A 4ZXEA 2R063 3T2QA 3U1XA 2VNRA 4IEYA 5BNPC 2RJLA 5JLVA 3ASIA 4FOVA 1M06G 3J7MA 4YYOA 4GB33 3BALA 4QX8A 4XE9A 4MG2A 1G8WA 3L9JT 4OFGA 3UL2A 5D2AA 4TXWA 1J84A 4FVVA 3KT1A 4Q4X2 1R093 2FDHA 3CO2A 3RYRA 3RYKA 4ZZ8A 1UMIA 2WNUA 4UFJA 1UAIA 1G86A 1OUXA 2QQUA 3A7QA 1JBCA 1QGLA 3PIJA 5EV7A 2FBEA 1VRH2 3HOBA 2RM23 4W4ZA 4NIAA 2XDVA 3UK9A 3WP6A 3JD72 1GNHA 1LHVA 4JCKA 3OPZA 2OXBA 2XVKA 3K51A 3ILFA 1N47A 2IXKA 1IS5A 1GNYA 2LM3A 2DU1A 5F3EA 1KXGA 2QQIA 4KQ7A 1ND3A 3R4DB 1F5JA 1ZNPA 3DPRA 1VIWB 2IWGB 1IHMA 5FYCA 1UWWA 1PO12 2EICA 2JE9A 3CJIA 4CDUB 5AC93 3LB9A 4CU6A 1D4M1 1ENSA 3IDBB 5IVJA 1AL22 1J1LA 1RHI2 4LO4B 4IV1C 4IEUA 5JUVA 3MLLA 4JQTA 3OD0A 2VW1A 1AUYA 4AEKA 1COV3 4G4FA 2AGSA 2R061 2V72A 4AQSA 4LOSA 4PIYA 5A7OA 1K42A 1SACA 2F4LA 4OMDA 1ODNA 1JI6A 5LEJA 3WZ1A 4UW5A 4N8MA 3NWKA 1SCRA 1UMHA 3FUOA 2QKDA 2Y6GA 3NNJA 4XEZA 5DZEA 3U4SA 1GUIA 4AVVA 4QDSA 4XDPA 2HWB2 5T5OA 1RJ7A 4L2NA 1JW6A 3LA7A 3M3EA 2HEYF 3MW4A 1ND2B 4PBOA 5FLJA 5CG8A 4D7TA 2RS11 1QXPA 4NHMA 1GFF2 1XSQA 3ZXAC 1I5ZA 2RM21 4XBNA 4X6QB 2B9VA 3UGGA 1QJX3 1UY3A 1QJFA 2PYTA 2VMHA 1X33A 5DABA 2GALA 3NMBA 1PM7A 1MQTA 2FD8A 3AMMA 4BMEA 3MZHA 1RITA 5CEHA 2KM2A 2R0FA 4Y3OA 1PK6A 3WG2A 3WG1A 3ZM8A 2JX9A 5C9AC 2WAOA 5LATA 4ATEA 1ZA7A 1S0CA 4UW4A 3NV2A 5I0SA 1IQDC 1RUF3 2HEWF 4V2WA 3AZZA 3CMGA 2CSGA 1WCUA 5JI7A 1ZBA2 3URFA 3BUCA 2P2KA 4HSJA 1SDDB 3J7NA 4E27A 1WW5A 5C8CA 3I2HA 3FBYA 3SEPA 1COV1 2RVAA 1HJFA 4UBGA 1Z7S2 1RMU3 2W87A 4KG8A 5LBFA 1W2TA 3OUJA 4NPRA 3UJOA 5JXGA 2VAUA 3LQCA 2UU8A 4UFKA 2JD4A 1NX9A 4EYUA 1D2SA 3KV5A 3VBSA 4P9JA 3ATGA 5A1AA 1PGSA 2JKBA 3OCPA 4XF4A 1FOD3 3ZN4A 2AC1A 3I97A 2PHRA 4G9SB 4AEJA 3VV1A 1CPNA 4JKLA 5DN2A 4MH0E 3RG0A 3JU9A 4TWTA 2YROA 4WVWA 4CCDA 4URTA 2WFF2 3ECQA 4EQVA 2ZAAA 3BU0A 4A7YA 2ZGUA 2PQQA 5FY7A 2ZHMA 1QJX1 4I09A 4LKDA 4P9LA 1J58A 4MGQA 1U5ZA 1UXXX 2F17A 2EIDA 4YZ5A 3KGZA 1MVQA 2VOKA 1GICA 3GM8A 3ZXGA 5GZCA 1LOFC 4I30A 4E2SA 4FI9A 4DZGA 5A7NA 3V0AA 2W2IA 1MEC2 3LPFA 3GYDA 3I2FA 3TBDA 1RUD3 1BMV1 3H3ZA 1FMD3 3HMYA 3I59A 4ZU7A 1RUF1 2VTXA 2D93A 4L97A 2PAKA 1YQ6A 2W9XA 5BNOC 3ACGA 1HB1A 3BPZA 4JX0A 3SC7X 1XNCA 3RPQA 3EBRA 2VOXA 1JUHA 1MS3A 1R1ZA 4FFGA 4GWMA 1LKNA 1RMU1 3AMNA 3INAA 4W6WA 3WNMA 4BA6A 1C1FA 1VBE1 2DV9A 2YY1A 2A6VA 1V9U3 4JDOA 5CYYA 4DRRA 2JENA 2C0ZA 3QLQA 3WNOA 1W9TA 1VBB2 1CPMA 2JDKA 3AP9A 3K77A 1NQDA 1RGSA 4V2VA 3MIBA 3VDDC 1O3QA 1V6OA 1H2MA 2XHNA 2VZ1A 4YG6A 3LEGA 4FT8A 4UWDA 4FPGA 4Z92B 1N1VA 3WDXA 4XHXA 2CAUA 2WNVA 3ZFFA 3ON7A 1YCIA 3D6EA 4XUTA 4JGZC 1AYM3 4HKLA 2VW2A 4UFHA 2Z42A 1OQDA 2BBAA 1B35B 1EV12 2LUWA 1JU3A 5D8AB 4ZS3A 4AHYA 3LEKA 3NAPB 1XYOA 2ZX0A 4YNIA 4CU9A 1BYHA 1ZRIA 1OHFA 1MS8A 2VUDA 3LIGA 4D94A 2GC2A 4Q1PA 3J26N 4CDXC 2W1UA 5J09A 2I07B 2VMFA 4PHZA 1ZZBA 5FZOA 3O5SA 4XC9A 2RG4A 2AUYA 4BLIA 1SPPA 4KU7A 2XB6C 1UKGA 3HNBM 4OVEA 2EIGA 3FFZA 5AVPA 2CHHA 4QPGA 1HXS1 1WD4A 1WW7A 2VZQA 5BNNC 5JOXA 3RZKA 2Y33A 3D3AA 1V9U1 4GQ7A 3UNPA 3IKWA 3KB5A 2ZGQA 5FZ1A 4XMAA 1QJY3 1VB4A 4CA9A 1V6LA 1PX4A 3SKJE 1ULDA 1CX4A 4MV2A 4WM7B 1WW4A 3U75A 4XPVA 1SQ4A 1N1YA 5FR3A 1GSLA 4NIHA 4FP2A 4R9BA 2YGMA 3GXUA 1PIV1 3IM0A 2VXRA 1AYM1 3HVDA 2WWUA 4C0BA 4IE5A 5EYYA 1RJ8A 1TME3 5JVVA 1JUIA 4GWJA 1XE0A 3KVBA 2BQPA 1W8WA 1CN1A 5EPAA 1HRI3 5DDJ2 3J8F2 2RS31 3OUIA 4Y5SA 3VDAA 4LT5A 2WR9A 1W6PB 4HL0A 3A0KA 1FI2A 4F7ZA 1DZTA 2OS2A 5JOZA 1K5MC 2W1WA 3ES1A 1GWKA 3B9IA 5E6HA 3H50A 5JPMB 5FY9A 5FUIA 2XJTA 3OSDA 4L0PA 2DVDA 4AVAA 1FPN1 4MGSA 4DOUA 3CLPA 4Q8LA 1JZ5A 3I3MA 1XB9A 4NWWA 3B5LB 2GDFA 4JGYB 4XUOA 2Q30A 4A42A 2PLV3 4GZ9A 4XF9A 3TNPB 4COWA 3H8RA 3HT1A 1YHFA 1QJY1 2ZGLA 5BV6A 5LY1A 3EO6A 3VBOB 5IK5A 3AKTA 1JYXA 3V65A 4DO0A 1DQ0A 4CDWB 5IW0A 2UY8A 1VBD2 3K4AA 3W21A 1RUI3 4COYA 1GNZA 4FP3A 2GC1A 4QB2A 3KHBA 1JYWA 5C6CA 1NOVA 2O14A 2W0XA 3LGRA 4XBLA 4JTNA 2LROA 4WVMB 2F4PA 5EJ1B 3GBWA 2DF7A 5TSWA 2DCZA 1SLCA 3ALQA 5A7WA 3WQBA 3W5NA 3JB8A 4WVZA 3RYPA 4OHWA 2ADEA 4QDRA 1RUG3 4XVHA 2P6HA 1XU2A 1OLQA 5AFEA 1XYNA 1QOTA 2RMU3 1DQ1A 3K48A 5BY5A 1NLQA 5J36A 3FHQA 4HK8A 2QQPA 1GYKA 2JXAA 4XETA 2P3JA 4O61A 2XXZA 4FTSA 5LCWL 1T6BX 4AQ6A 5FZ6A 5F5QA 2N7GA 1WCDJ 1W0OA 4EN7B 1BEV1 2IUWA 5IJRA 1FXZA 1F4AA 1LJ7A 2RJ2A 1NXD1 1DYPA 5B4XA 2X8KA 2NN8A 3TOJA 1DP0A 3J7LA 2IZWA 5FYHA 5ABJB 3NJXA 4YM3A 1LOBA 2VVDA 2ZEXA 4Q4Y3 5A6QA 4CEWC 1W04A 2WINB 4IERA 1VLNA 1RUI1 4YZ2A 1RUC2 2ZGKA 3AP7A 3OUHA 4AI9A 5L9BA 4XJ8A 4BYYA 1RUJ2 1RUE2 1ULFA 4K9SA 2HWF2 1CQ9A 3GGLA 2DTYA 2R043 2DVGA 1L7LA 3LKJA 1NZCA 5F8PA 1REEA 4DY3A 4A41A 5J1XA 5FPVA 2RS51 3PUSA 3HJRA 4FTEA 1L7QA 2B9UA 2Q0AA 1OH4A 1W06A 1DQ6A 3KV6A 4AGGA 3LCPA 4RFT0 3AB0A 3EQEA 3G7DA 4FTBA 3VBFB 5APAA 1QDOA 4K8RB 4XUNA 3UKNA 1CAUB 2EIBA 2FZ1A 5EXOA 1MS5A 1PX3A 3B94A 1JZ7A 1A3KA 4QM8A 5DXDA 1DZQA 3VBUA 3DXTA 4GH4C 4JDMA 3RJ2X 4BWOA 5F5CA 1YXWA 4QPIB 2GU9A 5GLTA 5IVBA 1VMJA 2XJRA 4J6GA 5ACA3 1QJZA 5FBJA 1W2OA 1WA6X 2DYCA 2JB4A 3PU8A 3JXSA 3LDRA 3WLUA 2ES3A 3MYXA 4Q4Y1 2LW8A 1IOAA 2OX0A 4CXWA 4AI2A 2OUJA 1I3HA 1GV9A 2GH2A 5LK5A 2TEPA 3OGGA 5DAWA 4LKFA 4XABA 1G6NA 1WLDA 3O1RA 1A78A 2LTNA 1PGL1 4YW6A 4HZFA 5FJKA 4CDUA 5CFDC 4B1LA 1LOAA 1VBC3 1ZYBA 2R041 5CADA 4Q0VA 2WRAA 4Z8BA 5FYZA 3MFAA 4AVCA 2YG0A 3NL1A 2E7AA 2EVXA 2Y60A 2HYXA 3WUCA 4CDQA 5A1LA 1S0JA 1RL3A 2D7FA 2R1DA 5LW9A 1G9CA 1JYIA 4PDWB 1KFXL 3QH6A 1DFQA 2WFPA 3LDKA 3NJVA 1UX7A 3KQRA 1XXNA 2QQMA 2VECA 2IXCA 3BOPA 3ZIXA 1BHGA 1MZ5A 4DB5A 3OG2A 1UPSA 1LCLA 1V6JA 2ENRA 5DZFA 4A6OA 4AFAA 1NCQA 4XXAA 4BMBA 3I54A 3VBRC 5JZGC 2R32A 3MV01 2ZACA 4NE9A 1AR93 2EXKA 1W6QB 1EUTA 1AHSA 1XE8A 3VN4A 4CP0A 2CGNA 1ND2A 3JB4C 2B8MA 2Y38A 4DMIA 2Y0IA 1OH3A 1W6NB 5ACA1 1CD3G 3KT4A 5FRAA 4X8NA 3FUQA 2WN2A 4CCKA 2BERA 2G9GA 3AM2A 3I7DA 1PVC2 2VMGA 1UIKA 1UCXA 3ZSKA 1H2KA 4AVBA 1POV0 4LBQD 2PAEA 4Z2AA 1O8PA 1ACCA 4DXRA 3I8TA 3N9OA 4BQ1A 2XBO2 1VP6A 1S2EA 2CY6A 3DGTA 3Q8EA 1YYNA 3WW4A 1VBC1 2YFUA 2VE1A 1PGW1 2JG9C 5K9YA 3KCXA 5KC5A 3SKVA 1T2XA 1ULGA 1WGPA 1LU1A 4GWNA 2P34A 1Q43A 1BK1A 2DVAA 3JUUA 3WP5A 3ZYPA 1PO21 1TMF1 2GP5A 5FZAA 3VKFC 5HCAA 2FCVA 1JU4A 2QQVA 2WKKA 3ZPOA 2VNVA 5IVEA 2VPVA 1OF4A 3OYWB 3T4HB 1KS4A 2RDQA 3BIWE 1WCKA 4CP1A 1VBA3 5FOBB 4B4RA 1CR7A 1V0AA 1X50A 3E5UA 3PL0A 3WNLA 2JDUA 4ZZ5A 1Y7BA 2WJSA 1AR72 4IE0A 1AX0A 2WAAA 2WQ8A 3AK0A 3DL3A 3DXUA 4IETA 3M7AA 5FAXA 4CPBD 5DAQA 3CZJA 4FBFA 3AKQA 1V70A 2RHPA 4RQPC 4CEYB 1D0GA 3OJBA 5GKAC 4NHXA 3ZFEC 3VD9A 2JEMA 4JV4A 5CFCB 4BB3A 2YYOA 3PVBB 1BLZA 1G9BA 2WIIB 1JXNA 2JWPA 3IZOA 1XNTA 3CEWA 4L92A 3M3OA 2ARXA 3VB9A 1MS1A 2Z79A 1A34A 4B7EA 4H14A 2D3RA 2GN7A 1TG7A 5FPUA 4BHPA 2H0VA 2E32A 3FHAA 3LSEA 5A32B 3CQOA 4LIUA 3V0AB 3H1WA 3USUB 2R49A 1YFXA 4K8FA 1IPSA 2OIIA 3JQXA 4OLLA 1PMIA 4COUA 2NMOA 1TNFA 4XACA 3S57A 4CUBA 1SBFA 2MEV3 2ZGRA 5HI0A 1W3XA 3WVJA 5F1RA 3TEWA 5FZKA 3MF9A 4LBNA 5ISLA 4ZHNA 4YG3A 1AR62 5M0TA 2J42A 1JZ4A 2Q1ZB 3KVAA 4A3XA 1E57A 3O1VA 4KGQA 3F95A 3IDAA 1ASJ3 2HWD2 4YRDA 3CJIC 1VBA1 5HV4A 4XZPA 3TEYA 3BTZA 4AHXA 3AX4A 1LGCA 1VAVA 2ZGSA 2P37A 1QOOA 3FWEA 1LODA 3WG4A 1LGNA 1GZWB 3MGUA 1NXMA 3ZR5A 3Q8FA 3RFRA 3KV4A 2JB8A 3I3QA 4Q29A 4LJHA 1RC6A 4NAOA 4YLZA 4BQWA 4N9HA 1OKQA 3GBFA 3ZVXA 4I3PA 2AYHA 1B35A 4IV3B 3NVCA 2IFRA 5D8AA 2R073 3NAPA 1DF0A 2WSUA 2WDBA 3CIHA 1GQGA 3W58A 2JDPA 1Y9GA 2KA3A 1C8M2 2PFWA 3VZOA 1URXA 4NO4A 5BPXA 3THCA 4QGLA 3VKOA 5A33B 1QHDA 2BV4A 3GZUC 4HVOA 4NIGA 1S0FA 1NA1B 1NG0A 3U37A 3DKQA 5BNPB 1BKZA 1TVGA 5I0DA 4R9AA 5IWFA 5E88A 3GZEA 2W08A 1QQP3 2XJUA 5A1FA 1UMZA 2XKOA 2XOMA 1UPIA 2HEVF 4EN0A 2D40A 4HT1T 1UZVA 4IE6A 1SLIA 1H1AA 2JICA 3OPTA 1RUNA 4H55A 2PHXA 3CJXA 4EROA 2C9AA 3MLKA 4WM7A 5LY2A 4Q4V2 3WD5A 5C8CC 5IVYA 1CIWA 1WCQA 4K7JA 1M4WA 3H7JA 5GZDA 2HWE2 2HBUA 2ARCA 2WT2A 1HLCA 2ZHLA 4L9BA 1NKGA 4Y4RA 5CZKA 3WCRA 4AXOA 2V4VA 2WWSA 3BPSA 4BIOA 3JBG3 1NLSA 3RZMA 2E63A 2W46A 5EHDA 3NJZA 2VQTA 1HRV3 1OFNA 4HBNA 5C8WA 3USSA 2ARBA 5FUPA 2YUEA 3HIFA 3P5BA 4Q4W3 1RIRA 5G05L 5FZ8A 1H0BA 1JZ6A 2DFCA 3EHKA 4FFHA 3K46A 1AX1A 1R1A3 5JSRA 1OLME 1X9TA 4IV1B 4Q26A 3WQ0A 3RZLA 2ZKNA 1R081 2ZTNA 2EXJA 3ENRA 3OGVA 4HK9A 5E8AA 4ZXKA 5FXZA 5A7QA 1Q8OA 3LA3A 3LEIA 2XPJA 2YZ4A 5SV8A 4Q0SA 2J22A 1NQJA 2G19A 1Q56A 1EAH3 3EXUA 4JGYA 3TN92 2P5BA 4AF9A 1QQP1 4CE8A 4QU1A 1CJDA 1O4ZA 3HAGA 3VBOA 5JSPA 4YGDA 4K40A 5FZMA 1S2BA 1YQ8A 4CDWA 1GZCA 1BBT3 1IG3A 5T54A 5F7UA 5FLHA 3AZWA 4ZS2A 3M70A 1MZEA 3HT2A 3I4IA 1UNBA 4ZONA 1UD1A 1UOJA 4QT6A 5KBFA 1D7PM 3AYCA 4WBBA 5FMDA 5C4WA 2VNOA 4WVMA 3WDUA 1AL23 2JE7A 1NAEA 3VL8A 4B1MA 3OGJA 5A3LA 2L9LA 4XURA 3WW1A 4RHV3 2G1MA 2VBPA 2WLQA 4M3CF 5FZDA 4CP9B 5C9AB 3H8XA 4Q4W1 4P02B 4W6YA 3WF3A 1RVF2 1R1A1 3VKLA 3NNGA 3Q9OA 2OT7A 1GZ9A 2D98A 1IS6A 4YG0A 5FQ0B 3PUIA 2CWMA 1UO9A 4FXKB 2QNKA 2X09A 4MXVA 4Q4X1 3WF4A 5I93A 4MGIE 2PHDA 4QKNA 5ANNA 1W6OB 1D4M3 2GMMA 3ORJA 4PJYA 5SV5A 1W8ZA 1VRH1 4LLFA 2D44A 2RR13 2HWC2 2ORZA 5ABJA 3JD71 3LOBA 1CX1A 5GLUA 5LK7B 3POFA 3ST7A 3MEPA 4MHUA 1ULOA 1BBT1 4BQ4A 1F8VA 4B4PA 4NPMA 2H0BA 1AJOA 2ETEA 5A6ZA 2ARAA 2DCJA 4BQYA 1JYNA 4CXYA 3VKMA 1YWKA 1ZX5A 3OY8A 4ZPIA 3OOXA 3TYJA 3MIHA 1AL21 3DF0A 2ZBJA 2BNOA 5BNQA 1OOPC 2VVFA 5EYXA 2RS13 4XF3A 4U36A 4RHV1 5FP9A 4C1WA 1RUH2 2BOJA 3H3UA 1Z7S3 2VR4A 4OQ9A 1AXKA 4DFSA 2W94A 2Y6JA 1F35A 1K3IA 3OPWA 3VBFA 5C7GA 5BNOB 1MPXA 1W28A 1CAUA 2ATFA 2WZR3 3GJAA 3K3OA 3PLQA 4R9DA 3WINE 5JAXA 2MHFA 2OYZA 4QD2A 4AFCA 1DQ2A 2O8OA 3C7OA 3GZAA 2HWB1
chains in the Genus database with same CATH topology
1ZVFA 2VUJA 1ZBE2 3NO8A 4R8HA 4QPIA 3VBHC 1HKDA 3A0NA 4NHKA 5I8TA 5JDBA 3DV8A 2ZMKA 2RR11 4GA9A 4P9XA 2ILMA 5H9QA 2ZJCA 3MI8A 3POYA 2ZHKA 5J48A 4C90A 3PVEA 1A6CA 2OVUA 4I02A 4YVSC 4JGZB 4OHZA 4GALA 4M01A 3ZXFA 2ET1A 1FX5A 2XGXA 1O5LA 1ZBA1 4OI4A 2X53S 2A7AA 3HWJA 1QJU3 2I2SA 4PDWA 2XH6A 1HV0A 4CDXB 1Z7S1 3R05A 4K3UA 2WS92 3CF6E 1X82A 1A8DA 2QZ2A 1QXJA 2WZR1 4H7MA 2GN3A 4PLNA 1VAMA 5FTTC 2VW0A 4AEDA 4M0NA 2NQYA 1W6QA 1XRUA 2C5DA 2XJQA 5BNNB 4FCAA 1S0EA 3KLSA 3SH5A 2WFF1 2B46X 1CGPA 3WP3A 2ZMLA 3AZXA 4TLFA 4V1PA 3L2HA 3ZN6B 4HVRA 1Y43B 2UWBA 3NSTA 1V6KA 4WZFA 1VBE3 1FNZA 2R062 2YGLA 5FO7B 3B02A 2ZCWA 4YVWC 3MDPA 4GB32 2EA7A 2RE9A 5CBLA 1CAVB 4AI1A 3FJSA 4Y24A 3AYDA 1R092 1QJU1 4AFBA 4F83A 4LUKA 3M1HA 4AI8A 1K5MB 1YFUA 2RM22 3OYWA 1J3RA 2ZKLA 5T50A 1NY72 3AKSA 1JOJA 3GNEA 3PVNA 1VBB1 4LO8A 2D43A 3TB0A 4R4XA 2WNEA 2H6BA 3SCGA 5FMOL 1G9FA 5KWRA 5GALA 2Q4SA 1CAXB 3GF6A 3LWCA 4KU8A 4CEYA 1YNAA 5AC92 3VUOA 5CFCA 4YM0A 3NKTA 5FO8B 4QU2A 1VJ2A 2A70A 4Y1VA 5E89A 4CZSA 5IK8A 1IGOA 2O8QA 1EV11 1HXS3 2H6CA 2VOVA 1IPKA 3J8F3 3U0ZA 5BUVA 4XJZA 3SITA 5A32A 2VY0A 2A5ZA 1TNRA 3M3IA 3USUA 3HD8B 4FPEA 2E53A 1MVEA 3AP4A 3AMHA 2V73A 1H8TC 4MLOA 1PIV3 3H9AA 2FMDA 3S30A 4JDNA 3WDVA 1MZ6A 1QJX2 4XJAA 2JJ6A 3KGLA 4LA2A 4RGAA 1SFYA 4HN0A 4F8AA 1B09A 2RS33 1APNA 1YO8A 4CDQC 4GMP0 1KDMA 2XG3A 4QXKA 4FO9A 5AVAA 2IC1A 3BCWA 1GZWA 1OLRA 3RZZA 3N4MA 1ONAA 2Q5TA 4XFCA 4XQDA 2WT1A 1RUF2 2NMNA 2ZGTA 4IEWA 4ASLA 2XVLA 3H7YA 4HFSA 1FPN3 2VMIA 4CEWB 1NCQC 1HQWA 3OBTA 1POV1 4IV3A 5DDJ1 2XJVA 3J8F1 4S2FA 4P9IA 1WCSA 4XTMA 5HCBA 3RS6A 5EFUA 4BOWA 4M00A 4PQ9A 3AJZA 2ZABA 3AFKA 1FOD2 1IPJA 1D0HA 5A33A 3NV3A 4EJRA 3IPVB 1H1MA 1YFWA 5BNPA 4ITCA 4ISRA 1ZRFA 5K0UC 3U4XA 3SCHA 2P3KA 2O0OA 2R0HA 1H4GA 4RR3C 4GH4B 4DY5A 3WHUA 5FO9B 1VBD1 4XXPA 1QH6A 3O0WA 4XJWA 1RUD2 3IDEA 4JRAA 1FMD2 3UKVA 4YARA 1JH5A 4L8QA 4Q2FA 1ENXA 3PHMA 4YSFA 3J4UH 1REFA 2ET7A 1OI6A 3CL1A 2XWJB 4B4QA 1BEV3 4NOTA 3U07A 2Z69A 3BB6A 4FPCA 1BXHA 5GLVA 3APBA 3RQ0A 4FPJA 4MZUA 4LHKA 1DU3D 3B3QE 5HXVA 5CFDB 1V9U2 4NVPA 3WDTA 3HN1A 3NKGA 4W65A 3PTYA 4JAAA 3DUIA 4HVQA 5J37A 4IV1A 1D2QA 4SBVA 2DVBA 3U10A 4FPFA 3MW2A 3FLTA 5BYNA 2A6YA 5JIUA 2F6BA 1WLCA 2BEOA 3ZXJA 1AYM2 2E6VA 4XJUA 4Y26A 5JIAA 5JZGB 3VBRB 2XKPA 1C3HA 3W59A 2RS53 2EAAA 3N3HA 3RMYA 2CWSA 1EYBA 4PCRA 2VG9A 1RUC1 2LALA 1IKPA 4X8PA 2HWF1 3AP6A 4Q0UA 3ME2A 2D3PA 3KM5A 3WW3A 3ZFGA 4OI1A 2OPKA 1WMFA 3AFGA 2D6KA 4XFBA 1O91A 2NLRA 1HQNA 5C9AA 2JG9B 3MPBA 4ZU4A 4YW2A 4OULA 1QJY2 1XNBA 4LO7A 4UW6A 4WM8C 5DUUA 1QMJA 1U5IA 3UV9A 3VBUA 2HJIA 2QVSB 3AJYA 1XNDA 4IEPA 5FQ0A 5JPNB 1B35C 1DGRA 4Y1UA 5J7MA 2Q1MA 4C91A 4KNCA 2ZX4A 4BH9A 4EN6B 3KZ4C 1W6OA 1SBEA 2CL2A 4U2AA 2D3SA 5FOJB 1QF3A 3SCFA 4BIFA 1TME2 2IFWA 4QQPA 1FV2A 4META 3WDWA 1F2NA 1HRI2 1TQ5A 2I45A 4RSUA 4RQPB 1S2KA 3ZFEB 2XHKA 4PBPA 3DN7A 5IUQA 4DQAA 4RS5C 3S7IA 2VVEA 1ZZ7A 4JC1A 4D69A 3QD6A 3M3CA 1LOFA 4FPYA 5FDBA 5DG2A 3H0OA 2D6NA 2PLV2 2JG8C 3R6SA 4DINB 3FLRA 5BNOA 2UYBA 1YLLA 3ZIWA 1DIWA 2BGCA 4XF1A 1QH7A 2Q8OA 1RUI2 4FXGB 3UJQA 5KXEA 3VHOA 2DU0A 3B69A 3ACLA 2IXLA 2B45X 1U0AA 3C2UA 4N53C 4R4ZA 1PO23 1TMF3 2P3IA 3RI8A 4CYDA 1RUG2 3KCCA 1WMEA 2HKXA 1NYWA 1S0IA 4LEJA 4JGYC 1YJLA 1IS3A 4JGZA 5H9SA 2XL9A 4P9WA 2JECA 3BTAA 5LRSA 2RMU2 2K2SA 1XNKA 1N3OA 2NM1A 4GKXA 4YFZA 1LU2A 4KBBA 1NCRC 4N90A 1OSGA 2Y26A 2EXIA 4FPHA 3O12A 3ELNA 4AQTA 5GJ6A 3WP4A 3N36A 5T3NA 3IWZA 2D5HA 1UN1A 4WVVA 4AW7A 4TZDA 4M3CB 3PMEA 4XFIA 2Z5WA 3GZTB 3RMXA 3WNXA 2GSYA 3E6CC 5C4WC 5L7OC 2R1BA 4N43C 4Q4Y2 4EWDA 4OI2A 1KRIA 1AR71 2CV6A 5KXCA 1FNYA 3ILRA 4AI3A 4LBQB 2FQPA 1PGL2 2EXHA 4BPZA 2X5IC 3E5XA 3LA2A 2R042 2DVFA 3ZN6A 2DURA 1FAYA 3FZ3A 5KHHA 4COZA 2B7YA 4HKOA 3BU7A 4ES9A 1GQHA 1KITA 1EP0A 4IEZA 3KMHA 4BCUA 1FT9A 4K1ZA 4Y22B 1SMVA 3AKPA 2YPJA 2PHUA 1S1AA 4LULA 4I01A 1LOEA 1CAVA 1VALA 3AMPA 1AYN3 1V6NA 4PLMA 4MUVA 2D6LX 4PIXA 5CAZA 1JYCA 3I2DA 1K5MA 5ACA2 1X8EA 3IDCB 4OUMA 1LOCA 1WBFA 3AMQA 1G9DA 1QNYA 4XJ9A 3THPA 2NPIA 4I0AA 3A4UA 5E1RA 2PHWA 1DBNA 4EN9B 4IL7A 2WNUC 1CAXA 4J1WA 1LENA 5C33A 1UKRA 1D4VB 1VBC2 4MGKE 1W6MB 4Z82A 2VQ0A 3E97A 4HPKB 1ND3C 3IN9A 1UU4A 3IBMA 1N3PA 3DPRC 1DGWA 1EPZA 3EJKA 4UXAA 2QJVA 1YI7A 4FSJA 1C8M1 1UZYA 2ZS6B 4XFFA 3D0SA 4OHXA 1W0PA 2VQAA 1AR92 1AYN1 1SBDA 1FATA 4FPOB 5DUWA 4QX5A 1KS5A 1I6XA 3BODA 2W52A 5LEKA 1SFNA 1YJKA 2ZGNA 2BUKA 3ZSLA 3WOGA 5CVRA 3ZSJA 5IT6A 2XLAA 4XBQA 4Q4V1 3ZYIB 4S2DA 4XTPA 1LECA 3V0BB 3L2YA 4KWKA 3M3QA 2DUOA 2BNNA 3D8CA 4MSVA 1R083 2NZ9A 1DGWX 1OD5A 4CEWA 1MQTC 1MZFA 4GXLA 2NP0A 3T1MA 4AEDC 4R9CA 1PK6C 1BJQA 3O0XA 1RINA 2OZ6A 1VBA2 2X29A 3MFCA 1ZRCA 4MXWB 4BLJA 1OOPB 4EN8B 2BVBA 3LAGA 2OA2A 4ASMB 3IPVA 5IK7A 3VHPA 3TN91 4E4SA 3MIDA 3WQ7A 2ZGMA 2TUNA 4EWEA 1ZRDA 2PHLA 2WL1A 2G4IA 1LEDA 3VBSC 2W39A 1LGBA 1H30A 1DG6A 4K21A 3WX5A 4GH4A 1LB2A 1W6PA 3FMGA 4JRLA 3VBHB 4I2OA 3MPPG 4I3GA 4N9IA 3POSA 1LHOA 1OA3A 1WW6A 3G6JB 4XF0A 4D3WA 1ULCA 2FMYA 5H9PA 2MEV2 4DPNA 4HLTA 4Q4X3 1YIPA 1C5HA 3D82A 1XU1A 4YVSB 4E9KA 1RUH3 1ASJ2 1VRH3 3FLPA 3NV1A 4NN0A 2R30A 5BPXA 5CFDA 3JD73 5CFCC 4Q8KA 2BPA2 1DHKB 5GM0A 4DNYA 3RI9A 1VR3A 1UW8A 1IS4A 4AFMA 1PO13 1PZ8A 3KCYA 1SLBA 2CGPA 4D7SA 5CNAA 3MIEA 4Y4YA 1OMIA 1RHI3 5GZEA 2HWC1 3ROUA 5JZGA 4GMP1 1PNGA 2EF6A 2UY9A 4QPYA 1TE1B 1LOGA 2OZJA 2R072 3TAYA 2VNGA 1GANA 2XJPA 2WA3A 2WNVC 2GAUA 3ZFFC 4EV0A 1UIJA 1CAWB 4O9GA 2AR6A 3ZSEA 1BQPA 4QMAA 4FPKA 5CA6A 2HWB3 3WQ1A 4YW1A 3R4SA 1EY2A 3VGIA 1C1LA 2K9ZA 2R6QA 1QQP2 1RUH1 4YVWB 1NLRA 4JQRA 2JG9A 3P3NA 2E7TA 2WS93 1HQLA 4QQOA 5JMCA 5E16A 4IEXA 4QPGC 4LR4A 4X6RB 2DUQA 1PO11 1WLWA 1ZBE1 4P9YA 5D1IA 2YHJA 4NR1A 4ZU5A 3QACA 1ZBA3 1RHI1 3THTA 1OA2A 3FE5A 3JBG2 3N7LA 1RTVA 3ZXDA 3WUDA 1HRV2 2XUMA 1PVXA 3N7KA 3PVOA 5GZGA 4CRQA 1WA4A 3ZFEA 5B2GB 3SH4A 4Q4W2 3NW4A 1ZRRA 1KD7A 4UW3A 1R1A2 5K7PA 3B01A 3B7MA 2BBVA 2D5FA 2BW8A 4YW5A 4H3WA 3MF6A 1H9WA 3C3VA 3ZX7A 2WFF3 3E6DA 1EAH2 3TRSB 3HBZA 3FHIB 2ZGOA 1AR82 3VDDB 5A3MA 4IESA 4DRVA 4FQ4A 4QQLA 2WS91 4LHLA 1H8TB 1MEC3 4G3YC 1BBT2 4LE4A 5JSOA 1HW5A 1H1IA 4MGZE 5EZWA 3RJRA 5CB7A 2WA4A 4CDQB 2VUAA 4LUMA 2VOWA 2QZ3A 5L73A 4AHZA 4RHV2 1CJPA 1DQ4A 2AENA 4NHLA 1N3QA 5EWSA 1UL9A 1VBB3 4DXZA 4GB31 4N7UA 2FZ2A 3VKNA 2WZPP 1NCQB 4FOWA 2GMEA 4H7LA 5FMOS 4ISQA 3ZO0B 4C1XA 1R091 4XILA 1W6NA 2QCSB 1D4M2 4LLOA 2XLFA 4M3CA 1SLTA 2RR12 2UWCA 1NY71 1EV13 2ZZQA 4W6XA 1T6GC 1MEC1 1FYUA 1WMDA 3IMNA 5K0UB 3ZFGC 3W9AA 2YC0A 4LBQA 1U12A 1LEMA 2IXIA 4S2HA 5AC91 4Y20B 4Z2WA 4OZXA 1BVVA 4FOQA 4RR3B 1ZZ9A 4YW4A 3VBUC 1MR5A 1DGRN 2RS12 4XFHA 4HETA 1SEFA 1ALYA 3ZN5A 3H8UA 4IEOA 1X8MA 3O14A 4B3NA 1V00A 4Y22A 2B42B 2WZR2 3D5OA 5I8YA 5DUXA 5DZGA 4L11A 2A71A 1U5XA 2KXLA 3P3PA 5DUVA 1UU5A 1C57A 1MACA 2SBAA 4A2UA 3MLJA 5I0RA 4CTEA 5I91A 3AZVA 3PMSA 4Q1RA 1MS0A 4IEVA 1O5UA 4XHBA 4AGRA 2IXHA 3KT7A 1DYKA 1POV3 1S0GA 2YDEA 1COV2 2DTWA 2YMZA 5DDJ3 4B8EA 4Y1ZA 3IIAA 1X36A 1OPOA 2IXJA 1C28A 3LSDA 4E4ZA 4LTAA 1GR3A 4MVTA 4M3CE 3DKWA 4XQWA 4LO5B 1W6MA 5GLZA 1KDKA 1UU6A 1O4TA 4RGGA 4HPKA 1ZZ6A 1QJU2 3HQXA 5I0UA 5KXBA 2A3YA 4CDUC 4B7KA 2HYKA 4COVA 2V09A 3SH3A 1O7FA 3VZNA 2WLPA 1FOD1 2B5HA 2W68A 2FHRA 1VBD3 3IT8A 3RDIA 1C5IA 2V5YA 3ZSMA 1BMV2 4JTOA 5HBAA 3AXEA 4AWDA 1QKQA 1VAKA 3AYAA 4EWAA 5HCFA 1YFYA 4WM8B 2VGDA 5JWPA 5H9RA 1ENRA 1LR5A 1ENQA 1RMU2 1BCXA 1VBE2 1GLHA 2D6MA 1DQ5A 1LTEA 4Y5Z0 1ND2C 2ZMNA 5JOWA 4QGMA 3V0BA 1RUD1 1FMD1 3H1MA 5FPXA 2XJSA 3VLBB 3M2MA 3T2TA 3QBQA 1NA1A 3JCIA 5LRRA 1Q5OA 1QDCA 1QY4A 2UURA 3OTFA 2D6PA 4RS5B 1YRZA 3ZYRA 3TNQA 4TYSA 1ZREA 1F9KA 4YFWA 3S6PA 4MXWA 1A8MA 1OOPA 1BZWA 1RUC3 5J3UA 2JG8B 3N7JA 1EPWA 1LRHA 1LHWA 1RUJ3 1RUE3 2K0GA 2HWF3 1LHUA 3SNMA 5CIRA 2BWCA 2WSVA 1IKQA 1JHNA 2VH9A 4ATFA 2GZWA 1HXS2 1XYPA 4TSVA 4Q0QA 5JOYA 3VBHA 1YUDA 4FAHA 3VZJA 4LBMA 2A3XA 4N53B 1S0DA 3R4UA 4WV8A 4WZCA 5F6KA 2NYYA 2BTVC 1PIV2 2WQ4A 4YVSA 4YGCA 4KGGA 3UKTA 1WBLA 2XVGA 5FCCA 1AZDA 3QH7A 2ZOEB 1NCRB 2RS32 4C0HA 1V6IA 3TWIA 2ZAHA 4AEMA 2AH2A 1RUJ1 1RUE1 2GC0A 3M4FA 4HKWA 3JQWA 4AGVA 5J96B 5L19A 4MYEA 1Y3TA 5C4WB 4OI0A 4XFGA 4N43B 5L7OB 1FPN2 3AZYA 1TME1 3NV4A 2GNBA 2DWRA 3WR0A 4ZKTB 1GKBA 2E9QA 1HRI1 1ZM1A 1PZ9A 4XFAA 1LHNA 1UX6A 3MIGA 1REDA 2X5IB 1DDLA 4AHWA 5T5PA 1CAWA 1Q8QA 1X7NA 5GLWA 1QNWA 3MIFA 4INDA 1IQAA 5D8AC 3NAPC 4IXLA 2WC2A 4YZ1A 1J59A 2PTMA 5T52A 2PELA 3WV6A 2PHFA 3SISA 2PLV1 4YVWA 4YW3A 3N35A 1Z0HA 1QXRA 4L99A 1SCSA 3BOWA 2C1FA 1PVC3 1KJRA 2A6WA 4YZ4A 1LULA 4IEQA 3S7EA 3X29B 1PNFA 3WG3A 2UWAA 5FLIA 5AFBA 2VULA 4OHYA 1ZZ8A 2A73B 3B9CA 2XBO3 4N7IA 5GZFA 1KJLA 2OW4A 2SLIA 3S0MA 1I1EA 3OY8B 3WHTA 2A75A 2GMPA 4LBJA 1U5YA 4WM7C 1H4HA 1BEV2 4XIOA 2WNUB 4AYUA 4PLOA 5KHJA 4J1XA 3VL9A 1RUG1 2PN5A 3O7OA 4ORFA 4OHVA 4RD7A 2RMU1 1AF9A 1LESA 1O4YA 1AR73 4HSLA 4XW3A 5JCTA 1ND3B 4OUSA 1ZA4A 3CU7A 3DPRB 4K20A 4YGBA 2A3WA 3CJIB 1H2NA 2YV8A 4FAGA 1CONA 2CYFA 5BXXA 4MX3A 2OUHA 3VDDA 1AXZA 1WUVA 4BZ4A 1NE6A 1AVBA 1PVC1 1Q3EA 1HV1A 2RS52 1H8TA 1C4RA 4Q27A 2XBO1 1Y9QA 4LE3A 5T5JA 3T1LA 2WQZC 4S2GA 2QDNA 2QE3A 2ERFA 3M8LA 3VBOC 2MPFA 2ZX1A 1N1TA 4RL7A 4Y1XA 3B00A 4RA0A 4CDWC 1AR63 4CDXA 1XE7A 1G9AA 4IQPA 3GHMA 2AREA 3ZXKA 5JR7B 2HWD3 4LBLA 3R0RA 2DFBA 3ZMNA 2ZX2A 2XWBB 2DCKA 4KG0A 1MQTB 3ZYGA 5BNNA 4AEDB 4JVAA 5FPZA 1PK6B 4BM8A 1GBGA 3LOIA 4F3JA 3MW3A 1OPMA 1H2LA 3PJYA 3E5QA 3QOPA 3ZXLA 1HDKA 2E51A 4FOYA 1Z78A 2JDZA 3B93A 5C8CB 5KHKA 2AZ5A 3FC0A 3VZKA 2A6ZA 5FFOC 5I0TA 2GH8A 1QU0A 4LBKA 5K0UA 5IK4A 1C8M3 3VBSB 4XDQA 4BE3A 4O9EA 4PIZA 5L36A 4DS0A 2WT0A 4Y20A 2D97A 4QQ2A 5ABJC 3VHRA 4FPLA 4RR3A 3ZYJB 2CTVA 3PJQA 2D6OX 3PNAA 1AR61 3JZVA 4LBOA 3H1YA 3WDYA 5I8SA 4CP2A 4E2GA 2HWD1 1HIXA 4XMIA 1JN2P 3O0VA 1AX2A 1IZ3A 1MS4A 2I74A 5CU1A 4YGEA 3FFQA 2EALA 1UF2C 4P9GA 4GULA 4LO6B 3V64A 5KHGA 4Q4V3 3V0AB 3OF1A 1AR91 1OQ1A 4I0BA 1FV3A 3RWNA 2YXSA 3FBMA 1S55A 4P5HA 2RJKA 3I59B 2HWE3 1PGW2 4KWJA 3VBFC 4I0WB 5T5LA 3RSJA 1SLAA 3POWA 1W2UA 4A7KA 3WXPA 3SHRA 1NE4A 1PO22 1TMF2 2CAVA 4K1YA 3MICA 1V6MA 4ES8A 3KS7A 4YM1A 1S0BA 5J98B 4KWLA 1AXYA 4QPIC 4YZ3A 5T55A 2XL7A 3AXDA 2P17A 4XQ4A 4FQZA 2R16A 3GHNA 4HMZA 5K8SA 1I9RA 3V56A 2DCYA 1G7YA 1J3QA 4KH9A 3HR9A 1C8NA 1MS9A 4MGYE 4R52A 3TN93 2WNVB 3ZFFB 2ZZJA 1KQRA 1O3RA 4AVTA 1W39A 2CNAA 4E4DX 4D7YA 2QFEA 3ETQA 1JTZX 1PHMA 5KHIA 2DUPA 2UYAA 4PDWC 2EAKA 1HX6A 3GBGA 2HWE1 4UBHA 2Z2SB 4P14A 4AI0A 3CNAA 1Q8VA 3OBRA 1YI9A 4WM8A 2ZX3A 3WT3A 5KC6A 1YIFA 1DGLA 5EJ3A 1F31A 4QPGB 4E2QA 3WW2A 5KXDA 1H9PA 1TEIA 2BWAA 3ZDSA 4KL1A 2B39A 2PA7A 3U11A 1O3TA 2TBVA 4QHBA 1RVF3 3D0JA 3ES4A 1Q8SA 1SLLA 2GNDA 4Q0PA 2MEV1 2PAMA 3WY6A 4AFDA 1AYN2 1WLTA 1F5FA 1J3PA 1DLLA 2DCTA 4XIKA 1L3JA 4RS5A 1ASJ1 1OFSA 2HWC3 3SLIA 2BYVE 5CG9A 4GMP3 2PHTA 1CESA 4YM2A 4AE2A 2ZHNA 4QQHA 3RRDA 5DG1A 4A7ZA 2ZA9A 2BNMA 1J1TA 2JG8A 4XYXA 4PF5A 1CVNA 3AYEA 1O3SA 1PZ7A 3GALA 2Y0OA 3SXWA 3ZXEA 3J9SA 2MNGA 3WCSA 1N1SA 1RUOA 2O1QA 3SMHA 1AJKA 3FX3A 1AL0G 2R071 4LA3A 4CEYC 4SLIA 3ZPYA 3KSCA 4XOGA 1RVF1 4AQ2A 1BVP1 4N53A 1DZRA 3QCWA 1XQNA 4ONUA 3VHNA 1KFUL 2GC3A 1ZBE3 4M0HA 2QUOA 1RB8G 1OQEA 2BFUS 3VBRA 4AK3A 1WD3A 1AR83 3AKRA 1NCRA 2GNMA 2XLGA 1ZZCA 1OA4A 2GNTA 1ULEA 4AG4A 2BVVA 1UZZA 4HANA 3LZZA 5F9TA 1R082 4Y1YA 4Z07A 5L7OA 4N43A 3VZMA 4QM9A 3JBG1 2QDRA 4LHNA 3E6BA 1VB2A 1HRV1 5FBZA 3ZFGB 1QWRA 4NWVA 3VZLA 4Z1VA 1QOSA 1SDWA 2E7QA 2X5IA 4AVSA 3D4KA 3VBUB 1Q8PA 4GKYA 4QGNA 3ZMOA 2CGOA 4IV3C 3OD4A 2ZGPA 3KD4A 5JI9A 4B29A 4GIQA 1H8VA 2A6XA 3RNSA 1EAH1 2BFUL 3N7MA 4K6BA 4HN1A 5FREA 4LNVA 1AR81 2G9FA 3AP5A 3ILNA 2TNFA 1NA1C 2ZPXA 4RQPA 2VU9A 5F6LB 2R063 5BNPC 2VNRA 4IEYA 5JLVA 2RJLA 3ASIA 4FOVA 1M06G 4YYOA 4GB33 3BALA 4XE9A 1G8WA 3L9JT 4OFGA 3UL2A 4FVVA 3KT1A 4Q4X2 1R093 3CO2A 3RYRA 3RYKA 2WNUA 1UAIA 1G86A 1JBCA 1QGLA 5EV7A 2FBEA 1VRH2 2RM23 3UK9A 3WP6A 3JD72 1GNHA 1LHVA 4JCKA 3OPZA 2XVKA 3K51A 3ILFA 2LM3A 1N47A 1IS5A 2IXKA 2DU1A 1KXGA 4KQ7A 1ND3A 3R4DB 1F5JA 1ZNPA 3DPRA 1VIWB 2IWGB 1IHMA 2JE9A 1PO12 3CJIA 4CDUB 5AC93 3LB9A 1D4M1 1ENSA 3IDBB 1AL22 1J1LA 1RHI2 4LO4B 4IV1C 4IEUA 3MLLA 3OD0A 2VW1A 1AUYA 4AEKA 1COV3 4G4FA 2AGSA 2R061 4AQSA 4PIYA 1SACA 5LEJA 3WZ1A 4UW5A 3NWKA 1SCRA 3FUOA 2QKDA 4XEZA 5DZEA 4AVVA 2HWB2 5T5OA 1RJ7A 4L2NA 1JW6A 3LA7A 3M3EA 2HEYF 3MW4A 1ND2B 4PBOA 5FLJA 5CG8A 4D7TA 2RS11 1QXPA 4NHMA 1GFF2 3ZXAC 1I5ZA 2RM21 4XBNA 4X6QB 1QJX3 2PYTA 2VMHA 1X33A 2GALA 1PM7A 1MQTA 3AMMA 4BMEA 3MZHA 1RITA 2KM2A 2R0FA 3WG1A 1PK6A 3WG2A 2JX9A 5C9AC 4ATEA 5I0SA 1S0CA 4UW4A 3NV2A 1RUF3 2HEWF 3AZZA 3URFA 5JI7A 1ZBA2 2P2KA 4HSJA 4E27A 1WW5A 5C8CA 3FBYA 1COV1 4UBGA 1Z7S2 1RMU3 4KG8A 4NPRA 3UJOA 2UU8A 2JD4A 1D2SA 3VBSA 4P9JA 3ATGA 1PGSA 2JKBA 3OCPA 4XF4A 1FOD3 3ZN4A 4G9SB 4AEJA 2PHRA 3VV1A 1CPNA 3RG0A 4MH0E 3JU9A 4TWTA 2YROA 4WVWA 4URTA 2WFF2 3ECQA 2ZAAA 4A7YA 2ZGUA 2PQQA 2ZHMA 1QJX1 4I09A 4P9LA 1J58A 1U5ZA 4YZ5A 3KGZA 1MVQA 2VOKA 1GICA 3ZXGA 5GZCA 1LOFC 4I30A 4E2SA 4DZGA 3V0AA 1MEC2 3GYDA 3TBDA 1RUD3 1BMV1 3H3ZA 1FMD3 3HMYA 3I59A 4ZU7A 1RUF1 2D93A 4L97A 2PAKA 5BNOC 3BPZA 1XNCA 3RPQA 3EBRA 2VOXA 1JUHA 1MS3A 1R1ZA 4GWMA 4W6WA 1LKNA 1RMU1 3AMNA 3INAA 4BA6A 1C1FA 1VBE1 2DV9A 2YY1A 2A6VA 1V9U3 4JDOA 4DRRA 2JENA 2C0ZA 3QLQA 1VBB2 1CPMA 3AP9A 1NQDA 1RGSA 3VDDC 3MIBA 1O3QA 1V6OA 1H2MA 4YG6A 4FT8A 4FPGA 4Z92B 1N1VA 3WDXA 4XHXA