1JTZX

Crystal structure of trance/rankl cytokine.
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
155
structure length
155
Chain Sequence
QPFAHLTINAASIPSGSHKVTLSSWYHDRGWAKISNMTLSNGKLRVNQDGFYYLYANICFRHHETSGSVPTDYLQLMVYVVKTSIKIPSSHNLMKGGSTKNWSGNSEFHFYSINVGGFFKLRAGEEISIQVSNPSLLDPDQDATYFGAFKVQDID
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords TUMOR NECROSIS FACTOR LIGAND SUPERFAMILY MEMBER 11
publication title Crystal structure of the TRANCE/RANKL cytokine reveals determinants of receptor-ligand specificity
pubmed doi rcsb
source organism Mus musculus
molecule tags Cytokine
total genus 29
structure length 155
sequence length 155
chains with identical sequence Y, Z
ec nomenclature
pdb deposition date 2001-08-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
X PF00229 TNF TNF(Tumour Necrosis Factor) family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.40 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 1jtzX00
4QQ2A 1OSGA 2WNVA 4J6GA 2JG8C 3ALQA 5TSWA 1D4VB 4MXVA 2JG8A 5L36A 1I9RA 1WCKA 3WD5A 1XU1A 2JG8B 3FC0A 4E4SA 1S55A 2QDNA 4D7YA 3TYJA 3IT8A 2JG9C 1U5YA 2KA3A 2Z5WA 2E7AA 2OIIA 2JG9A 4E4DX 1RJ8A 5CIRA 1RJ7A 5HBAA 2JG9B 3L9JT 1A8MA 4TWTA 1U5XA 2TNFA 4QQOA 1C28A 1DU3D 4N90A 4DB5A 3ME2A 1JTZX 3LKJA 4RSUA 1D0GA 4GIQA 4F3JA 2ZPXA 4QPYA 1PK6B 5L19A 3URFA 1D2QA 1U5ZA 2AZ5A 4MXWA 3TWIA 2R6QA 5KC5A 2ZJCA 3B93A 2Q1MA 1KXGA 4OULA 4NN0A 4MXWB 1DG6A 1KD7A 3B9IA 4QQHA 2X29A 2R32A 1OQDA 1XU2A 1PK6C 1TNRA 2RJLA 2HEVF 4G3YC 1O91A 5KC6A 4G4FA 1PK6A 2WNUC 4HT1T 4DOUA 1IQAA 4MSVA 2RE9A 2WNUA 3V56A 4TSVA 4KGQA 2WNUB 4KG8A 1GR3A 1JH5A 1TNFA 4OUSA 2TUNA 2HEWF 3QD6A 4OUMA 2WNVB 5KWRA 3AB0A 2Q8OA 3MI8A 3B94A 1ALYA 2R30A 4QQPA 2O0OA 3K51A 1OQEA 1C3HA 2RJKA 4QQLA 2QE3A 5BNQA 4EN0A 4KGGA 3K48A 2HEYF 2WNVC 3QBQA
chains in the Genus database with same CATH superfamily
1MS0A 1UMHA 4KMQA 4XVHA 1BEV3 1MZFA 2ZACA 3OYWB 1MEC2 4Y4RA 2LRPA 4YFWA 2ZGLA 3VBSC 4DUVA 1PX3A 2YY1A 1VBE2 4J6GA 3RQ0A 1AVBA 3AKPA 5FV3A 2DTYA 5FWJA 4NMIA 4KNCA 2FDKA 2RS33 4NVPA 2QFEA 1O4YA 2JDAA 4TXWA 4ZXKA 5F3IA 4IE6A 2VZOA 5HPOA 2CGPA 1IPKA 3TEYA 4XIOA 4KBZA 1GZ9A 2JG9C 4LBKA 5HV0A 1SLCA 3H3ZA 3PU3A 1E5IA 2OIIA 2HJIA 4CUGA 1H6XA 1MVEA 3Q8CA 4IE4A 4YM2A 2GMPA 1GOHA 3WP5A 2GSYA 4WVVA 3DXTA 4U2AA 2BUKA 1YUDA 4MVTA 4BDVB 2VU9A 2DYCA 2VQ0A 3V0BA 3LOIA 5H9RA 3T0AA 3VBOA 1KITA 2WS91 3HOBA 3PIGA 4YZ3A 5FY4A 1IS3A 2YHJA 1G9FA 1DZRA 4UBHA 1TMF2 5CKMA 4MZUA 1W2OA 1IS5A 2NN8A 4AXOA 2MHFA 3POWA 2A3YA 2DCJA 2F4LA 3NJYA 3PUHA 4LO4B 3WG1A 4AOCA 2E7TA 1Q8VA 5KBFA 2C1FA 2Z69A 1FX5A 2XH6A 1RXFA 3MO4A 3U11A 3WQ7A 1CR7A 4ATEA 1GP6A 1QXRA 3FLPA 5JI9A 2IVJA 1SACA 2GDFA 4UF0B 1YIFA 1NUKA 1KS4A 1YQ6A 2OZJA 4IEVA 4YLZA 5DN2A 5JIAA 3VBHC 2YV8A 3OCPA 4YG0A 5F32A 4AI0A 5FZ4A 2EAKA 3SXWA 1SMVA 2E6VA 5LRSA 2OS2A 2VMIA 3VB9A 1Y9MA 2PHRA 3S0MA 1AYN1 1CZSA 4RYDA 3H7JA 1PZ8A 3D4KA 3D5OA 2VMHA 5AFEA 5JPMB 1AR62 4Z92B 4BQ3A 1APNA 1VBC1 3ELNA 2QZ3A 3VDCA 3MLJA 2PELA 1IQAA 3PLQA 2HBUA 2WDBA 3MIFA 4R52A 4Y4YA 1K45A 1BEV2 5LZ6A 1OUSA 2WN2A 3PVBB 4AEDA 4DZGA 1COV3 1HX6A 3KQ4B 3S7EA 3ASIA 2XUEA 4IQPA 3VKOA 4MH0E 1QF3A 1SLBA 3SNMA 1FNZA 2G9ZA 2RS32 3FJSA 4B4QA 2GH8A 1YC61 4NJ4A 2P3IA 2XGXA 2C6SA 3FZ3A 1C8M3 4K7JA 3ACFA 5D8AB 3OF1A 2VC9A 3AB0A 4XW3A 2WINB 1JBCA 1LJ7A 3BKZA 2PAMA 2H6BA 5FZ1A 1PHMA 4CCJA 4JGYB 1G9BA 3LF7A 1OLME 4Y5SA 4LUKA 3KD4A 5F8PA 1FYUA 1OA2A 4ZZ8A 1DBNA 4QPWA 4P9IA 3BODA 3R4UA 4CP9A 5F7UA 1OSGA 1WMXA 2AC1A 2ZEYA 2UY8A 3ZR6A 5F5CA 3BPZA 1ONAA 3O1UA 4IERA 4S2HA 4C0BA 1H2MA 4YZ2A 3MV01 1UIKA 4HPKA 1RHI1 5K0UB 1BQPA 1OI6A 1R1A1 2JDHA 1FPN2 5ANNA 2XJUA 1QWRA 1AYM2 1DGRA 3KT4A 3MLKA 4OHWA 3OBTA 4XF4A 3FUQA 3VD5A 4YZ5A 5KXCA 3TYJA 4NHYA 1ZZ8A 2E63A 2YUEA 1W0NA 1XYOA 5F3EA 1IKPA 5C33A 4Y22B 4K21A 3WCRA 3WQ1A 3WEZA 4C90A 3NJZA 3DKWA 1RJ8A 4CCNA 2Y8KA 3AVSA 4ASKA 3WV6A 4O7XA 1QJY3 2OUJA 4OI0A 3L9JT 1A8MA 3KQRA 2YC2A 4IEZA 5K0UA 1S0GA 3VDDB 4AHXA 1RUD3 2AEYA 1PNGA 3OEAA 3PTRB 2FDGA 1K3IA 1YRZA 2RDRA 5H9PA 1LKNA 1J58A 3FBMA 4E9KA 2R063 4BM8A 1QDOA 2DFBA 1Q43A 3CZUA 5JIUA 4EN7B 4S2GA 5BNPB 3DYPA 4D3WA 4RGKA 3UT0A 1F9KA 5JPNB 1C57A 4GWIA 4IV1C 5FO7B 1YI7A 3ZO0B 1F8VA 3FE5A 4Z82A 3BYWA 3VDDA 1CIWA 4Y24A 2DTWA 2E31A 5CEHA 1RUJ3 1C8M2 1YHFA 2W1WA 3FHQA 1HV0A 2PHTA 5JZGB 5C3RA 3DCQA 1RUG1 4KBBA 3ZM8A 2BV4A 1UXXX 4JDOA 5IWFA 3K4DA 2MEV3 2XLGA 4CP1A 3NNLA 1NCRB 4O9EA 2EIGA 3MW4A 5T55A 1I5ZA 1TME3 1V6LA 4L2NA 1O91A 4MOAA 4JCKA 3RGBA 4DY3A 5LCWL 2FZ2A 5FCCA 1CAVA 3SMHA 4GD4A 5A7WA 2D98A 1HXS1 4MSVA 4YARA 4YGCA 2WFF3 3H9AA 3OUIA 4JV4A 5CU1A 4XFCA 1UMIA 3MIHA 3VD9A 1SPPA 4LTAA 1JH5A 3E97A 5D8AC 1RUNA 2BVVA 3H7YA 4CCDA 5JZGA 2TUNA 4IW3A 1AR93 4LBMA 3O1SA 2DCYA 3DV8A 3DEMA 5F5QA 3VHOA 1UYYA 2PLV1 3G6JB 4JGYC 4YWAA 3WUCA 3FLTA 4NAMA 5ABJB 3I7DA 1PMHX 4OCTA 4XHXA 5AFBA 4CU8A 3WW4A 2BQPA 1QH7A 4LO5B 2CHHA 5EHDA 3OPTA 3WDWA 2NM1A 4AVBA 4BXFA 4TZDA 1N3QA 2JIGA 4JKMA 1ST8A 4AVCA 5A70A 1GMMA 4XF0A 4FAHA 2ZABA 4AYUA 4A2UA 4BIFA 1QJY2 2ARBA 1MS8A 1DYOA 4LORA 1BK0A 5FZ6A 3UV9A 1OH4A 3MUY1 3TEZA 5FPZA 4YRDA 1RUD2 1QJZA 1DGWA 3SITA 4DUWA 1HJGA 2VZ3A 2CY6A 2IZWA 3A22A 5C4WB 3NNJA 2HWF1 1UD1A 4QDQA 4UW3A 2R062 2HWC3 2WT2A 4E2SA 4Q4W2 3T3YA 2ZHMA 3VBUC 1CONA 3LA7A 3IPVB 3NAPB 2XL7A 4XJ8A 2VCCA 1WW5A 3DUIA 4IEXA 3LD8A 3POYA 2GALA 3ZXFA 1OFNA 2W0XA 3GZEA 4Y20B 1FAYA 2XG3A 4LKEA 2NYYA 2XL9A 3WP6A 3SKJE 2EICA 5B2GB 5IK8A 3ZXAC 2P3KA 1GZWA 1NYWA 2AACA 2GMEA 4B8EA 2WRAA 5DAWA 5JSPA 2QZ2A 1RUJ2 4RD7A 3OSDA 4G9SB 1H2LA 3AKTA 1HKDA 1MS4A 3S7IA 4XCAA 5M0TA 1G9DA 4TWTA 2OVUA 5LEJA 1H9WA 1SLAA 1UU5A 1PO21 2Z4FA 1QQP1 1JYCA 1GUIA 1H8TB 1WMDA 3RG0A 2MEV2 3LFMA 4Y33A 4FVVA 3HBZA 3NAPA 5BNPC 2V4VA 1TME2 1FATA 3NNFA 1TVGA 3LEKA 5FYVA 3TEXA 3X29B 4DB5A 1FOD3 2OUHA 1AR71 2ERFA 2CAVA 2VO5A 4MUVA 5FXZA 2VD7A 4RSUA 1SFNA 2IVIB 1JYTA 4QX1A 2WFF2 5FLIA 4BK5A 4E2QA 2Y6FA 2Z2SB 1VRBA 3MF9A 1BK1A 1Y43B 4DINB 4KG0A 1D2QA 1U5ZA 1GV9A 1R093 2A6VA 1AR92 2R071 4C8DA 2Q1MA 4Z07A 2N7GA 4LIUA 4D7TA 4IEQA 1LU1A 3ORJA 3POJA 4AHYA 1NCRC 1O6UA 2IWGB 2WZR1 4ISRA 4QM9A 1VAKA 3TNQA 3NV2A 5FZHA 2RMU3 2D6NA 4Q4X1 3ZFGA 1RUC3 3N7KA 2QQKA 1SCRA 4H55A 4AR2A 2Y6HA 1W28A 1EPWA 5K7PA 3WDUA 2RJLA 3I2HA 3VZLA 3ZFFB 4Z8BA 4P08A 2C26A 3E5UA 3IDEA 2B45X 2F4PA 5DABA 3MFCA 3JQXA 4A7ZA 5FOJB 2DBNA 1X50A 3KV6A 4FPOB 1W0PA 4OQ8A 5C7GA 5A3NA 2FCTA 3RWNA 4ASLA 1JZ6A 1MS5A 1ULEA 1YJLA 2WZ8A 1ZA7A 2I07B 3VZJA 5FR3A 4AQ2A 5ABJC 1ODMA 4XDPA 1US3A 1NAEA 4KWKA 2ZMKA 2Y6JA 1LU2A 2HWC2 2IC1A 3H3UA 4HLTA 4OUMA 1K12A 4QU1A 1GANA 2BZDA 4LO6B 3N35A 5EIYB 1A34A 3UJQA 5LK7B 1UZVA 4H3WA 4LOTA 2BNOA 1K5JA 4AF9A 2P6HA 2RM21 2ZEZA 3LFIA 2VZQA 3M3CA 5EXOA 1ULFA 2JB8A 3PL0A 1S2BA 2YG0A 2O8QA 5FUIA 5F9TA 3TN91 1WCUA 1NA1C 3M4FA 1ALYA 1QJFA 3KF5A 3PDQA 3T08A 3U07A 1FMD1 4AI2A 1R081 1N1VA 3I97A 4MO3M 5C3PA 3BIWE 1IKQA 4IEOA 1WLTA 4IE7A 5C4WC 3NV3A 1R64A 2WWSA 4KGGA 3N9LA 3KGLA 3NNGA 4LA3A 4QQ2A 2Z79A 3H8OA 4XILA 4JKKA 2Q1ZB 1O5LA 2ET1A 3D8CA 1W2UA 4HBNA 4YPJA 3AXEA 4UAPA 4Y1YA 1BMV2 1FOD2 4JGZA 5SV8A 4M00A 4D8MA 2D6MA 4BQYA 2RDQA 1L3JA 1QIQA 3ROUA 2HLEA 5FK8A 3N9MA 2VG9A 2XKPA 2KR2A 5IAXA 4CE8A 3M3IA 1UZWA 4PIYA 2ORZA 1R092 4XJ9A 5CG9A 3ZN6B 2J22A 2JDMA 3DPRB 1UOJA 2ATFA 3BCWA 3FX3A 2FDJA 1H8TC 3GM8A 3TAYA 1XNAA 2G9GA 4JHTA 4W6WA 1RJ7A 4PDWA 2RMU2 3ZIWA 4YGEA 1RUC2 4KI5M 4Y26A 3P5BA 4P00B 3VZOA 4AL9A 3I4IA 2GN7A 2ZKLA 1C28A 4XFBA 3WX5A 5IATA 2VZVA 4INDA 2YGMA 3PJYA 2CSGA 3R6SA 4KWLA 3IIAA 3S6PA 3ST7A 1JTZX 1D4M3 1W9YA 4XUNA 4XF3A 1FV3A 5FYTA 2DUPA 3VBFB 3RI8A 1N47A 3HAGA 4QPYA 5JDBA 3OGRA 3WVJA 2NMOA 4BYYA 2JD9A 4OZOA 2GNDA 3PVNA 4XJWA 3W5NA 2ZTNA 4UOJA 5J36A 5FMCA 1UXZA 3B93A 2JEMA 1PIV3 4HETA 4NN0A 4HVQA 5FJHA 2HWD3 3U4XA 2CTVA 3J7HA 5HXVA 1KD7A 2HWB3 4YVWB 5C3SA 3ZFFC 4GULA 4YFZA 5JMOA 4Q4Y3 4XJAA 5FY8A 4CPBD 1ND2C 2AR6A 4XFIA 1PGL1 1LOFA 2EXHA 3P3PA 3ZFEB 2WQ8A 5LY1A 3JQWA 4HONA 1IG0A 3K4AA 2OA2A 2VZTA 3EB7A 2XJSA 3ZSEA 1JXNA 4CDQA 5GJ6A 4YW6A 5LA9A 2B7YA 3AYDA 4J1WA 1QJU1 1S0EA 4K20A 2R041 3SCFA 4BLJA 4RHV1 3VKLA 2KD7A 4RQPA 3AP7A 1JZ5A 5CFCC 1XNDA 2JECA 2W2IA 3O14A 4FFGA 5A3MA 3RZHA 5JOZA 3POIA 1LR5A 4KG8A 4A41A 3RPQA 3THTA 4WV8A 4LIVA 3VDAA 1UPSA 2HEWF 3AP9A 3VZNA 4K3UA 3ZFEA 1QNYA 4DXRA 4QMAA 3PUIA 1RIRA 2PXJA 4R9BA 3H1WA 3MV11 2YGLA 2A6XA 5I93A 3AK0A 1UOGA 3T2PA 4ARXA 1JYVA 4A45A 1O3SA 1UZYA 1HIXA 1ZBA3 3ACGA 4I01A 5BNNC 1XRUA 2VH9A 4YYOA 3MIGA 2QTWB 4YW4A 3UETA 3ZSMA 1CAXA 4JTOA 4DIQA 1AR81 2XKOA 2VW1A 4AFDA 5BY5A 4DEQA 4HVRA 2C9KA 3HD8B 5L7OB 3GHMA 4YVSC 1PGW1 2A6WA 1MACA 1QNWA 3PURA 5AC92 4O9GA 1UY1A 3MW2A 4RGAA 1QKQA 3INAA 1TG7A 1B35B 2P6CA 5HXMA 3VUOA 1D4M2 4HKOA 1WW6A 4Y5TA 4OHXA 1O7FA 2BFUL 1SZBA 5C9AA 1ZVFA 3T2QA 1X9PA 2VBDA 3DPRC 2BP6A 4IE0A 5JOYA 3U1XA 4QX0A 2G4IA 1DGRN 3ZPYA 1WGPA 5D21A 2Z5WA 1JZ4A 2JDZA 3WNXA 1PIV2 1VR3A 1W6MA 2W3JA 2HWD2 3CKHA 2RR13 4XC9A 2HWB2 1Z0HA 4BQWA 1WW4A 2VM9A 1AL23 5A1AA 1KS5A 2ZAHA 1EUTA 1G9CA 3ZYBA 1SFPA 3O1MA 1UPIA 2Q4SA 2F17A 1OOPA 4AGRA 2WO7A 3C8XA 3WNOA 2DVFA 4TTGA 2VUDA 1UIJA 2JWPA 2YDEA 4E4ZA 3VBFC 3USUA 1NCQB 1ZYBA 2B46X 2QQVA 1V6OA 4IESA 3OGGA 4YW5A 1S0FA 5LEKA 3HBKA 4XE9A 1GLHA 2P3JA 1XC6A 2ZZJA 4LBQB 5LY2A 4GB33 5JOWA 2BVBA 3ZYGA 2GAUA 1NXD1 2YFZA 3A4UA 4PBOA 3CZJA 4YVWC 2DU1A 4WVWA 2VTFA 1IPSA 5FPAA 1FXZA 1MEC1 3RYRA 2XVKA 4C91A 1GQPA 4K6BA 3USSA 3KM5A 2Q8CA 4GMP3 2ZMNA 5JSRA 5FREA 5KC5A 1F31A 3WW3A 1FV2A 3O1OA 2D6KA 1V9U3 4AEJA 4FPJA 4DRRA 4BJ0A 4BQ1A 1J83A 2LTNA 2Q8EA 3H1YA 3RS6A 4ES9A 5IK5A 1NKGA 1ZBA2 3M70A 1JUHA 1RYYA 3ZYHA 3TBDA 5E6HA 3GJBA 5KHGA 3ZDSA 4QX8A 1MS9A 3WG3A 3IMNA 4P9JA 1VPHA 4Y1UA 1RVF3 3S5AA 2XJQA 3WQBA 1LB2A 2GU9A 4LXLA 3AC0A 4QPIB 3KVAA 1HW5A 2PTMA 3E5QA 1WW7A 5FFOC 2ZBJA 3PIJA 3EXUA 1LOBA 3CU7A 1KDKA 2BU9A 4QWNA 2LS6A 1OUXA 2VOXA 4QGNA 1ZREA 3OBZA 1NY71 3S5QA 3I3EA 4B3NA 3W20A 5A80A 1CAUB 3AYAA 2J1EA 5A7SA 1REDA 1X82A 5J48A 5FP9A 3WDYA 4A7KA 4JKLA 1OC1A 4FP2A 3WF1A 3N3HA 5CNAA 3QLQA 1BCXA 2VAUA 3ZXDA 5L9VA 1CAWB 1J84A 4QB1A 3WF2A 4F7ZA 5C71A 1DCSA 5L7OC 2Y6GA 3B94A 4YW7A 3J26N 1O8SA 1Z7S1 4EE2A 2RR12 3NO8A 4OZXA 5FZ0A 1AL22 3ATGA 5DMYA 2BGCA 1UN1A 2WKKA 4RR3C 1B35C 1IZ3A 2BTVC 4KU8A 1PZ7A 2D93A 2VQUA 1BKZA 2ARAA 2ZCWA 1PVC3 2BNMA 1W6NA 1ZM1A 2R49A 5KHKA 1GSLA 1HRV1 4DS0A 4L92A 1HB4A 2A71A 1QOTA 1Y4WA 4GB32 5T54A 3HIFA 3ILRA 1XU1A 1NLRA 3ETQA 4Q0SA 3V64A 1VMFA 1LHWA 1UCXA 4IEPA 5DAQA 5ACA3 1UWWA 1X33A 1JZ2A 2BOJA 2BPA2 3EO6A 3UJOA 3VZKA 4BQXA 4XABA 4AAXA 5J7MA 3RJ2X 2QQIA 5GZFA 4FPKA 2E26A 2VCMA 1I1EA 2X5IA 5ISLA 3VHNA 3T4VA 5JWPA 2R0FA 3OGSA 5KXEA 1DQ2A 1PMJX 1GU3A 3PVOA 5A3UA 1V6IA 1LENA 2VZ1A 4TN7A 1ND3C 1REFA 4XFGA 4CDUA 1U5XA 5I8SA 4DXTA 1OPMA 4MADA 1ASJ3 4FOVA 1PVXA 3V0BB 5DAVA 1DU3D 3UGGA 3VBOB 1RVF2 2ZS6B 4LO7A 3ACLA 2DBIA 1JYWA 4EN6B 5T5LA 4COVA 1B09A 4RN5A 1H1MA 1BVVA 2ZEWA 3DYOA 4K1ZA 4LKDA 4Q0QA 4PJYA 4F3JA 1OFSA 3B7MA 3S57A 1I5PA 5JXIA 1W9FA 5EYYA 2JIJA 2WYFA 1JI6A 2JENA 2ZJCA 4BPZA 2IXCA 5A32A 1HRI1 1JOPA 5GZGA 1HJFA 2XB6C 4FP3A 5CZKA 1RB8G 1JOBA 4QKDA 1ULCA 5HCAA 4QXCA 4XF9A 5IK7A 1QY4A 2WBKA 4CCMA 3WINE 2R32A 5FBJA 4QPIC 4N8MA 2DVDA 5CFDC 4PI2A 4L99A 1GOGA 4BMBA 2B5HA 2ZX2A 2W1QA 4OUEA 1YJKA 4QPGC 4NIIA 2ZX1A 4HOOA 1FPN3 4LUMA 2LM3A 2G9FA 4XUPA 1DQ0A 2VVEA 1AYM3 1RMU1 2ARXA 1WD3A 2WNUA 5LA2A 4COWA 2PMWB 4LHNA 3O1TA 1WCDJ 3I2DA 3KVBA 3AZWA 2R16A 1PVC2 3AZYA 4AEDB 5FDBA 4Q0PA 3R0RA 5FY9A 1C5HA 4ZPIA 3CL1A 4ZY9A 5T3NA 3NSTA 4FFFA 4DFSA 2DURA 5DXDA 4LULA 2DU0A 4PF1A 5ACA2 3JBG1 2VR4A 5D1IA 1VBA1 3LEMA 3I2GA 4W65A 3HWJA 5FZBA 3J4UH 4BIOA 3TB0A 4A6SA 4B1MA 2WA4A 1COV1 1D0HA 3SHRA 3ZLIA 1MS3A 3SH4A 2VTXA 5K4LA 4B29A 2D3RA 3KV4A 5J98B 4BLIA 4COUA 5DUUA 4XBNA 4FT8A 2KXLA 5FBZA 5GLTA 1EP0A 3LIGA 4PQQA 5FYHA 1W05A 1JYIA 3ON7A 1W8UA 4HK9A 4XDOA 3U4SA 3EMRA 4P14A 2UY9A 3V0AA 4OFGA 1VP6A 4CP9B 1A8DA 1VE0A 1ASJ2 1EV11 1W8HA 1QJX1 2ZEXA 3W59A 3I54A 1W6QA 3HNBM 1D4VB 2DCKA 5A33A 5F2WA 2Q30A 5L36A 3AM2A 5DG1A 1CQ9A 3Q8BA 1WCSA 4HPKB 4XZPA 3VKMA 5BV6A 5CKNA 2AREA 2Q0AA 2YBSA 1RUOA 2WABA 2VNVA 3UL2A 1CGPA 3AYCA 3LDRA 2ZAAA 3WR0A 4X6QB 3OGVA 2AENA 4CVUA 1U5YA 1I3HA 4BZ4A 2P1BA 4D6SA 1CPNA 4E4DX 4JDNA 3VBRA 4Q4V1 3LWCA 1VBC3 4CA9A 2FCUA 1VB4A 2A3WA 1AX0A 4Z2WA 3HQUA 3O0WA 4P9XA 1DQ4A 1PO11 4V2WA 4EZHA 5EP9A 1X8MA 3D6EA 2AUYA 3OPZA 1ZBE3 4PBPA 1RUH1 1DP0A 1H1AA 4IGOA 2V5DA 1VMJA 4L8QA 3GJAA 2QJVA 4Y1XA 4CEWB 4ISQA 4LQRA 1A3KA 5I0UA 5FZ9A 4Z1VA 2QQMA 4Q1RA 2Q8DA 1S0BA 3KCCA 4NPRA 3VD3A 3CJXA 3IM0A 2A70A 4KWUA 3TEWA 2GNTA 2CL2A 5L19A 3WDVA 1CJPA 5CKQA 1GKBA 4LBOA 4PLOA 1KXGA 2R061 4XQ4A 3AP4A 1SBFA 1WKYA 3NKGA 4COYA 2AH2A 3DYMA 2GNBA 1AJKA 4XFHA 1NLQA 1KFXL 1VJ2A 1XXNA 1H2NA 5FK7A 5FZ7A 1HN0A 1DLLA 4QX7A 1KFUL 1SLTA 5FYBA 4NO4A 3FWEA 4IETA 4CEWA 4D6RA 1DFQA 3ILFA 3GBFA 4XACA 1F5FA 1DIWA 2PHXA 4EN9B 1LECA 4Q4W3 4HK8A 1ZZBA 3JU9A 1HN1A 2B9UA 4DOUA 4AEDC 2J42A 1R1A3 3GNEA 1UO9A 2XLAA 3EBRA 3U37A 4OI1A 4PIXA 4RS5B 5J96B 1CAVB 4JDMA 3AMHA 2DWRA 5A7WB 3CEWA 3EQEA 5IHRA 1POV1 4KGQA 4OI2A 5C5UA 3JD71 3RZMA 1ULPA 5GZEA 4PHZA 1SPPB 2OYZA 1TME1 4CRQA 1IGOA 2VW2A 4CU6A 1ZZ6A 3WDTA 2Q1FA 4LITA 3C7OA 5AVAA 1W9SA 1QEXA 3E5XA 4D0QA 5IVBA 1OKOA 1WZXA 3VBUA 4GWMA 3NW4A 3UNPA 1BBT3 4QM8A 2CU5A 2O0OA 3IB3A 4XPVA 4RS5A 1CWPA 1VBC2 1UYXA 2QE3A 4QXKA 2UU8A 2DUOA 5FZKA 2VZRA 2QVSB 3AYEA 3B9CA 5CYYA 2R0HA 3OUJA 4J1XA 4WM8B 2VMGA 1PZ9A 2VMCA 1IG3A 2VULA 3PNAA 2W1UA 4XUOA 1ZBE2 3ALQA 4GMP0 4UFJA 2H6CA 3GBGA 3ZYFA 2Y60A 1RUI1 1UKRA 4HANA 1NT0A 4AVAA 4K8RB 3ZXEA 1WCKA 1OVPA 3KS7A 4B4RA 5FZEA 3NWKA 3EYPA 4BQ2A 4ORFA 2QNKA 3A23A 2BBAA 1JOJA 4UI9L 5IAVA 1EYBA 5EYXA 1RUG3 2VUAA 2XHNA 4UFKA 3KV9A 1PNFA 1JZ8A 2VZUA 1DDLA 3GF6A 4WM8A 5FZDA 5CIRA 3NL1A 4LHLA 2ARCA 2JX9A 1GZWB 1XE0A 2BERA 2CWSA 3K46A 5FZCA 2C0ZA 5DZGA 5I0DA 5K0UC 1CJDA 5FY5A 4ATFA 3B5LB 1HXS3 1GNHA 4XAAA 4QHBA 2B9VA 2YPJA 4QQOA 2YFUA 5D2AA 2ZHLA 1W03A 1YYNA 1NX9A 4XJUA 3K3NA 3RYPA 4SBVA 2WLPA 4FTSA 4JAAA 1R1A2 2VCBA 5FTTC 1WBFA 2PLV3 3WOGA 5BUVA 2K2SA 4FPEA 5K9YA 5FZAA 1QGLA 1VBD1 1PK6B 5F5IA 5F5AA 3O1PA 2V4AA 3M8LA 2VTXJ 4MXWA 4MX3A 3VDDC 4BE3A 4EWEA 4EV0A 1OD3A 5BPXA 3FMGA 1W8NA 1EAH3 1TE1B 1FOD1 1UL9A 1XSRA 1G8WA 4W8JA 3GZUC 4N9HA 1WLWA 2VGDA 3ENRA 1J1LA 4NE9A 3J7MA 1DLCA 1OLRA 3LPFA 4FOQA 4QDRA 1OA3A 2GH2A 3FFQA 3M7AA 4X8PA 1BBT2 2WT0A 4F83A 5I0SA 3ZFGB 1ZRCA 2XBO3 1XNKA 3SC7X 1ZRDA 2JKXA 4CDXA 2HWF3 1OF3A 1J3PA 4CCEA 4X8NA 2SBAA 2BJSA 3D0JA 1PK6A 3HR9A 4I3PA 4O61A 3L2HA 2D97A 3RZGA 1RXGA 1VAMA 2D6LX 1W2TA 2YZ4A 4RL7A 3LE0A 1DZTA 2WO1A 1WUVA 3AMMA 3POSA 2P34A 2ZXQA 4WVMA 2WWJA 5JZGC 4V1PA 2PAKA 3M3EA 4DEVA 4PLMA 5IK4A 1UYPA 1QH6A 2OZ6A 3QD6A 5GLWA 4BA6A 2VL4A 2W5FA 1DQ1A 1ENRA 4Y5Z0 1L7RA 1U12A 1UX6A 4D7SA 3OUHA 3ZMNA 5GM0A 3NNMA 5JSOA 2VNRA 1MZ6A 3NRUA 3R4DB 2DF7A 4AWDA 2EIEA 1RUG2 3WNKA 3LB9A 4AK3A 1QQP3 2VQTA 4ZKTB 3A0KA 4R4ZA 5FYIA 2GZWA 1XNCA 4NWVA 5FPVA 2PHWA 2FDHA 2RS51 1OBNA 1CZTA 1G7YA 5H9QA 3OPWA 1LOCA 1H0BA 3LDBA 4NHMA 4ARYA 4XHBA 1GBGA 2D6PA 5FZ8A 3KZ4C 3ZSKA 1AR73 1CVNA 1LOAA 4NIHA 1AXKA 5T52A 2ZX4A 1HXS2 3U10A 3QBQA 1KDMA 4M01A 4R9CA 2JXAA 4AFMA 2BBVA 3SISA 4KWJA 1SEFA 2GC2A 1ENXA 3HQRA 1SFYA 1W9TA 2YB7A 4XQWA 5EPAA 3BN6A 4ZZ5A 2XHKA 2HWE1 2PLV2 4BISA 2XWJB 4JGZB 4M4RA 3JUUA 2WZR3 3D82A 2C5DA 3APBA 3ZXGA 5JOXA 1AXYA 3H8UA 4SLIA 4UBGA 1VLNA 4B7EA 5DDJ3 1W6PA 4Q4X3 1DYKA 1YQ2A 4QKFA 1DGLA 4GZ9A 4UWDA 1Q56A 1EAH2 2GC0A 1BXHA 1GOFA 1E5HA 3B01A 1YNAA 4FTEA 4XAEA 3VV1A 4IGQA 2IUWA 3NAPC 4OQ9A 4PDWB 2XBO2 2VZPA 1XQNA 1HV1A 2EXIA 5FZFA 4P9LA 4I02A 3VHPA 4DNYA 1FI2A 2HWF2 2VUCA 3VDBA 1KEXA 4XURA 1OLQA 2ZGMA 3LKJA 4EZ4A 5FIXA 3P1IA 5IT6A 5KR7A 4NHLA 1GNZA 2JKBA 4GIQA 4QXBA 5G05L 4XCBA 2ZPXA 1WCQA 2ZKNA 4DY5A 2BDRA 4GH4B 4K8FA 1BLZA 2RM23 4AGVA 1KJLA 3UESA 4PF5A 4JX0A 1VRH1 2A7AA 2R6QA 2WN3A 2XWBB 1RTVA 3B00A 3Q9OA 3RJRA 3TN93 1EY2A 5F6KA 5FZOA 3ZVXA 4BK4A 1JZ7A 3I2OA 3AX4A 4MG2A 2VBPA 4OHYA 1D4M1 1R083 5DUVA 2A75A 4IEWA 3GYDA 2OPKA 2WSVA 1OPOA 2OQ6A 1PO22 2E32A 2QQWA 1QQP2 4LHSA 4C0HA 5AC93 2UYAA 4LBQD 5BYNA 2BRTA 5CBLA 1V6JA 1WMEA 3O7OA 3J8F1 1WA4A 3WHTA 3I2KA 1VALA 4TYSA 2CGNA 3D3AA 3FBYA 3ZN5A 4DO0A 4G3YC 4CZSA 1ULOA 3R4SA 5BNNA 1PIV1 5KC6A 4AVSA 1DGWX 1ZZ7A 4G4FA 4GH4A 2MPFA 1AR72 1U5IA 2HWD1 2V09A 4XJZA 2HWB1 5DZEA 5GLVA 4CDQB 4WM7B 5C8CA 4Q4Y1 3AP5A 1Q8PA 3PUSA 4RGGA 3F2ZA 2DUQA 1URXA 2YBKA 4RQPB 2PQQA 3LQCA 2JDYA 5F6LB 3UKNA 3BU0A 2BFUS 3H0OA 4BU2A 4N53A 3CJIA 4YVSA 2WWUA 2EIDA 3VD4A 4IGPA 2WNEA 2WNVB 1T6GC 1UY0A 2WZR2 1G86A 2DDUA 3Q8EA 2YC4A 5DDJ2 3NJVA 1JYXA 4Q4X2 4E8DA 3KMHA 5C70A 4I3GA 3I49A 2HH9A 4I0WB 2JE7A 3PTYA 4WM7A 2RHPA 2YPDA 3POGA 5JVVA 4PIZA 4OMDA 1MQTB 1CAXB 5T5OA 4H2AA 4AVTA 5FPXA 1RUE1 4PI0A 3DKQA 4Y1VA 3M3QA 5FP3A 5CISA 1DQ6A 3C7GA 3DL3A 3MIEA 5FLJA 1UZ0A 2J1TA 4N9IA 4IV3A 1ZBA1 4QX2A 4RFT0 2WNVA 3RYKA 1AF9A 4JGZC 1VBB1 2JG8A 3VD7A 1XPWA 5J37A 1OD5A 3Q8FA 3M2MA 4BWOA 4Q2FA 4E4SA 5C9AB 3ZYJB 2RM22 1MQTA 4QD2A 2ES3A 2XQRA 1ZZCA 1GP5A 1ULDA 4XXPA 3TN92 3ZXKA 2CDOA 3AFGA 3T2OA 4URAA 4J25A 1FMD2 3K2OA 1UAIA 1R082 1W2AX 1YO8A 3CMGA 1W6MB 1QJU3 1U0AA 3MICA 1JYNA 4CXYA 1QDCA 3RZLA 2JDNA 2MNGA 4RHV3 3W5MA 3ABZA 4LBLA 4FPHA 1OOPB 1I6XA 5FXVA 4N7IA 3RNSA 5K8SA 5LBEA 2WSUA 2ID4A 2VVDA 4CCLA 3BPSA 5I0RA 4M3CB 3USUB 1NQJA 4GWNA 3OGJA 3BIEA 1US2A 1VAVA 3HN1A 2NZ9A 4FO9A 4NIAA 1K5MA 1E5RA 2W9XA 5FZMA 3KGZA 3E6DA 4UW4A 5BNOA 2ZHKA 1JU4A 4UW5A 3RI9A 1P8JA 5F39A 3WF3A 2AZ5A 4CTEA 1DQ5A 1XBFA 4B4PA 1YFXA 2UWAA 5EV7A 2UYBA 4CDWA 3IMMA 1LOFC 2W94A 4N43A 4YM0A 4LPLA 3J7LA 2V73A 5C8WA 1RUF1 4UW6A 2X29A 4NHXA 5EJ3A 5C3OA 2IXJA 5L9RA 4M3CA 3SEEA 1UF2C 3OBAA 4XIKA 4CDQC 1OURA 1IHMA 2WZPP 2RS11 3OY8A 1GYKA 1POV0 1W2NA 2D6OX 4QHZA 5A7NA 4CEYB 4EJRA 2WAOA 4NUBA 4NPLA 2XJRA 4RQPC 1V9U1 5JCTA 1H4HA 1QXJA 5EZWA 2JD4A 4R9DA 4AFAA 1NZCA 5LA0A 3GZTB 4Y3OA 3BU7A 4HSJA 1W90A 2A5ZA 5I8YA 1VBE1 3I59A 3WW1A 2PHFA 4LK7A 4HG6B 4CUBA 3ZFEC 3NKTA 3AKQA 1YIPA 2WR9A 5T5JA 3IN9A 5J3UA 2D7FA 3AJZA 4HN0A 3WXPA 2Y26A 1M4WA 2W95A 1JHJA 4DQAA 1QMJA 2QQLA 4QB6A 3T1MA 1PGL2 4OMCA 5FZ3A 4CEYA 2LALA 3WDXA 2BEOA 1NQDA 2ENRA 4ZU7A 3MI8A 2WQZC 2JDKA 2UWBA 3FHIB 3DN7A 3K51A 1N1YA 4HL0A 1YFWA 4LO8A 2DV9A 5I91A 1QJU2 5IVJA 4WZCA 2H0VA 1VIWB 4N7UA 4RHV2 3ZYRA 4JRAA 1W8WA 3AL6A 5JAXA 3E6CC 5C9AC 2W92A 3AL5A 3IBMA 4MXVA 3ACHA 3TNPB 4FQZA 3VBSA 1ND3A 3WP4A 3NJXA 1TMF1 1WBLA 1W6NB 3MGUA 5A3PA 3WD5A 3LEIA 4EQVA 1IS6A 3LOBA 2GMMA 5FLHA 4Q8KA 3U78A 2ZX0A 1RITA 5A1LA 1LODA 5JXGA 4E27A 3BTAA 1RINA 5G04L 3B69A 1OT5A 3A7QA 1GP4A 1O5UA 4L11A 1IPJA 4BOWA 3HT2A 2JG9A 4COZA 1BMV1 2WL1A 3GALA 2AYHA 1OOPC 2QQJA 3ZPOA 1JMUB 1WD4A 4M0HA 2X5IB 4LE3A 2WJSA 1LHNA 3ACIA 3CHXA 4CPBA 5FP4A 1PGW2 4XFFA 4DXSA 4PLNA 3WSOA 3A21A 3H3LA 3T4HB 3LA2A 1AR61 1Y9QA 4CDUB 5JR2A 1BZWA 1OXCA 2YC0A 3T30A 1L7LA 4QXHA 5FWEA 1HQNA 2ZGRA 2IFRA 4HXCA 1BEV1 3LSDA 4QPGA 2JICA 5LWBA 1XJAA 1AJOA 4QX3A 2E9QA 3NVCA 4LLOA 5F2SA 2Y38A 3ES1A 5B4XA 5JI7A 1X8EA 1YQCA 5I8TA 5L73A 4A7YA 3POEA 1O3RA 1ZRFA 1ASJ1 1SBEA 2ADDA 5GALA 2RS31 3QH7A 1NCQC 1W3VA 1Z7S3 4UFHA 4AI8A 5CG8A 1UYZA 3KCYA 1IOAA 4QAWA 3BOPA 4JQTA 5A32B 2E51A 1UY2A 1ACCA 1W8ZA 1YQ8A 3LEGA 4LBJA 4X6RB 2OW4A 5C6CA 2JE8A 3K75B 3VBHA 1WLDA 5DQ0A 1S2KA 1J3QA 2XPJA 4NIGA 4A42A 2K46A 4IDZA 3UGFA 3IAQA 5LBCA 2PHLA 4D94A 4YW1A 3MPBA 3HEIA 3P6BA 4MGKE 4OHVA 1UMZA 4NRMA 1OQ1A 4RA0A 1SBDA 1A6CA 1QOSA 3AMQA 1J3RA 4B7KA 2BGPA 3GCXA 3WY6A 3I3BA 5FJKA 2P2KA 1REEA 4I2OA 4FI9A 4Q0VA 3C7EA 1VB2A 2VMDA 2HBTA 2D5HA 2WNUB 2VJXA 3JZVA 5CADA 1CN1A 1ENQA 3N9NA 1G9AA 2Y33A 2PA7A 3I3DA 2J1UA 3WG4A 4XXAA 2XVGA 2FMDA 5KWRA 1FPN1 4XTMA 3CO2A 3ZN4A 1AYM1 5BXXA 5LA1A 3CDZB 2W47A 4RFRB 1HQLA 4R8HA 3G7DA 5LBBA 2ZGNA 4FPGA 2ADEA 2XLFA 2ZGPA 3AJYA 3RVHA 4CUAA 4HZFA 3CF6E 1K42A 1STMA 5T5PA 1AX1A 2PFWA 2WYSA 2OX0A 1X9TA 4QQLA 2J1AA 3KB5A 1NLSA 2D43A 4IXLA 5FRAA 2ET7A 3OYWA 2GP5A 5CVRA 5KXBA 1KGYA 1AZDA 3RZZA 4JHZA 2CDPA 1NY72 3A0NA 3HVDA 1NZIA 3V0AB 4W6YA 1V70A 1X7NA 3RDIA 3ETPA 4K9SA 1QJEA 4FPCA 3MPPG 1JN2P 3AP6A 1W6QB 2W52A 1HRI3 5A33B 2J7MA 1D7PM 4K1YA 4JTNA 4DXZA 2NP0A 5HCBA 1OVSA 4KH9A 2ZGKA 3GHNA 2RG4A 5LK5A 3V65A 4CCKA 1BYHA 2X5IC 2VQAA 5E88A 5FYCA 2WS93 5IFTA 2E7AA 5E16A 4A3ZA 1Z7S2 2WT1A 2ZA9A 3IIIA 2QBXA 5LB6A 1C8M1 2I2SA 1LEMA 4AFCA 3FFZA 4IEYA 4CDUC 3BALA 1HB1A 4TLFA 4MGQA 3VBRB 2TEPA 3HJRA 1RMU3 4H14A 4R9AA 5EQUA 1SG3A 4IV1B 1W39A 2EALA 3ES4A 1N3PA 1WLCA 1YLLA 2TNFA 5FO9B 2C4XA 3N9OA 4N90A 1XNBA 5FYMA 1PM7A 1HRV2 4YNIA 2Y0OA 2X05A 5EFUA 3WLUA 3KHCA 2VNOA 1LHUA 4NAOA 3IWZA 2QDRA 4GWJA 1D0GA 1CPMA 2WIIB 1ENSA 1YI9A 5IFPA 1QU0A 2UWCA 3SLIA 5KHIA 3JBG3 4IL7A 1VBA3 2JDPA 2OXBA 2UURA 2RDNA 4TLGA 3URFA 3MBWA 1ZBE1 1AYN3 3TWIA 1SLIA 1LOGA 2JDUA 4I30A 1RGSA 2XXZA 3N9PA 4OULA 3FUOA 4UF0A 4ZXEA 1DG6A 4OVEA 3W21A 3I2JA 4IV1A 2VVFA 3B3QE 1J1TA 3VBOC 4D69A 2ILMA 2IXLA 3MF6A 5C5TA 1GQGA 1V6MA 4OYUA 4XTPA 1JUIA 3MLLA 4HMZA 4FOWA 1EV13 5HI0A 1QJX3 4R4XA 2VOWA 1W06A 4OLLA 1QJY1 2WNUC 3BB6A 2BWCA 3MHZA 1YXWA 3GDBA 4HKLA 4AW7A 2RE9A 1RUD1 4P9WA 4FPFA 2FQPA 5ERLA 1N3OA 3JB8A 3HNYM 4BH9A 3ILNA 3O0VA 4XBQA 4E8CA 1GR3A 2VCAA 2Q5TA 2FDFA 4Q0UA 2VPVA 4FXKB 4XZUG 5FUPA 1YCIA 4GAZA 1Z78A 2DCZA 4Q4W1 4LLFA 5D8AA 1HRI2 3OG2A 1DHKB 3MW3A 4Q4V3 1O3TA 2XOMA 5L9BA 4U36A 4AEMA 4M4PA 4AE2A 1C4RA 2GC1A 1PO13 1RL3A 4JGYA 4LNVA 3DXUA 3OJBA 2A73B 4QKBA 4MYEA 3C7HA 4QB2A 2WS92 4L9BA 3WNPA 1CZVA 1SDWA 5FMDA 1E57A 2QUOA 3QACA 3VBUB 1RUH3 5LW9A 1RHI3 3GZAA 3AXDA 3N7MA 4Q27A 1UOBA 5I0TA 1CD3G 1RUJ1 2DVBA 1OMIA 5HCFA 4Y1ZA 3ZSJA 5BNQA 3K48A 2HEYF 3O12A 3OB8A 1RMU2 1WWYA 1EPZA 4YG6A 2Y6LA 2MEV1 4UXAA 1W8OA 2G1MA 1PGSA 3UK9A 1MZEA 1BBT1 5A1FA 1Q5OA 3VL9A 5AVPA 1GFF2 2ZOEB 2RDSA 5FMOS 4AQSA 1PX4A 2C9AA 1H6YA 2Y64A 4FCAA 2K9ZA 4JZRA 3BTYA 2WFF1 3EHKA 3N7JA 3WF0A 3JBG2 4LK6A 1VBA2 2VZSA 1JHNA 1MS1A 2B42B 5DPNA 2HYXA 2VE1A 4Y22A 4XEZA 5FKCA 3NQHA 5FMBA 1AYN2 5FY0A 1COV2 3ITQA 4LR4A 3VBRC 4MGTA 1AR91 4S2DA 1H8VA 3MFAA 4QU2A 4DMIA 2RVAA 5KHHA 2BWAA 2W68A 2X8KA 2J1VA 2EXJA 3RWKX 2JJ6A 1YEWA 3LZZA 1SCSA 2PHUA 4FFHA 5FZGA 3RZJA 1LGBA 3H8RA 5F3CA 4LT5A 2YU2A 5FY1A 1DF0A 3MYXA 1ZNPA 1SLLA 1OF4A 1EV12 1POV3 1QJX2 1UU6A 3PMEA 1S0IA 3WNMA 3GGLA 4AGGA 4HN1A 4A3XA 3JD73 4FPYA 1YWKA 3HQXA 1LGCA 2DCTA 5BNPA 1ZZ9A 4CXWA 1Q3EA 1UY4A 4L97A 4AAPA 2FMYA 5A3TA 3MUZ1 3N4MA 2Y6KA 5A7PA 2EIBA 2OPWA 3ZXLA 2A1XA 4DPNA 4LE4A 4LHKA 1GWMA 2HWC1 2NMNA 1KRIA 4LKFA 2LUWA 3Q8AA 5DG2A 4MXWB 3ZR5A 1OA4A 3KWVA 4ONUA 1PM4A 4W4ZA 1YFUA 4Q4V2 3O1VA 4XBLA 3AFKA 4CEWC 2X10A 3WT3A 3VL8A 2R7EB 5A6QA 2ZGUA 5IVYA 1PO12 2CV6A 2P37A 1AX2A 1XE7A 1NCRA 1HB2A 2D3SA 4UFLA 4LA2A 4XOGA 1GWLA 3DECA 1HLCA 1XU2A 4QT6A 1KJRA 4OHZA 4CYDA 1RUH2 5FO8B 1RHI2 5E8AA 3BOWA 2E53A 3ZIXA 2ZMLA 1EAH1 3KHBA 4FBFA 1RUI3 3DF0A 5EWSA 5IVCA 4HT1T 3SEPA 5FMOL 4AHWA 4QKNA 4CDXB 2K0GA 3PUAA 1SHWB 4PT6A 3E1F1 5FYYA 5CB7A 3K4ZA 1NA1B 1BJQA 3FHAA 1N1TA 4YM3A 3PJQA 3C2UA 2E33A 4I0BA 1MZ5A 4WVMB 1FNYA 2XBO1 4KL1A 3WF4A 1TNFA 4AI3A 1S4CA 1W8TA 5A6XA 5ABJA 4GALA 2CWMA 2PAEA 3IDCB 3K3OA 5DUXA 3WW2A 3T1LA 2YROA 2WLQA 2XR4A 3RRDA 4YSFA 3T0DA 3OD4A 2WFPA 3WUDA 3L2YA 1BVP1 2FHRA 4BMEA 2WNOA 1W6OB 4AI9A 5JLVA 5KXDA 4RS5C 1R091 4IEUA 2OQ7A 5IVVA 5LBFA 4AG4A 3CNAA 1O4TA 2ZZQA 1MPXA 4W6XA 2B39A 1OQEA 2GNMA 2OT7A 3PU8A 4ZU5A 3HMYA 1NA1A 5A7QA 2Y34A 4NOTA 3AKRA 2RMU1 3VN4A 3I2IA 2F6BA 3NMBA 5JUVA 1NE4A 1RUC1 5C4WA 4YM1A 1S2EA 3UKTA 5LRRA 1VBD3 2DFCA 3BVCA 3W58A 1CESA 4Q8LA 2VBBA 3WQ0A 2EXKA 2WC2A 1H4GA 3MIBA 3IPVA 3JD72 4H7LA 5FQ0B 5FPBA 4P5YA 4HVOA 1VMHA 1W6OA 1I9RA 2IXHA 2W08A 3OD0A 4XMIA 4M0NA 4Y20A 1C1FA 3ZKUA 1PMIA 2A6YA 4CP2A 2PQSA 1GWKA 1PO23 2QQNA 3WP3A 4EROA 3SH3A 1LTEA 1Y7BA 3IT8A 1DZQA 3O5SA 4WM8C 3UYJA 3VHRA 3VKFC 4M3CE 1UX7A 4QDSA 4ZU4A 2J1SA 1W6PB 4GXLA 5C3QA 2I45A 1Y3TA 1AXZA 4FXGB 4IE5A 1C5IA 1H8TA 1V00A 1BHGA 2WO2A 4JQRA 4YGDA 5DZFA 1GICA 1XE8A 2P3YA 3B02A 2FBEA 5FQ0A 3I3QA 4P5HA 3UGHA 5DDJ1 5FXXA 3AZZA 3ZYIB 4BCUA 3IKWA 4AQTA 1LHVA 1OLMA 2W39A 1CX4A 3T2TA 2R073 4A44A 5GZCA 4C1WA 3DGTA 3SKVA 2QQPA 2YBPA 2FZ1A 1RUI2 3N36A 2QCSB 4CP0A 1ND2B 3IZOA 4L0PA 4UFIA 1J59A 1WMFA 4ES8A 2VNGA 3H42B 2E7QA 1GNYA 4LKSA 4ASMB 4NPMA 4NRPA 3HN3A 2B4KA 2ZHNA 3IDBB 2WO3A 3PUQA 4M3CF 3OBRA 3KV5A 3RFRA 3PVEA 2YXSA 1V6NA 5E1RA 4CXXA 3MDPA 2XVLA 2RS53 2VUJA 4AI1A 2NPIA 5HV4A 1LGNA 2XJPA 4LOSA 1UQXA 4MGSA 1ZRRA 5FZOB 3HT1A 5CFCB 1TQ5A 2W1SA 1HDKA 3LPGA 4QQHA 4BQ4A 5JMCA 1MVQA 4DUXA 1XYPA 3KT7A 3AKSA 4NR1A 3ZFFA 1FT9A 4WZFA 5FUNA 4Q29A 4CDXC 1ND2A 4XYXA 3H1MA 1PK6C 1JU3A 1TNRA 1V0AA 2HEVF 3JB4C 4AHZA 1S1AA 2QQUA 4XETA 5A6YA 5FKBA 3O1RA 1HB3A 2EF6A 2HKXA 3MIDA 4QX5A 5DAPA 5FYZA 5IJRA 3T09A 3FL7A 4MHRA 2ETEA 4MHUA 2HWE3 5BNNB 1UW8A 1W04A 5ANQA 5CAZA 1W8FA 3O0XA 5FP7A 3ECQA 1VBD2 5C8CB 5AC91 3QOPA 1LOEA 1SDDB 2JB4A 4HSLA 4ZS2A 4GA9A 5CFCA 4NROA 1FMD3 5IUQA 2WAAA 2ZGQA 1KQRA 4LBNA 3ZFGC 1F4AA 2BOIA 2GC3A 2PYTA 1LHOA 3CJIB 4N53B 1ZRIA 4YVSB 3OOXA 2IFWA 4NHKA 2HYKA 2P5BA 4ZHNA 2XJTA 1HQWA 3M1HA 3H50A 5FPUA 2Q8OA 1CX1A 4YW3A 2BYVE 1LNSA 4QQPA 5EJ1B 4YZ1A 4YW2A 1O4ZA 3SQOA 2NQYA 1F35A 2YYOA 3VZMA 1GZTA 2RJKA 4CU7A 5DUWA 2FCVA 4ZONA 1XOYA 5GKAC 1JS9A 4Q26A 5FOBB 3KT1A 2QKDA 4YZ4A 4AVVA 2IXIA 3R05A 2R072 3WZ1A 5TSWA 2X53S 4IV3B 1OKQA 1VRH3 2LROA 3MZHA 3KSCA 2C24A 1X36A 2XUMA 3GXUA 5E89A 2JG8B 3PMSA 3FC0A 3ZX7A 4Z2AA 4AEKA 1F4HA 3CLPA 2FD8A 3ZN6A 3DPRA 4XFAA 4AFBA 4KU7A 3WHUA 4EN8B 3ZXJA 3AMPA 3K77A 4MGIE 4OI4A 2XJVA 3SCHA 1JW6A 1N1SA 4FPLA 3J8F3 2Y0IA 4GJZA 2RS52 5FXWA 4ET7A 3POFA 3RMXA 2ORXA 4CCOA 2QQOA 4EWAA 4CSWA 5JXJA 2WUHA 1G6NA 1NG0A 3LSEA 4KQ7A 5IVFA 1SQ4A 4WVZA 1XYNA 4YG3A 2W91A 3NV4A 5LASA 4BQ5A 4XQDA 3AMNA 2DVAA 5FZLA 1H9PA 4MGZE 4PQ9A 5FP8A 1YQ5A 5A7OA 3ZOIA 1LAJA 3VBFA 2WQ4A 4LJHA 3LGRA 2AEZA 4GKYA 4XUTA 3WNNA 2HWE2 1O3QA 1LULA 1CIYA 4QHOA 1S0DA 1OHFA 3I3MA 1E5SA 4GJYA 3VGIA 5B4NA 2VW0A 2XMLA 4A6OA 3I2FA 1H1IA 1K5MB 2I74A 3SH5A 4PDWC 5BNOB 4V2VA 5FY7A 4YVWA 1UOFA 3U14A 3J9SA 1UZZA 3D0SA 2VOTA 3AZVA 3W9AA 2H0BA 3VKNA 2R043 3B9IA 4XUQA 2NLRA 1RUE3 4CDWB 4FTBA 3JXSA 4N43B 2V72A 4PCRA 4P9GA 3U75A 3LA3A 2O1QA 4GH4C 3HPNA 2A3XA 2BGOA 4EYUA 2RR11 4FAGA 5C8CC 2CNAA 5FYSA 1VBB3 1AL21 2B8MA 3OY8B 4F8AA 5JXHA 3CBNA 5JR7B 3THCA 2X09A 1C1LA 2EA7A 4Q5OA 2GP3A 3V56A 2CYFA 4N53C 3CJIC 4ITCA 2O14A 1Q8SA 3AVRA 1ULGA 5J1XA 1VRH2 1AR83 1C8NA 4XF1A 3TOJA 1MR5A 3GCWA 3I59B 4GB31 1NOVA 3M3OA 4RR3B 3F95A 1F5JA 4HFSA 3ZSLA 1W3XA 3VLBB 3POBA 4MV2A 1EUUA 4WM7C 3IDAA 1Q8OA 2SLIA 3CQOA 2AGSA 2J1RA 3LDKA 3KLSA 4GMP1 2O8OA 3J8F2 3QH6A 4CCCA 2VXRA 4CUCA 1C3HA 5IYYA 5L7OA 4BB3A 3E6BA 3WG2A 3RZKA 1S0CA 1AHSA 2V5YA 1GZCA 3KF3A 4LMFA 2OKXA 4FSJA 4IV3C 2VXJA 4EN0A 1Y9GA 4Q4Y2 2WNVC 3RMYA 4BXSV 3T0BA 4RR3A 1B35A 4WBBA 4EWDA 1ODNA 2JG8C 3S30A 4FOYA 4DRVA 5J09A 3U0ZA 1JZ3A 4FQ4A 4LEJA 1LCLA 4MLOA 1QOOA 4AQ6A 2GN3A 4C1XA 2VECA 1RVF1 4A4AA 1UY3A 1UKGA 2DVGA 3SCGA 2ZGSA 1V6KA 2FDIA 3VBSB 1F15A 1MQTC 2P17A 1ND3B 4IUGA 1GQHA 3P3NA 3BTZA 1S55A 2QDNA 4D7YA 1RUF3 1RC6A 4BHPA 2VOVA 5FZIA 1ZA4A 4D6QA 3WNLA 2KA3A 4FFIA 1OH3A 2PHDA 4O65A 1W0OA 2VY0A 5KHJA 2RS13 2BW8A 3FLRA 3LCPA 5T50A 1F2NA 2R042 4NIDA 4HKWA 3OTFA 3HNMA 5HBAA 1RUE2 1YFYA 2JG9B 1R1ZA 1D2SA 4I0AA 3UKVA 1XSQA 2TBVA 1NCQA 1TZOA 4JC1A 4UT5A 3NV1A 5DAXA 4I09A 1MEC3 1XNTA 2VMEA 3GBWA 3WCSA 4URTA 4NWWA 4ZS3A 1VBE3 3BGAA 4LBQA 4XDQA 5FPLA 5FYUA 2A6ZA 1VBB2 2L9LA 3ME2A 3C7FA 1AUYA 4E2GA 4K40A 2ZGOA 1ZX5A 1K5MC 4B1LA 4QGLA 1W99A 3JCIA 1XB9A 2WZEA 2ZGTA 2CGOA 5A3WA 5BNOC 1LESA 2R1BA 2W46A 2ZX3A 5CA6A 5CFDB 2YMZA 3EJKA 3IAPA 5A3OA 1PVC1 2RJ2A 4QPGB 1UU4A 1POQA 1AR82 1H30A 4GKXA 4AZZA 4CDWC 2VOKA 2PN5A 4N43C 4H7MA 4NRQA 3ZYPA 1WA6X 5LATA 1O8PA 2EVXA 5F37A 5GZDA 2G19A 1A78A 2D3PA 3KCXA 5ACA1 2BNNA 1S0JA 3J7NA 4JRLA 4W50A 2CAUA 4S2FA 5GLUA 5H9SA 1OQDA 5F1RA 4P9YA 2D44A 1O59A 1QXPA 3I8TA 3LAGA 4QPIA 1L7QA 2XDVA 3VBHB 3N9QA 5A6ZA 3THDA 5CFDA 5EJZB 5IVEA 1TMF3 4E4HA 5SV5A 2EAAA 3OEBA 1Q8QA 1LEDA 3N7LA 1NE6A 1NXMA 3MEPA 1T6BX 2VMFA 4CU9A 1CAUA 4TSVA 2W87A 3AZXA 3C3VA 3BTXA 3H8XA 4YGBA 2D40A 4OUSA 2D5FA 5IW0A 1QHDA 2JE9A 2P4EA 3TRSB 3THPA 5HCHA 1CAWA 5FAXA 4CEYC 5APAA 2IXKA 3BI3A 2Z42A 5A3LA 1LRHA 2WA3A 1AL0G 1RUF2 1TEIA 3RSJA 1W9WA 2YU1A 3LIHA 2RV9A 3CIHA 1IQDC 1JODA 1H2KA 4QGMA 4UYBA 4UFMA 3PHMA 4GQ7A 1UNBA 4XMAA 5F3GA 2RS12 2R30A 2XQXA 1HRV3 4META 1AR63 2R1DA 3FN9A 5GLZA 3ZKYA 1M06G 3ZMOA 1DYPA 4P02B 4MGYE 1V9U2 1T2XA 2KM2A 2LW8A 2XONA 3ZDVA 3BUCA 4Q1PA 1IS4A 4JVAA 3QCWA
chains in the Genus database with same CATH topology
1MS0A 1BEV3 1MZFA 2ZACA 3OYWB 1MEC2 4YFWA 2ZGLA 3VBSC 2YY1A 4J6GA 1VBE2 3RQ0A 1AVBA 3AKPA 2DTYA 4KNCA 2RS33 4NVPA 2QFEA 1O4YA 4ZXKA 2CGPA 1IPKA 4XIOA 1GZ9A 2JG9C 4LBKA 1SLCA 3H3ZA 2OIIA 2HJIA 1MVEA 4YM2A 2GMPA 3WP5A 2GSYA 4WVVA 4U2AA 2BUKA 1YUDA 4MVTA 2VU9A 2DYCA 2VQ0A 3V0BA 3LOIA 5H9RA 3VBOA 1KITA 2WS91 4YZ3A 1IS3A 2YHJA 1G9FA 1DZRA 4UBHA 1TMF2 4MZUA 1IS5A 2NN8A 4AXOA 2MHFA 3POWA 2A3YA 2DCJA 3WG1A 4LO4B 2E7TA 1Q8VA 5KBFA 2C1FA 2Z69A 1FX5A 2XH6A 3U11A 3WQ7A 1CR7A 4ATEA 1QXRA 3FLPA 1SACA 2GDFA 1YIFA 1KS4A 2OZJA 4IEVA 4YLZA 3VBHC 5JIAA 4AI0A 2YV8A 3OCPA 4YG0A 2EAKA 3SXWA 1SMVA 2E6VA 5LRSA 2VMIA 2PHRA 3S0MA 1AYN1 5JPMB 3H7JA 1PZ8A 3D4KA 3D5OA 2VMHA 5AFEA 1AR62 4Z92B 1APNA 1VBC1 3ELNA 2QZ3A 3MLJA 2PELA 1IQAA 3PLQA 3MIFA 4R52A 4Y4YA 1BEV2 3PVBB 4DZGA 4AEDA 1COV3 1HX6A 3S7EA 3ASIA 4IQPA 3VKOA 4MH0E 1QF3A 1SLBA 3SNMA 1FNZA 3FJSA 2RS32 4B4QA 2GH8A 2P3IA 2XGXA 3FZ3A 1C8M3 4K7JA 5D8AB 3OF1A 3AB0A 4XW3A 2WINB 1JBCA 1LJ7A 2PAMA 2H6BA 1PHMA 4JGYB 1G9BA 4LUKA 3KD4A 1FYUA 1OA2A 1DBNA 4P9IA 3BODA 3R4UA 1OSGA 2UY8A 3BPZA 1ONAA 4IERA 4S2HA 4C0BA 1H2MA 4YZ2A 1UIKA 4HPKA 1RHI1 5K0UB 1BQPA 1OI6A 1R1A1 1FPN2 2XJUA 1QWRA 1AYM2 1DGRA 3KT4A 3MLKA 4OHWA 3OBTA 4XF4A 3FUQA 4YZ5A 5KXCA 3TYJA 1ZZ8A 2E63A 2YUEA 1XYOA 1IKPA 4Y22B 4K21A 3WCRA 3WQ1A 4C90A 3NJZA 3DKWA 1RJ8A 3WV6A 4OI0A 1QJY3 2OUJA 3L9JT 1A8MA 3KQRA 4IEZA 5K0UA 1S0GA 3VDDB 4AHXA 1RUD3 1PNGA 1YRZA 5H9PA 1LKNA 1J58A 3FBMA 4E9KA 2R063 4BM8A 1QDOA 2DFBA 1Q43A 5JIUA 4EN7B 4S2GA 5BNPB 4D3WA 1F9KA 5JPNB 1C57A 4IV1C 3ZO0B 5FO7B 1YI7A 1F8VA 3FE5A 4Z82A 3VDDA 1CIWA 4Y24A 2DTWA 1RUJ3 1C8M2 1YHFA 1HV0A 2PHTA 5JZGB 1RUG1 4KBBA 4JDOA 2MEV3 2XLGA 4CP1A 1NCRB 4O9EA 2EIGA 3MW4A 5T55A 1I5ZA 1TME3 1V6LA 4L2NA 1O91A 4DY3A 4JCKA 2FZ2A 5FCCA 1CAVA 3SMHA 4YARA 2D98A 1HXS1 4MSVA 4YGCA 2WFF3 3H9AA 4JV4A 5CU1A 4XFCA 3MIHA 4LTAA 1JH5A 3E97A 5D8AC 1RUNA 2BVVA 3H7YA 5JZGA 2TUNA 4LBMA 1AR93 2DCYA 3DV8A 5F5QA 3VHOA 2PLV1 3G6JB 4JGYC 3WUCA 5ABJB 3FLTA 3I7DA 5AFBA 4XHXA 3WW4A 2BQPA 1QH7A 4LO5B 3WDWA 2NM1A 4AVBA 4TZDA 1N3QA 4AVCA 4XF0A 4FAHA 2ZABA 4AYUA 4A2UA 4BIFA 1QJY2 2ARBA 1MS8A 3UV9A 5FPZA 4YRDA 1RUD2 1QJZA 1DGWA 3SITA 2CY6A 2IZWA 5C4WB 4UW3A 2HWF1 1UD1A 2R062 2HWC3 2WT2A 4E2SA 4Q4W2 2ZHMA 3VBUC 1CONA 3LA7A 3IPVB 3NAPB 2XL7A 4XJ8A 1WW5A 3DUIA 4IEXA 3POYA 2GALA 3ZXFA 1OFNA 2W0XA 4Y20B 1FAYA 2XG3A 2NYYA 2XL9A 3WP6A 5B2GB 5IK8A 3ZXAC 2P3KA 1GZWA 1NYWA 4B8EA 2GMEA 5JSPA 2QZ2A 1RUJ2 4RD7A 4G9SB 1H2LA 3AKTA 1HKDA 1MS4A 3S7IA 1G9DA 4TWTA 2OVUA 5LEJA 1H9WA 1SLAA 1UU5A 1PO21 1QQP1 1JYCA 1H8TB 1WMDA 3RG0A 2MEV2 4FVVA 3HBZA 3NAPA 5BNPC 1TME2 1FATA 3X29B 4DB5A 1FOD3 2OUHA 1AR71 2ERFA 2CAVA 4MUVA 4RSUA 1SFNA 2WFF2 5FLIA 4E2QA 2Z2SB 3MF9A 1BK1A 1Y43B 4DINB 4KG0A 1D2QA 1U5ZA 1GV9A 1R093 2A6VA 1AR92 2R071 2Q1MA 4Z07A 2N7GA 4D7TA 4IEQA 1LU1A 4AHYA 1NCRC 2IWGB 2WZR1 4ISRA 4QM9A 3TNQA 1VAKA 3NV2A 2RMU3 2D6NA 4Q4X1 3ZFGA 1RUC3 3N7KA 4H55A 1SCRA 1EPWA 5K7PA 3WDUA 2RJLA 3ZFFB 3VZLA 4Z8BA 3IDEA 3E5UA 2B45X 2F4PA 3MFCA 3JQXA 4A7ZA 5FOJB 1X50A 4FPOB 1W0PA 3RWNA 4ASLA 1MS5A 1ULEA 1YJLA 3VZJA 2I07B 4AQ2A 5ABJC 4KWKA 2ZMKA 3H3UA 1LU2A 2HWC2 2IC1A 4HLTA 4OUMA 1GANA 4LO6B 3N35A 3UJQA 5LK7B 4H3WA 2BNOA 4AF9A 2RM21 3M3CA 5EXOA 1ULFA 1S2BA 2O8QA 5F9TA 3TN91 1NA1C 3M4FA 1ALYA 3U07A 4AI2A 1FMD1 1R081 1N1VA 3BIWE 1IKQA 4IEOA 1WLTA 5C4WC 3NV3A 2WWSA 4KGGA 3KGLA 4LA3A 4QQ2A 2Z79A 4XILA 2Q1ZB 1O5LA 2ET1A 3D8CA 1W2UA 4HBNA 3AXEA 4Y1YA 1BMV2 1FOD2 4JGZA 5SV8A 4M00A 2D6MA 1L3JA 3ROUA 2VG9A 2XKPA 5CG9A 3M3IA 4PIYA 4XJ9A 1R092 3ZN6B 3DPRB 2ATFA 3BCWA 3FX3A 1H8TC 3TAYA 2G9GA 4W6WA 1RJ7A 4PDWA 2RMU2 3ZIWA 4YGEA 1RUC2 4Y26A 3VZOA 3I4IA 2GN7A 2ZKLA 1C28A 4XFBA 3WX5A 4INDA 2YGMA 3PJYA 3R6SA 4KWLA 3IIAA 3S6PA 3ST7A 1JTZX 1D4M3 4XF3A 1FV3A 2DUPA 3VBFB 3RI8A 1N47A 3HAGA 4QPYA 5JDBA 3WVJA 2NMOA 4BYYA 2GNDA 3PVNA 4XJWA 2ZTNA 5J36A 3B93A 2JEMA 1PIV3 4HETA 4NN0A 4HVQA 2HWD3 3U4XA 2CTVA 5HXVA 1KD7A 2HWB3 4YVWB 3ZFFC 4GULA 4YFZA 4Q4Y3 4XJAA 1ND2C 2AR6A 4XFIA 1PGL1 1LOFA 2EXHA 3P3PA 3ZFEB 3JQWA 2OA2A 2XJSA 3ZSEA 1JXNA 4CDQA 5GJ6A 2B7YA 3AYDA 4J1WA 1QJU1 1S0EA 4K20A 2R041 3SCFA 4BLJA 4RHV1 3VKLA 4RQPA 3AP7A 5CFCC 1XNDA 2JECA 3O14A 5A3MA 5JOZA 1LR5A 4KG8A 3RPQA 3THTA 4WV8A 1UPSA 2HEWF 3AP9A 3VZNA 4K3UA 3ZFEA 1QNYA 4QMAA 1RIRA 4R9BA 3H1WA 2YGLA 2A6XA 5I93A 3AK0A 1O3SA 1UZYA 1HIXA 1ZBA3 4I01A 5BNNC 1XRUA 2VH9A 4YYOA 3MIGA 4YW4A 3ZSMA 1CAXA 4JTOA 1AR81 2XKOA 2VW1A 4AFDA 5BY5A 4HVRA 3HD8B 5L7OB 3GHMA 4YVSC 1PGW1 2A6WA 1MACA 1QNWA 5AC92 4O9GA 3MW2A 4RGAA 1QKQA 3INAA 1B35B 3VUOA 1D4M2 4HKOA 1WW6A 4OHXA 1O7FA 2BFUL 5C9AA 1ZVFA 3DPRC 5JOYA 2G4IA 1DGRN 3ZPYA 1WGPA 2Z5WA 2JDZA 3WNXA 1PIV2 1VR3A 1W6MA 2HWD2 2RR13 2HWB2 1Z0HA 1WW4A 1AL23 1KS5A 2ZAHA 1G9CA 1UPIA 2Q4SA 1OOPA 4AGRA 2DVFA 1UIJA 4E4ZA 2YDEA 3VBFC 3USUA 1NCQB 1ZYBA 2B46X 1V6OA 4IESA 3OGGA 4YW5A 1S0FA 5LEKA 4XE9A 1GLHA 2P3JA 2ZZJA 4LBQB 4GB33 5JOWA 2BVBA 3ZYGA 2GAUA 1NXD1 3A4UA 4PBOA 4YVWC 2DU1A 4WVWA 3RYRA 1FXZA 1MEC1 4C91A 2XVKA 4K6BA 3USSA 3KM5A 5KC5A 4GMP3 2ZMNA 5JSRA 5FREA 1F31A 3WW3A 1FV2A 2D6KA 1V9U3 4AEJA 4FPJA 4DRRA 4BQ1A 4ES9A 2LTNA 3H1YA 3RS6A 5IK5A 1ZBA2 3M70A 1JUHA 3TBDA 3ZDSA 3WG3A 1MS9A 3IMNA 4P9JA 4Y1UA 1RVF3 2XJQA 1LB2A 2GU9A 4QPIB 1HW5A 2PTMA 3E5QA 1WW7A 5FFOC 2ZBJA 3EXUA 1LOBA 3CU7A 1KDKA 2VOXA 4QGNA 1ZREA 1NY71 4B3NA 1CAUB 3AYAA 1REDA 1X82A 5J48A 3WDYA 4A7KA 4FP2A 3N3HA 5CNAA 3QLQA 1BCXA 3ZXDA 1CAWB 4F7ZA 5L7OC 3B94A 3J26N 1Z7S1 2RR12 3NO8A 4OZXA 1AL22 3ATGA 2BGCA 1UN1A 2WKKA 4RR3C 1B35C 1IZ3A 2BTVC 4KU8A 1PZ7A 2D93A 1BKZA 2ZCWA 1PVC3 2BNMA 1W6NA 1ZM1A 2R49A 5KHKA 1GSLA 1HRV1 4DS0A 4L92A 2A71A 1QOTA 4GB32 5T54A 3HIFA 3ILRA 1XU1A 1NLRA 3ETQA 4Q0SA 3V64A 1LHWA 1UCXA 4IEPA 5ACA3 2BPA2 1X33A 3EO6A 3UJOA 3VZKA 5J7MA 3RJ2X 5GZFA 4FPKA 1I1EA 2X5IA 3VHNA 5JWPA 2R0FA 1DQ2A 3PVOA 1V6IA 1LENA 1ND3C 1REFA 4XFGA 4CDUA 1U5XA 5I8SA 1OPMA 1ASJ3 4FOVA 1PVXA 3V0BB 1DU3D 3VBOB 1RVF2 2ZS6B 4LO7A 3ACLA 4EN6B 5T5LA 4COVA 1B09A 1H1MA 1BVVA 4K1ZA 4F3JA 4Q0QA 4PJYA 1OFSA 3B7MA 5EYYA 2JENA 2ZJCA 4BPZA 2IXCA 5A32A 1HRI1 5GZGA 1RB8G 2XB6C 4FP3A 1ULCA 5HCAA 4XF9A 5IK7A 1QY4A 3WINE 2R32A 4QPIC 2DVDA 5CFDC 4L99A 4BMBA 2B5HA 2ZX2A 4QPGC 1YJKA 2ZX1A 1FPN3 4LUMA 2LM3A 2G9FA 1DQ0A 2VVEA 1AYM3 1RMU1 2ARXA 1WD3A 2WNUA 4COWA 4LHNA 1WCDJ 3I2DA 3AZWA 2R16A 1PVC2 3AZYA 4AEDB 5FDBA 4Q0PA 3R0RA 1C5HA 3CL1A 5T3NA 3NSTA 4DFSA 2DURA 5DXDA 4LULA 2DU0A 5ACA2 3JBG1 5D1IA 1VBA1 4W65A 3HWJA 3J4UH 4BIOA 3TB0A 2WA4A 1COV1 1D0HA 3SHRA 1MS3A 3SH4A 4B29A 2D3RA 5J98B 4BLIA 4COUA 5DUUA 4XBNA 4FT8A 2KXLA 5FBZA 5GLTA 1EP0A 1JYIA 4HK9A 4P14A 2UY9A 3V0AA 4OFGA 1VP6A 1A8DA 1ASJ2 1EV11 1QJX1 3W59A 3I54A 1W6QA 1D4VB 2DCKA 5A33A 5L36A 2Q30A 3AM2A 5DG1A 1CQ9A 5BV6A 1WCSA 4HPKB 4XZPA 3VKMA 1RUOA 2AREA 2Q0AA 3UL2A 1CGPA 3AYCA 2ZAAA 3WR0A 4X6QB 2AENA 1U5YA 1I3HA 4BZ4A 1CPNA 4E4DX 4JDNA 3VBRA 4Q4V1 3LWCA 1VBC3 1VB4A 2A3WA 1AX0A 4Z2WA 3O0WA 4P9XA 1DQ4A 1PO11 1X8MA 3D6EA 2AUYA 3OPZA 1ZBE3 4PBPA 1RUH1 1H1AA 4L8QA 2QJVA 4Y1XA 4CEWB 4ISQA 1A3KA 5I0UA 4Z1VA 4Q1RA 1S0BA 3KCCA 4NPRA 3CJXA 3IM0A 2A70A 2GNTA 2CL2A 5L19A 3WDVA 1CJPA 1GKBA 4LBOA 4PLOA 1KXGA 2R061 4XQ4A 3AP4A 1SBFA 4COYA 3NKGA 2AH2A 2GNBA 1AJKA 4XFHA 1VJ2A 1KFXL 1XXNA 1H2NA 1DLLA 4CEWA 1KFUL 1SLTA 4NO4A 3FWEA 4IETA 1DFQA 3ILFA 3GBFA 1F5FA 1DIWA 2PHXA 4EN9B 1LECA 4Q4W3 4HK8A 1ZZBA 3JU9A 2B9UA 4DOUA 4AEDC 1R1A3 3GNEA 2XLAA 3EBRA 4OI1A 4PIXA 4RS5B 5J96B 1CAVB 4JDMA 3AMHA 2DWRA 3CEWA 3EQEA 1POV1 4KGQA 4OI2A 3JD71 2OYZA 5GZEA 1TME1 4CRQA 1IGOA 2VW2A 1ZZ6A 3WDTA 5AVAA 3E5XA 3VBUA 4GWMA 3NW4A 1BBT3 4QM8A 2O0OA 4XPVA 4RS5A 1VBC2 2QE3A 4QXKA 2UU8A 2DUOA 2QVSB 3AYEA 3B9CA 2R0HA 4J1XA 4WM8B 2VMGA 1PZ9A 2VULA 3PNAA 1ZBE2 3ALQA 4GMP0 2H6CA 3GBGA 1RUI1 1UKRA 4HANA 4AVAA 3ZXEA 1WCKA 3KS7A 4B4RA 3NWKA 4ORFA 2QNKA 1JOJA 1EYBA 5EYXA 1RUG3 2VUAA 1PNFA 1DDLA 3GF6A 4WM8A 5CIRA 3NL1A 4LHLA 2JX9A 1GZWB 2CWSA 5K0UC 2C0ZA 5DZGA 1CJDA 4ATFA 3B5LB 1HXS3 1GNHA 4QHBA 2YPJA 4QQOA 2ZHLA 1YYNA 4XJUA 3RYPA 4FTSA 4SBVA 2WLPA 4JAAA 1R1A2 5FTTC 1WBFA 2PLV3 3WOGA 5BUVA 2K2SA 4FPEA 5K9YA 1QGLA 1VBD1 1PK6B 3M8LA 4MXWA 4MX3A 3VDDC 4BE3A 4EWEA 4EV0A 5BPXA 3FMGA 1EAH3 1TE1B 1FOD1 1UL9A 1G8WA 3GZUC 4N9HA 1WLWA 2VGDA 3ENRA 1J1LA 1OLRA 4FOQA 4X8PA 1OA3A 2GH2A 3FFQA 3M7AA 1BBT2 2WT0A 4F83A 5I0SA 3ZFGB 1ZRCA 2XBO3 1XNKA 1ZRDA 4CDXA 2HWF3 1J3PA 4X8NA 2SBAA 3D0JA 3HR9A 1PK6A 4I3PA 5CG8A 3L2HA 2D97A 1VAMA 2D6LX 2YZ4A 4RL7A 1DZTA 3AMMA 1WUVA 3POSA 2P34A 4WVMA 5JZGC 4V1PA 2PAKA 3M3EA 5IK4A 4PLMA 4BA6A 1QH6A 2OZ6A 3QD6A 5GLWA 1DQ1A 1ENRA 4Y5Z0 1U12A 1UX6A 4D7SA 3ZMNA 5GM0A 5JSOA 2VNRA 1MZ6A 3R4DB 2DF7A 4AWDA 1RUG2 3LB9A 4AK3A 1QQP3 4ZKTB 3A0KA 4R4ZA 2GZWA 1XNCA 4NWVA 2PHWA 2RS51 1G7YA 5H9QA 1LOCA 1H0BA 4NHMA 4XHBA 1GBGA 2D6PA 3KZ4C 3ZSKA 1AR73 1CVNA 1LOAA 1AXKA 5T52A 2ZX4A 1HXS2 3U10A 3QBQA 1KDMA 4M01A 4R9CA 2JXAA 4AFMA 2BBVA 3SISA 4KWJA 1SEFA 2GC2A 1ENXA 1SFYA 4XQWA 2XHKA 2HWE1 2PLV2 2XWJB 4JGZB 3JUUA 2WZR3 3D82A 2C5DA 3APBA 3ZXGA 5JOXA 1AXYA 3H8UA 4SLIA 4UBGA 1VLNA 4B7EA 5DDJ3 1W6PA 4Q4X3 1DYKA 1DGLA 1Q56A 1EAH2 2GC0A 1BXHA 3B01A 1YNAA 4FTEA 3VV1A 3NAPC 4PDWB 2XBO2 1XQNA 1HV1A 2EXIA 3VHPA 4P9LA 4I02A 4DNYA 1FI2A 2HWF2 1OLQA 2ZGMA 3LKJA 5IT6A 4NHLA 1GNZA 2JKBA 4GIQA 2ZPXA 2ZKNA 4DY5A 4GH4B 4K8FA 2RM23 4AGVA 1KJLA 4PF5A 1VRH1 2A7AA 2R6QA 2XWBB 3RJRA 1RTVA 3B00A 3Q9OA 3TN93 3ZVXA 1EY2A 5F6KA 4OHYA 3AX4A 1D4M1 1R083 5DUVA 2A75A 4IEWA 3GYDA 2OPKA 2WSVA 1OPOA 1PO22 4C0HA 5AC93 1QQP2 5BYNA 5CBLA 2UYAA 4LBQD 1V6JA 1WMEA 3O7OA 3J8F1 1WA4A 3WHTA 1VALA 4TYSA 2CGNA 3FBYA 3ZN5A 4G3YC 4CZSA 3R4SA 5BNNA 1PIV1 5KC6A 4AVSA 1DGWX 1ZZ7A 4G4FA 4GH4A 2MPFA 1AR72 1U5IA 2HWD1 2V09A 4XJZA 2HWB1 5DZEA 5GLVA 4CDQB 4WM7B 5C8CA 4Q4Y1 3AP5A 1Q8PA 4RGGA 2DUQA 1URXA 4RQPB 5F6LB 2PQQA 3UKNA 2BFUS 3H0OA 4N53A 3CJIA 4YVSA 2WNEA 2WNVB 1T6GC 2WZR2 1G86A 5DDJ2 4Q4X2 3KMHA 4I3GA 4I0WB 2JE7A 3PTYA 4WM7A 2RHPA 5JVVA 4PIZA 1MQTB 1CAXB 5T5OA 4AVTA 5FPXA 1RUE1 4Y1VA 3M3QA 1DQ6A 3DL3A 5FLJA 3MIEA 4N9IA 4IV3A 1ZBA1 4RFT0 2WNVA 3RYKA 1AF9A 4JGZC 1VBB1 2JG8A 5J37A 1OD5A 3M2MA 4BWOA 4Q2FA 4E4SA 5C9AB 3ZYJB 2RM22 1MQTA 4QD2A 2ES3A 1ZZCA 1ULDA 4XXPA 3TN92 3ZXKA 3AFGA 1FMD2 1UAIA 1R082 1YO8A 1W6MB 1QJU3 1U0AA 3MICA 1QDCA 2MNGA 4RHV3 4LBLA 4FPHA 1OOPB 1I6XA 4N7IA 3RNSA 5K8SA 2WSUA 2VVDA 5I0RA 4M3CB 3USUB 1NQJA 4GWNA 3OGJA 3HN1A 1VAVA 2NZ9A 4FO9A 1K5MA 3KGZA 3E6DA 4UW4A 5BNOA 2ZHKA 4UW5A 3RI9A 4CTEA 2AZ5A 1DQ5A 4B4PA 1YFXA 2UWAA 5EV7A 2UYBA 4CDWA 1LOFC 4N43A 4YM0A 2V73A 5C8WA 1RUF1 4UW6A 2X29A 5EJ3A 2IXJA 4M3CA 1UF2C 4XIKA 4CDQC 1IHMA 2WZPP 2RS11 3OY8A 1GYKA 1POV0 2D6OX 4CEYB 4EJRA 4RQPC 2XJRA 1V9U1 5JCTA 1H4HA 1QXJA 5EZWA 2JD4A 4R9DA 4AFAA 1NZCA 3GZTB 3BU7A 4HSJA 5I8YA 2A5ZA 1VBE1 3I59A 3WW1A 2PHFA 3ZFEC 3NKTA 3AKQA 1YIPA 5T5JA 3IN9A 5J3UA 2D7FA 3AJZA 4HN0A 3WXPA 2Y26A 1M4WA 4DQAA 1QMJA 3T1MA 1PGL2 4CEYA 2LALA 3WDXA 2BEOA 1NQDA 2ENRA 4ZU7A 3MI8A 2WQZC 2UWBA 3FHIB 3DN7A 3K51A 1N1YA 4HL0A 1YFWA 4LO8A 2DV9A 5I91A 1QJU2 4WZCA 2H0VA 1VIWB 4N7UA 4RHV2 3ZYRA 4JRAA 5JAXA 3E6CC 5C9AC 3IBMA 4MXVA 3TNPB 3VBSA 4FQZA 3WP4A 1ND3A 1TMF1 1WBLA 1W6NB 3MGUA 3WD5A 1IS6A 3LOBA 2GMMA 5FLHA 4Q8KA 2ZX0A 1RITA 1LODA 4E27A 3BTAA 1RINA 3B69A 1O5UA 4L11A 1IPJA 4BOWA 3HT2A 2JG9A 4COZA 2WL1A 3GALA 2AYHA 1OOPC 1WD4A 4M0HA 2X5IB 4LE3A 2WJSA 1LHNA 1PGW2 4XFFA 4PLNA 3LA2A 1AR61 1Y9QA 4CDUB 1BZWA 2YC0A 1HQNA 2ZGRA 2IFRA 1BEV1 3LSDA 4QPGA 2JICA 1AJOA 2E9QA 3NVCA 4LLOA 2Y38A 3ES1A 5JI7A 1X8EA 5I8TA 5L73A 4A7YA 1O3RA 1ZRFA 1ASJ1 1SBEA 5GALA 2RS31 3QH7A 1NCQC 1Z7S3 4AI8A 3KCYA 1IOAA 3BOPA 5A32B 2E51A 4LBJA 4X6RB 2OW4A 5C6CA 3VBHA 1WLDA 1S2KA 1J3QA 2XPJA 2PHLA 4D94A 4YW1A 3MPBA 4MGKE 4OHVA 1UMZA 1OQ1A 4RA0A 1SBDA 1A6CA 1QOSA 3AMQA 1J3RA 4B7KA 3WY6A 2P2KA 1REEA 4I2OA 4Q0VA 1VB2A 2D5HA 2WNUB 3JZVA 5CADA 1CN1A 1ENQA 1G9AA 2PA7A 3WG4A 4XXAA 2XVGA 2FMDA 5KWRA 1FPN1 4XTMA 3CO2A 3ZN4A 1AYM1 5BXXA 1HQLA 4R8HA 3G7DA 2ZGNA 4FPGA 2XLFA 2ZGPA 3AJYA 4HZFA 3CF6E 5T5PA 1AX1A 2PFWA 4QQLA 3KB5A 1NLSA 2D43A 4IXLA 5FRAA 2ET7A 3OYWA 5CVRA 5KXBA 1AZDA 3RZZA 1NY72 3A0NA 3V0AB 4W6YA 1V70A 1X7NA 3RDIA 4K9SA 4FPCA 3MPPG 1JN2P 3AP6A 1W6QB 2W52A 1HRI3 5A33B 4K1YA 4JTNA 4DXZA 2NP0A 5HCBA 4KH9A 2ZGKA 3GHNA 5LK5A 3V65A 1BYHA 2X5IC 2VQAA 5E88A 2WS93 2E7AA 5E16A 1Z7S2 2WT1A 2ZA9A 1C8M1 1LEMA 2I2SA 4AFCA 3FFZA 4IEYA 4CDUC 3BALA 4TLFA 3VBRB 2TEPA 4H14A 1RMU3 4R9AA 4IV1B 1W39A 2EALA 3ES4A 1N3PA 1WLCA 1YLLA 2TNFA 5FO9B 4N90A 1XNBA 1PM7A 1HRV2 4YNIA 2Y0OA 3WLUA 5EFUA 2VNOA 1LHUA 3IWZA 2QDRA 1D0GA 1CPMA 2WIIB 1ENSA 1YI9A 5KHIA 1QU0A 2UWCA 3SLIA 3JBG3 4IL7A 1VBA3 2UURA 3URFA 1ZBE1 1AYN3 3TWIA 1SLIA 1LOGA 4I30A 1RGSA 4OULA 3FUOA 1DG6A 4OVEA 4IV1A 2VVFA 3B3QE 1J1TA 3VBOC 4D69A 2ILMA 2IXLA 3MF6A 1GQGA 1V6MA 4XTPA 1JUIA 3MLLA 4HMZA 4FOWA 1EV13 5HI0A 1QJX3 4R4XA 2VOWA 4OLLA 1QJY1 2WNUC 3BB6A 2BWCA 1YXWA 4HKLA 4AW7A 2RE9A 1RUD1 4P9WA 4FPFA 2FQPA 1N3OA 3JB8A 4BH9A 3ILNA 3O0VA 4XBQA 1GR3A 2Q5TA 4Q0UA 2VPVA 4FXKB 1YCIA 1Z78A 2DCZA 4Q4W1 4LLFA 5D8AA 1HRI2 1DHKB 3MW3A 4Q4V3 1O3TA 4U36A 4AEMA 4AE2A 1C4RA 2GC1A 1PO13 1RL3A 4JGYA 4LNVA 5KXEA 3OJBA 2A73B 4MYEA 2WS92 4L9BA 1SDWA 1E57A 2QUOA 3QACA 3VBUB 1RUH3 1RHI3 3GZAA 3AXDA 3N7MA 4Q27A 5I0TA 1CD3G 1RUJ1 2DVBA 1OMIA 5HCFA 4Y1ZA