1JU5C

Ternary complex of an crk sh2 domain, crk-derived phophopeptide, and abl sh3 domain by nmr spectroscopy
Total Genus 5
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
5
sequence length
60
structure length
60
Chain Sequence
DPNLFVALYDFVASGDNTLSITKGEKLRVLGYNHNGEWCEAQTKNGQGWVPSNYITPVNS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structure of a regulatory complex involving the Abl SH3 domain, the Crk SH2 domain, and a Crk-derived phosphopeptide
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein binding/transferase
molecule keywords Crk
total genus 5
structure length 60
sequence length 60
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 2001-08-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 1ju5C00
2BTTA 2DE0X 4JJDA 1PKSA 2CT3A 1TUCA 1W6XA 3U23A 2KBTA 2XMFA 1JQQA 1ZBJA 2JM8A 1UUEA 2LJ0A 2DBKA 4R0KA 1E6HA 3CQTA 1RLPC 1AZEA 1Z9ZA 2KT8A 1SSHA 4J9CA 2K3BA 3VS0A 2JXBA 3FJ5A 5IHIA 1SHFA 1NYFA 4LE9A 2J05A 2A37A 2EQIA 4LN2A 1TG0A 1SHGA 1B07A 2HCKA 1ARKA 5I11A 1GCQA 1UDLA 4RTTA 2QDLA 2LJ1A 1G2BA 1RLQC 1QLYA 1EFNA 3M0UA 1GFDA 4J9IA 4OMQA 2J6OA 4LNPA 2RQTA 1E6GA 2EYWA 1GL5A 1GBRA 1N5ZA 2ENMA 2VKNA 3NHNA 1YWPA 2KT1A 1PRLC 1ZUKA 3REBB 1KSWA 1PKTA 2W0ZA 1PNJA 2AK5A 1T0JA 2GGRA 2DL5A 2L2PA 3EG0A 1IO6A 2KROA 3VS6A 2D1XA 2KXCA 1BB9A 2DNUA 1H3HA 1RI9A 4JZ4A 4RTVA 5FWCA 1UTIA 3VS3A 2JMAA 2MOXA 2VWFA 1U3OA 2JM9A 3C0CA 3UA6A 2DA9A 2PTKA 1GFCA 1M30A 5IXFA 2O88A 2J06A 2DL8A 4CC2A 2HDAA 4D8KA 5IHNA 3EG2A 2LJ3A 3I35A 2GTOA 4QT7A 1NEGA 2FRWA 2VVKA 3H41A 4AG1C 2AZSA 2LNHB 2RQUA 4D8DA 3H0FA 1U5SA 1MV3A 1M3BA 1KJWA 1UHCA 2M51A 2O9SA 2IIMA 1J3TA 4J9BA 1UFFA 2OAWA 1YWOA 4IIMA 5IH2A 2FO0A 1W70A 2JMCA 1HD3A 2C0TA 1NEBA 5ECAA 1UGVA 2BZ8A 1I07A 3TSZA 4OMNA 2O9VA 2GNCA 2KGTA 2CREA 2M0YA 3ZL7C 2D8JA 2GBQA 2C0OA 5GJVB 2RN8A 1K0XA 1CKAA 2E5KA 2AZVA 2CH4W 2EW3A 4J9DA 3M0PA 1SRMA 2PZ1A 3IQLA 3O5ZA 2CUBA 2W10A 4GBQA 3UF4A 1K76A 5IXBA 4Z89A 2YUQA 4F16A 1BU1A 2ECZA 3H0HA 2KEAA 2V1RA 2H8HA 1M8MA 3EG3A 4CC3A 2HBWA 1WXUA 4Y92A 4RTYA 2YUNA 1K4US 4CC7A 1Y0MA 4ZNXA 2EYZA 2KYBA 1B3QA 2DYBA 1TUDA 1SPKA 2CT4A 1A0NB 1KIKA 4AFSC 3QWXX 1I1JA 2DJQA 1VYTA 1OOTA 3NMZC 1AWOA 2J6FA 2KNBB 2FPFA 3GBQA 2OI3A 3I5SA 1YN8A 1HJDA 1LCKA 1QCFA 4Z8AA 2CSQA 1ZUYA 1WI7A 2NUZA 4AFQC 3LH5A 2NWMA 1MV0B 1NG2A 2DRKA 4OMLA 2KRNA 3UATA 1JU5C 2JW4A 1WX6A 2DF6A 1X43A 2FEIA 4JJCA 2CDTA 4CC4B 1GCPA 3EHRA 1H92A 1JXOA 1QWFA 1Y57A 2J6KA 1BK2A 2O2OA 2DILA 3EHQA 2DL3A 3REAB 2FPDA 2K9GA 2YSQA 1MUZA 2GTJA 1PWTA 1WLPB 4AFUC 4A63B 1ZUUA 2L3QA 3VS1A 5IHKA 2KXDA 3SEMA 1QKXA 4HVWA 2K2MA 4RTZA 1FMKA 1X2QA 3PE0A 4KRTA 1UJ0A 2RQRA 1YCSB 2LP5A 1XOVA 2RQVA 2ROTA 2P4RA 1AWJA 1GBQA 2HEQA 3H0IA 3KFVA 4RTWA 2LZ6B 2DLPA 5FW9A 1E7OA 1K1ZA 3VRYA 1OPKA 1X6BA 2O31A 1AWXA 4J9GA 1WFWA 4HCKA 1T3SA 1QWEA 4RUGA 4JZ3A 1S1NA 1UE9A 3M0SA 1CKBA 2DBMA 5L23A 4HVUA 3VS2A 2EGEA 1WYXA 1ABQA 4ORZA 1OPLA 4FSSA 2RQWA 1HSQA 1GRIA 4M4ZA 2DX1A 3VS5A 1NYGA 1G83A 1UECA 2A28A 2LX7A 1JEGA 3M0TA 1U06A 2SRCA 1YP5A 1VYVA 2OJ2A 2DM1A 2RMOA 2A36A 1AD5A 2K6DA 4HXJA 2ED1A 2MCNA 2ED0A 4F17A 1SEMA 1BBZA 2YDLA 1I0CA 1X27A 3RBBB 1NM7A 3VS7A 2PNIA 2D0NA 2I0NA 2KR3A 3NPFA 2AKKA 2DVJA 3TVTA 4DEYA 2EGCA 1AEYA 2X3XD 3VS4A 2CH4A 2HSPA 1T0HA 2CSIA 2DL7A 3VRZA 2JT4A 1AZGB 3PVLA 3NGPA 1X2KA 1M3AA 3THKA 1W1FA 4AG2C 2FRYA 3SHWA 2B86A 1PRMC 1PHTA 2JS0A 3M0RA 4LUDA 1FYNA 3RNJA 2BZXA 1UHFA 2BZYA 2K79A 5FWBA 2YUOA 2MIOA 1X69A 5GJWB 4J9EA 4OMPA 1UJYA 4IIOA 2A08A 1WXBA 2EBPA 1ZX6A 2RPNA 1JO8A 3JV3A 4J9HA 1AVZC 3A98A 4HVVA 1KFZA 1K0SA 3I9QA 4WCIA 1JXMA 4RTUA 2EGAA 2G6FX 3PVQA 2ROLA 2LQNA 4RTXA 2F2WA 1RUWA 2ESWA 1VA7A 1T3LA 3TSWA 2EYYA 2F2XA 2FPEA 5I22A 4GLMA 1CSKA 2KYMA 2DMOA 5EC7A 2YT6A 1K9AA 4ESRA 1UG1A 2CUDA 3ULRB 1SRLA 2L3PA 2EPDA 2KRMA 1H8KA 1QKWA 1WA7A 1WDXA 2L0AA 2KE9A 2LMJA 4LUEA 1M3CA 2EYXA 3I5RA 4DEXA 2JS2A 1WIEA 1WXTA 2FG0A 2D8HA 1AWWA 1ABOA 2J7IA 1Z9QA 2RF0A 4JPBW 1NLOC 2LQWA 1VYUA 4OMMA 4EIKA 1ZSGA 2LCSA 3UA7A 4JJBA 1ZLMA 4F14A 2DL4A 1OEBA 3EG1A 2EVRA 1V1CA 2RNAA 1YNZA 2F2VA 4Z88A 2X3WD 4AFZC 5HCKA 2K7AA 2KRSA 4J9FA 4X1VA 2L3SA 1GCQC 2ABLA 3R6NA 1X6GA 2C0IA 2V1QA 3M0QA 2GQIA 2EKHA 3EGUA 4K11A 2AKLA 4OMOA 2SEMA 3QWYA 2JTEA 1AOJA 1OV3A 2YUPA 2DRMA 1NLPC 4E6RA 1M27C
chains in the Genus database with same CATH superfamily
4F7UB 4ZGJB 1PKSA 3RMQA 1YITT 1JQQA 2JN0A 1KC8U 1UUEA 2QA4T 4R0KA 1WZOA 1E6HA 1WPYA 3L42A 2L8DA 1VQLT 1Z9ZA 3RERA 2RHUA 3OYGA 1VQKT 1YIJA 2DYIA 2IVWA 1VIFA 4XU3A 3NTHA 3VS0A 1QVFP 3QJ6A 3MEAA 2QASA 5IHIA 2IG0A 1VQ8A 4RMOA 4PNOA 2RHYA 4F7UG 2F1LA 3RKYA 4LN2A 5KYWB 1SHGA 3CCLQ 2OAUA 3HRSA 3CMAA 2QDLA 1QLYA 1GFDA 2CP5A 3SB2A 2J6OA 4KT0E 2EYWA 1GL5A 2RO0A 2D9TA 1KD1C 3NHNA 1YWPA 1UGQB 3REBB 4YTLA 3JCMV 4M78G 5LJ5j 2MK5A 3JCMd 2ZPEB 3F70A 3M58A 2COZA 3MO8A 1G3SA 2DNUA 7AT1B 1MMNA 2VB6A 2O4XA 5FWCA 3META 2JMAA 4OB2B 1VQMQ 3OBYA 4MMKA 1TWBA 2JM9A 3M5AA 3DB4A 1UEBA 5GMKj 5IXFA 1PSFA 1OZ3A 2O88A 2J06A 2JNGA 3QG1A 2DTOA 1PC0A 4NS5A 3H8ZA 4LDYA 1WHJA 2DZ9A 5LJ5d 1X75C 4QVZA 2DEUA 1IZ6A 1N8RC 2L5QA 4ZGDB 3O8VA 2XDBA 1U5SA 4RG8A 3JB9J 1MV3A 2A3LA 4DA4A 1UHCA 2LT4A 1VQLQ 2PUOB 2QQAA 1D1BA 2H3EB 2L3RA 4J9BA 2NUPA 2ZPGB 1BCMA 1RAAB 1TSFA 1YWOA 4IIMA 3MKDA 3JAME 2RI5A 4O6JA 3TCJA 1I07A 3EG9B 3WVEB 1QVFS 4EMKB 3OMCA 3CC2Q 2KGTA 2OTLA 5LJ3e 1K9MU 1K0XA 4ZN1A 5CKFA 2E5KA 2V8KA 2V26A 3D7SB 4B9XA 2A0FB 2AHJB 3IQLA 1RAHB 4C92F 2DD5A 4C5IA 3UF4A 4KUIA 3SFMA 1QQJA 3EFOB 3CC4Q 2V1RA 1M8MA 2EKOA 1BIAA 4BI3A 3G4ST 5GANd 3QPHA 4M78C 2YUNA 3V8KA 4E7ZA 4ZNXA 2EYZA 3GOXA 1SPKA 2CT4A 4C92A 1KIKA 1JRIA 3QWXX 5CCAA 2R5AA 1K73C 3LH0A 4FL6A 4L5GA 3SDZA 1AWOA 2FPFA 5LL6S 3I5SA 3FC3A 5LJ5e 3TREA 3HL8A 1HJDA 3EFOA 1QCFA 3QDRB 1ZUYA 1PM3A 4AFQC 2QEXA 1MNDA 1QCOA 4OMLA 3T9NA 2X35A 2RJCA 5GAOp 4JJCA 4B6MA 2CDTA 4M77C 5J26A 4CC4B 3OSSC 3GF5A 3P8DA 4M7AD 1BK2A 2O2OA 4A54A 4RCCA 3JB9F 2YSQA 2GQVA 2AT1B 1PWTA 1WLPB 4C92G 1YITQ 2LCLA 4ME7A 4D6WA 1ZUUA 2X51A 5IHKA 3JCMh 4DOVA 3CC4T 3M4YA 2KXDA 4IKFA 2K2MA 1X2QA 3PE0A 2NYSA 5I2SA 4LXCA 4M7AE 3MEVA 4C8QD 1VQPQ 2DAQA 1VQOQ 2ROTA 4QQGA 4XU0A 4BI4A 2DLPA 2QGFB 3CCST 5GAMe 1OPKA 3FJPA 3P8BB 1X01A 3RKWA 3TQ7P 4HCKA 3CMAT 1QWEA 1Q81R 1K8AC 1QP2A 2DBMA 5LJ5h 1MGQA 5L23A 3VS2A 2R5MA 3CCJQ 2EGEA 1VQ8T 1SG5A 1Q7YC 1GRIA 4M78D 2DX1A 2V8IA 3VS5A 8AT1B 3G71A 1NYGA 4E7KA 4PJOE 1MMAA 2HL5C 4NL2A 4A4FA 2E3IA 5CAIA 3JCMX 2MI6A 3CBOA 1U06A 2EJFA 2KDSA 2RMOA 2A36A 1YIJQ 3M4GA 3C94A 3HFNA 4JLGA 1SEMA 4N4HA 3RBBB 1NM7A 1NJIU 1VQ7A 4PJOD 4C92B 5J3BA 2X3XD 1ZSZC 5CKHA 3QSUA 2DL7A 2JT4A 4HCZA 3I55Q 4BACA 2QXFA 4AMCA 5AYFA 1KQSP 2KVQG 3I55T 2E70A 3CC7Q 3G4SQ 3H6ZA 1JJ2A 2JS0A 4M7AC 1PG5B 4LUDA 1VQNQ 1UHFA 5GAMh 2BZYA 2K79A 5HK0A 5A2QE 1C6VX 2YUOA 2XDPA 2DVEA 3LGLA 2BUDA 4OMPA 4IUUA 4IIOA 3JCMb 4C5HA 1RAFB 1WXBA 2QTXA 1VQNA 3EGXA 1ZX6A 3J81E 1NZ9A 1WHGA 3X26B 1G3TA 4ELZC 4A53A 4RTXA 4JRKA 2F2WA 1RUWA 2ESWA 6AT1B 3TSWA 2EYYA 4C0ZA 5I22A 3ASKA 2EQJA 2Y4XA 1CSKA 1RADB 2M1HA 5EC7A 4LD6A 3CBPA 4PJOF 4LDXA 2KAFA 4C8QE 2LRQA 1K9MC 1M2VB 3JSCA 1OULA 1YBYA 2EYXA 1KHIA 3CCUQ 1LNXA 2FG0A 3EFRA 4PFOA 1M1KU 3WVDB 4EIKA 2LQWA 1VYUA 4WF2A 5DLQE 1ZSGA 1D1CA 2HNIA 1Y71A 3DB3A 3OS5A 3CCSQ 2YLBA 4JJBA 5HY6A 1M1GA 2VUBA 3EGXB 4L59A 4F14A 1U8RA 3CMEQ 2DL4A 4A4HA 4DQ2A 2YRDA 3CCJA 4BE2A 1Y96B 2OTJT 2E10A 2K7AA 1M5Q1 4J9FA 4X1VA 2ABLA 2PUKB 5L8RE 3QXEB 2WSCE 3H9NA 1SF9A 3EGUA 2FVUA 3X24B 1HK9A 2SEMA 4A4EA 2JZ2A 4M7DD 5GAOn 2M02A 1TTHB 5DM7R 1D09B 3CPWP 2G3RA 4JJDA 4DOWA 3OYMA 3NTIA 1TUCA 4OB3B 3U23A 2XMFA 2VXEA 2X4JA 5IN1A 1YJWQ 4M7AG 1RLPC 1AZEA 3PIPA 2KT8A 4ATOA 4J9CA 3DLMA 2K3BA 3MEWA 1DJ7B 3HKSA 5D7UA 4KULA 3OYEA 3CCUA 2ZCFB 4GY5A 1OZ2A 2JXBA 2CP3A 3PTAA 1NYFA 2L89A 4XTYA 5GAN8 1VQ6Q 3L1AA 1N27A 1B07A 2XKOC 2NUPB 1FX7A 1GCQA 1UDLA 1M90C 1W4SA 1G2BA 3CXCS 3JB9I 1EFNA 3CCEQ 3OYLA 4J9IA 2ATCB 1RI0A 2HQHA 3BFMA 4LNPA 1VQ6A 1E6GA 5M9OA 4F04B 1JBMA 1N5ZA 2X9HA 5LJ5g 2ENMA 3PT9A 5LJ3g 2MWOA 1KQSS 4PKCC 2EYQA 1PNJA 5CQXA 5IAYA 3C12A 2GGRA 4QQDA 1IO6A 4HCCA 1K73R 2HQEA 1BB9A 2CZ1B 1RI9A 1O9SA 1KK7A 5KYUA 4PLIA 2VWFA 3G6EQ 1U3OA 1FMWA 1Q82R 1WNLA 3UA6A 4WTOB 4RG2A 4PFPA 1BI1A 3JCMg 3INZA 3CC2A 4FYVB 3S6WA 5IHNA 4JLIA 3EG2A 2HMAA 4M7DF 4HKEA 4HA8A 2FRWA 2P0KA 3X25B 1WHLA 2HD0A 4ZTJA 3H0FA 3RMSA 5GANj 4E7IA 1M3BA 4BE1A 1KJWA 4FIBA 2M51A 4F7UA 2O9SA 3NTKA 4N0AA 2IIMA 2OTJQ 4M75G 2CP7A 4FYWB 4LDWA 3G71T 1W70A 2PVDB 8ATCB 5KYYB 4E47A 1UGVA 1H3ZA 2DPPB 4OMNA 2OTJA 1I5LA 2KK4A 3ZL7C 4R55A 4M78A 5GJVB 3QUIA 4L6V5 3QDFA 1SRMA 1BI0A 2PZ1A 5FRMA 2CYZB 1MNEA 4XTVA 3PMTA 1AHJB 4C8QF 4A4GA 2ECZA 5FU6C 4M75D 1Q7YR 2KEAA 2Z0WA 3JB9H 2YLCA 3JCMP 1WGSA 2HBWA 3CXCA 3TU4K 1WXUA 3OY9A 1WJRA 2QQRA 4ANJA 4KUDK 1K4US 2EQMA 1Y0MA 4M77B 3RR6A 1U1SA 4OB1B 1OX9A 1BIBA 1QCNA 4AFSC 3EFSA 4TVRA 1LVKA 5KYXB 3JB9G 1OOTA 3NMZC 4LDVA 1KQ2A 2J6FA 1TXQA 5KYYA 1YN8A 1VQPT 1LCKA 4Z8AA 1WI7A 2NWMA 1MV0B 4QVDA 2KRNA 2EFIA 4F7UE 3CMAQ 2NLUA 3CCLA 1OU9A 4O5VA 1H92A 1Y57A 4CRIA 1KHCA 3EHQA 3ZBDA 2E12A 1WQWA 2DL3A 1M8VA 3M9QA 3JCMW 2FPDA 4J6XA 2K9GA 1MUZA 2GTJA 2JOYA 3GNGA 3LLRA 2CKKA 4A63B 4M75C 2QK0A 1FMVA 2K3YA 1YJNA 1N9SA 1ZSZB 2VGMA 2Y4YA 1QKXA 5GMKm 4RTZA 4OF1A 3G71Q 1HXDA 1UJ0A 5A0GA 2E3HA 2QAZA 2RQRA 2LP5A 4II1A 1QP3A 1ZHIA 2HEQA 1YHQQ 1VQ9Q 2XK0A 2QA4Q 4MZTA 1NJIC 5FW9A 3RKXA 1KC8C 1D3BB 4PJLA 1E7OA 1K1ZA 4FW2A 5EG2A 4DBQA 3OYFA 2XIDA 4KGVB 1VQPA 1AWXA 2YWWA 4BE0A 1RAIB 3CCET 3M0SA 4ZN3A 2X4XA 3CCQT 1XQHA 4C8QC 4X34A 5LJ3f 2DKGA 4M4ZA 2E65A 3JB9D 1H641 2QDYB 2A28A 3M0TA 1I8FA 5GANf 1YI2A 1ZA1B 1WQ7A 2DM1A 1V29B 1AT1B 3UPUA 1TUGB 1VQMA 1AD5A 3LGFA 1JJ2S 1BBZA 2YDLA 1I0CA 1X27A 5KE3A 3VS7A 4C5EA 5GAOq 2I0NA 4M77A 3JCMJ 4OMFB 3TVTA 4DEYA 2EGCA 1KQSA 1AEYA 2CH4A 3X28B 2DIQA 2CSIA 3VRZA 3NGPA 3ZEHA 4M7DB 5GAN6 2KY9A 2JTFA 4XTUA 3THKA 1W1FA 4IUQA 2FRYA 3BDLA 2B86A 4FYYB 4BDZA 2WSEE 2BZXA 4VUBA 1VQ5Q 1RACB 4C92C 2MIOA 1XTDA 1B34A 3RDVA 3EH1A 3BE3A 5GAN4 1AVZC 4J8OA 3A98A 5CO7A 4ZTFA 1KFZA 4ZGEB 2HL3A 1IHVA 2B8AA 1JXMA 2EGAA 2G6FX 3VUBA 4M7DA 1IXDA 2ROLA 3MEUA 2XDDA 4MZPA 4J6YA 3GPLA 2F2XA 1OI1A 2VYTA 4GLMA 2XG8D 4M75A 2KYMA 3CCEA 1VQ9T 1K73U 4AT1B 1UGPB 1OU8A 3ULRB 3C95A 5GAN5 1SRLA 2XICA 2L3PA 3BY7A 4E2FB 2XI9A 5LJ5f 1PD0A 1WA7A 1WDXA 1Q95G 4M75F 1WIEA 2KI7A 4LD9K 1KC8R 2J7IA 4XU1A 4JPBW 1VQ4A 1W2BP 1WHHA 4JS4A 4FT4A 1ZLMA 2WSFE 1YITA 1S72Q 2EVRA 3OSVA 4OGEA 5GMKh 1YCYA 2LNVA 4PJOC 4QKUA 5KYUB 2F2VA 4Z88A 4M7DG 2JVVA 5HCKA 3OW2P 4EMGA 4EMKC 3R6NA 1X6GA 2EJ9A 2GQIA 2EKHA 1TS9A 3LW5E 3QWYA 2EQKA 5CKEA 3KBGA 1SSFA 4KGZB 2YUPA 4E6RA 2ZPBB 2BTTA 2DJZA 3R6OA 2PVGB 2QEXQ 5C6SA 3EGDB 2MWPA 1W6XA 2KBTA 2LJ0A 2DBKA 4XAXB 1M2OA 3FEOA 3S3MA 3CQTA 3GIBA 4EPCA 1SSHA 4PJNA 1WJQA 4BB7A 1R0BG 1N8RU 3FJ5A 4X9CA 2A37A 2EQIA 4X9DA 4IURA 1PCXA 1IGQA 2LJ1A 3M0UA 1D1AA 4OMQA 2EWNA 3M54A 1GBRA 4C0DB 2VKNA 1ZUKA 1KSWA 1PKTA 2W0ZA 1T0JA 3EG0A 3OYJA 2QQBA 3J80E 3URGA 1R77A 4DBHA 2D1XA 2RK1A 2CZ7B 1SKUB 1H3HA 4JZ4A 5KYXA 3I56Q 1M1KR 4NOYA 1QVPA 2MOXA 3JCMf 3CC2T 4XU2A 1VQKQ 3C0CA 3RESA 2DA9A 2PTKA 3EG9A 3E9FA 4PJMA 4E7HA 1RAGB 2DL8A 3GNFB 4N4GA 2HDAA 4D8KA 4FM4B 2LJ3A 2F5KA 2GTOA 4QT7A 3JCMe 2BE7D 3OS0A 2VVKA 3H41A 4AG1C 3V7CA 3S3NA 1F1BB 1N6AA 3I55A 3QZ9B 2DTHA 4M77D 4EDUA 1M9SA 2DFUA 1B7TA 4C0FA 1WHMA 3M57A 1X6OA 1J3TA 2QGGA 3LWHA 1D0XA 1UFFA 2OAWA 2CP0A 4DBFA 5GAMj 5IH2A 2FO0A 4BY6C 1HD3A 5GAN7 4C8QG 1Q86U 5ECAA 1VQ7T 4PJOG 2D0QB 2RHIA 1BI2A 2GNCA 1KD1U 2CREA 2M0YA 2OTLT 1CKAA 1C1AA 1YJNQ 1P92A 2DZCA 2EW3A 1VIEA 4J9DA 3CC7T 3LX7A 1XNIA 1LOJA 3L2WA 1BI3A 5GANe 3KXTA 1K76A 2K2VA 2YRCA 3MPUB 4Z89A 5LJ3d 2YUQA 1HYOA 2M16A 5GAOm 3H0HA 3OYHA 2QYZA 1Q81U 4HT9A 1VQ9A 5LJ3j 3EG3A 4CC3A 4PFZA 3SWNC 2JJ9A 5CR2A 3LWIA 3OS1A 4CC7A 2ZPHB 2K5IA 4UC4A 4C8QA 2KYBA 2DYBA 2BE9B 1YJ9A 2DJQA 3CCUT 1VYTA 3OYKA 3E2UA 5GMKe 3HPWA 2KNBB 3GBQA 2P4TA 5FU6B 2NUZA 2K57A 1YI2Q 3LH5A 1NG2A 4M7AA 4FYXB 3UATA 3VUZA 1JU5C 3OA6A 1WX6A 4XK8E 1GCPA 5HK3A 3EHRA 1YHQA 4N0AC 1JXOA 1XJWB 2DILA 1VQ5T 3CD6T 4M78E 2V8JA 4CI0C 4BUGA 1Y07A 1I5OB 2P84A 3V8LA 3SEMA 1VQMT 1QVFA 2E4HA 4BI8B 3ER0A 2RHXA 3A5ZB 4P5NA 3SD4A 1VOMA 1XOVA 4M77E 1AWJA 3H0IA 2K5FA 4MDWA 3KFVA 1OYXA 4Y91A 3SWNB 1VQLA 5GMKi 4XTZA 4JS5A 3PGGA 1KG1A 5AT1B 1MHNA 1NBEB 4J9GA 1WFWA 1T3SA 4RUGA 4C0GA 1B34B 4JZ3A 5LJ3h 2EJGA 1CKBA 2HSEB 4GLKA 5GMKl 2O01E 1G5VA 2HKNA 1PD1A 1WYXA 1ABQA 4ORZA 2RJEA 1NPRA 3C4SA 1G83A 3QYHB 3E1SA 1YJ9T 1VQ8Q 2LX7A 4FW1A 1G3YA 1JEGA 4M7AB 2A7YA 2F69A 4OP0A 2RA2A 1IGUA 2SRCA 4E7LA 3ZFJA 1VYVA 2X4WA 1M2VA 2RD1A 3HFOA 1VQ4T 3OW2A 1YJNT 2K6DA 5DLOA 4HXJA 2ED1A 2MCNA 5KCOA 2PNIA 2YHTA 2KR3A 3NPFA 3UWNA 5HKCA 2K3XA 2FYKA 5DY9A 2HSPA 1T0HA 1M4ZA 1AZGB 2DETA 2GFUA 2KSSA 4JRPA 4E7JA 3OB9A 1O75A 5KE2A 2VXFA 2FZCB 1VQ6T 4HCBA 4FSXA 3AHUA 2HKQB 3A8HB 3M0RA 4EMHA 3HHTB 3RNJA 2RI2A 3OQ5A 3NFCA 4E7SA 5FWBA 2DERA 9ATCB 3QO3A 5GJWB 4C92D 4J9EA 5I2MA 3HTRA 2A08A 3CEYA 2EBPA 1V76A 1FXXA 3JV3A 4J9HA 4HVVA 1YFNA 1VQ4Q 4RTUA 5D6XA 2LQNA 4JDSA 4M7DE 2FPEA 4FT2A 5GAN2 2RI3A 2VASA 2DIGA 3M56A 4FU6A 5C0MA 5KYNA 1UG1A 2CUDA 3CCVT 3CD6Q 4HT8A 1C0MA 1ZSZA 2GFAA 2KRMA 4N4IA 1KD1R 2LT1A 2KE9A 3RUXA 4LUEA 3OYBA 3L2VA 4DEXA 2D8HA 1UGSB 4PJJA 1AWWA 1Z9QA 2RF0A 1VQOA 1NLOC 2OX7A 3V8JA 5GAN3 2LCSA 3CCMT 1Q82U 2RJFA 3CPWS 2I2LA 4QQ6A 2RNAA 2RJDA 1FWZA 1W2BS 1YNZA 5FROA 1N9RA 3CCRA 2X3WD 4AFZC 4C8QB 3EAEA 3FB9A 3HP9A 5GAMg 1VQKA 1GCQC 1QVGA 1G8XA 2C0IA 2VV5A 2RHZA 2V1QA 3CCQA 3M0QA 4K11A 2DXTA 2AKLA 2H3JA 4OMOA 5KYWA 2XD0A 1AOJA 3CCRT 3OYAA 1OV3A 2QA4A 3FIFA 2DRMA 1M27C 1I81A 3BW1A 2K5LA 2DE0X 2DO3A 2COYA 3M59A 2CT3A 3OYDA 1VUBA 3N5BB 1LJOA 4OGCA 3OYYA 1ZBJA 2K4YA 1YIJT 2JM8A 1MMDA 3DLLA 2ZZDA 1OQKA 1D0YA 3MP6A 2QEXT 1JJ2P 1Q81C 1K8AR 1YI2T 3UT1A 1RAEB 1ZBXA 3LYIA 2C06A 3L2QA 1VQNT 3JRZA 4Y28E 1NJIR 1I4K1 2RB6A 3I56A 1SHFA 4RCBA 4LE9A 3HRTA 2J05A 2PVOB 1EZZB 2NUTB 1TG0A 1KQ1A 2HCKA 1ARKA 5I11A 4XTWA 4RTTA 1RLQC 3A8LB 3G4SA 2RQTA 1WJSA 2MF2A 3A8OB 2KT1A 4RKUE 1PRLC 3DKMA 4C92E 5CKDA 2NUTA 1G3WA 2MPXC 4MDXA 2AK5A 3VJPA 2BIVA 2DL5A 2L2PA 2FB7A 2DXBA 2WACA 2KROA 2P0QA 1YJWT 5GANg 3VS6A 2CP2A 2KXCA 4IUVA 4RTVA 3CXCP 3AT1B 2X4YA 4B9WA 1UTIA 3VS3A 3MP8A 5FU7B 2FHDA 1GFCA 5A0LA 4QW2A 1M30A 2GF7A 4J7IA 4Q5WA 1LPLA 4CC2A 1IREB 4M7DC 3CCLT 4BY6B 3I35A 2LC4A 4KGXB 2ZPFB 2RH2A 1NEGA 2R57A 2AZSA 2LNHB 4M78F 1EIFA 2BKDN 2RQUA 4D8DA 4JRIA 3CCSA 2LVMA 1QW1A 2LQKA 3CCQQ 2GCXA 3OS2A 3L2RA 2E1HA 5IT9E 3G1JA 2DD4A 1D3BA 2JMCA 2C0TA 1NEBA 3V7RA 2PQWA 4F7UF 3MHXA 2QG9B 3JCMQ 2BZ8A 3CCMQ 3TSZA 4ELYC 1BCOA 2O9VA 4PL6A 2D8JA 5KCHA 3CC4A 2GBQA 2C0OA 4V2SA 4PJOB 2RN8A 1VQ5A 1Q86C 5FU7C 2AZVA 2CH4W 2M0OA 3M0PA 3CCMA 1D0ZA 3O5ZA 2CUBA 2HQXA 2W10A 4GBQA 1VQOT 4XTXA 5IXBA 2EAYA 3CCVQ 3ME9A 5D6WA 1BU1A 2EIFA 2H8HA 2LQ8A 3PFSA 3KUFA 5I21A 5FRNA 4Y92A 3L2UA 3CCVA 1R8OB 1Y7XA 4RTYA 4OVAA 4QVCA 4J7FA 2LCCA 1B3QA 2O4XB 1TUDA 5D6YA 1A0NB 2KMTA 2P0PA 2IPOB 3CPFA 1K9MR 3VYGA 3GP8A 1I1JA 5GAMf 3EH2A 3X20B 2QI2A 3QKJA 3VU3C 1RABB 2OI3A 4KBMB 2DEQA 3QHSA 2CSQA 4MMLA 3OYIA 1TOVA 1BKBA 2CP6A 5CVIA 2MAMA 3E9GA 2DRKA 1Q7YU 2E5QA 1NE8A 2JW4A 3A8MB 5A0DA 2DF6A 1X43A 1YJWA 2FEIA 4C0DC 3QBYA 1WHKA 5FLXE 3OYCA 2QQ9A 1QWFA 2J6KA 3EGDA 4JJNK 1QVGS 4IUTA 2LTOA 1JB0E 1M90U 3REAB 3P8HA 3CMEA 4AFUC 2YRVA 4KH1B 3CPWA 2L3QA 3VS1A 3OYNA 1RL2A 2OTLQ 2E6ZA 4HVWA 1FMKA 5CKBA 2M9UA 4KRTA 2MMPA 1M1FA 3FRNA 2ZPIB 2DTIA 1YCSB 4M78B 2RQVA 2E64A 2CGHA 2P4RA 1GBQA 1IHWA 2VGNA 4RTWA 2LZ6B 1PSEA 3VV0A 3HSBA 3VRYA 3L2ZA 2MYSA 1X6BA 4PK4A 2XHCA 2O31A 2YXYA 1IB8A 1S1NA 1UE9A 4J6WA 3A8GB 2FL7A 4BD3A 1ACMB 3G6EA 4PJOA 4HVUA 3PNWC 1Q86R 2FZGB 1OPLA 2Y90A 3QIIA 4FSSA 2RQWA 1HSQA 3MJXA 1UB4A 4EMKA 1UECA 1U1TA 1TU0B 3WXMB 4R56A 3FDRA 2JTMA 5KH6A 1BYMA 1YP5A 3RIRA 2OJ2A 4A4KA 2CS7A 2DXUA 3JCMc 3OMGA 1ZQ1A 4XQ3A 2ED0A 4F17A 1S72T 1R0CB 2D0NA 2RK2A 2AKKA 2DVJA 3CBMA 3VS4A 2CZ6B 3PVLA 3VYHB 3GLXA 2LDMA 1X2KA 2KQWA 1M3AA 2VC8A 4J5YA 5GANh 1OX8A 3QJYA 1NPPA 3E19A 4AG2C 3SHWA 1EX4A 1PRMC 4J83A 5GAMd 1PHTA 5GAOl 3PMIA 3CCJT 2E6NA 3OW2S 2QTVA 1FYNA 1S72A 2HZYA 2AIRB 2HAXA 4Z02A 2HBPA 1M1KC 3CD6A 4M77F 3M53A 3G7ZA 1N8RR 1X69A 1TH7A 1UJYA 1IRXA 3HRUA 1YHQT 2RPNA 1JO8A 3MP1A 2E41A 3V7SA 2QQSA 1K0SA 2LX9A 3I9QA 4WCIA 2COWA 2EQUA 2DXCA 3PVQA 1MMGA 2R58A 4M7AF 3M55A 4M77G 1VA7A 1T3LA 3FLGA 4IUPA 3G6ET 3CCRQ 2D6FA 2PU9B 4DBRA 3CMET 3MCAB 2DMOA 3VKIA 4MZMA 2YT6A 3PIOA 1K9AA 4ESRA 4M75E 4JRQA 2ZAEA 3OBWA 3QZ5B 1M90R 2F5TX 3Q1JA 5CQYA 1ZA2B 3SWNA 1H8KA 2EPDA 4JUVA 4C5GA 4BDYA 2FZKB 1QKWA 5GAOr 2L0AA 2LMJA 1M3CA 2ZGWA 3I5RA 1W2BA 2JS2A 2JUFA 1WXTA 2CZ0B 5CIUA 5CK9A 4NL3A 1ABOA 4OMMA 3J7AF 2RM4A 3UA7A 4KH0B 4LDUA 1QVGP 1VQ7Q 1OEBA 1UGRB 3EG1A 2DK3A 1GXIE 4OB0B 1YJ9Q 1V1CA 3I56T 2XU8A 1Y96A 3S3OA 3TEEA 4FCYA 2KRSA 2L3SA 1Q82C 3QYGB 3A1PA 5J39A 4M75B 3BDUA 3CC7A 2JTEA 1QMCA 1K8AU 1NLPC 4PLLA 3UDCA 4F16A
chains in the Genus database with same CATH topology
2BTTA 2DE0X 4JJDA 1PKSA 2CT3A 1TUCA 1W6XA 3U23A 2KBTA 2XMFA 1JQQA 1ZBJA 2JM8A 1UUEA 2LJ0A 2DBKA 4R0KA 1E6HA 3CQTA 1RLPC 1AZEA 1Z9ZA 2KT8A 1SSHA 4J9CA 2K3BA 3VS0A 2JXBA 3FJ5A 5IHIA 1SHFA 1NYFA 4LE9A 2J05A 2A37A 2EQIA 4LN2A 1TG0A 1SHGA 1B07A 2HCKA 1ARKA 5I11A 1GCQA 1UDLA 4RTTA 2QDLA 2LJ1A 1G2BA 1RLQC 1QLYA 1EFNA 3M0UA 1GFDA 4J9IA 4OMQA 2J6OA 4LNPA 2RQTA 1E6GA 2EYWA 1GL5A 1GBRA 1N5ZA 2ENMA 2VKNA 3NHNA 1YWPA 2KT1A 1PRLC 1ZUKA 3REBB 1KSWA 1PKTA 2W0ZA 1PNJA 2AK5A 1T0JA 2GGRA 2DL5A 2L2PA 3EG0A 1IO6A 2KROA 3VS6A 2D1XA 2KXCA 1BB9A 2DNUA 1H3HA 1RI9A 4JZ4A 4RTVA 5FWCA 1UTIA 3VS3A 2JMAA 2MOXA 2VWFA 1U3OA 2JM9A 3C0CA 3UA6A 2DA9A 2PTKA 1GFCA 1M30A 5IXFA 2O88A 2J06A 2DL8A 4CC2A 2HDAA 4D8KA 5IHNA 3EG2A 2LJ3A 3I35A 2GTOA 4QT7A 1NEGA 2FRWA 2VVKA 3H41A 4AG1C 2AZSA 2LNHB 2RQUA 4D8DA 3H0FA 1U5SA 1MV3A 1M3BA 1KJWA 1UHCA 2M51A 2O9SA 2IIMA 1J3TA 4J9BA 1UFFA 2OAWA 1YWOA 4IIMA 5IH2A 2FO0A 1W70A 2JMCA 1HD3A 2C0TA 1NEBA 5ECAA 1UGVA 2BZ8A 1I07A 3TSZA 4OMNA 2O9VA 2GNCA 2KGTA 2CREA 2M0YA 3ZL7C 2D8JA 2GBQA 2C0OA 5GJVB 2RN8A 1K0XA 1CKAA 2E5KA 2AZVA 2CH4W 2EW3A 4J9DA 3M0PA 1SRMA 2PZ1A 3IQLA 3O5ZA 2CUBA 2W10A 4GBQA 3UF4A 1K76A 5IXBA 4Z89A 2YUQA 4F16A 1BU1A 2ECZA 3H0HA 2KEAA 2V1RA 2H8HA 1M8MA 3EG3A 4CC3A 2HBWA 1WXUA 4Y92A 4RTYA 2YUNA 1K4US 4CC7A 1Y0MA 4ZNXA 2EYZA 2KYBA 1B3QA 2DYBA 1TUDA 1SPKA 2CT4A 1A0NB 1KIKA 4AFSC 3QWXX 1I1JA 2DJQA 1VYTA 1OOTA 3NMZC 1AWOA 2J6FA 2KNBB 2FPFA 3GBQA 2OI3A 3I5SA 1YN8A 1HJDA 1LCKA 1QCFA 4Z8AA 2CSQA 1ZUYA 1WI7A 2NUZA 4AFQC 3LH5A 2NWMA 1MV0B 1NG2A 2DRKA 4OMLA 2KRNA 3UATA 1JU5C 2JW4A 1WX6A 2DF6A 1X43A 2FEIA 4JJCA 2CDTA 4CC4B 1GCPA 3EHRA 1H92A 1JXOA 1QWFA 1Y57A 2J6KA 1BK2A 2O2OA 2DILA 3EHQA 2DL3A 3REAB 2FPDA 2K9GA 2YSQA 1MUZA 2GTJA 1PWTA 1WLPB 4AFUC 4A63B 1ZUUA 2L3QA 3VS1A 5IHKA 2KXDA 3SEMA 1QKXA 4HVWA 2K2MA 4RTZA 1FMKA 1X2QA 3PE0A 4KRTA 1UJ0A 2RQRA 1YCSB 2LP5A 1XOVA 2RQVA 2ROTA 2P4RA 1AWJA 1GBQA 2HEQA 3H0IA 3KFVA 4RTWA 2LZ6B 2DLPA 5FW9A 1E7OA 1K1ZA 3VRYA 1OPKA 1X6BA 2O31A 1AWXA 4J9GA 1WFWA 4HCKA 1T3SA 1QWEA 4RUGA 4JZ3A 1S1NA 1UE9A 3M0SA 1CKBA 2DBMA 5L23A 4HVUA 3VS2A 2EGEA 1WYXA 1ABQA 4ORZA 1OPLA 4FSSA 2RQWA 1HSQA 1GRIA 4M4ZA 2DX1A 3VS5A 1NYGA 1G83A 1UECA 2A28A 2LX7A 1JEGA 3M0TA 1U06A 2SRCA 1YP5A 1VYVA 2OJ2A 2DM1A 2RMOA 2A36A 1AD5A 2K6DA 4HXJA 2ED1A 2MCNA 2ED0A 4F17A 1SEMA 1BBZA 2YDLA 1I0CA 1X27A 3RBBB 1NM7A 3VS7A 2PNIA 2D0NA 2I0NA 2KR3A 3NPFA 2AKKA 2DVJA 3TVTA 4DEYA 2EGCA 1AEYA 2X3XD 3VS4A 2CH4A 2HSPA 1T0HA 2CSIA 2DL7A 3VRZA 2JT4A 1AZGB 3PVLA 3NGPA 1X2KA 1M3AA 3THKA 1W1FA 4AG2C 2FRYA 3SHWA 2B86A 1PRMC 1PHTA 2JS0A 3M0RA 4LUDA 1FYNA 3RNJA 2BZXA 1UHFA 2BZYA 2K79A 5FWBA 2YUOA 2MIOA 1X69A 5GJWB 4J9EA 4OMPA 1UJYA 4IIOA 2A08A 1WXBA 2EBPA 1ZX6A 2RPNA 1JO8A 3JV3A 4J9HA 1AVZC 3A98A 4HVVA 1KFZA 1K0SA 3I9QA 4WCIA 1JXMA 4RTUA 2EGAA 2G6FX 3PVQA 2ROLA 2LQNA 4RTXA 2F2WA 1RUWA 2ESWA 1VA7A 1T3LA 3TSWA 2EYYA 2F2XA 2FPEA 5I22A 4GLMA 1CSKA 2KYMA 2DMOA 5EC7A 2YT6A 1K9AA 4ESRA 1UG1A 2CUDA 3ULRB 1SRLA 2L3PA 2EPDA 2KRMA 1H8KA 1QKWA 1WA7A 1WDXA 2L0AA 2KE9A 2LMJA 4LUEA 1M3CA 2EYXA 3I5RA 4DEXA 2JS2A 1WIEA 1WXTA 2FG0A 2D8HA 1AWWA 1ABOA 2J7IA 1Z9QA 2RF0A 4JPBW 1NLOC 2LQWA 1VYUA 4OMMA 4EIKA 1ZSGA 2LCSA 3UA7A 4JJBA 1ZLMA 4F14A 2DL4A 1OEBA 3EG1A 2EVRA 1V1CA 2RNAA 1YNZA 2F2VA 4Z88A 2X3WD 4AFZC 5HCKA 2K7AA 2KRSA 4J9FA 4X1VA 2L3SA 1GCQC 2ABLA 3R6NA 1X6GA 2C0IA 2V1QA 3M0QA 2GQIA 2EKHA 3EGUA 4K11A 2AKLA 4OMOA 2SEMA 3QWYA 2JTEA 1AOJA 1OV3A 2YUPA 2DRMA 1NLPC 4E6RA 1M27C
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2BTT A;  2DE0 X;  4JJD A;  1PKS A;  2CT3 A;  1TUC A;  1W6X A;  3U23 A;  2KBT A;  2XMF A;  1JQQ A;  1ZBJ A;  2JM8 A;  1UUE A;  2LJ0 A;  2DBK A;  4R0K A;  1E6H A;  3CQT A;  1RLP C;  1AZE A;  1Z9Z A;  2KT8 A;  1SSH A;  4J9C A;  2K3B A;  3VS0 A;  2JXB A;  3FJ5 A;  5IHI A;  1SHF A;  1NYF A;  4LE9 A;  2J05 A;  2A37 A;  2EQI A;  4LN2 A;  1TG0 A;  1SHG A;  1B07 A;  2HCK A;  1ARK A;  5I11 A;  1GCQ A;  1UDL A;  4RTT A;  2QDL A;  2LJ1 A;  1G2B A;  1RLQ C;  1QLY A;  1EFN A;  3M0U A;  1GFD A;  4J9I A;  4OMQ A;  2J6O A;  4LNP A;  2RQT A;  1E6G A;  2EYW A;  1GL5 A;  1GBR A;  1N5Z A;  2ENM A;  2VKN A;  3NHN A;  1YWP A;  2KT1 A;  1PRL C;  1ZUK A;  3REB B;  1KSW A;  1PKT A;  2W0Z A;  1PNJ A;  2AK5 A;  1T0J A;  2GGR A;  2DL5 A;  2L2P A;  3EG0 A;  1IO6 A;  2KRO A;  3VS6 A;  2D1X A;  2KXC A;  1BB9 A;  2DNU A;  1H3H A;  1RI9 A;  4JZ4 A;  4RTV A;  5FWC A;  1UTI A;  3VS3 A;  2JMA A;  2MOX A;  2VWF A;  1U3O A;  2JM9 A;  3C0C A;  3UA6 A;  2DA9 A;  2PTK A;  1GFC A;  1M30 A;  5IXF A;  2O88 A;  2J06 A;  2DL8 A;  4CC2 A;  2HDA A;  4D8K A;  5IHN A;  3EG2 A;  2LJ3 A;  3I35 A;  2GTO A;  4QT7 A;  1NEG A;  2FRW A;  2VVK A;  3H41 A;  4AG1 C;  2AZS A;  2LNH B;  2RQU A;  4D8D A;  3H0F A;  1U5S A;  1MV3 A;  1M3B A;  1KJW A;  1UHC A;  2M51 A;  2O9S A;  2IIM A;  1J3T A;  4J9B A;  1UFF A;  2OAW A;  1YWO A;  4IIM A;  5IH2 A;  2FO0 A;  1W70 A;  2JMC A;  1HD3 A;  2C0T A;  1NEB A;  5ECA A;  1UGV A;  2BZ8 A;  1I07 A;  3TSZ A;  4OMN A;  2O9V A;  2GNC A;  2KGT A;  2CRE A;  2M0Y A;  3ZL7 C;  2D8J A;  2GBQ A;  2C0O A;  5GJV B;  2RN8 A;  1K0X A;  1CKA A;  2E5K A;  2AZV A;  2CH4 W;  2EW3 A;  4J9D A;  3M0P A;  1SRM A;  2PZ1 A;  3IQL A;  3O5Z A;  2CUB A;  2W10 A;  4GBQ A;  3UF4 A;  1K76 A;  5IXB A;  4Z89 A;  2YUQ A;  4F16 A;  1BU1 A;  2ECZ A;  3H0H A;  2KEA A;  2V1R A;  2H8H A;  1M8M A;  3EG3 A;  4CC3 A;  2HBW A;  1WXU A;  4Y92 A;  4RTY A;  2YUN A;  1K4U S;  4CC7 A;  1Y0M A;  4ZNX A;  2EYZ A;  2KYB A;  1B3Q A;  2DYB A;  1TUD A;  1SPK A;  2CT4 A;  1A0N B;  1KIK A;  4AFS C;  3QWX X;  1I1J A;  2DJQ A;  1VYT A;  1OOT A;  3NMZ C;  1AWO A;  2J6F A;  2KNB B;  2FPF A;  3GBQ A;  2OI3 A;  3I5S A;  1YN8 A;  1HJD A;  1LCK A;  1QCF A;  4Z8A A;  2CSQ A;  1ZUY A;  1WI7 A;  2NUZ A;  4AFQ C;  3LH5 A;  2NWM A;  1MV0 B;  1NG2 A;  2DRK A;  4OML A;  2KRN A;  3UAT A;  1JU5 C;  2JW4 A;  1WX6 A;  2DF6 A;  1X43 A;  2FEI A;  4JJC A;  2CDT A;  4CC4 B;  1GCP A;  3EHR A;  1H92 A;  1JXO A;  1QWF A;  1Y57 A;  2J6K A;  1BK2 A;  2O2O A;  2DIL A;  3EHQ A;  2DL3 A;  3REA B;  2FPD A;  2K9G A;  2YSQ A;  1MUZ A;  2GTJ A;  1PWT A;  1WLP B;  4AFU C;  4A63 B;  1ZUU A;  2L3Q A;  3VS1 A;  5IHK A;  2KXD A;  3SEM A;  1QKX A;  4HVW A;  2K2M A;  4RTZ A;  1FMK A;  1X2Q A;  3PE0 A;  4KRT A;  1UJ0 A;  2RQR A;  1YCS B;  2LP5 A;  1XOV A;  2RQV A;  2ROT A;  2P4R A;  1AWJ A;  1GBQ A;  2HEQ A;  3H0I A;  3KFV A;  4RTW A;  2LZ6 B;  2DLP A;  5FW9 A;  1E7O A;  1K1Z A;  3VRY A;  1OPK A;  1X6B A;  2O31 A;  1AWX A;  4J9G A;  1WFW A;  4HCK A;  1T3S A;  1QWE A;  4RUG A;  4JZ3 A;  1S1N A;  1UE9 A;  3M0S A;  1CKB A;  2DBM A;  5L23 A;  4HVU A;  3VS2 A;  2EGE A;  1WYX A;  1ABQ A;  4ORZ A;  1OPL A;  4FSS A;  2RQW A;  1HSQ A;  1GRI A;  4M4Z A;  2DX1 A;  3VS5 A;  1NYG A;  1G83 A;  1UEC A;  2A28 A;  2LX7 A;  1JEG A;  3M0T A;  1U06 A;  2SRC A;  1YP5 A;  1VYV A;  2OJ2 A;  2DM1 A;  2RMO A;  2A36 A;  1AD5 A;  2K6D A;  4HXJ A;  2ED1 A;  2MCN A;  2ED0 A;  4F17 A;  1SEM A;  1BBZ A;  2YDL A;  1I0C A;  1X27 A;  3RBB B;  1NM7 A;  3VS7 A;  2PNI A;  2D0N A;  2I0N A;  2KR3 A;  3NPF A;  2AKK A;  2DVJ A;  3TVT A;  4DEY A;  2EGC A;  1AEY A;  2X3X D;  3VS4 A;  2CH4 A;  2HSP A;  1T0H A;  2CSI A;  2DL7 A;  3VRZ A;  2JT4 A;  1AZG B;  3PVL A;  3NGP A;  1X2K A;  1M3A A;  3THK A;  1W1F A;  4AG2 C;  2FRY A;  3SHW A;  2B86 A;  1PRM C;  1PHT A;  2JS0 A;  3M0R A;  4LUD A;  1FYN A;  3RNJ A;  2BZX A;  1UHF A;  2BZY A;  2K79 A;  5FWB A;  2YUO A;  2MIO A;  1X69 A;  5GJW B;  4J9E A;  4OMP A;  1UJY A;  4IIO A;  2A08 A;  1WXB A;  2EBP A;  1ZX6 A;  2RPN A;  1JO8 A;  3JV3 A;  4J9H A;  1AVZ C;  3A98 A;  4HVV A;  1KFZ A;  1K0S A;  3I9Q A;  4WCI A;  1JXM A;  4RTU A;  2EGA A;  2G6F X;  3PVQ A;  2ROL A;  2LQN A;  4RTX A;  2F2W A;  1RUW A;  2ESW A;  1VA7 A;  1T3L A;  3TSW A;  2EYY A;  2F2X A;  2FPE A;  5I22 A;  4GLM A;  1CSK A;  2KYM A;  2DMO A;  5EC7 A;  2YT6 A;  1K9A A;  4ESR A;  1UG1 A;  2CUD A;  3ULR B;  1SRL A;  2L3P A;  2EPD A;  2KRM A;  1H8K A;  1QKW A;  1WA7 A;  1WDX A;  2L0A A;  2KE9 A;  2LMJ A;  4LUE A;  1M3C A;  2EYX A;  3I5R A;  4DEX A;  2JS2 A;  1WIE A;  1WXT A;  2FG0 A;  2D8H A;  1AWW A;  1ABO A;  2J7I A;  1Z9Q A;  2RF0 A;  4JPB W;  1NLO C;  2LQW A;  1VYU A;  4OMM A;  4EIK A;  1ZSG A;  2LCS A;  3UA7 A;  4JJB A;  1ZLM A;  4F14 A;  2DL4 A;  1OEB A;  3EG1 A;  2EVR A;  1V1C A;  2RNA A;  1YNZ A;  2F2V A;  4Z88 A;  2X3W D;  4AFZ C;  5HCK A;  2K7A A;  2KRS A;  4J9F A;  4X1V A;  2L3S A;  1GCQ C;  2ABL A;  3R6N A;  1X6G A;  2C0I A;  2V1Q A;  3M0Q A;  2GQI A;  2EKH A;  3EGU A;  4K11 A;  2AKL A;  4OMO A;  2SEM A;  3QWY A;  2JTE A;  1AOJ A;  1OV3 A;  2YUP A;  2DRM A;  1NLP C;  4E6R A;  1M27 C; 
#chains in the Genus database with same CATH topology
 4F7U B;  4ZGJ B;  1PKS A;  3RMQ A;  1YIT T;  1JQQ A;  2JN0 A;  1KC8 U;  1UUE A;  2QA4 T;  4R0K A;  1WZO A;  1E6H A;  1WPY A;  3L42 A;  2L8D A;  1VQL T;  1Z9Z A;  3RER A;  2RHU A;  3OYG A;  1VQK T;  1YIJ A;  2DYI A;  2IVW A;  1VIF A;  4XU3 A;  3NTH A;  3VS0 A;  1QVF P;  3QJ6 A;  3MEA A;  2QAS A;  5IHI A;  2IG0 A;  1VQ8 A;  4RMO A;  4PNO A;  2RHY A;  4F7U G;  2F1L A;  3RKY A;  4LN2 A;  5KYW B;  1SHG A;  3CCL Q;  2OAU A;  3HRS A;  3CMA A;  2QDL A;  1QLY A;  1GFD A;  2CP5 A;  3SB2 A;  2J6O A;  4KT0 E;  2EYW A;  1GL5 A;  2RO0 A;  2D9T A;  1KD1 C;  3NHN A;  1YWP A;  1UGQ B;  3REB B;  4YTL A;  3JCM V;  4M78 G;  5LJ5 j;  2MK5 A;  3JCM d;  2ZPE B;  3F70 A;  3M58 A;  2COZ A;  3MO8 A;  1G3S A;  2DNU A;  7AT1 B;  1MMN A;  2VB6 A;  2O4X A;  5FWC A;  3MET A;  2JMA A;  4OB2 B;  1VQM Q;  3OBY A;  4MMK A;  1TWB A;  2JM9 A;  3M5A A;  3DB4 A;  1UEB A;  5GMK j;  5IXF A;  1PSF A;  1OZ3 A;  2O88 A;  2J06 A;  2JNG A;  3QG1 A;  2DTO A;  1PC0 A;  4NS5 A;  3H8Z A;  4LDY A;  1WHJ A;  2DZ9 A;  5LJ5 d;  1X75 C;  4QVZ A;  2DEU A;  1IZ6 A;  1N8R C;  2L5Q A;  4ZGD B;  3O8V A;  2XDB A;  1U5S A;  4RG8 A;  3JB9 J;  1MV3 A;  2A3L A;  4DA4 A;  1UHC A;  2LT4 A;  1VQL Q;  2PUO B;  2QQA A;  1D1B A;  2H3E B;  2L3R A;  4J9B A;  2NUP A;  2ZPG B;  1BCM A;  1RAA B;  1TSF A;  1YWO A;  4IIM A;  3MKD A;  3JAM E;  2RI5 A;  4O6J A;  3TCJ A;  1I07 A;  3EG9 B;  3WVE B;  1QVF S;  4EMK B;  3OMC A;  3CC2 Q;  2KGT A;  2OTL A;  5LJ3 e;  1K9M U;  1K0X A;  4ZN1 A;  5CKF A;  2E5K A;  2V8K A;  2V26 A;  3D7S B;  4B9X A;  2A0F B;  2AHJ B;  3IQL A;  1RAH B;  4C92 F;  2DD5 A;  4C5I A;  3UF4 A;  4KUI A;  3SFM A;  1QQJ A;  3EFO B;  3CC4 Q;  2V1R A;  1M8M A;  2EKO A;  1BIA A;  4BI3 A;  3G4S T;  5GAN d;  3QPH A;  4M78 C;  2YUN A;  3V8K A;  4E7Z A;  4ZNX A;  2EYZ A;  3GOX A;  1SPK A;  2CT4 A;  4C92 A;  1KIK A;  1JRI A;  3QWX X;  5CCA A;  2R5A A;  1K73 C;  3LH0 A;  4FL6 A;  4L5G A;  3SDZ A;  1AWO A;  2FPF A;  5LL6 S;  3I5S A;  3FC3 A;  5LJ5 e;  3TRE A;  3HL8 A;  1HJD A;  3EFO A;  1QCF A;  3QDR B;  1ZUY A;  1PM3 A;  4AFQ C;  2QEX A;  1MND A;  1QCO A;  4OML A;  3T9N A;  2X35 A;  2RJC A;  5GAO p;  4JJC A;  4B6M A;  2CDT A;  4M77 C;  5J26 A;  4CC4 B;  3OSS C;  3GF5 A;  3P8D A;  4M7A D;  1BK2 A;  2O2O A;  4A54 A;  4RCC A;  3JB9 F;  2YSQ A;  2GQV A;  2AT1 B;  1PWT A;  1WLP B;  4C92 G;  1YIT Q;  2LCL A;  4ME7 A;  4D6W A;  1ZUU A;  2X51 A;  5IHK A;  3JCM h;  4DOV A;  3CC4 T;  3M4Y A;  2KXD A;  4IKF A;  2K2M A;  1X2Q A;  3PE0 A;  2NYS A;  5I2S A;  4LXC A;  4M7A E;  3MEV A;  4C8Q D;  1VQP Q;  2DAQ A;  1VQO Q;  2ROT A;  4QQG A;  4XU0 A;  4BI4 A;  2DLP A;  2QGF B;  3CCS T;  5GAM e;  1OPK A;  3FJP A;  3P8B B;  1X01 A;  3RKW A;  3TQ7 P;  4HCK A;  3CMA T;  1QWE A;  1Q81 R;  1K8A C;  1QP2 A;  2DBM A;  5LJ5 h;  1MGQ A;  5L23 A;  3VS2 A;  2R5M A;  3CCJ Q;  2EGE A;  1VQ8 T;  1SG5 A;  1Q7Y C;  1GRI A;  4M78 D;  2DX1 A;  2V8I A;  3VS5 A;  8AT1 B;  3G71 A;  1NYG A;  4E7K A;  4PJO E;  1MMA A;  2HL5 C;  4NL2 A;  4A4F A;  2E3I A;  5CAI A;  3JCM X;  2MI6 A;  3CBO A;  1U06 A;  2EJF A;  2KDS A;  2RMO A;  2A36 A;  1YIJ Q;  3M4G A;  3C94 A;  3HFN A;  4JLG A;  1SEM A;  4N4H A;  3RBB B;  1NM7 A;  1NJI U;  1VQ7 A;  4PJO D;  4C92 B;  5J3B A;  2X3X D;  1ZSZ C;  5CKH A;  3QSU A;  2DL7 A;  2JT4 A;  4HCZ A;  3I55 Q;  4BAC A;  2QXF A;  4AMC A;  5AYF A;  1KQS P;  2KVQ G;  3I55 T;  2E70 A;  3CC7 Q;  3G4S Q;  3H6Z A;  1JJ2 A;  2JS0 A;  4M7A C;  1PG5 B;  4LUD A;  1VQN Q;  1UHF A;  5GAM h;  2BZY A;  2K79 A;  5HK0 A;  5A2Q E;  1C6V X;  2YUO A;  2XDP A;  2DVE A;  3LGL A;  2BUD A;  4OMP A;  4IUU A;  4IIO A;  3JCM b;  4C5H A;  1RAF B;  1WXB A;  2QTX A;  1VQN A;  3EGX A;  1ZX6 A;  3J81 E;  1NZ9 A;  1WHG A;  3X26 B;  1G3T A;  4ELZ C;  4A53 A;  4RTX A;  4JRK A;  2F2W A;  1RUW A;  2ESW A;  6AT1 B;  3TSW A;  2EYY A;  4C0Z A;  5I22 A;  3ASK A;  2EQJ A;  2Y4X A;  1CSK A;  1RAD B;  2M1H A;  5EC7 A;  4LD6 A;  3CBP A;  4PJO F;  4LDX A;  2KAF A;  4C8Q E;  2LRQ A;  1K9M C;  1M2V B;  3JSC A;  1OUL A;  1YBY A;  2EYX A;  1KHI A;  3CCU Q;  1LNX A;  2FG0 A;  3EFR A;  4PFO A;  1M1K U;  3WVD B;  4EIK A;  2LQW A;  1VYU A;  4WF2 A;  5DLQ E;  1ZSG A;  1D1C A;  2HNI A;  1Y71 A;  3DB3 A;  3OS5 A;  3CCS Q;  2YLB A;  4JJB A;  5HY6 A;  1M1G A;  2VUB A;  3EGX B;  4L59 A;  4F14 A;  1U8R A;  3CME Q;  2DL4 A;  4A4H A;  4DQ2 A;  2YRD A;  3CCJ A;  4BE2 A;  1Y96 B;  2OTJ T;  2E10 A;  2K7A A;  1M5Q 1;  4J9F A;  4X1V A;  2ABL A;  2PUK B;  5L8R E;  3QXE B;  2WSC E;  3H9N A;  1SF9 A;  3EGU A;  2FVU A;  3X24 B;  1HK9 A;  2SEM A;  4A4E A;  2JZ2 A;  4M7D D;  5GAO n;  2M02 A;  1TTH B;  5DM7 R;  1D09 B;  3CPW P;  2G3R A;  4JJD A;  4DOW A;  3OYM A;  3NTI A;  1TUC A;  4OB3 B;  3U23 A;  2XMF A;  2VXE A;  2X4J A;  5IN1 A;  1YJW Q;  4M7A G;  1RLP C;  1AZE A;  3PIP A;  2KT8 A;  4ATO A;  4J9C A;  3DLM A;  2K3B A;  3MEW A;  1DJ7 B;  3HKS A;  5D7U A;  4KUL A;  3OYE A;  3CCU A;  2ZCF B;  4GY5 A;  1OZ2 A;  2JXB A;  2CP3 A;  3PTA A;  1NYF A;  2L89 A;  4XTY A;  5GAN 8;  1VQ6 Q;  3L1A A;  1N27 A;  1B07 A;  2XKO C;  2NUP B;  1FX7 A;  1GCQ A;  1UDL A;  1M90 C;  1W4S A;  1G2B A;  3CXC S;  3JB9 I;  1EFN A;  3CCE Q;  3OYL A;  4J9I A;  2ATC B;  1RI0 A;  2HQH A;  3BFM A;  4LNP A;  1VQ6 A;  1E6G A;  5M9O A;  4F04 B;  1JBM A;  1N5Z A;  2X9H A;  5LJ5 g;  2ENM A;  3PT9 A;  5LJ3 g;  2MWO A;  1KQS S;  4PKC C;  2EYQ A;  1PNJ A;  5CQX A;  5IAY A;  3C12 A;  2GGR A;  4QQD A;  1IO6 A;  4HCC A;  1K73 R;  2HQE A;  1BB9 A;  2CZ1 B;  1RI9 A;  1O9S A;  1KK7 A;  5KYU A;  4PLI A;  2VWF A;  3G6E Q;  1U3O A;  1FMW A;  1Q82 R;  1WNL A;  3UA6 A;  4WTO B;  4RG2 A;  4PFP A;  1BI1 A;  3JCM g;  3INZ A;  3CC2 A;  4FYV B;  3S6W A;  5IHN A;  4JLI A;  3EG2 A;  2HMA A;  4M7D F;  4HKE A;  4HA8 A;  2FRW A;  2P0K A;  3X25 B;  1WHL A;  2HD0 A;  4ZTJ A;  3H0F A;  3RMS A;  5GAN j;  4E7I A;  1M3B A;  4BE1 A;  1KJW A;  4FIB A;  2M51 A;  4F7U A;  2O9S A;  3NTK A;  4N0A A;  2IIM A;  2OTJ Q;  4M75 G;  2CP7 A;  4FYW B;  4LDW A;  3G71 T;  1W70 A;  2PVD B;  8ATC B;  5KYY B;  4E47 A;  1UGV A;  1H3Z A;  2DPP B;  4OMN A;  2OTJ A;  1I5L A;  2KK4 A;  3ZL7 C;  4R55 A;  4M78 A;  5GJV B;  3QUI A;  4L6V 5;  3QDF A;  1SRM A;  1BI0 A;  2PZ1 A;  5FRM A;  2CYZ B;  1MNE A;  4XTV A;  3PMT A;  1AHJ B;  4C8Q F;  4A4G A;  2ECZ A;  5FU6 C;  4M75 D;  1Q7Y R;  2KEA A;  2Z0W A;  3JB9 H;  2YLC A;  3JCM P;  1WGS A;  2HBW A;  3CXC A;  3TU4 K;  1WXU A;  3OY9 A;  1WJR A;  2QQR A;  4ANJ A;  4KUD K;  1K4U S;  2EQM A;  1Y0M A;  4M77 B;  3RR6 A;  1U1S A;  4OB1 B;  1OX9 A;  1BIB A;  1QCN A;  4AFS C;  3EFS A;  4TVR A;  1LVK A;  5KYX B;  3JB9 G;  1OOT A;  3NMZ C;  4LDV A;  1KQ2 A;  2J6F A;  1TXQ A;  5KYY A;  1YN8 A;  1VQP T;  1LCK A;  4Z8A A;  1WI7 A;  2NWM A;  1MV0 B;  4QVD A;  2KRN A;  2EFI A;  4F7U E;  3CMA Q;  2NLU A;  3CCL A;  1OU9 A;  4O5V A;  1H92 A;  1Y57 A;  4CRI A;  1KHC A;  3EHQ A;  3ZBD A;  2E12 A;  1WQW A;  2DL3 A;  1M8V A;  3M9Q A;  3JCM W;  2FPD A;  4J6X A;  2K9G A;  1MUZ A;  2GTJ A;  2JOY A;  3GNG A;  3LLR A;  2CKK A;  4A63 B;  4M75 C;  2QK0 A;  1FMV A;  2K3Y A;  1YJN A;  1N9S A;  1ZSZ B;  2VGM A;  2Y4Y A;  1QKX A;  5GMK m;  4RTZ A;  4OF1 A;  3G71 Q;  1HXD A;  1UJ0 A;  5A0G A;  2E3H A;  2QAZ A;  2RQR A;  2LP5 A;  4II1 A;  1QP3 A;  1ZHI A;  2HEQ A;  1YHQ Q;  1VQ9 Q;  2XK0 A;  2QA4 Q;  4MZT A;  1NJI C;  5FW9 A;  3RKX A;  1KC8 C;  1D3B B;  4PJL A;  1E7O A;  1K1Z A;  4FW2 A;  5EG2 A;  4DBQ A;  3OYF A;  2XID A;  4KGV B;  1VQP A;  1AWX A;  2YWW A;  4BE0 A;  1RAI B;  3CCE T;  3M0S A;  4ZN3 A;  2X4X A;  3CCQ T;  1XQH A;  4C8Q C;  4X34 A;  5LJ3 f;  2DKG A;  4M4Z A;  2E65 A;  3JB9 D;  1H64 1;  2QDY B;  2A28 A;  3M0T A;  1I8F A;  5GAN f;  1YI2 A;  1ZA1 B;  1WQ7 A;  2DM1 A;  1V29 B;  1AT1 B;  3UPU A;  1TUG B;  1VQM A;  1AD5 A;  3LGF A;  1JJ2 S;  1BBZ A;  2YDL A;  1I0C A;  1X27 A;  5KE3 A;  3VS7 A;  4C5E A;  5GAO q;  2I0N A;  4M77 A;  3JCM J;  4OMF B;  3TVT A;  4DEY A;  2EGC A;  1KQS A;  1AEY A;  2CH4 A;  3X28 B;  2DIQ A;  2CSI A;  3VRZ A;  3NGP A;  3ZEH A;  4M7D B;  5GAN 6;  2KY9 A;  2JTF A;  4XTU A;  3THK A;  1W1F A;  4IUQ A;  2FRY A;  3BDL A;  2B86 A;  4FYY B;  4BDZ A;  2WSE E;  2BZX A;  4VUB A;  1VQ5 Q;  1RAC B;  4C92 C;  2MIO A;  1XTD A;  1B34 A;  3RDV A;  3EH1 A;  3BE3 A;  5GAN 4;  1AVZ C;  4J8O A;  3A98 A;  5CO7 A;  4ZTF A;  1KFZ A;  4ZGE B;  2HL3 A;  1IHV A;  2B8A A;  1JXM A;  2EGA A;  2G6F X;  3VUB A;  4M7D A;  1IXD A;  2ROL A;  3MEU A;  2XDD A;  4MZP A;  4J6Y A;  3GPL A;  2F2X A;  1OI1 A;  2VYT A;  4GLM A;  2XG8 D;  4M75 A;  2KYM A;  3CCE A;  1VQ9 T;  1K73 U;  4AT1 B;  1UGP B;  1OU8 A;  3ULR B;  3C95 A;  5GAN 5;  1SRL A;  2XIC A;  2L3P A;  3BY7 A;  4E2F B;  2XI9 A;  5LJ5 f;  1PD0 A;  1WA7 A;  1WDX A;  1Q95 G;  4M75 F;  1WIE A;  2KI7 A;  4LD9 K;  1KC8 R;  2J7I A;  4XU1 A;  4JPB W;  1VQ4 A;  1W2B P;  1WHH A;  4JS4 A;  4FT4 A;  1ZLM A;  2WSF E;  1YIT A;  1S72 Q;  2EVR A;  3OSV A;  4OGE A;  5GMK h;  1YCY A;  2LNV A;  4PJO C;  4QKU A;  5KYU B;  2F2V A;  4Z88 A;  4M7D G;  2JVV A;  5HCK A;  3OW2 P;  4EMG A;  4EMK C;  3R6N A;  1X6G A;  2EJ9 A;  2GQI A;  2EKH A;  1TS9 A;  3LW5 E;  3QWY A;  2EQK A;  5CKE A;  3KBG A;  1SSF A;  4KGZ B;  2YUP A;  4E6R A;  2ZPB B;  2BTT A;  2DJZ A;  3R6O A;  2PVG B;  2QEX Q;  5C6S A;  3EGD B;  2MWP A;  1W6X A;  2KBT A;  2LJ0 A;  2DBK A;  4XAX B;  1M2O A;  3FEO A;  3S3M A;  3CQT A;  3GIB A;  4EPC A;  1SSH A;  4PJN A;  1WJQ A;  4BB7 A;  1R0B G;  1N8R U;  3FJ5 A;  4X9C A;  2A37 A;  2EQI A;  4X9D A;  4IUR A;  1PCX A;  1IGQ A;  2LJ1 A;  3M0U A;  1D1A A;  4OMQ A;  2EWN A;  3M54 A;  1GBR A;  4C0D B;  2VKN A;  1ZUK A;  1KSW A;  1PKT A;  2W0Z A;  1T0J A;  3EG0 A;  3OYJ A;  2QQB A;  3J80 E;  3URG A;  1R77 A;  4DBH A;  2D1X A;  2RK1 A;  2CZ7 B;  1SKU B;  1H3H A;  4JZ4 A;  5KYX A;  3I56 Q;  1M1K R;  4NOY A;  1QVP A;  2MOX A;  3JCM f;  3CC2 T;  4XU2 A;  1VQK Q;  3C0C A;  3RES A;  2DA9 A;  2PTK A;  3EG9 A;  3E9F A;  4PJM A;  4E7H A;  1RAG B;  2DL8 A;  3GNF B;  4N4G A;  2HDA A;  4D8K A;  4FM4 B;  2LJ3 A;  2F5K A;  2GTO A;  4QT7 A;  3JCM e;  2BE7 D;  3OS0 A;  2VVK A;  3H41 A;  4AG1 C;  3V7C A;  3S3N A;  1F1B B;  1N6A A;  3I55 A;  3QZ9 B;  2DTH A;  4M77 D;  4EDU A;  1M9S A;  2DFU A;  1B7T A;  4C0F A;  1WHM A;  3M57 A;  1X6O A;  1J3T A;  2QGG A;  3LWH A;  1D0X A;  1UFF A;  2OAW A;  2CP0 A;  4DBF A;  5GAM j;  5IH2 A;  2FO0 A;  4BY6 C;  1HD3 A;  5GAN 7;  4C8Q G;  1Q86 U;  5ECA A;  1VQ7 T;  4PJO G;  2D0Q B;  2RHI A;  1BI2 A;  2GNC A;  1KD1 U;  2CRE A;  2M0Y A;  2OTL T;  1CKA A;  1C1A A;  1YJN Q;  1P92 A;  2DZC A;  2EW3 A;  1VIE A;  4J9D A;  3CC7 T;  3LX7 A;  1XNI A;  1LOJ A;  3L2W A;  1BI3 A;  5GAN e;  3KXT A;  1K76 A;  2K2V A;  2YRC A;  3MPU B;  4Z89 A;  5LJ3 d;  2YUQ A;  1HYO A;  2M16 A;  5GAO m;  3H0H A;  3OYH A;  2QYZ A;  1Q81 U;  4HT9 A;  1VQ9 A;  5LJ3 j;  3EG3 A;  4CC3 A;  4PFZ A;  3SWN C;  2JJ9 A;  5CR2 A;  3LWI A;  3OS1 A;  4CC7 A;  2ZPH B;  2K5I A;  4UC4 A;  4C8Q A;  2KYB A;  2DYB A;  2BE9 B;  1YJ9 A;  2DJQ A;  3CCU T;  1VYT A;  3OYK A;  3E2U A;  5GMK e;  3HPW A;  2KNB B;  3GBQ A;  2P4T A;  5FU6 B;  2NUZ A;  2K57 A;  1YI2 Q;  3LH5 A;  1NG2 A;  4M7A A;  4FYX B;  3UAT A;  3VUZ A;  1JU5 C;  3OA6 A;  1WX6 A;  4XK8 E;  1GCP A;  5HK3 A;  3EHR A;  1YHQ A;  4N0A C;  1JXO A;  1XJW B;  2DIL A;  1VQ5 T;  3CD6 T;  4M78 E;  2V8J A;  4CI0 C;  4BUG A;  1Y07 A;  1I5O B;  2P84 A;  3V8L A;  3SEM A;  1VQM T;  1QVF A;  2E4H A;  4BI8 B;  3ER0 A;  2RHX A;  3A5Z B;  4P5N A;  3SD4 A;  1VOM A;  1XOV A;  4M77 E;  1AWJ A;  3H0I A;  2K5F A;  4MDW A;  3KFV A;  1OYX A;  4Y91 A;  3SWN B;  1VQL A;  5GMK i;  4XTZ A;  4JS5 A;  3PGG A;  1KG1 A;  5AT1 B;  1MHN A;  1NBE B;  4J9G A;  1WFW A;  1T3S A;  4RUG A;  4C0G A;  1B34 B;  4JZ3 A;  5LJ3 h;  2EJG A;  1CKB A;  2HSE B;  4GLK A;  5GMK l;  2O01 E;  1G5V A;  2HKN A;  1PD1 A;  1WYX A;  1ABQ A;  4ORZ A;  2RJE A;  1NPR A;  3C4S A;  1G83 A;  3QYH B;  3E1S A;  1YJ9 T;  1VQ8 Q;  2LX7 A;  4FW1 A;  1G3Y A;  1JEG A;  4M7A B;  2A7Y A;  2F69 A;  4OP0 A;  2RA2 A;  1IGU A;  2SRC A;  4E7L A;  3ZFJ A;  1VYV A;  2X4W A;  1M2V A;  2RD1 A;  3HFO A;  1VQ4 T;  3OW2 A;  1YJN T;  2K6D A;  5DLO A;  4HXJ A;  2ED1 A;  2MCN A;  5KCO A;  2PNI A;  2YHT A;  2KR3 A;  3NPF A;  3UWN A;  5HKC A;  2K3X A;  2FYK A;  5DY9 A;  2HSP A;  1T0H A;  1M4Z A;  1AZG B;  2DET A;  2GFU A;  2KSS A;  4JRP A;  4E7J A;  3OB9 A;  1O75 A;  5KE2 A;  2VXF A;  2FZC B;  1VQ6 T;  4HCB A;  4FSX A;  3AHU A;  2HKQ B;  3A8H B;  3M0R A;  4EMH A;  3HHT B;  3RNJ A;  2RI2 A;  3OQ5 A;  3NFC A;  4E7S A;  5FWB A;  2DER A;  9ATC B;  3QO3 A;  5GJW B;  4C92 D;  4J9E A;  5I2M A;  3HTR A;  2A08 A;  3CEY A;  2EBP A;  1V76 A;  1FXX A;  3JV3 A;  4J9H A;  4HVV A;  1YFN A;  1VQ4 Q;  4RTU A;  5D6X A;  2LQN A;  4JDS A;  4M7D E;  2FPE A;  4FT2 A;  5GAN 2;  2RI3 A;  2VAS A;  2DIG A;  3M56 A;  4FU6 A;  5C0M A;  5KYN A;  1UG1 A;  2CUD A;  3CCV T;  3CD6 Q;  4HT8 A;  1C0M A;  1ZSZ A;  2GFA A;  2KRM A;  4N4I A;  1KD1 R;  2LT1 A;  2KE9 A;  3RUX A;  4LUE A;  3OYB A;  3L2V A;  4DEX A;  2D8H A;  1UGS B;  4PJJ A;  1AWW A;  1Z9Q A;  2RF0 A;  1VQO A;  1NLO C;  2OX7 A;  3V8J A;  5GAN 3;  2LCS A;  3CCM T;  1Q82 U;  2RJF A;  3CPW S;  2I2L A;  4QQ6 A;  2RNA A;  2RJD A;  1FWZ A;  1W2B S;  1YNZ A;  5FRO A;  1N9R A;  3CCR A;  2X3W D;  4AFZ C;  4C8Q B;  3EAE A;  3FB9 A;  3HP9 A;  5GAM g;  1VQK A;  1GCQ C;  1QVG A;  1G8X A;  2C0I A;  2VV5 A;  2RHZ A;  2V1Q A;  3CCQ A;  3M0Q A;  4K11 A;  2DXT A;  2AKL A;  2H3J A;  4OMO A;  5KYW A;  2XD0 A;  1AOJ A;  3CCR T;  3OYA A;  1OV3 A;  2QA4 A;  3FIF A;  2DRM A;  1M27 C;  1I81 A;  3BW1 A;  2K5L A;  2DE0 X;  2DO3 A;  2COY A;  3M59 A;  2CT3 A;  3OYD A;  1VUB A;  3N5B B;  1LJO A;  4OGC A;  3OYY A;  1ZBJ A;  2K4Y A;  1YIJ T;  2JM8 A;  1MMD A;  3DLL A;  2ZZD A;  1OQK A;  1D0Y A;  3MP6 A;  2QEX T;  1JJ2 P;  1Q81 C;  1K8A R;  1YI2 T;  3UT1 A;  1RAE B;  1ZBX A;  3LYI A;  2C06 A;  3L2Q A;  1VQN T;  3JRZ A;  4Y28 E;  1NJI R;  1I4K 1;  2RB6 A;  3I56 A;  1SHF A;  4RCB A;  4LE9 A;  3HRT A;  2J05 A;  2PVO B;  1EZZ B;  2NUT B;  1TG0 A;  1KQ1 A;  2HCK A;  1ARK A;  5I11 A;  4XTW A;  4RTT A;  1RLQ C;  3A8L B;  3G4S A;  2RQT A;  1WJS A;  2MF2 A;  3A8O B;  2KT1 A;  4RKU E;  1PRL C;  3DKM A;  4C92 E;  5CKD A;  2NUT A;  1G3W A;  2MPX C;  4MDX A;  2AK5 A;  3VJP A;  2BIV A;  2DL5 A;  2L2P A;  2FB7 A;  2DXB A;  2WAC A;  2KRO A;  2P0Q A;  1YJW T;  5GAN g;  3VS6 A;  2CP2 A;  2KXC A;  4IUV A;  4RTV A;  3CXC P;  3AT1 B;  2X4Y A;  4B9W A;  1UTI A;  3VS3 A;  3MP8 A;  5FU7 B;  2FHD A;  1GFC A;  5A0L A;  4QW2 A;  1M30 A;  2GF7 A;  4J7I A;  4Q5W A;  1LPL A;  4CC2 A;  1IRE B;  4M7D C;  3CCL T;  4BY6 B;  3I35 A;  2LC4 A;  4KGX B;  2ZPF B;  2RH2 A;  1NEG A;  2R57 A;  2AZS A;  2LNH B;  4M78 F;  1EIF A;  2BKD N;  2RQU A;  4D8D A;  4JRI A;  3CCS A;  2LVM A;  1QW1 A;  2LQK A;  3CCQ Q;  2GCX A;  3OS2 A;  3L2R A;  2E1H A;  5IT9 E;  3G1J A;  2DD4 A;  1D3B A;  2JMC A;  2C0T A;  1NEB A;  3V7R A;  2PQW A;  4F7U F;  3MHX A;  2QG9 B;  3JCM Q;  2BZ8 A;  3CCM Q;  3TSZ A;  4ELY C;  1BCO A;  2O9V A;  4PL6 A;  2D8J A;  5KCH A;  3CC4 A;  2GBQ A;  2C0O A;  4V2S A;  4PJO B;  2RN8 A;  1VQ5 A;  1Q86 C;  5FU7 C;  2AZV A;  2CH4 W;  2M0O A;  3M0P A;  3CCM A;  1D0Z A;  3O5Z A;  2CUB A;  2HQX A;  2W10 A;  4GBQ A;  1VQO T;  4XTX A;  5IXB A;  2EAY A;  3CCV Q;  3ME9 A;  5D6W A;  1BU1 A;  2EIF A;  2H8H A;  2LQ8 A;  3PFS A;  3KUF A;  5I21 A;  5FRN A;  4Y92 A;  3L2U A;  3CCV A;  1R8O B;  1Y7X A;  4RTY A;  4OVA A;  4QVC A;  4J7F A;  2LCC A;  1B3Q A;  2O4X B;  1TUD A;  5D6Y A;  1A0N B;  2KMT A;  2P0P A;  2IPO B;  3CPF A;  1K9M R;  3VYG A;  3GP8 A;  1I1J A;  5GAM f;  3EH2 A;  3X20 B;  2QI2 A;  3QKJ A;  3VU3 C;  1RAB B;  2OI3 A;  4KBM B;  2DEQ A;  3QHS A;  2CSQ A;  4MML A;  3OYI A;  1TOV A;  1BKB A;  2CP6 A;  5CVI A;  2MAM A;  3E9G A;  2DRK A;  1Q7Y U;  2E5Q A;  1NE8 A;  2JW4 A;  3A8M B;  5A0D A;  2DF6 A;  1X43 A;  1YJW A;  2FEI A;  4C0D C;  3QBY A;  1WHK A;  5FLX E;  3OYC A;  2QQ9 A;  1QWF A;  2J6K A;  3EGD A;  4JJN K;  1QVG S;  4IUT A;  2LTO A;  1JB0 E;  1M90 U;  3REA B;  3P8H A;  3CME A;  4AFU C;  2YRV A;  4KH1 B;  3CPW A;  2L3Q A;  3VS1 A;  3OYN A;  1RL2 A;  2OTL Q;  2E6Z A;  4HVW A;  1FMK A;  5CKB A;  2M9U A;  4KRT A;  2MMP A;  1M1F A;  3FRN A;  2ZPI B;  2DTI A;  1YCS B;  4M78 B;  2RQV A;  2E64 A;  2CGH A;  2P4R A;  1GBQ A;  1IHW A;  2VGN A;  4RTW A;  2LZ6 B;  1PSE A;  3VV0 A;  3HSB A;  3VRY A;  3L2Z A;  2MYS A;  1X6B A;  4PK4 A;  2XHC A;  2O31 A;  2YXY A;  1IB8 A;  1S1N A;  1UE9 A;  4J6W A;  3A8G B;  2FL7 A;  4BD3 A;  1ACM B;  3G6E A;  4PJO A;  4HVU A;  3PNW C;  1Q86 R;  2FZG B;  1OPL A;  2Y90 A;  3QII A;  4FSS A;  2RQW A;  1HSQ A;  3MJX A;  1UB4 A;  4EMK A;  1UEC A;  1U1T A;  1TU0 B;  3WXM B;  4R56 A;  3FDR A;  2JTM A;  5KH6 A;  1BYM A;  1YP5 A;  3RIR A;  2OJ2 A;  4A4K A;  2CS7 A;  2DXU A;  3JCM c;  3OMG A;  1ZQ1 A;  4XQ3 A;  2ED0 A;  4F17 A;  1S72 T;  1R0C B;  2D0N A;  2RK2 A;  2AKK A;  2DVJ A;  3CBM A;  3VS4 A;  2CZ6 B;  3PVL A;  3VYH B;  3GLX A;  2LDM A;  1X2K A;  2KQW A;  1M3A A;  2VC8 A;  4J5Y A;  5GAN h;  1OX8 A;  3QJY A;  1NPP A;  3E19 A;  4AG2 C;  3SHW A;  1EX4 A;  1PRM C;  4J83 A;  5GAM d;  1PHT A;  5GAO l;  3PMI A;  3CCJ T;  2E6N A;  3OW2 S;  2QTV A;  1FYN A;  1S72 A;  2HZY A;  2AIR B;  2HAX A;  4Z02 A;  2HBP A;  1M1K C;  3CD6 A;  4M77 F;  3M53 A;  3G7Z A;  1N8R R;  1X69 A;  1TH7 A;  1UJY A;  1IRX A;  3HRU A;  1YHQ T;  2RPN A;  1JO8 A;  3MP1 A;  2E41 A;  3V7S A;  2QQS A;  1K0S A;  2LX9 A;  3I9Q A;  4WCI A;  2COW A;  2EQU A;  2DXC A;  3PVQ A;  1MMG A;  2R58 A;  4M7A F;  3M55 A;  4M77 G;  1VA7 A;  1T3L A;  3FLG A;  4IUP A;  3G6E T;  3CCR Q;  2D6F A;  2PU9 B;  4DBR A;  3CME T;  3MCA B;  2DMO A;  3VKI A;  4MZM A;  2YT6 A;  3PIO A;  1K9A A;  4ESR A;  4M75 E;  4JRQ A;  2ZAE A;  3OBW A;  3QZ5 B;  1M90 R;  2F5T X;  3Q1J A;  5CQY A;  1ZA2 B;  3SWN A;  1H8K A;  2EPD A;  4JUV A;  4C5G A;  4BDY A;  2FZK B;  1QKW A;  5GAO r;  2L0A A;  2LMJ A;  1M3C A;  2ZGW A;  3I5R A;  1W2B A;  2JS2 A;  2JUF A;  1WXT A;  2CZ0 B;  5CIU A;  5CK9 A;  4NL3 A;  1ABO A;  4OMM A;  3J7A F;  2RM4 A;  3UA7 A;  4KH0 B;  4LDU A;  1QVG P;  1VQ7 Q;  1OEB A;  1UGR B;  3EG1 A;  2DK3 A;  1GXI E;  4OB0 B;  1YJ9 Q;  1V1C A;  3I56 T;  2XU8 A;  1Y96 A;  3S3O A;  3TEE A;  4FCY A;  2KRS A;  2L3S A;  1Q82 C;  3QYG B;  3A1P A;  5J39 A;  4M75 B;  3BDU A;  3CC7 A;  2JTE A;  1QMC A;  1K8A U;  1NLP C;  4PLL A;  3UDC A;  4F16 A; 
#chains in the Genus database with same CATH homology
 2BTT A;  2DE0 X;  4JJD A;  1PKS A;  2CT3 A;  1TUC A;  1W6X A;  3U23 A;  2KBT A;  2XMF A;  1JQQ A;  1ZBJ A;  2JM8 A;  1UUE A;  2LJ0 A;  2DBK A;  4R0K A;  1E6H A;  3CQT A;  1RLP C;  1AZE A;  1Z9Z A;  2KT8 A;  1SSH A;  4J9C A;  2K3B A;  3VS0 A;  2JXB A;  3FJ5 A;  5IHI A;  1SHF A;  1NYF A;  4LE9 A;  2J05 A;  2A37 A;  2EQI A;  4LN2 A;  1TG0 A;  1SHG A;  1B07 A;  2HCK A;  1ARK A;  5I11 A;  1GCQ A;  1UDL A;  4RTT A;  2QDL A;  2LJ1 A;  1G2B A;  1RLQ C;  1QLY A;  1EFN A;  3M0U A;  1GFD A;  4J9I A;  4OMQ A;  2J6O A;  4LNP A;  2RQT A;  1E6G A;  2EYW A;  1GL5 A;  1GBR A;  1N5Z A;  2ENM A;  2VKN A;  3NHN A;  1YWP A;  2KT1 A;  1PRL C;  1ZUK A;  3REB B;  1KSW A;  1PKT A;  2W0Z A;  1PNJ A;  2AK5 A;  1T0J A;  2GGR A;  2DL5 A;  2L2P A;  3EG0 A;  1IO6 A;  2KRO A;  3VS6 A;  2D1X A;  2KXC A;  1BB9 A;  2DNU A;  1H3H A;  1RI9 A;  4JZ4 A;  4RTV A;  5FWC A;  1UTI A;  3VS3 A;  2JMA A;  2MOX A;  2VWF A;  1U3O A;  2JM9 A;  3C0C A;  3UA6 A;  2DA9 A;  2PTK A;  1GFC A;  1M30 A;  5IXF A;  2O88 A;  2J06 A;  2DL8 A;  4CC2 A;  2HDA A;  4D8K A;  5IHN A;  3EG2 A;  2LJ3 A;  3I35 A;  2GTO A;  4QT7 A;  1NEG A;  2FRW A;  2VVK A;  3H41 A;  4AG1 C;  2AZS A;  2LNH B;  2RQU A;  4D8D A;  3H0F A;  1U5S A;  1MV3 A;  1M3B A;  1KJW A;  1UHC A;  2M51 A;  2O9S A;  2IIM A;  1J3T A;  4J9B A;  1UFF A;  2OAW A;  1YWO A;  4IIM A;  5IH2 A;  2FO0 A;  1W70 A;  2JMC A;  1HD3 A;  2C0T A;  1NEB A;  5ECA A;  1UGV A;  2BZ8 A;  1I07 A;  3TSZ A;  4OMN A;  2O9V A;  2GNC A;  2KGT A;  2CRE A;  2M0Y A;  3ZL7 C;  2D8J A;  2GBQ A;  2C0O A;  5GJV B;  2RN8 A;  1K0X A;  1CKA A;  2E5K A;  2AZV A;  2CH4 W;  2EW3 A;  4J9D A;  3M0P A;  1SRM A;  2PZ1 A;  3IQL A;  3O5Z A;  2CUB A;  2W10 A;  4GBQ A;  3UF4 A;  1K76 A;  5IXB A;  4Z89 A;  2YUQ A;  4F16 A;  1BU1 A;  2ECZ A;  3H0H A;  2KEA A;  2V1R A;  2H8H A;  1M8M A;  3EG3 A;  4CC3 A;  2HBW A;  1WXU A;  4Y92 A;  4RTY A;  2YUN A;  1K4U S;  4CC7 A;  1Y0M A;  4ZNX A;  2EYZ A;  2KYB A;  1B3Q A;  2DYB A;  1TUD A;  1SPK A;  2CT4 A;  1A0N B;  1KIK A;  4AFS C;  3QWX X;  1I1J A;  2DJQ A;  1VYT A;  1OOT A;  3NMZ C;  1AWO A;  2J6F A;  2KNB B;  2FPF A;  3GBQ A;  2OI3 A;  3I5S A;  1YN8 A;  1HJD A;  1LCK A;  1QCF A;  4Z8A A;  2CSQ A;  1ZUY A;  1WI7 A;  2NUZ A;  4AFQ C;  3LH5 A;  2NWM A;  1MV0 B;  1NG2 A;  2DRK A;  4OML A;  2KRN A;  3UAT A;  1JU5 C;  2JW4 A;  1WX6 A;  2DF6 A;  1X43 A;  2FEI A;  4JJC A;  2CDT A;  4CC4 B;  1GCP A;  3EHR A;  1H92 A;  1JXO A;  1QWF A;  1Y57 A;  2J6K A;  1BK2 A;  2O2O A;  2DIL A;  3EHQ A;  2DL3 A;  3REA B;  2FPD A;  2K9G A;  2YSQ A;  1MUZ A;  2GTJ A;  1PWT A;  1WLP B;  4AFU C;  4A63 B;  1ZUU A;  2L3Q A;  3VS1 A;  5IHK A;  2KXD A;  3SEM A;  1QKX A;  4HVW A;  2K2M A;  4RTZ A;  1FMK A;  1X2Q A;  3PE0 A;  4KRT A;  1UJ0 A;  2RQR A;  1YCS B;  2LP5 A;  1XOV A;  2RQV A;  2ROT A;  2P4R A;  1AWJ A;  1GBQ A;  2HEQ A;  3H0I A;  3KFV A;  4RTW A;  2LZ6 B;  2DLP A;  5FW9 A;  1E7O A;  1K1Z A;  3VRY A;  1OPK A;  1X6B A;  2O31 A;  1AWX A;  4J9G A;  1WFW A;  4HCK A;  1T3S A;  1QWE A;  4RUG A;  4JZ3 A;  1S1N A;  1UE9 A;  3M0S A;  1CKB A;  2DBM A;  5L23 A;  4HVU A;  3VS2 A;  2EGE A;  1WYX A;  1ABQ A;  4ORZ A;  1OPL A;  4FSS A;  2RQW A;  1HSQ A;  1GRI A;  4M4Z A;  2DX1 A;  3VS5 A;  1NYG A;  1G83 A;  1UEC A;  2A28 A;  2LX7 A;  1JEG A;  3M0T A;  1U06 A;  2SRC A;  1YP5 A;  1VYV A;  2OJ2 A;  2DM1 A;  2RMO A;  2A36 A;  1AD5 A;  2K6D A;  4HXJ A;  2ED1 A;  2MCN A;  2ED0 A;  4F17 A;  1SEM A;  1BBZ A;  2YDL A;  1I0C A;  1X27 A;  3RBB B;  1NM7 A;  3VS7 A;  2PNI A;  2D0N A;  2I0N A;  2KR3 A;  3NPF A;  2AKK A;  2DVJ A;  3TVT A;  4DEY A;  2EGC A;  1AEY A;  2X3X D;  3VS4 A;  2CH4 A;  2HSP A;  1T0H A;  2CSI A;  2DL7 A;  3VRZ A;  2JT4 A;  1AZG B;  3PVL A;  3NGP A;  1X2K A;  1M3A A;  3THK A;  1W1F A;  4AG2 C;  2FRY A;  3SHW A;  2B86 A;  1PRM C;  1PHT A;  2JS0 A;  3M0R A;  4LUD A;  1FYN A;  3RNJ A;  2BZX A;  1UHF A;  2BZY A;  2K79 A;  5FWB A;  2YUO A;  2MIO A;  1X69 A;  5GJW B;  4J9E A;  4OMP A;  1UJY A;  4IIO A;  2A08 A;  1WXB A;  2EBP A;  1ZX6 A;  2RPN A;  1JO8 A;  3JV3 A;  4J9H A;  1AVZ C;  3A98 A;  4HVV A;  1KFZ A;  1K0S A;  3I9Q A;  4WCI A;  1JXM A;  4RTU A;  2EGA A;  2G6F X;  3PVQ A;  2ROL A;  2LQN A;  4RTX A;  2F2W A;  1RUW A;  2ESW A;  1VA7 A;  1T3L A;  3TSW A;  2EYY A;  2F2X A;  2FPE A;  5I22 A;  4GLM A;  1CSK A;  2KYM A;  2DMO A;  5EC7 A;  2YT6 A;  1K9A A;  4ESR A;  1UG1 A;  2CUD A;  3ULR B;  1SRL A;  2L3P A;  2EPD A;  2KRM A;  1H8K A;  1QKW A;  1WA7 A;  1WDX A;  2L0A A;  2KE9 A;  2LMJ A;  4LUE A;  1M3C A;  2EYX A;  3I5R A;  4DEX A;  2JS2 A;  1WIE A;  1WXT A;  2FG0 A;  2D8H A;  1AWW A;  1ABO A;  2J7I A;  1Z9Q A;  2RF0 A;  4JPB W;  1NLO C;  2LQW A;  1VYU A;  4OMM A;  4EIK A;  1ZSG A;  2LCS A;  3UA7 A;  4JJB A;  1ZLM A;  4F14 A;  2DL4 A;  1OEB A;  3EG1 A;  2EVR A;  1V1C A;  2RNA A;  1YNZ A;  2F2V A;  4Z88 A;  2X3W D;  4AFZ C;  5HCK A;  2K7A A;  2KRS A;  4J9F A;  4X1V A;  2L3S A;  1GCQ C;  2ABL A;  3R6N A;  1X6G A;  2C0I A;  2V1Q A;  3M0Q A;  2GQI A;  2EKH A;  3EGU A;  4K11 A;  2AKL A;  4OMO A;  2SEM A;  3QWY A;  2JTE A;  1AOJ A;  1OV3 A;  2YUP A;  2DRM A;  1NLP C;  4E6R A;  1M27 C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...