1JU5C

Ternary complex of an crk sh2 domain, crk-derived phophopeptide, and abl sh3 domain by nmr spectroscopy
Total Genus 5
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
5
sequence length
60
structure length
60
Chain Sequence
DPNLFVALYDFVASGDNTLSITKGEKLRVLGYNHNGEWCEAQTKNGQGWVPSNYITPVNS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structure of a regulatory complex involving the Abl SH3 domain, the Crk SH2 domain, and a Crk-derived phosphopeptide
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein binding/transferase
molecule keywords Crk
total genus 5
structure length 60
sequence length 60
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 2001-08-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 1ju5C00
2O31A 1IO6A 3SEMA 1BU1A 2D1XA 1YWOA 1B07A 2RNAA 3LH5A 1BK2A 2YUQA 2SRCA 5IH2A 2A28A 4FSSA 1PHTA 1TG0A 2LZ6B 4E6RA 3A98A 2NUZA 2DRKA 2EGAA 2JM9A 1NM7A 3M0TA 1GFCA 1ABQA 4Z8AA 2KXDA 2DYBA 4J9DA 1K4US 1AEYA 2LCSA 2GTOA 2DBKA 2XMFA 1JU5C 1PKSA 4M4ZA 2FPDA 2EGEA 4F16A 4Y92A 4J9BA 1NLPC 1SRLA 5FWCA 2EYXA 1MV3A 1UGVA 2CUBA 2LJ1A 1ZUKA 3QWXX 1GCQA 2AZVA 4JJDA 1M30A 4LNPA 1AD5A 3I5RA 2EKHA 1QWFA 1WFWA 2B86A 4LN2A 1I0CA 2CH4W 1SHFA 1GFDA 1RI9A 2OAWA 4ZNXA 4AFSC 2CH4A 4RTWA 1NEGA 2BZ8A 1FMKA 2L2PA 2L3QA 1SRMA 1N5ZA 3PE0A 1AWWA 2JT4A 1K76A 2AK5A 1B3QA 2LJ0A 2RF0A 2HCKA 1M27C 2H8HA 1QWEA 1V1CA 2DLPA 1HJDA 2K7AA 2O2OA 2DL8A 2RMOA 4AG2C 1QKWA 2M0YA 4JZ4A 1UUEA 2KRSA 1WI7A 1GCPA 1VYVA 2RQVA 1WIEA 2IIMA 2KRNA 2W10A 4RTXA 2O9VA 2CREA 2ED1A 3I35A 4CC3A 3NGPA 2YUOA 4J9HA 2ROLA 4CC4B 3UATA 5IXFA 4HCKA 2EPDA 2FRYA 2KYMA 4J9EA 1GCQC 4KRTA 2J6FA 5IHIA 1UE9A 3RBBB 2ED0A 2QDLA 2GTJA 2ESWA 1GL5A 1NG2A 2GQIA 1JXMA 1UDLA 1T0HA 2KT8A 4J9IA 2GGRA 4RTYA 4QT7A 3QWYA 1AOJA 2FG0A 2MIOA 2A08A 2GNCA 2JMCA 3REAB 1YN8A 4RTUA 1X69A 2EYYA 2YUNA 1HD3A 4DEYA 2BTTA 3THKA 2RQUA 1PRLC 3VS3A 3ULRB 1K9AA 1W6XA 4D8KA 4Z88A 4CC7A 1I1JA 2DF6A 2C0TA 2AKKA 3EG1A 2V1QA 2F2WA 1U06A 1WX6A 1VYUA 2RQTA 2DRMA 3JV3A 4JJBA 4GLMA 1T0JA 1NLOC 2L3SA 1OV3A 1RUWA 1GBQA 1Z9ZA 2KEAA 4R0KA 2M51A 2JTEA 2KNBB 2L0AA 5GJWB 1VYTA 2BZYA 4AFQC 1UJYA 2PNIA 3KFVA 1SPKA 2O9SA 1KSWA 1NEBA 5IXBA 4ORZA 1SHGA 2K79A 2J6OA 1X6GA 1FYNA 2OI3A 4JZ3A 2ABLA 2DM1A 2CT4A 1VA7A 1BBZA 3H0IA 1MV0B 1UG1A 1TUCA 1YP5A 2LNHB 1M3CA 2X3XD 3UA7A 1JO8A 1AWOA 3TSWA 1OPKA 2FEIA 2D8HA 4LE9A 2KBTA 2AKLA 2DL4A 1LCKA 2HDAA 2RQWA 1QCFA 1M8MA 1WXTA 3EG2A 1H3HA 2C0OA 2LP5A 2FRWA 5I22A 2JMAA 4F14A 1UHCA 2EW3A 3H41A 1MUZA 2ENMA 5FW9A 4HXJA 2PTKA 1EFNA 2DMOA 2LQWA 1YNZA 3NPFA 1PNJA 2YSQA 1OPLA 2I0NA 2FPFA 1K0SA 3REBB 1KIKA 2ECZA 1OEBA 2EVRA 2KE9A 1UHFA 4J9CA 3M0PA 1CKBA 1RLPC 2RN8A 1X2KA 2OJ2A 2JW4A 2YDLA 2K3BA 2A37A 2LMJA 4RTTA 1XOVA 1W70A 2YUPA 2LJ3A 4EIKA 2DX1A 4F17A 1ZUYA 1WXUA 4RTZA 5EC7A 1H92A 3UA6A 5I11A 1JXOA 2KGTA 3SHWA 2A36A 1AVZC 4X1VA 2JM8A 4OMMA 1K1ZA 1X6BA 1G83A 2KT1A 2CSIA 3CQTA 4LUEA 1JEGA 1KFZA 1X43A 1YCSB 3VS7A 3U23A 4HVWA 1U3OA 2F2XA 2J05A 1A0NB 3TVTA 1HSQA 1UTIA 2C0IA 2KROA 3ZL7C 1WDXA 2EQIA 1GBRA 1ZLMA 4AFUC 1SEMA 1PRMC 1ARKA 2HBWA 2SEMA 2DJQA 1M3BA 2AZSA 2G6FX 2EYWA 1SSHA 2DL3A 4JPBW 5GJVB 1RLQC 4OMQA 5ECAA 1YWPA 5FWBA 3O5ZA 1AWJA 1NYFA 2LQNA 2EGCA 2RQRA 3R6NA 2EYZA 3PVQA 1X2QA 3M0RA 1AZEA 2D8JA 1ZUUA 2J7IA 3M0SA 2CT3A 4OMPA 2J6KA 4HVUA 2DVJA 2J06A 2V1RA 1M3AA 3C0CA 3I9QA 4RTVA 4J9GA 4OMOA 2FO0A 2VWFA 2DE0X 2VVKA 3EHQA 4D8DA 2LX7A 2JXBA 3FJ5A 3PVLA 2MCNA 1BB9A 1UJ0A 3VS0A 1G2BA 1K0XA 1GRIA 4OMLA 4Z89A 2RPNA 1PWTA 1UECA 2HSPA 3NHNA 1AZGB 3GBQA 3VS5A 1QLYA 4RUGA 2JS2A 1TUDA 2O88A 3VS2A 2D0NA 2EBPA 5IHNA 2DA9A 1Z9QA 2E5KA 3EG3A 1ABOA 3H0FA 1W1FA 1WLPB 4AG1C 2MOXA 3IQLA 4GBQA 3VS4A 4AFZC 2DL5A 2KR3A 2K9GA 2ROTA 1U5SA 1ZX6A 2NWMA 1ZBJA 1WYXA 1AWXA 3I5SA 1E6GA 4WCIA 2GBQA 1KJWA 3H0HA 4K11A 1S1NA 2CSQA 5L23A 3RNJA 1I07A 2JS0A 2FPEA 3EGUA 3VRYA 1H8KA 2YT6A 2K2MA 5IHKA 2KRMA 4A63B 2X3WD 2DILA 1JQQA 1Y57A 2W0ZA 3VS6A 1J3TA 1WXBA 2K6DA 4HVVA 3VRZA 1WA7A 3EHRA 2BZXA 1T3LA 2CDTA 1T3SA 1PKTA 2PZ1A 4OMNA 3VS1A 4LUDA 1Y0MA 2KYBA 3TSZA 1CKAA 2DNUA 2DBMA 1CSKA 2F2VA 2HEQA 2DL7A 1OOTA 3M0QA 2CUDA 2VKNA 2P4RA 1E6HA 2L3PA 3M0UA 3EG0A 3NMZC 1X27A 2KXCA 1E7OA 4JJCA 4DEXA 5HCKA 1QKXA 3UF4A 1UFFA 4J9FA 4ESRA 4IIMA 4IIOA 1NYGA 4CC2A 1ZSGA
chains in the Genus database with same CATH superfamily
1IHVA 2QASA 4J7FA 1IO6A 2ZPHB 1BU1A 2D1XA 5DLQE 1YWOA 2JNGA 2DERA 4OGCA 5FRNA 1OYXA 2QAZA 2HAXA 4OB2B 4XAXB 2NLUA 1VQ6T 2CP5A 2JTFA 3F70A 3PMIA 2XDDA 1Q81R 3LYIA 4Z8AA 4KULA 1AEYA 3QHSA 2MPXC 2XMFA 5LJ3j 3CPWA 4F7UB 1JU5C 4F16A 3OQ5A 3JCMh 4J9BA 5GAN6 2QQBA 2EYXA 2LJ1A 1ZUKA 5LJ5j 5GAN8 2YRCA 3RKXA 5CR2A 4LNPA 2MWOA 1QWFA 3EFOB 2B86A 4LN2A 2P0PA 1I0CA 3I56T 4ZNXA 2OAWA 3CCET 2JOYA 2RHIA 4IUPA 2GFUA 4RTWA 3SDZA 4RG8A 1SRMA 1KC8R 1NBEB 1Q81C 1BI2A 2ZAEA 3PMTA 5GAOr 1BI0A 4OB0B 5GAN4 2AK5A 1MMAA 5AYFA 5GMKm 1VQNA 4ANJA 2LJ0A 1WQWA 2FZGB 2RF0A 1NPRA 3M54A 3H6ZA 1Q81U 2NUPB 2O2OA 2ZPIB 1VQPT 1QKWA 4JZ4A 1TUGB 1VYVA 3OB9A 3BY7A 2DD4A 4O5VA 3CCQT 2F5KA 2E3IA 3EFRA 1VQNT 4HCCA 4J7IA 2YUOA 1G5VA 3JCMP 4XTVA 4CC4B 3UATA 2KYMA 4J9EA 4KRTA 5CK9A 5IHIA 1UE9A 2A7YA 3CC7Q 1UEBA 3M9QA 4M75D 4ZN3A 4FYVB 2ED0A 2GTJA 1MHNA 2ESWA 2L89A 2GQIA 1JXMA 2VXFA 4RG2A 3QG1A 4J9IA 5KE2A 3P8HA 3CCRA 1K9MC 3VUZA 2YRDA 4Z02A 3G4ST 3DKMA 3QWYA 2MIOA 1GXIE 2JMCA 4F7UF 1QVFA 4M78C 4XTXA 3LLRA 1JJ2P 5CKEA 4M78E 1G3YA 1HD3A 2RQUA 1PRLC 3D7SB 3VS3A 3WVDB 2C0TA 2AKKA 2QQRA 2V1QA 2F2WA 4X9CA 3OS2A 2X51A 2LTOA 3UPUA 3CCRQ 2CP6A 1OU8A 3INZA 2E65A 3MKDA 4PJOF 1VQ8Q 4GLMA 2HKQB 4F7UG 3QDRB 2V26A 3X20B 4B9WA 4R0KA 1I81A 5CQXA 1VQKQ 4JRPA 1KG1A 4IUQA 1SPKA 2O9SA 1KSWA 3PFSA 3CXCP 3G4SA 2LCLA 4NS5A 1FYNA 2VUBA 2M9UA 2X4WA 4E7JA 2HZYA 1Q7YU 1QP2A 1BCMA 1YJ9A 1QCNA 4L59A 1UG1A 4DQ2A 4LD6A 1BYMA 2QI2A 1VQ4Q 3OSVA 3OYEA 3OW2A 3TSWA 3NTIA 2FEIA 3C95A 4QQ6A 2NUTA 2AKLA 3EGDA 4UC4A 1LCKA 2HDAA 1M8MA 5GAN2 3EG2A 1AT1B 1YI2T 4B6MA 1KD1C 4C0FA 5C6SA 2CP0A 1MUZA 2VGMA 1D3BA 3HP9A 3CBOA 2PTKA 3CMAA 2LQWA 1YNZA 1PNJA 3V7RA 4FW1A 2NYSA 1KIKA 4BE2A 1VQKT 2L8DA 2RJCA 4XK8E 4J9CA 5GAMg 1YITQ 2JW4A 1IXDA 4E7ZA 3E2UA 3HFNA 3L2ZA 1LOJA 1B34A 3CBPA 3L42A 1G3TA 4JLGA 4KUIA 4X1VA 3QBYA 2RI2A 4E7KA 2BE7D 2KT1A 4PJOB 3CQTA 1JEGA 1KFZA 1X43A 4C92B 4V2SA 4PJMA 4PL6A 1WHLA 4HCBA 3TVTA 1ZSZB 3RMSA 2E3HA 3HL8A 3ZL7C 3CC7T 2IPOB 2CZ7B 3KUFA 4L5GA 3OYYA 2E6ZA 1KD1R 2DXBA 2KMTA 1ARKA 2HBWA 2QA4Q 2G6FX 2DL3A 3QSUA 1RLQC 4JLIA 3EFSA 1OX8A 2A0FB 1YWPA 1AWJA 2E4HA 2KY9A 2YRVA 3PVQA 1QVGA 2CGHA 1AZEA 1FWZA 3CCQA 1IREB 4X34A 3M0SA 2CT3A 4OMPA 3G6EA 4KT0E 4HA8A 2LQKA 1V76A 2DVJA 3ZFJA 3GF5A 2V8JA 3M4YA 1Q82R 4E47A 4KBMB 1ZA1B 4OP0A 3VYGA 4D8DA 4D6WA 2DVEA 1FMVA 1VQNQ 3JRZA 1BB9A 1N9RA 4DBHA 1VQ4T 1G2BA 4QVZA 1GRIA 2X4YA 4HT9A 1QW1A 4OMLA 4C8QC 4BE0A 1YJ9Q 4GY5A 2AIRB 2GFAA 5A0DA 4A4HA 1LJOA 1RADB 3I55Q 4DOWA 3CC2Q 2KSSA 2E70A 3FRNA 1TUDA 2DO3A 5IHNA 3L2WA 2EAYA 2LNVA 3MEVA 1M2OA 1RAHB 3EG3A 3H0FA 1WLPB 4FM4B 1P92A 4AFZC 3LWHA 1BI1A 3CC4T 1U5SA 2RHXA 2RJFA 5HK0A 3EG9B 1W2BP 1MMDA 2NWMA 4KH1B 2QA4A 1YJNT 1E6GA 1VQKA 1I5OB 3PNWC 2LRQA 4XQ3A 4K11A 1M1KU 2DTHA 4M7DF 1OU9A 4DOVA 4BI8B 1H8KA 3NTKA 2K2MA 1VQ4A 2DILA 1Y57A 1HYOA 4KUDK 3CD6T 1WXBA 3G71A 3FC3A 1NJIU 1WA7A 1T3LA 4J6YA 2CDTA 2PZ1A 3VS1A 1Q86R 4A4EA 1Y0MA 3TSZA 1N6AA 1CKAA 2COZA 2LVMA 1VQ7T 3M56A 1PD1A 1OOTA 2NUTB 2CUDA 5KYNA 3MPUB 4JS4A 2F1LA 3CEYA 2ZGWA 2KXCA 3CCRT 4C8QD 1E7OA 4DEXA 4M7DG 3UF4A 4J9FA 4ESRA 3HRUA 2G3RA 3S3OA 1WHGA 4PJOC 3JCMe 2DPPB 4IUVA 1YIJA 4BY6C 4OVAA 3OS0A 3LGFA 3SB2A 3V7CA 2K5FA 4CRIA 3OMGA 5IH2A 1Q7YC 3CCUQ 2X9HA 1RL2A 2RK2A 2VV5A 4OF1A 4QQGA 3QUIA 5GAN5 1ZSZC 4M78D 2COWA 2EGAA 3A8MB 4FYWB 2JM9A 3JAME 4XTZA 3M0TA 1K4US 1Q95G 1NJIR 3G6EQ 2GTOA 4KGZB 1Q86U 3L2UA 2FPDA 4Y92A 2FHDA 3M58A 1SRLA 5FWCA 4PJOG 1JBMA 3QWXX 1GCQA 2RO0A 3QDFA 1KQSP 2DZ9A 3EGXA 5GANd 3M59A 6AT1B 4E2FB 3RIRA 4C92G 3OYLA 1YIJT 1NEGA 4N4HA 4IUTA 2VYTA 1KHCA 2KDSA 1M90R 3BW1A 3PE0A 2JT4A 1K76A 3J81E 5FRMA 2P0QA 1K73U 2QXFA 4M77E 3CMET 2K4YA 1C6VX 4LD9K 1M27C 2HBPA 4FT4A 1QWEA 2KK4A 2K7AA 4M77F 1DJ7B 5GAOp 1QMCA 3MP1A 3P8DA 3A8LB 2CP3A 5LJ5f 4X9DA 5DY9A 3OMCA 2RHZA 2KRNA 2R5AA 2JTMA 4LXCA 2CREA 3I35A 3DLMA 4C5IA 1K8AC 2M0OA 5GANh 1QVPA 1TXQA 2FRYA 4M7DE 3CCSA 1GCQC 3OW2S 1VQLQ 1ZBXA 2GCXA 4QQDA 3FLGA 3RBBB 4M7DB 5DM7R 1LPLA 1UDLA 2M16A 1T0HA 2KT8A 3A8OB 4KGXB 4RTYA 4MZPA 4QT7A 1IRXA 1AOJA 3S3MA 4BDZA 1VQOT 4VUBA 1KD1U 2EYYA 3LX7A 2YUNA 2BTTA 2XU8A 3ZEHA 4LDWA 3G71Q 4IUUA 3TEEA 2RHUA 4Z88A 1I1JA 2DF6A 5KYWB 3CCVQ 1OZ2A 4A54A 3CCUA 1WX6A 1K9MR 2EYQA 1VYUA 2DTOA 5D6YA 4MMLA 3JV3A 4JJBA 4BY6B 5L8RE 5LL6S 3CXCS 2L3SA 3CCMT 1Z9ZA 3MO8A 4NL2A 5GAN3 4PJOD 1N8RC 5GJWB 1RAGB 3CC4Q 2BZYA 4AFQC 1UJYA 1OI1A 2PNIA 3HSBA 3RMQA 8AT1B 5IXBA 1I8FA 1YIJQ 2COYA 2K79A 2YHTA 2C06A 1WZOA 4ZN1A 1VQOA 1YI2A 3G1JA 3JB9J 2ABLA 1R0CB 4F7UE 2DM1A 2CT4A 4JJNK 1BBZA 3UWNA 3VJPA 4EMHA 4NL3A 3CCUT 2LT4A 1JO8A 4KGVB 1OPKA 4LE9A 3JCMQ 3EGDB 2BE9B 3M4GA 1H3HA 2XK0A 3GLXA 5I22A 2QDYB 1MMNA 2JMAA 1KQSA 2DXUA 1NPPA 3QKJA 5KYYA 2EW3A 1M1KR 5FW9A 1B7TA 1EFNA 1ZHIA 1RAAB 5J26A 3JCMV 4C0DC 2R57A 3M5AA 4C0ZA 2ECZA 1OEBA 2EVRA 1UHFA 3M0PA 3NTHA 1RLPC 5LJ3e 5KYXA 2RN8A 1V29B 1X2KA 2OJ2A 2XDBA 3MP6A 4R55A 2YDLA 2A37A 3QYHB 4MDWA 4XU0A 1XOVA 2LJ3A 4F17A 1ZUYA 2OTJT 3CXCA 2ZZDA 4A4FA 4BI3A 1B34B 2KVQG 3UA6A 1RI0A 3SHWA 5GMKl 4OMMA 4ZGEB 1K1ZA 5GANf 4A4GA 1G83A 3SD4A 4Y91A 4LUEA 1BKBA 3U23A 4HVWA 1U3OA 2F2XA 4ELYC 4M78A 1VQ8A 1HK9A 1A0NB 3RKYA 2RI3A 2PU9B 5LJ5h 3CCQQ 1S72Q 1D0YA 2CZ6B 2MAMA 1SEMA 2E64A 3CCVA 2DJQA 1XQHA 4N4GA 2DIGA 1M1KC 2CZ0B 4OMQA 5FU7C 3O5ZA 4J83A 3OYDA 3R6OA 2EGCA 4BUGA 4E7HA 2ATCB 3SWNB 3HKSA 2D8JA 1K9MU 4II1A 4HVUA 2J06A 2V1RA 2RK1A 3ZBDA 3QIIA 3A8GB 4FSXA 2ZPEB 2VB6A 2PUKB 4OMOA 1AHJB 4FW2A 3CMAQ 3VYHB 2HMAA 4HT8A 4FT2A 4PNOA 4M7AC 1M9SA 2DFUA 3TU4K 3AT1B 1UJ0A 3VS0A 1K8AR 1K0XA 1MNEA 4FYYB 4Z89A 1PWTA 4PLLA 2HSPA 3NHNA 2RH2A 1IGQA 4Q5WA 1PSFA 5GAOl 2DXTA 4HKEA 4RUGA 1BCOA 2XHCA 3MCAB 2DD5A 1M2VB 3VS2A 2DA9A 4M7AD 1G3SA 4YTLA 1SKUB 2WACA 2E5KA 1W1FA 1O75A 2A3LA 4PKCC 5C0MA 1WHHA 2Y90A 2LDMA 3IQLA 5LJ3d 3C94A 2FYKA 5HKCA 1WHMA 1D1BA 4QVCA 3GOXA 3EG9A 2EJGA 1VQLT 2RHYA 3V8LA 1WYXA 2QTXA 5M9OA 1AWXA 3HRTA 2GBQA 1KJWA 2OTJQ 2DTIA 3RNJA 1I07A 4PJOE 2RJDA 5GAMh 3VRYA 4QKUA 1RABB 1VQ9A 3GIBA 5EG2A 1W2BS 1N9SA 3OW2P 4HVVA 3EHRA 3JB9I 2I2LA 1T3SA 4OMNA 1D1AA 1NE8A 1CSKA 3H8ZA 4JRIA 5LJ5g 3ER0A 2XD0A 5I2SA 2BIVA 4FCYA 4M77C 5KCOA 3NMZC 1QP3A 1ZQ1A 2FZCB 4M75E 5HCKA 1QKXA 1VQ6A 1TWBA 4ZTFA 4ZTJA 3OY9A 1UFFA 1ZA2B 3TQ7P 4J6WA 3SWNA 2E6NA 2MK5A 3OYHA 1ZSGA 2O31A 2FL7A 3SEMA 4PFOA 2VC8A 5GAMd 1M90U 2PUOB 2WSFE 3META 1BK2A 2YUQA 5GAMj 4WF2A 3VKIA 4FIBA 5GANe 4F7UA 5CIUA 4FSSA 1R8OB 1PHTA 1RACB 1TG0A 2EQUA 4E6RA 1YJWA 2JZ2A 3TREA 1UGSB 1Y96B 2DRKA 1Y07A 2OX7A 1NM7A 1WQ7A 4M7DD 2KXDA 2DYBA 4J9DA 3JB9H 3EH2A 2LCSA 2QEXQ 3CCJQ 2AT1B 1OX9A 1JJ2A 4M4ZA 2HL3A 2EGEA 1MNDA 1OZ3A 1NLPC 3FEOA 3ME9A 5CAIA 5CVIA 1JB0E 4M7DA 3PIOA 1FXXA 1S72A 1AD5A 3BE3A 1TTHB 1M5Q1 2QTVA 3I5RA 1WFWA 5J39A 4M7AA 1SHFA 1GFDA 2XDPA 2QK0A 3HFOA 4QW2A 3OA6A 4AFSC 2CH4A 4C8QF 2H3EB 2L2PA 2L3QA 3V8JA 1Q82C 3C12A 2HSEB 1SF9A 1N5ZA 4M7AB 2DK3A 1AWWA 3H9NA 4N0AA 4JUVA 1D0XA 2QQ9A 1B3QA 2X35A 2HCKA 3FB9A 4XTWA 1VIFA 2VXEA 3MEWA 2K2VA 1H3ZA 3RDVA 1V1CA 4TVRA 1VQ6Q 3CCSQ 5GAOn 2RMOA 2M0YA 4MMKA 1WI7A 1GCPA 1TH7A 4BD3A 5KE3A 1WJRA 1QVGP 4Y28E 1MMGA 4M77D 1WIEA 3NGPA 4XU1A 4J9HA 4OMFB 4RKUE 4EPCA 3CPWP 5IXFA 2EJ9A 2FVUA 3EFOA 1UGRB 5CKDA 1VQ7A 1YITT 3GNFB 2QDLA 2IVWA 4LDVA 1VQMA 2EWNA 2GGRA 2QGGA 3OSSC 2LT1A 2HD0A 2GNCA 2D9TA 2R58A 3REAB 1KK7A 4RTUA 3QXEB 2L3RA 3FDRA 2QG9B 3LGLA 4DEYA 1YJ9T 3VU3C 2CKKA 3ULRB 1K9AA 1W6XA 3S6WA 5CKBA 5KYUA 3CC4A 1BIAA 3E19A 3S3NA 3OS5A 5LJ3h 1VQMQ 2RQTA 2HKNA 2B8AA 2EQKA 3V8KA 5GANg 5GMKh 2EQMA 1T0JA 3QYGB 2QA4T 1NLOC 1PM3A 1OV3A 1TOVA 1PCXA 4E7SA 1GBQA 1XTDA 2M51A 2O01E 3JCMg 2L0AA 5D6XA 4ATOA 3JCMW 2R5MA 3QJ6A 4PJLA 1K8AU 4BI4A 4LDXA 3DLLA 1NEBA 2KI7A 3CD6A 2J6OA 2AHJB 1D09B 1X6GA 3RKWA 2OI3A 2MI6A 2RM4A 3FJPA 3G4SQ 5LJ5e 4JZ3A 5A2QE 1TS9A 3Q1JA 5CCAA 3L2RA 1N8RR 1RAFB 4N4IA 3H0IA 1TUCA 1YP5A 2E1HA 2RI5A 3BFMA 4GLKA 1AWOA 4CI0C 2EFIA 2D8HA 3UT1A 5FU7B 5KH6A 2RQWA 3SWNC 1WNLA 4C92D 1PD0A 2LP5A 4C5HA 4F14A 1UHCA 3OYKA 3OYFA 4PJJA 5FLXE 3H41A 2FZKB 2ENMA 1KQ1A 4HXJA 1X01A 1EIFA 2NUPA 2DMOA 5KYWA 3NPFA 1YHQQ 2YSQA 1OPLA 3J80E 2I0NA 3X26B 3MHXA 1O9SA 3LH0A 3J7AF 4M75G 3QJYA 2VGNA 1D3BB 3BDLA 1U1SA 2K3BA 3AHUA 1W70A 4EIKA 2DX1A 3QZ9B 2HNIA 3CPWS 1WXUA 4FU6A 4PJOA 1YITA 1H92A 2YLBA 5I11A 1JXOA 3G6ET 2KGTA 1AVZC 2JM8A 4MZTA 2DYIA 3OYJA 3CCLT 1X6BA 4PJNA 2CSIA 2QYZA 3JB9G 1YCSB 3VS7A 4J8OA 3OYCA 1VQPQ 8ATCB 5GAOq 1QVFS 3MEUA 4EMKB 1HSQA 2C0IA 3I55T 3I56Q 4EMKC 1GBRA 4LDUA 4R56A 2M1HA 1IGUA 4PK4A 3CCEQ 1ZLMA 1TU0B 4AFUC 2DAQA 1PRMC 3RESA 2SEMA 4A53A 4A4KA 4RMOA 5GJVB 3NFCA 1QQJA 2CYZB 5LJ5d 3A1PA 2JVVA 2LQNA 3R6NA 1VQOQ 4LDYA 2P84A 4QVDA 1X2QA 3M0RA 3CCMA 3OYNA 2J7IA 3M55A 1M4ZA 3HPWA 2DJZA 4DBRA 5GAOm 4RTVA 3I9QA 2JJ9A 4J9GA 3CCVT 4RCCA 2FO0A 2JUFA 3N5BB 4O6JA 1WHKA 2DE0X 2VVKA 2QQAA 5FU6B 3L1AA 1WJSA 5FU6C 1VQ8T 3OYGA 1U8RA 4RCBA 5IAYA 2XICA 1IZ6A 3CC7A 3WVEB 2OAUA 1UECA 2EIFA 3VS5A 5A0GA 1QLYA 2GF7A 4M78F 5HK3A 2D0NA 2EBPA 2WSCE 3OYAA 2LCCA 4NOYA 4WTOB 2F69A 3C4SA 1ABOA 3GP8A 1EZZB 3LW5E 3CMEA 2F5TX 4AG1C 2MOXA 4GBQA 2DL5A 4M7AF 2ROTA 2XI9A 1ZX6A 5I21A 4C92A 4M7AE 3PT9A 1ZBJA 1G8XA 4WCIA 2QEXA 1SG5A 3RERA 3G7ZA 5L23A 4JRKA 1ACMB 2H3JA 2JS0A 1G3WA 2FPEA 2YT6A 1UGPB 5IHKA 4A63B 2X3WD 1J3TA 4OB1B 4C5EA 3HHTB 2BZXA 3CCLQ 4B9XA 1Y96A 2K5IA 4LUDA 4FYXB 5CQYA 2DBMA 3FIFA 2F2VA 2HEQA 2DL7A 3M0QA 2BUDA 3GPLA 2VKNA 3OYIA 1WGSA 3CC2T 1E6HA 2L3PA 1VQ9T 3M0UA 3EG0A 2E5QA 3OS1A 1VQMT 4IKFA 1M90C 1K73C 4IIMA 5KYYB 1NYGA 3I56A 1F1BB 1NZ9A 1SSFA 1KC8U 1YBYA 2E41A 1B07A 2RNAA 3LH5A 5CKHA 3CPFA 2MWPA 2SRCA 1M1FA 1K73R 2A28A 4J6XA 2LZ6B 2O4XA 3A98A 2NUZA 3G71T 1RAEB 2WSEE 4M75B 1GFCA 1ABQA 2KAFA 4M75C 2DBKA 1PKSA 3OBWA 1D0ZA 4HCZA 2IG0A 4XU3A 4FL6A 3E9GA 1MV3A 1UGVA 1EX4A 2QQSA 3ASKA 2CUBA 2CS7A 1VQ5A 2AZVA 4JJDA 1M30A 1U1TA 2OTLA 3KBGA 2EKHA 2CH4W 2RA2A 4M75F 2HQEA 4JS5A 1RI9A 4EMGA 3QZ5B 1YJWQ 4M77B 4M78G 2BZ8A 1FMKA 2D6FA 3L2VA 3CCLA 2PVDB 5GMKi 3JCMf 3VUBA 4EMKA 1XNIA 2GQVA 1QVGS 3E1SA 2H8HA 2DLPA 2DEUA 1HJDA 2ZPGB 2DL8A 2QGFB 4AG2C 3MP8A 1UUEA 2KRSA 3A8HB 3JSCA 2RQVA 4BACA 2QEXT 4JRQA 2K5LA 3CMAT 1YI2Q 5FROA 2IIMA 2W10A 2HL5C 1UGQB 5LJ3g 4RTXA 3OYMA 2O9VA 2ED1A 4CC3A 1BIBA 7AT1B 4E7LA 2EJFA 2OTLT 2K57A 2V8KA 3DB3A 2ROLA 4PLIA 4HCKA 2EPDA 3RR6A 4C8QB 1KQ2A 1OULA 2J6FA 4ZGDB 3QO3A 2JN0A 1Q86C 1VQ9Q 1X6OA 3HTRA 3MEAA 3X28B 5AT1B 4C8QE 3OYBA 2Y4XA 5IT9E 1GL5A 1NG2A 5KCHA 2RJEA 1OQKA 2X4JA 1QVFP 4MDXA 1Y7XA 3JB9D 2FG0A 4DBFA 2A08A 1PSEA 1H641 1YN8A 1X69A 5CKFA 1FX7A 3THKA 1WPYA 5CO7A 1I5LA 4OGEA 4D8KA 1PG5B 2MF2A 4CC7A 4ME7A 2RD1A 3EG1A 2ZCFB 2K3YA 1U06A 3MJXA 2HQXA 3CD6Q 2DRMA 1M1GA 5D7UA 1M8VA 2X4XA 1WHJA 1RUWA 2KEAA 1UB4A 1WJQA 2JTEA 2KNBB 2V8IA 9ATCB 1VYTA 4F04B 4XTYA 2YXYA 3KFVA 1VQ5T 4ORZA 3VV0A 1SHGA 4MZMA 3CC2A 2KQWA 4EDUA 3P8BB 3JCMb 4C0DB 1RAIB 3V7SA 4DBQA 1KQSS 1VA7A 2XG8D 5KYUB 1MV0B 2DXCA 4M77A 2LNHB 4C92C 1M3CA 2X3XD 3UA7A 1YJNQ 3JCMc 4BDYA 1FMWA 1VQ7Q 1I4K1 2KBTA 1C0MA 4L6V5 2DL4A 1QCFA 4XTUA 1YCYA 1WXTA 2C0OA 2FRWA 5IN1A 1VQPA 1N27A 3URGA 5J3BA 5DLOA 2FB7A 4BB7A 4C5GA 1HXDA 2FPFA 3X24B 1K0SA 3REBB 1D1CA 1YJNA 4PFZA 2KE9A 3PGGA 1CKBA 2CP2A 2CP7A 2O4XB 2LMJA 4RTTA 1KC8C 1W4SA 2YUPA 4KH0B 4RTZA 1Q7YR 5EC7A 3CBMA 5GAMe 2PQWA 1VUBA 4ZGJB 4OB3B 2A36A 2CZ1B 3CCEA 3KXTA 5A0LA 1YHQA 3JCMJ 4ELZC 1IB8A 3GNGA 4P5NA 2DEQA 3X25B 2OTJA 1TSFA 2L5QA 2J05A 2LX9A 2DETA 1R77A 4C92E 3A5ZB 1UTIA 1NJIC 1W2BA 2KROA 1WDXA 2EQIA 1VOMA 4N0AC 4E7IA 5GANj 4M75A 4C92F 5GMKj 5HY6A 1JJ2S 2D0QB 4BE1A 1YHQT 1M3BA 2AZSA 2EYWA 1SSHA 4JPBW 2BKDN 2DKGA 2P4TA 3BDUA 5ECAA 3QPHA 5FWBA 2VASA 3RUXA 1NYFA 2RQRA 4C8QA 1Y71A 3LWIA 2EYZA 3PIPA 5GAN7 3PTAA 1JRIA 3CMEQ 3EH1A 3I55A 3JB9F 1ZUUA 2ZPFB 2Z0WA 2J6KA 2MMPA 3L2QA 3CCST 4M77G 4M7DC 1M3AA 3C0CA 3SFMA 2VWFA 2LQ8A 2Y4YA 1XJWB 3EHQA 3CCJT 4DA4A 2LX7A 2JXBA 3FJ5A 3PVLA 3UDCA 2MCNA 2DZCA 1ZSZA 1LNXA 4J5YA 1M2VA 2RPNA 4AMCA 2DIQA 5I2MA 3OBYA 1AZGB 3GBQA 1IHWA 4XU2A 1LVKA 3E9FA 4IURA 2E12A 2JS2A 5GAMf 2PVOB 4C0GA 2O88A 4C8QG 3CCJA 3EAEA 3T9NA 1C1AA 1N8RU 1Z9QA 4JDSA 2XIDA 2K3XA 2XKOC 2YWWA 4M7AG 3TCJA 3VS4A 3JCMX 1KHIA 2KR3A 2K9GA 2YLCA 5GMKe 1R0BG 3I5SA 4AT1B 5KYXB 4PFPA 1Q82U 1QCOA 3H0HA 1S1NA 2CSQA 3O8VA 2LC4A 5D6WA 3EGUA 2HQHA 2E10A 2KRMA 1PC0A 3WXMB 1JQQA 2W0ZA 3HRSA 3VS6A 2K6DA 3VRZA 1PKTA 2OTLQ 2MYSA 3EGXB 2KYBA 2DNUA 2PVGB 3CCMQ 2M02A 1X75C 2P0KA 2P4RA 4M78B 1S72T 3JCMd 5LJ3f 2EKOA 1X27A 1VQ5Q 2RB6A 1BI3A 1MGQA 3M53A 4JJCA 1YJWT 2EQJA 4IIOA 3DB4A 1VIEA 2ZPBB 4CC2A 3M57A 1YFNA 1VQLA
chains in the Genus database with same CATH topology
2O31A 1IO6A 3SEMA 1BU1A 2D1XA 1YWOA 1B07A 2RNAA 3LH5A 1BK2A 2YUQA 2SRCA 5IH2A 2A28A 4FSSA 1PHTA 1TG0A 2LZ6B 4E6RA 3A98A 2NUZA 2DRKA 2EGAA 2JM9A 1NM7A 3M0TA 1GFCA 1ABQA 4Z8AA 2KXDA 2DYBA 4J9DA 1K4US 1AEYA 2LCSA 2GTOA 2DBKA 2XMFA 1JU5C 1PKSA 4M4ZA 2FPDA 2EGEA 4F16A 4Y92A 4J9BA 1NLPC 1SRLA 5FWCA 2EYXA 1MV3A 1UGVA 2CUBA 2LJ1A 1ZUKA 3QWXX 1GCQA 2AZVA 4JJDA 1M30A 4LNPA 1AD5A 3I5RA 2EKHA 1QWFA 1WFWA 2B86A 4LN2A 1I0CA 2CH4W 1SHFA 1GFDA 1RI9A 2OAWA 4ZNXA 4AFSC 2CH4A 4RTWA 1NEGA 2BZ8A 1FMKA 2L2PA 2L3QA 1SRMA 1N5ZA 3PE0A 1AWWA 2JT4A 1K76A 2AK5A 1B3QA 2LJ0A 2RF0A 2HCKA 1M27C 2H8HA 1QWEA 1V1CA 2DLPA 1HJDA 2K7AA 2O2OA 2DL8A 2RMOA 4AG2C 1QKWA 2M0YA 4JZ4A 1UUEA 2KRSA 1WI7A 1GCPA 1VYVA 2RQVA 1WIEA 2IIMA 2KRNA 2W10A 4RTXA 2O9VA 2CREA 2ED1A 3I35A 4CC3A 3NGPA 2YUOA 4J9HA 2ROLA 4CC4B 3UATA 5IXFA 4HCKA 2EPDA 2FRYA 2KYMA 4J9EA 1GCQC 4KRTA 2J6FA 5IHIA 1UE9A 3RBBB 2ED0A 2QDLA 2GTJA 2ESWA 1GL5A 1NG2A 2GQIA 1JXMA 1UDLA 1T0HA 2KT8A 4J9IA 2GGRA 4RTYA 4QT7A 3QWYA 1AOJA 2FG0A 2MIOA 2A08A 2GNCA 2JMCA 3REAB 1YN8A 4RTUA 1X69A 2EYYA 2YUNA 1HD3A 4DEYA 2BTTA 3THKA 2RQUA 1PRLC 3VS3A 3ULRB 1K9AA 1W6XA 4D8KA 4Z88A 4CC7A 1I1JA 2DF6A 2C0TA 2AKKA 3EG1A 2V1QA 2F2WA 1U06A 1WX6A 1VYUA 2RQTA 2DRMA 3JV3A 4JJBA 4GLMA 1T0JA 1NLOC 2L3SA 1OV3A 1RUWA 1GBQA 1Z9ZA 2KEAA 4R0KA 2M51A 2JTEA 2KNBB 2L0AA 5GJWB 1VYTA 2BZYA 4AFQC 1UJYA 2PNIA 3KFVA 1SPKA 2O9SA 1KSWA 1NEBA 5IXBA 4ORZA 1SHGA 2K79A 2J6OA 1X6GA 1FYNA 2OI3A 4JZ3A 2ABLA 2DM1A 2CT4A 1VA7A 1BBZA 3H0IA 1MV0B 1UG1A 1TUCA 1YP5A 2LNHB 1M3CA 2X3XD 3UA7A 1JO8A 1AWOA 3TSWA 1OPKA 2FEIA 2D8HA 4LE9A 2KBTA 2AKLA 2DL4A 1LCKA 2HDAA 2RQWA 1QCFA 1M8MA 1WXTA 3EG2A 1H3HA 2C0OA 2LP5A 2FRWA 5I22A 2JMAA 4F14A 1UHCA 2EW3A 3H41A 1MUZA 2ENMA 5FW9A 4HXJA 2PTKA 1EFNA 2DMOA 2LQWA 1YNZA 3NPFA 1PNJA 2YSQA 1OPLA 2I0NA 2FPFA 1K0SA 3REBB 1KIKA 2ECZA 1OEBA 2EVRA 2KE9A 1UHFA 4J9CA 3M0PA 1CKBA 1RLPC 2RN8A 1X2KA 2OJ2A 2JW4A 2YDLA 2K3BA 2A37A 2LMJA 4RTTA 1XOVA 1W70A 2YUPA 2LJ3A 4EIKA 2DX1A 4F17A 1ZUYA 1WXUA 4RTZA 5EC7A 1H92A 3UA6A 5I11A 1JXOA 2KGTA 3SHWA 2A36A 1AVZC 4X1VA 2JM8A 4OMMA 1K1ZA 1X6BA 1G83A 2KT1A 2CSIA 3CQTA 4LUEA 1JEGA 1KFZA 1X43A 1YCSB 3VS7A 3U23A 4HVWA 1U3OA 2F2XA 2J05A 1A0NB 3TVTA 1HSQA 1UTIA 2C0IA 2KROA 3ZL7C 1WDXA 2EQIA 1GBRA 1ZLMA 4AFUC 1SEMA 1PRMC 1ARKA 2HBWA 2SEMA 2DJQA 1M3BA 2AZSA 2G6FX 2EYWA 1SSHA 2DL3A 4JPBW 5GJVB 1RLQC 4OMQA 5ECAA 1YWPA 5FWBA 3O5ZA 1AWJA 1NYFA 2LQNA 2EGCA 2RQRA 3R6NA 2EYZA 3PVQA 1X2QA 3M0RA 1AZEA 2D8JA 1ZUUA 2J7IA 3M0SA 2CT3A 4OMPA 2J6KA 4HVUA 2DVJA 2J06A 2V1RA 1M3AA 3C0CA 3I9QA 4RTVA 4J9GA 4OMOA 2FO0A 2VWFA 2DE0X 2VVKA 3EHQA 4D8DA 2LX7A 2JXBA 3FJ5A 3PVLA 2MCNA 1BB9A 1UJ0A 3VS0A 1G2BA 1K0XA 1GRIA 4OMLA 4Z89A 2RPNA 1PWTA 1UECA 2HSPA 3NHNA 1AZGB 3GBQA 3VS5A 1QLYA 4RUGA 2JS2A 1TUDA 2O88A 3VS2A 2D0NA 2EBPA 5IHNA 2DA9A 1Z9QA 2E5KA 3EG3A 1ABOA 3H0FA 1W1FA 1WLPB 4AG1C 2MOXA 3IQLA 4GBQA 3VS4A 4AFZC 2DL5A 2KR3A 2K9GA 2ROTA 1U5SA 1ZX6A 2NWMA 1ZBJA 1WYXA 1AWXA 3I5SA 1E6GA 4WCIA 2GBQA 1KJWA 3H0HA 4K11A 1S1NA 2CSQA 5L23A 3RNJA 1I07A 2JS0A 2FPEA 3EGUA 3VRYA 1H8KA 2YT6A 2K2MA 5IHKA 2KRMA 4A63B 2X3WD 2DILA 1JQQA 1Y57A 2W0ZA 3VS6A 1J3TA 1WXBA 2K6DA 4HVVA 3VRZA 1WA7A 3EHRA 2BZXA 1T3LA 2CDTA 1T3SA 1PKTA 2PZ1A 4OMNA 3VS1A 4LUDA 1Y0MA 2KYBA 3TSZA 1CKAA 2DNUA 2DBMA 1CSKA 2F2VA 2HEQA 2DL7A 1OOTA 3M0QA 2CUDA 2VKNA 2P4RA 1E6HA 2L3PA 3M0UA 3EG0A 3NMZC 1X27A 2KXCA 1E7OA 4JJCA 4DEXA 5HCKA 1QKXA 3UF4A 1UFFA 4J9FA 4ESRA 4IIMA 4IIOA 1NYGA 4CC2A 1ZSGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2O31 A;  1IO6 A;  3SEM A;  1BU1 A;  2D1X A;  1YWO A;  1B07 A;  2RNA A;  3LH5 A;  1BK2 A;  2YUQ A;  2SRC A;  5IH2 A;  2A28 A;  4FSS A;  1PHT A;  1TG0 A;  2LZ6 B;  4E6R A;  3A98 A;  2NUZ A;  2DRK A;  2EGA A;  2JM9 A;  1NM7 A;  3M0T A;  1GFC A;  1ABQ A;  4Z8A A;  2KXD A;  2DYB A;  4J9D A;  1K4U S;  1AEY A;  2LCS A;  2GTO A;  2DBK A;  2XMF A;  1JU5 C;  1PKS A;  4M4Z A;  2FPD A;  2EGE A;  4F16 A;  4Y92 A;  4J9B A;  1NLP C;  1SRL A;  5FWC A;  2EYX A;  1MV3 A;  1UGV A;  2CUB A;  2LJ1 A;  1ZUK A;  3QWX X;  1GCQ A;  2AZV A;  4JJD A;  1M30 A;  4LNP A;  1AD5 A;  3I5R A;  2EKH A;  1QWF A;  1WFW A;  2B86 A;  4LN2 A;  1I0C A;  2CH4 W;  1SHF A;  1GFD A;  1RI9 A;  2OAW A;  4ZNX A;  4AFS C;  2CH4 A;  4RTW A;  1NEG A;  2BZ8 A;  1FMK A;  2L2P A;  2L3Q A;  1SRM A;  1N5Z A;  3PE0 A;  1AWW A;  2JT4 A;  1K76 A;  2AK5 A;  1B3Q A;  2LJ0 A;  2RF0 A;  2HCK A;  1M27 C;  2H8H A;  1QWE A;  1V1C A;  2DLP A;  1HJD A;  2K7A A;  2O2O A;  2DL8 A;  2RMO A;  4AG2 C;  1QKW A;  2M0Y A;  4JZ4 A;  1UUE A;  2KRS A;  1WI7 A;  1GCP A;  1VYV A;  2RQV A;  1WIE A;  2IIM A;  2KRN A;  2W10 A;  4RTX A;  2O9V A;  2CRE A;  2ED1 A;  3I35 A;  4CC3 A;  3NGP A;  2YUO A;  4J9H A;  2ROL A;  4CC4 B;  3UAT A;  5IXF A;  4HCK A;  2EPD A;  2FRY A;  2KYM A;  4J9E A;  1GCQ C;  4KRT A;  2J6F A;  5IHI A;  1UE9 A;  3RBB B;  2ED0 A;  2QDL A;  2GTJ A;  2ESW A;  1GL5 A;  1NG2 A;  2GQI A;  1JXM A;  1UDL A;  1T0H A;  2KT8 A;  4J9I A;  2GGR A;  4RTY A;  4QT7 A;  3QWY A;  1AOJ A;  2FG0 A;  2MIO A;  2A08 A;  2GNC A;  2JMC A;  3REA B;  1YN8 A;  4RTU A;  1X69 A;  2EYY A;  2YUN A;  1HD3 A;  4DEY A;  2BTT A;  3THK A;  2RQU A;  1PRL C;  3VS3 A;  3ULR B;  1K9A A;  1W6X A;  4D8K A;  4Z88 A;  4CC7 A;  1I1J A;  2DF6 A;  2C0T A;  2AKK A;  3EG1 A;  2V1Q A;  2F2W A;  1U06 A;  1WX6 A;  1VYU A;  2RQT A;  2DRM A;  3JV3 A;  4JJB A;  4GLM A;  1T0J A;  1NLO C;  2L3S A;  1OV3 A;  1RUW A;  1GBQ A;  1Z9Z A;  2KEA A;  4R0K A;  2M51 A;  2JTE A;  2KNB B;  2L0A A;  5GJW B;  1VYT A;  2BZY A;  4AFQ C;  1UJY A;  2PNI A;  3KFV A;  1SPK A;  2O9S A;  1KSW A;  1NEB A;  5IXB A;  4ORZ A;  1SHG A;  2K79 A;  2J6O A;  1X6G A;  1FYN A;  2OI3 A;  4JZ3 A;  2ABL A;  2DM1 A;  2CT4 A;  1VA7 A;  1BBZ A;  3H0I A;  1MV0 B;  1UG1 A;  1TUC A;  1YP5 A;  2LNH B;  1M3C A;  2X3X D;  3UA7 A;  1JO8 A;  1AWO A;  3TSW A;  1OPK A;  2FEI A;  2D8H A;  4LE9 A;  2KBT A;  2AKL A;  2DL4 A;  1LCK A;  2HDA A;  2RQW A;  1QCF A;  1M8M A;  1WXT A;  3EG2 A;  1H3H A;  2C0O A;  2LP5 A;  2FRW A;  5I22 A;  2JMA A;  4F14 A;  1UHC A;  2EW3 A;  3H41 A;  1MUZ A;  2ENM A;  5FW9 A;  4HXJ A;  2PTK A;  1EFN A;  2DMO A;  2LQW A;  1YNZ A;  3NPF A;  1PNJ A;  2YSQ A;  1OPL A;  2I0N A;  2FPF A;  1K0S A;  3REB B;  1KIK A;  2ECZ A;  1OEB A;  2EVR A;  2KE9 A;  1UHF A;  4J9C A;  3M0P A;  1CKB A;  1RLP C;  2RN8 A;  1X2K A;  2OJ2 A;  2JW4 A;  2YDL A;  2K3B A;  2A37 A;  2LMJ A;  4RTT A;  1XOV A;  1W70 A;  2YUP A;  2LJ3 A;  4EIK A;  2DX1 A;  4F17 A;  1ZUY A;  1WXU A;  4RTZ A;  5EC7 A;  1H92 A;  3UA6 A;  5I11 A;  1JXO A;  2KGT A;  3SHW A;  2A36 A;  1AVZ C;  4X1V A;  2JM8 A;  4OMM A;  1K1Z A;  1X6B A;  1G83 A;  2KT1 A;  2CSI A;  3CQT A;  4LUE A;  1JEG A;  1KFZ A;  1X43 A;  1YCS B;  3VS7 A;  3U23 A;  4HVW A;  1U3O A;  2F2X A;  2J05 A;  1A0N B;  3TVT A;  1HSQ A;  1UTI A;  2C0I A;  2KRO A;  3ZL7 C;  1WDX A;  2EQI A;  1GBR A;  1ZLM A;  4AFU C;  1SEM A;  1PRM C;  1ARK A;  2HBW A;  2SEM A;  2DJQ A;  1M3B A;  2AZS A;  2G6F X;  2EYW A;  1SSH A;  2DL3 A;  4JPB W;  5GJV B;  1RLQ C;  4OMQ A;  5ECA A;  1YWP A;  5FWB A;  3O5Z A;  1AWJ A;  1NYF A;  2LQN A;  2EGC A;  2RQR A;  3R6N A;  2EYZ A;  3PVQ A;  1X2Q A;  3M0R A;  1AZE A;  2D8J A;  1ZUU A;  2J7I A;  3M0S A;  2CT3 A;  4OMP A;  2J6K A;  4HVU A;  2DVJ A;  2J06 A;  2V1R A;  1M3A A;  3C0C A;  3I9Q A;  4RTV A;  4J9G A;  4OMO A;  2FO0 A;  2VWF A;  2DE0 X;  2VVK A;  3EHQ A;  4D8D A;  2LX7 A;  2JXB A;  3FJ5 A;  3PVL A;  2MCN A;  1BB9 A;  1UJ0 A;  3VS0 A;  1G2B A;  1K0X A;  1GRI A;  4OML A;  4Z89 A;  2RPN A;  1PWT A;  1UEC A;  2HSP A;  3NHN A;  1AZG B;  3GBQ A;  3VS5 A;  1QLY A;  4RUG A;  2JS2 A;  1TUD A;  2O88 A;  3VS2 A;  2D0N A;  2EBP A;  5IHN A;  2DA9 A;  1Z9Q A;  2E5K A;  3EG3 A;  1ABO A;  3H0F A;  1W1F A;  1WLP B;  4AG1 C;  2MOX A;  3IQL A;  4GBQ A;  3VS4 A;  4AFZ C;  2DL5 A;  2KR3 A;  2K9G A;  2ROT A;  1U5S A;  1ZX6 A;  2NWM A;  1ZBJ A;  1WYX A;  1AWX A;  3I5S A;  1E6G A;  4WCI A;  2GBQ A;  1KJW A;  3H0H A;  4K11 A;  1S1N A;  2CSQ A;  5L23 A;  3RNJ A;  1I07 A;  2JS0 A;  2FPE A;  3EGU A;  3VRY A;  1H8K A;  2YT6 A;  2K2M A;  5IHK A;  2KRM A;  4A63 B;  2X3W D;  2DIL A;  1JQQ A;  1Y57 A;  2W0Z A;  3VS6 A;  1J3T A;  1WXB A;  2K6D A;  4HVV A;  3VRZ A;  1WA7 A;  3EHR A;  2BZX A;  1T3L A;  2CDT A;  1T3S A;  1PKT A;  2PZ1 A;  4OMN A;  3VS1 A;  4LUD A;  1Y0M A;  2KYB A;  3TSZ A;  1CKA A;  2DNU A;  2DBM A;  1CSK A;  2F2V A;  2HEQ A;  2DL7 A;  1OOT A;  3M0Q A;  2CUD A;  2VKN A;  2P4R A;  1E6H A;  2L3P A;  3M0U A;  3EG0 A;  3NMZ C;  1X27 A;  2KXC A;  1E7O A;  4JJC A;  4DEX A;  5HCK A;  1QKX A;  3UF4 A;  1UFF A;  4J9F A;  4ESR A;  4IIM A;  4IIO A;  1NYG A;  4CC2 A;  1ZSG A; 
#chains in the Genus database with same CATH topology
 1IHV A;  2QAS A;  4J7F A;  1IO6 A;  2ZPH B;  1BU1 A;  2D1X A;  5DLQ E;  1YWO A;  2JNG A;  2DER A;  4OGC A;  5FRN A;  1OYX A;  2QAZ A;  2HAX A;  4OB2 B;  4XAX B;  2NLU A;  1VQ6 T;  2CP5 A;  2JTF A;  3F70 A;  3PMI A;  2XDD A;  1Q81 R;  3LYI A;  4Z8A A;  4KUL A;  1AEY A;  3QHS A;  2MPX C;  2XMF A;  5LJ3 j;  3CPW A;  4F7U B;  1JU5 C;  4F16 A;  3OQ5 A;  3JCM h;  4J9B A;  5GAN 6;  2QQB A;  2EYX A;  2LJ1 A;  1ZUK A;  5LJ5 j;  5GAN 8;  2YRC A;  3RKX A;  5CR2 A;  4LNP A;  2MWO A;  1QWF A;  3EFO B;  2B86 A;  4LN2 A;  2P0P A;  1I0C A;  3I56 T;  4ZNX A;  2OAW A;  3CCE T;  2JOY A;  2RHI A;  4IUP A;  2GFU A;  4RTW A;  3SDZ A;  4RG8 A;  1SRM A;  1KC8 R;  1NBE B;  1Q81 C;  1BI2 A;  2ZAE A;  3PMT A;  5GAO r;  1BI0 A;  4OB0 B;  5GAN 4;  2AK5 A;  1MMA A;  5AYF A;  5GMK m;  1VQN A;  4ANJ A;  2LJ0 A;  1WQW A;  2FZG B;  2RF0 A;  1NPR A;  3M54 A;  3H6Z A;  1Q81 U;  2NUP B;  2O2O A;  2ZPI B;  1VQP T;  1QKW A;  4JZ4 A;  1TUG B;  1VYV A;  3OB9 A;  3BY7 A;  2DD4 A;  4O5V A;  3CCQ T;  2F5K A;  2E3I A;  3EFR A;  1VQN T;  4HCC A;  4J7I A;  2YUO A;  1G5V A;  3JCM P;  4XTV A;  4CC4 B;  3UAT A;  2KYM A;  4J9E A;  4KRT A;  5CK9 A;  5IHI A;  1UE9 A;  2A7Y A;  3CC7 Q;  1UEB A;  3M9Q A;  4M75 D;  4ZN3 A;  4FYV B;  2ED0 A;  2GTJ A;  1MHN A;  2ESW A;  2L89 A;  2GQI A;  1JXM A;  2VXF A;  4RG2 A;  3QG1 A;  4J9I A;  5KE2 A;  3P8H A;  3CCR A;  1K9M C;  3VUZ A;  2YRD A;  4Z02 A;  3G4S T;  3DKM A;  3QWY A;  2MIO A;  1GXI E;  2JMC A;  4F7U F;  1QVF A;  4M78 C;  4XTX A;  3LLR A;  1JJ2 P;  5CKE A;  4M78 E;  1G3Y A;  1HD3 A;  2RQU A;  1PRL C;  3D7S B;  3VS3 A;  3WVD B;  2C0T A;  2AKK A;  2QQR A;  2V1Q A;  2F2W A;  4X9C A;  3OS2 A;  2X51 A;  2LTO A;  3UPU A;  3CCR Q;  2CP6 A;  1OU8 A;  3INZ A;  2E65 A;  3MKD A;  4PJO F;  1VQ8 Q;  4GLM A;  2HKQ B;  4F7U G;  3QDR B;  2V26 A;  3X20 B;  4B9W A;  4R0K A;  1I81 A;  5CQX A;  1VQK Q;  4JRP A;  1KG1 A;  4IUQ A;  1SPK A;  2O9S A;  1KSW A;  3PFS A;  3CXC P;  3G4S A;  2LCL A;  4NS5 A;  1FYN A;  2VUB A;  2M9U A;  2X4W A;  4E7J A;  2HZY A;  1Q7Y U;  1QP2 A;  1BCM A;  1YJ9 A;  1QCN A;  4L59 A;  1UG1 A;  4DQ2 A;  4LD6 A;  1BYM A;  2QI2 A;  1VQ4 Q;  3OSV A;  3OYE A;  3OW2 A;  3TSW A;  3NTI A;  2FEI A;  3C95 A;  4QQ6 A;  2NUT A;  2AKL A;  3EGD A;  4UC4 A;  1LCK A;  2HDA A;  1M8M A;  5GAN 2;  3EG2 A;  1AT1 B;  1YI2 T;  4B6M A;  1KD1 C;  4C0F A;  5C6S A;  2CP0 A;  1MUZ A;  2VGM A;  1D3B A;  3HP9 A;  3CBO A;  2PTK A;  3CMA A;  2LQW A;  1YNZ A;  1PNJ A;  3V7R A;  4FW1 A;  2NYS A;  1KIK A;  4BE2 A;  1VQK T;  2L8D A;  2RJC A;  4XK8 E;  4J9C A;  5GAM g;  1YIT Q;  2JW4 A;  1IXD A;  4E7Z A;  3E2U A;  3HFN A;  3L2Z A;  1LOJ A;  1B34 A;  3CBP A;  3L42 A;  1G3T A;  4JLG A;  4KUI A;  4X1V A;  3QBY A;  2RI2 A;  4E7K A;  2BE7 D;  2KT1 A;  4PJO B;  3CQT A;  1JEG A;  1KFZ A;  1X43 A;  4C92 B;  4V2S A;  4PJM A;  4PL6 A;  1WHL A;  4HCB A;  3TVT A;  1ZSZ B;  3RMS A;  2E3H A;  3HL8 A;  3ZL7 C;  3CC7 T;  2IPO B;  2CZ7 B;  3KUF A;  4L5G A;  3OYY A;  2E6Z A;  1KD1 R;  2DXB A;  2KMT A;  1ARK A;  2HBW A;  2QA4 Q;  2G6F X;  2DL3 A;  3QSU A;  1RLQ C;  4JLI A;  3EFS A;  1OX8 A;  2A0F B;  1YWP A;  1AWJ A;  2E4H A;  2KY9 A;  2YRV A;  3PVQ A;  1QVG A;  2CGH A;  1AZE A;  1FWZ A;  3CCQ A;  1IRE B;  4X34 A;  3M0S A;  2CT3 A;  4OMP A;  3G6E A;  4KT0 E;  4HA8 A;  2LQK A;  1V76 A;  2DVJ A;  3ZFJ A;  3GF5 A;  2V8J A;  3M4Y A;  1Q82 R;  4E47 A;  4KBM B;  1ZA1 B;  4OP0 A;  3VYG A;  4D8D A;  4D6W A;  2DVE A;  1FMV A;  1VQN Q;  3JRZ A;  1BB9 A;  1N9R A;  4DBH A;  1VQ4 T;  1G2B A;  4QVZ A;  1GRI A;  2X4Y A;  4HT9 A;  1QW1 A;  4OML A;  4C8Q C;  4BE0 A;  1YJ9 Q;  4GY5 A;  2AIR B;  2GFA A;  5A0D A;  4A4H A;  1LJO A;  1RAD B;  3I55 Q;  4DOW A;  3CC2 Q;  2KSS A;  2E70 A;  3FRN A;  1TUD A;  2DO3 A;  5IHN A;  3L2W A;  2EAY A;  2LNV A;  3MEV A;  1M2O A;  1RAH B;  3EG3 A;  3H0F A;  1WLP B;  4FM4 B;  1P92 A;  4AFZ C;  3LWH A;  1BI1 A;  3CC4 T;  1U5S A;  2RHX A;  2RJF A;  5HK0 A;  3EG9 B;  1W2B P;  1MMD A;  2NWM A;  4KH1 B;  2QA4 A;  1YJN T;  1E6G A;  1VQK A;  1I5O B;  3PNW C;  2LRQ A;  4XQ3 A;  4K11 A;  1M1K U;  2DTH A;  4M7D F;  1OU9 A;  4DOV A;  4BI8 B;  1H8K A;  3NTK A;  2K2M A;  1VQ4 A;  2DIL A;  1Y57 A;  1HYO A;  4KUD K;  3CD6 T;  1WXB A;  3G71 A;  3FC3 A;  1NJI U;  1WA7 A;  1T3L A;  4J6Y A;  2CDT A;  2PZ1 A;  3VS1 A;  1Q86 R;  4A4E A;  1Y0M A;  3TSZ A;  1N6A A;  1CKA A;  2COZ A;  2LVM A;  1VQ7 T;  3M56 A;  1PD1 A;  1OOT A;  2NUT B;  2CUD A;  5KYN A;  3MPU B;  4JS4 A;  2F1L A;  3CEY A;  2ZGW A;  2KXC A;  3CCR T;  4C8Q D;  1E7O A;  4DEX A;  4M7D G;  3UF4 A;  4J9F A;  4ESR A;  3HRU A;  2G3R A;  3S3O A;  1WHG A;  4PJO C;  3JCM e;  2DPP B;  4IUV A;  1YIJ A;  4BY6 C;  4OVA A;  3OS0 A;  3LGF A;  3SB2 A;  3V7C A;  2K5F A;  4CRI A;  3OMG A;  5IH2 A;  1Q7Y C;  3CCU Q;  2X9H A;  1RL2 A;  2RK2 A;  2VV5 A;  4OF1 A;  4QQG A;  3QUI A;  5GAN 5;  1ZSZ C;  4M78 D;  2COW A;  2EGA A;  3A8M B;  4FYW B;  2JM9 A;  3JAM E;  4XTZ A;  3M0T A;  1K4U S;  1Q95 G;  1NJI R;  3G6E Q;  2GTO A;  4KGZ B;  1Q86 U;  3L2U A;  2FPD A;  4Y92 A;  2FHD A;  3M58 A;  1SRL A;  5FWC A;  4PJO G;  1JBM A;  3QWX X;  1GCQ A;  2RO0 A;  3QDF A;  1KQS P;  2DZ9 A;  3EGX A;  5GAN d;  3M59 A;  6AT1 B;  4E2F B;  3RIR A;  4C92 G;  3OYL A;  1YIJ T;  1NEG A;  4N4H A;  4IUT A;  2VYT A;  1KHC A;  2KDS A;  1M90 R;  3BW1 A;  3PE0 A;  2JT4 A;  1K76 A;  3J81 E;  5FRM A;  2P0Q A;  1K73 U;  2QXF A;  4M77 E;  3CME T;  2K4Y A;  1C6V X;  4LD9 K;  1M27 C;  2HBP A;  4FT4 A;  1QWE A;  2KK4 A;  2K7A A;  4M77 F;  1DJ7 B;  5GAO p;  1QMC A;  3MP1 A;  3P8D A;  3A8L B;  2CP3 A;  5LJ5 f;  4X9D A;  5DY9 A;  3OMC A;  2RHZ A;  2KRN A;  2R5A A;  2JTM A;  4LXC A;  2CRE A;  3I35 A;  3DLM A;  4C5I A;  1K8A C;  2M0O A;  5GAN h;  1QVP A;  1TXQ A;  2FRY A;  4M7D E;  3CCS A;  1GCQ C;  3OW2 S;  1VQL Q;  1ZBX A;  2GCX A;  4QQD A;  3FLG A;  3RBB B;  4M7D B;  5DM7 R;  1LPL A;  1UDL A;  2M16 A;  1T0H A;  2KT8 A;  3A8O B;  4KGX B;  4RTY A;  4MZP A;  4QT7 A;  1IRX A;  1AOJ A;  3S3M A;  4BDZ A;  1VQO T;  4VUB A;  1KD1 U;  2EYY A;  3LX7 A;  2YUN A;  2BTT A;  2XU8 A;  3ZEH A;  4LDW A;  3G71 Q;  4IUU A;  3TEE A;  2RHU A;  4Z88 A;  1I1J A;  2DF6 A;  5KYW B;  3CCV Q;  1OZ2 A;  4A54 A;  3CCU A;  1WX6 A;  1K9M R;  2EYQ A;  1VYU A;  2DTO A;  5D6Y A;  4MML A;  3JV3 A;  4JJB A;  4BY6 B;  5L8R E;  5LL6 S;  3CXC S;  2L3S A;  3CCM T;  1Z9Z A;  3MO8 A;  4NL2 A;  5GAN 3;  4PJO D;  1N8R C;  5GJW B;  1RAG B;  3CC4 Q;  2BZY A;  4AFQ C;  1UJY A;  1OI1 A;  2PNI A;  3HSB A;  3RMQ A;  8AT1 B;  5IXB A;  1I8F A;  1YIJ Q;  2COY A;  2K79 A;  2YHT A;  2C06 A;  1WZO A;  4ZN1 A;  1VQO A;  1YI2 A;  3G1J A;  3JB9 J;  2ABL A;  1R0C B;  4F7U E;  2DM1 A;  2CT4 A;  4JJN K;  1BBZ A;  3UWN A;  3VJP A;  4EMH A;  4NL3 A;  3CCU T;  2LT4 A;  1JO8 A;  4KGV B;  1OPK A;  4LE9 A;  3JCM Q;  3EGD B;  2BE9 B;  3M4G A;  1H3H A;  2XK0 A;  3GLX A;  5I22 A;  2QDY B;  1MMN A;  2JMA A;  1KQS A;  2DXU A;  1NPP A;  3QKJ A;  5KYY A;  2EW3 A;  1M1K R;  5FW9 A;  1B7T A;  1EFN A;  1ZHI A;  1RAA B;  5J26 A;  3JCM V;  4C0D C;  2R57 A;  3M5A A;  4C0Z A;  2ECZ A;  1OEB A;  2EVR A;  1UHF A;  3M0P A;  3NTH A;  1RLP C;  5LJ3 e;  5KYX A;  2RN8 A;  1V29 B;  1X2K A;  2OJ2 A;  2XDB A;  3MP6 A;  4R55 A;  2YDL A;  2A37 A;  3QYH B;  4MDW A;  4XU0 A;  1XOV A;  2LJ3 A;  4F17 A;  1ZUY A;  2OTJ T;  3CXC A;  2ZZD A;  4A4F A;  4BI3 A;  1B34 B;  2KVQ G;  3UA6 A;  1RI0 A;  3SHW A;  5GMK l;  4OMM A;  4ZGE B;  1K1Z A;  5GAN f;  4A4G A;  1G83 A;  3SD4 A;  4Y91 A;  4LUE A;  1BKB A;  3U23 A;  4HVW A;  1U3O A;  2F2X A;  4ELY C;  4M78 A;  1VQ8 A;  1HK9 A;  1A0N B;  3RKY A;  2RI3 A;  2PU9 B;  5LJ5 h;  3CCQ Q;  1S72 Q;  1D0Y A;  2CZ6 B;  2MAM A;  1SEM A;  2E64 A;  3CCV A;  2DJQ A;  1XQH A;  4N4G A;  2DIG A;  1M1K C;  2CZ0 B;  4OMQ A;  5FU7 C;  3O5Z A;  4J83 A;  3OYD A;  3R6O A;  2EGC A;  4BUG A;  4E7H A;  2ATC B;  3SWN B;  3HKS A;  2D8J A;  1K9M U;  4II1 A;  4HVU A;  2J06 A;  2V1R A;  2RK1 A;  3ZBD A;  3QII A;  3A8G B;  4FSX A;  2ZPE B;  2VB6 A;  2PUK B;  4OMO A;  1AHJ B;  4FW2 A;  3CMA Q;  3VYH B;  2HMA A;  4HT8 A;  4FT2 A;  4PNO A;  4M7A C;  1M9S A;  2DFU A;  3TU4 K;  3AT1 B;  1UJ0 A;  3VS0 A;  1K8A R;  1K0X A;  1MNE A;  4FYY B;  4Z89 A;  1PWT A;  4PLL A;  2HSP A;  3NHN A;  2RH2 A;  1IGQ A;  4Q5W A;  1PSF A;  5GAO l;  2DXT A;  4HKE A;  4RUG A;  1BCO A;  2XHC A;  3MCA B;  2DD5 A;  1M2V B;  3VS2 A;  2DA9 A;  4M7A D;  1G3S A;  4YTL A;  1SKU B;  2WAC A;  2E5K A;  1W1F A;  1O75 A;  2A3L A;  4PKC C;  5C0M A;  1WHH A;  2Y90 A;  2LDM A;  3IQL A;  5LJ3 d;  3C94 A;  2FYK A;  5HKC A;  1WHM A;  1D1B A;  4QVC A;  3GOX A;  3EG9 A;  2EJG A;  1VQL T;  2RHY A;  3V8L A;  1WYX A;  2QTX A;  5M9O A;  1AWX A;  3HRT A;  2GBQ A;  1KJW A;  2OTJ Q;  2DTI A;  3RNJ A;  1I07 A;  4PJO E;  2RJD A;  5GAM h;  3VRY A;  4QKU A;  1RAB B;  1VQ9 A;  3GIB A;  5EG2 A;  1W2B S;  1N9S A;  3OW2 P;  4HVV A;  3EHR A;  3JB9 I;  2I2L A;  1T3S A;  4OMN A;  1D1A A;  1NE8 A;  1CSK A;  3H8Z A;  4JRI A;  5LJ5 g;  3ER0 A;  2XD0 A;  5I2S A;  2BIV A;  4FCY A;  4M77 C;  5KCO A;  3NMZ C;  1QP3 A;  1ZQ1 A;  2FZC B;  4M75 E;  5HCK A;  1QKX A;  1VQ6 A;  1TWB A;  4ZTF A;  4ZTJ A;  3OY9 A;  1UFF A;  1ZA2 B;  3TQ7 P;  4J6W A;  3SWN A;  2E6N A;  2MK5 A;  3OYH A;  1ZSG A;  2O31 A;  2FL7 A;  3SEM A;  4PFO A;  2VC8 A;  5GAM d;  1M90 U;  2PUO B;  2WSF E;  3MET A;  1BK2 A;  2YUQ A;  5GAM j;  4WF2 A;  3VKI A;  4FIB A;  5GAN e;  4F7U A;  5CIU A;  4FSS A;  1R8O B;  1PHT A;  1RAC B;  1TG0 A;  2EQU A;  4E6R A;  1YJW A;  2JZ2 A;  3TRE A;  1UGS B;  1Y96 B;  2DRK A;  1Y07 A;  2OX7 A;  1NM7 A;  1WQ7 A;  4M7D D;  2KXD A;  2DYB A;  4J9D A;  3JB9 H;  3EH2 A;  2LCS A;  2QEX Q;  3CCJ Q;  2AT1 B;  1OX9 A;  1JJ2 A;  4M4Z A;  2HL3 A;  2EGE A;  1MND A;  1OZ3 A;  1NLP C;  3FEO A;  3ME9 A;  5CAI A;  5CVI A;  1JB0 E;  4M7D A;  3PIO A;  1FXX A;  1S72 A;  1AD5 A;  3BE3 A;  1TTH B;  1M5Q 1;  2QTV A;  3I5R A;  1WFW A;  5J39 A;  4M7A A;  1SHF A;  1GFD A;  2XDP A;  2QK0 A;  3HFO A;  4QW2 A;  3OA6 A;  4AFS C;  2CH4 A;  4C8Q F;  2H3E B;  2L2P A;  2L3Q A;  3V8J A;  1Q82 C;  3C12 A;  2HSE B;  1SF9 A;  1N5Z A;  4M7A B;  2DK3 A;  1AWW A;  3H9N A;  4N0A A;  4JUV A;  1D0X A;  2QQ9 A;  1B3Q A;  2X35 A;  2HCK A;  3FB9 A;  4XTW A;  1VIF A;  2VXE A;  3MEW A;  2K2V A;  1H3Z A;  3RDV A;  1V1C A;  4TVR A;  1VQ6 Q;  3CCS Q;  5GAO n;  2RMO A;  2M0Y A;  4MMK A;  1WI7 A;  1GCP A;  1TH7 A;  4BD3 A;  5KE3 A;  1WJR A;  1QVG P;  4Y28 E;  1MMG A;  4M77 D;  1WIE A;  3NGP A;  4XU1 A;  4J9H A;  4OMF B;  4RKU E;  4EPC A;  3CPW P;  5IXF A;  2EJ9 A;  2FVU A;  3EFO A;  1UGR B;  5CKD A;  1VQ7 A;  1YIT T;  3GNF B;  2QDL A;  2IVW A;  4LDV A;  1VQM A;  2EWN A;  2GGR A;  2QGG A;  3OSS C;  2LT1 A;  2HD0 A;  2GNC A;  2D9T A;  2R58 A;  3REA B;  1KK7 A;  4RTU A;  3QXE B;  2L3R A;  3FDR A;  2QG9 B;  3LGL A;  4DEY A;  1YJ9 T;  3VU3 C;  2CKK A;  3ULR B;  1K9A A;  1W6X A;  3S6W A;  5CKB A;  5KYU A;  3CC4 A;  1BIA A;  3E19 A;  3S3N A;  3OS5 A;  5LJ3 h;  1VQM Q;  2RQT A;  2HKN A;  2B8A A;  2EQK A;  3V8K A;  5GAN g;  5GMK h;  2EQM A;  1T0J A;  3QYG B;  2QA4 T;  1NLO C;  1PM3 A;  1OV3 A;  1TOV A;  1PCX A;  4E7S A;  1GBQ A;  1XTD A;  2M51 A;  2O01 E;  3JCM g;  2L0A A;  5D6X A;  4ATO A;  3JCM W;  2R5M A;  3QJ6 A;  4PJL A;  1K8A U;  4BI4 A;  4LDX A;  3DLL A;  1NEB A;  2KI7 A;  3CD6 A;  2J6O A;  2AHJ B;  1D09 B;  1X6G A;  3RKW A;  2OI3 A;  2MI6 A;  2RM4 A;  3FJP A;  3G4S Q;  5LJ5 e;  4JZ3 A;  5A2Q E;  1TS9 A;  3Q1J A;  5CCA A;  3L2R A;  1N8R R;  1RAF B;  4N4I A;  3H0I A;  1TUC A;  1YP5 A;  2E1H A;  2RI5 A;  3BFM A;  4GLK A;  1AWO A;  4CI0 C;  2EFI A;  2D8H A;  3UT1 A;  5FU7 B;  5KH6 A;  2RQW A;  3SWN C;  1WNL A;  4C92 D;  1PD0 A;  2LP5 A;  4C5H A;  4F14 A;  1UHC A;  3OYK A;  3OYF A;  4PJJ A;  5FLX E;  3H41 A;  2FZK B;  2ENM A;  1KQ1 A;  4HXJ A;  1X01 A;  1EIF A;  2NUP A;  2DMO A;  5KYW A;  3NPF A;  1YHQ Q;  2YSQ A;  1OPL A;  3J80 E;  2I0N A;  3X26 B;  3MHX A;  1O9S A;  3LH0 A;  3J7A F;  4M75 G;  3QJY A;  2VGN A;  1D3B B;  3BDL A;  1U1S A;  2K3B A;  3AHU A;  1W70 A;  4EIK A;  2DX1 A;  3QZ9 B;  2HNI A;  3CPW S;  1WXU A;  4FU6 A;  4PJO A;  1YIT A;  1H92 A;  2YLB A;  5I11 A;  1JXO A;  3G6E T;  2KGT A;  1AVZ C;  2JM8 A;  4MZT A;  2DYI A;  3OYJ A;  3CCL T;  1X6B A;  4PJN A;  2CSI A;  2QYZ A;  3JB9 G;  1YCS B;  3VS7 A;  4J8O A;  3OYC A;  1VQP Q;  8ATC B;  5GAO q;  1QVF S;  3MEU A;  4EMK B;  1HSQ A;  2C0I A;  3I55 T;  3I56 Q;  4EMK C;  1GBR A;  4LDU A;  4R56 A;  2M1H A;  1IGU A;  4PK4 A;  3CCE Q;  1ZLM A;  1TU0 B;  4AFU C;  2DAQ A;  1PRM C;  3RES A;  2SEM A;  4A53 A;  4A4K A;  4RMO A;  5GJV B;  3NFC A;  1QQJ A;  2CYZ B;  5LJ5 d;  3A1P A;  2JVV A;  2LQN A;  3R6N A;  1VQO Q;  4LDY A;  2P84 A;  4QVD A;  1X2Q A;  3M0R A;  3CCM A;  3OYN A;  2J7I A;  3M55 A;  1M4Z A;  3HPW A;  2DJZ A;  4DBR A;  5GAO m;  4RTV A;  3I9Q A;  2JJ9 A;  4J9G A;  3CCV T;  4RCC A;  2FO0 A;  2JUF A;  3N5B B;  4O6J A;  1WHK A;  2DE0 X;  2VVK A;  2QQA A;  5FU6 B;  3L1A A;  1WJS A;  5FU6 C;  1VQ8 T;  3OYG A;  1U8R A;  4RCB A;  5IAY A;  2XIC A;  1IZ6 A;  3CC7 A;  3WVE B;  2OAU A;  1UEC A;  2EIF A;  3VS5 A;  5A0G A;  1QLY A;  2GF7 A;  4M78 F;  5HK3 A;  2D0N A;  2EBP A;  2WSC E;  3OYA A;  2LCC A;  4NOY A;  4WTO B;  2F69 A;  3C4S A;  1ABO A;  3GP8 A;  1EZZ B;  3LW5 E;  3CME A;  2F5T X;  4AG1 C;  2MOX A;  4GBQ A;  2DL5 A;  4M7A F;  2ROT A;  2XI9 A;  1ZX6 A;  5I21 A;  4C92 A;  4M7A E;  3PT9 A;  1ZBJ A;  1G8X A;  4WCI A;  2QEX A;  1SG5 A;  3RER A;  3G7Z A;  5L23 A;  4JRK A;  1ACM B;  2H3J A;  2JS0 A;  1G3W A;  2FPE A;  2YT6 A;  1UGP B;  5IHK A;  4A63 B;  2X3W D;  1J3T A;  4OB1 B;  4C5E A;  3HHT B;  2BZX A;  3CCL Q;  4B9X A;  1Y96 A;  2K5I A;  4LUD A;  4FYX B;  5CQY A;  2DBM A;  3FIF A;  2F2V A;  2HEQ A;  2DL7 A;  3M0Q A;  2BUD A;  3GPL A;  2VKN A;  3OYI A;  1WGS A;  3CC2 T;  1E6H A;  2L3P A;  1VQ9 T;  3M0U A;  3EG0 A;  2E5Q A;  3OS1 A;  1VQM T;  4IKF A;  1M90 C;  1K73 C;  4IIM A;  5KYY B;  1NYG A;  3I56 A;  1F1B B;  1NZ9 A;  1SSF A;  1KC8 U;  1YBY A;  2E41 A;  1B07 A;  2RNA A;  3LH5 A;  5CKH A;  3CPF A;  2MWP A;  2SRC A;  1M1F A;  1K73 R;  2A28 A;  4J6X A;  2LZ6 B;  2O4X A;  3A98 A;  2NUZ A;  3G71 T;  1RAE B;  2WSE E;  4M75 B;  1GFC A;  1ABQ A;  2KAF A;  4M75 C;  2DBK A;  1PKS A;  3OBW A;  1D0Z A;  4HCZ A;  2IG0 A;  4XU3 A;  4FL6 A;  3E9G A;  1MV3 A;  1UGV A;  1EX4 A;  2QQS A;  3ASK A;  2CUB A;  2CS7 A;  1VQ5 A;  2AZV A;  4JJD A;  1M30 A;  1U1T A;  2OTL A;  3KBG A;  2EKH A;  2CH4 W;  2RA2 A;  4M75 F;  2HQE A;  4JS5 A;  1RI9 A;  4EMG A;  3QZ5 B;  1YJW Q;  4M77 B;  4M78 G;  2BZ8 A;  1FMK A;  2D6F A;  3L2V A;  3CCL A;  2PVD B;  5GMK i;  3JCM f;  3VUB A;  4EMK A;  1XNI A;  2GQV A;  1QVG S;  3E1S A;  2H8H A;  2DLP A;  2DEU A;  1HJD A;  2ZPG B;  2DL8 A;  2QGF B;  4AG2 C;  3MP8 A;  1UUE A;  2KRS A;  3A8H B;  3JSC A;  2RQV A;  4BAC A;  2QEX T;  4JRQ A;  2K5L A;  3CMA T;  1YI2 Q;  5FRO A;  2IIM A;  2W10 A;  2HL5 C;  1UGQ B;  5LJ3 g;  4RTX A;  3OYM A;  2O9V A;  2ED1 A;  4CC3 A;  1BIB A;  7AT1 B;  4E7L A;  2EJF A;  2OTL T;  2K57 A;  2V8K A;  3DB3 A;  2ROL A;  4PLI A;  4HCK A;  2EPD A;  3RR6 A;  4C8Q B;  1KQ2 A;  1OUL A;  2J6F A;  4ZGD B;  3QO3 A;  2JN0 A;  1Q86 C;  1VQ9 Q;  1X6O A;  3HTR A;  3MEA A;  3X28 B;  5AT1 B;  4C8Q E;  3OYB A;  2Y4X A;  5IT9 E;  1GL5 A;  1NG2 A;  5KCH A;  2RJE A;  1OQK A;  2X4J A;  1QVF P;  4MDX A;  1Y7X A;  3JB9 D;  2FG0 A;  4DBF A;  2A08 A;  1PSE A;  1H64 1;  1YN8 A;  1X69 A;  5CKF A;  1FX7 A;  3THK A;  1WPY A;  5CO7 A;  1I5L A;  4OGE A;  4D8K A;  1PG5 B;  2MF2 A;  4CC7 A;  4ME7 A;  2RD1 A;  3EG1 A;  2ZCF B;  2K3Y A;  1U06 A;  3MJX A;  2HQX A;  3CD6 Q;  2DRM A;  1M1G A;  5D7U A;  1M8V A;  2X4X A;  1WHJ A;  1RUW A;  2KEA A;  1UB4 A;  1WJQ A;  2JTE A;  2KNB B;  2V8I A;  9ATC B;  1VYT A;  4F04 B;  4XTY A;  2YXY A;  3KFV A;  1VQ5 T;  4ORZ A;  3VV0 A;  1SHG A;  4MZM A;  3CC2 A;  2KQW A;  4EDU A;  3P8B B;  3JCM b;  4C0D B;  1RAI B;  3V7S A;  4DBQ A;  1KQS S;  1VA7 A;  2XG8 D;  5KYU B;  1MV0 B;  2DXC A;  4M77 A;  2LNH B;  4C92 C;  1M3C A;  2X3X D;  3UA7 A;  1YJN Q;  3JCM c;  4BDY A;  1FMW A;  1VQ7 Q;  1I4K 1;  2KBT A;  1C0M A;  4L6V 5;  2DL4 A;  1QCF A;  4XTU A;  1YCY A;  1WXT A;  2C0O A;  2FRW A;  5IN1 A;  1VQP A;  1N27 A;  3URG A;  5J3B A;  5DLO A;  2FB7 A;  4BB7 A;  4C5G A;  1HXD A;  2FPF A;  3X24 B;  1K0S A;  3REB B;  1D1C A;  1YJN A;  4PFZ A;  2KE9 A;  3PGG A;  1CKB A;  2CP2 A;  2CP7 A;  2O4X B;  2LMJ A;  4RTT A;  1KC8 C;  1W4S A;  2YUP A;  4KH0 B;  4RTZ A;  1Q7Y R;  5EC7 A;  3CBM A;  5GAM e;  2PQW A;  1VUB A;  4ZGJ B;  4OB3 B;  2A36 A;  2CZ1 B;  3CCE A;  3KXT A;  5A0L A;  1YHQ A;  3JCM J;  4ELZ C;  1IB8 A;  3GNG A;  4P5N A;  2DEQ A;  3X25 B;  2OTJ A;  1TSF A;  2L5Q A;  2J05 A;  2LX9 A;  2DET A;  1R77 A;  4C92 E;  3A5Z B;  1UTI A;  1NJI C;  1W2B A;  2KRO A;  1WDX A;  2EQI A;  1VOM A;  4N0A C;  4E7I A;  5GAN j;  4M75 A;  4C92 F;  5GMK j;  5HY6 A;  1JJ2 S;  2D0Q B;  4BE1 A;  1YHQ T;  1M3B A;  2AZS A;  2EYW A;  1SSH A;  4JPB W;  2BKD N;  2DKG A;  2P4T A;  3BDU A;  5ECA A;  3QPH A;  5FWB A;  2VAS A;  3RUX A;  1NYF A;  2RQR A;  4C8Q A;  1Y71 A;  3LWI A;  2EYZ A;  3PIP A;  5GAN 7;  3PTA A;  1JRI A;  3CME Q;  3EH1 A;  3I55 A;  3JB9 F;  1ZUU A;  2ZPF B;  2Z0W A;  2J6K A;  2MMP A;  3L2Q A;  3CCS T;  4M77 G;  4M7D C;  1M3A A;  3C0C A;  3SFM A;  2VWF A;  2LQ8 A;  2Y4Y A;  1XJW B;  3EHQ A;  3CCJ T;  4DA4 A;  2LX7 A;  2JXB A;  3FJ5 A;  3PVL A;  3UDC A;  2MCN A;  2DZC A;  1ZSZ A;  1LNX A;  4J5Y A;  1M2V A;  2RPN A;  4AMC A;  2DIQ A;  5I2M A;  3OBY A;  1AZG B;  3GBQ A;  1IHW A;  4XU2 A;  1LVK A;  3E9F A;  4IUR A;  2E12 A;  2JS2 A;  5GAM f;  2PVO B;  4C0G A;  2O88 A;  4C8Q G;  3CCJ A;  3EAE A;  3T9N A;  1C1A A;  1N8R U;  1Z9Q A;  4JDS A;  2XID A;  2K3X A;  2XKO C;  2YWW A;  4M7A G;  3TCJ A;  3VS4 A;  3JCM X;  1KHI A;  2KR3 A;  2K9G A;  2YLC A;  5GMK e;  1R0B G;  3I5S A;  4AT1 B;  5KYX B;  4PFP A;  1Q82 U;  1QCO A;  3H0H A;  1S1N A;  2CSQ A;  3O8V A;  2LC4 A;  5D6W A;  3EGU A;  2HQH A;  2E10 A;  2KRM A;  1PC0 A;  3WXM B;  1JQQ A;  2W0Z A;  3HRS A;  3VS6 A;  2K6D A;  3VRZ A;  1PKT A;  2OTL Q;  2MYS A;  3EGX B;  2KYB A;  2DNU A;  2PVG B;  3CCM Q;  2M02 A;  1X75 C;  2P0K A;  2P4R A;  4M78 B;  1S72 T;  3JCM d;  5LJ3 f;  2EKO A;  1X27 A;  1VQ5 Q;  2RB6 A;  1BI3 A;  1MGQ A;  3M53 A;  4JJC A;  1YJW T;  2EQJ A;  4IIO A;  3DB4 A;  1VIE A;  2ZPB B;  4CC2 A;  3M57 A;  1YFN A;  1VQL A; 
#chains in the Genus database with same CATH homology
 2O31 A;  1IO6 A;  3SEM A;  1BU1 A;  2D1X A;  1YWO A;  1B07 A;  2RNA A;  3LH5 A;  1BK2 A;  2YUQ A;  2SRC A;  5IH2 A;  2A28 A;  4FSS A;  1PHT A;  1TG0 A;  2LZ6 B;  4E6R A;  3A98 A;  2NUZ A;  2DRK A;  2EGA A;  2JM9 A;  1NM7 A;  3M0T A;  1GFC A;  1ABQ A;  4Z8A A;  2KXD A;  2DYB A;  4J9D A;  1K4U S;  1AEY A;  2LCS A;  2GTO A;  2DBK A;  2XMF A;  1JU5 C;  1PKS A;  4M4Z A;  2FPD A;  2EGE A;  4F16 A;  4Y92 A;  4J9B A;  1NLP C;  1SRL A;  5FWC A;  2EYX A;  1MV3 A;  1UGV A;  2CUB A;  2LJ1 A;  1ZUK A;  3QWX X;  1GCQ A;  2AZV A;  4JJD A;  1M30 A;  4LNP A;  1AD5 A;  3I5R A;  2EKH A;  1QWF A;  1WFW A;  2B86 A;  4LN2 A;  1I0C A;  2CH4 W;  1SHF A;  1GFD A;  1RI9 A;  2OAW A;  4ZNX A;  4AFS C;  2CH4 A;  4RTW A;  1NEG A;  2BZ8 A;  1FMK A;  2L2P A;  2L3Q A;  1SRM A;  1N5Z A;  3PE0 A;  1AWW A;  2JT4 A;  1K76 A;  2AK5 A;  1B3Q A;  2LJ0 A;  2RF0 A;  2HCK A;  1M27 C;  2H8H A;  1QWE A;  1V1C A;  2DLP A;  1HJD A;  2K7A A;  2O2O A;  2DL8 A;  2RMO A;  4AG2 C;  1QKW A;  2M0Y A;  4JZ4 A;  1UUE A;  2KRS A;  1WI7 A;  1GCP A;  1VYV A;  2RQV A;  1WIE A;  2IIM A;  2KRN A;  2W10 A;  4RTX A;  2O9V A;  2CRE A;  2ED1 A;  3I35 A;  4CC3 A;  3NGP A;  2YUO A;  4J9H A;  2ROL A;  4CC4 B;  3UAT A;  5IXF A;  4HCK A;  2EPD A;  2FRY A;  2KYM A;  4J9E A;  1GCQ C;  4KRT A;  2J6F A;  5IHI A;  1UE9 A;  3RBB B;  2ED0 A;  2QDL A;  2GTJ A;  2ESW A;  1GL5 A;  1NG2 A;  2GQI A;  1JXM A;  1UDL A;  1T0H A;  2KT8 A;  4J9I A;  2GGR A;  4RTY A;  4QT7 A;  3QWY A;  1AOJ A;  2FG0 A;  2MIO A;  2A08 A;  2GNC A;  2JMC A;  3REA B;  1YN8 A;  4RTU A;  1X69 A;  2EYY A;  2YUN A;  1HD3 A;  4DEY A;  2BTT A;  3THK A;  2RQU A;  1PRL C;  3VS3 A;  3ULR B;  1K9A A;  1W6X A;  4D8K A;  4Z88 A;  4CC7 A;  1I1J A;  2DF6 A;  2C0T A;  2AKK A;  3EG1 A;  2V1Q A;  2F2W A;  1U06 A;  1WX6 A;  1VYU A;  2RQT A;  2DRM A;  3JV3 A;  4JJB A;  4GLM A;  1T0J A;  1NLO C;  2L3S A;  1OV3 A;  1RUW A;  1GBQ A;  1Z9Z A;  2KEA A;  4R0K A;  2M51 A;  2JTE A;  2KNB B;  2L0A A;  5GJW B;  1VYT A;  2BZY A;  4AFQ C;  1UJY A;  2PNI A;  3KFV A;  1SPK A;  2O9S A;  1KSW A;  1NEB A;  5IXB A;  4ORZ A;  1SHG A;  2K79 A;  2J6O A;  1X6G A;  1FYN A;  2OI3 A;  4JZ3 A;  2ABL A;  2DM1 A;  2CT4 A;  1VA7 A;  1BBZ A;  3H0I A;  1MV0 B;  1UG1 A;  1TUC A;  1YP5 A;  2LNH B;  1M3C A;  2X3X D;  3UA7 A;  1JO8 A;  1AWO A;  3TSW A;  1OPK A;  2FEI A;  2D8H A;  4LE9 A;  2KBT A;  2AKL A;  2DL4 A;  1LCK A;  2HDA A;  2RQW A;  1QCF A;  1M8M A;  1WXT A;  3EG2 A;  1H3H A;  2C0O A;  2LP5 A;  2FRW A;  5I22 A;  2JMA A;  4F14 A;  1UHC A;  2EW3 A;  3H41 A;  1MUZ A;  2ENM A;  5FW9 A;  4HXJ A;  2PTK A;  1EFN A;  2DMO A;  2LQW A;  1YNZ A;  3NPF A;  1PNJ A;  2YSQ A;  1OPL A;  2I0N A;  2FPF A;  1K0S A;  3REB B;  1KIK A;  2ECZ A;  1OEB A;  2EVR A;  2KE9 A;  1UHF A;  4J9C A;  3M0P A;  1CKB A;  1RLP C;  2RN8 A;  1X2K A;  2OJ2 A;  2JW4 A;  2YDL A;  2K3B A;  2A37 A;  2LMJ A;  4RTT A;  1XOV A;  1W70 A;  2YUP A;  2LJ3 A;  4EIK A;  2DX1 A;  4F17 A;  1ZUY A;  1WXU A;  4RTZ A;  5EC7 A;  1H92 A;  3UA6 A;  5I11 A;  1JXO A;  2KGT A;  3SHW A;  2A36 A;  1AVZ C;  4X1V A;  2JM8 A;  4OMM A;  1K1Z A;  1X6B A;  1G83 A;  2KT1 A;  2CSI A;  3CQT A;  4LUE A;  1JEG A;  1KFZ A;  1X43 A;  1YCS B;  3VS7 A;  3U23 A;  4HVW A;  1U3O A;  2F2X A;  2J05 A;  1A0N B;  3TVT A;  1HSQ A;  1UTI A;  2C0I A;  2KRO A;  3ZL7 C;  1WDX A;  2EQI A;  1GBR A;  1ZLM A;  4AFU C;  1SEM A;  1PRM C;  1ARK A;  2HBW A;  2SEM A;  2DJQ A;  1M3B A;  2AZS A;  2G6F X;  2EYW A;  1SSH A;  2DL3 A;  4JPB W;  5GJV B;  1RLQ C;  4OMQ A;  5ECA A;  1YWP A;  5FWB A;  3O5Z A;  1AWJ A;  1NYF A;  2LQN A;  2EGC A;  2RQR A;  3R6N A;  2EYZ A;  3PVQ A;  1X2Q A;  3M0R A;  1AZE A;  2D8J A;  1ZUU A;  2J7I A;  3M0S A;  2CT3 A;  4OMP A;  2J6K A;  4HVU A;  2DVJ A;  2J06 A;  2V1R A;  1M3A A;  3C0C A;  3I9Q A;  4RTV A;  4J9G A;  4OMO A;  2FO0 A;  2VWF A;  2DE0 X;  2VVK A;  3EHQ A;  4D8D A;  2LX7 A;  2JXB A;  3FJ5 A;  3PVL A;  2MCN A;  1BB9 A;  1UJ0 A;  3VS0 A;  1G2B A;  1K0X A;  1GRI A;  4OML A;  4Z89 A;  2RPN A;  1PWT A;  1UEC A;  2HSP A;  3NHN A;  1AZG B;  3GBQ A;  3VS5 A;  1QLY A;  4RUG A;  2JS2 A;  1TUD A;  2O88 A;  3VS2 A;  2D0N A;  2EBP A;  5IHN A;  2DA9 A;  1Z9Q A;  2E5K A;  3EG3 A;  1ABO A;  3H0F A;  1W1F A;  1WLP B;  4AG1 C;  2MOX A;  3IQL A;  4GBQ A;  3VS4 A;  4AFZ C;  2DL5 A;  2KR3 A;  2K9G A;  2ROT A;  1U5S A;  1ZX6 A;  2NWM A;  1ZBJ A;  1WYX A;  1AWX A;  3I5S A;  1E6G A;  4WCI A;  2GBQ A;  1KJW A;  3H0H A;  4K11 A;  1S1N A;  2CSQ A;  5L23 A;  3RNJ A;  1I07 A;  2JS0 A;  2FPE A;  3EGU A;  3VRY A;  1H8K A;  2YT6 A;  2K2M A;  5IHK A;  2KRM A;  4A63 B;  2X3W D;  2DIL A;  1JQQ A;  1Y57 A;  2W0Z A;  3VS6 A;  1J3T A;  1WXB A;  2K6D A;  4HVV A;  3VRZ A;  1WA7 A;  3EHR A;  2BZX A;  1T3L A;  2CDT A;  1T3S A;  1PKT A;  2PZ1 A;  4OMN A;  3VS1 A;  4LUD A;  1Y0M A;  2KYB A;  3TSZ A;  1CKA A;  2DNU A;  2DBM A;  1CSK A;  2F2V A;  2HEQ A;  2DL7 A;  1OOT A;  3M0Q A;  2CUD A;  2VKN A;  2P4R A;  1E6H A;  2L3P A;  3M0U A;  3EG0 A;  3NMZ C;  1X27 A;  2KXC A;  1E7O A;  4JJC A;  4DEX A;  5HCK A;  1QKX A;  3UF4 A;  1UFF A;  4J9F A;  4ESR A;  4IIM A;  4IIO A;  1NYG A;  4CC2 A;  1ZSG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...