1JUFA

Structure of minor histocompatibility antigen peptide, h13b, complexed to h2-db
Total Genus 70
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
70
sequence length
276
structure length
276
Chain Sequence
b'GPHSMRYFETAVSRPGLEEPRYISVGYVDNKEFVRFDSDAENPRYEPRAPWMEQEGPEYWERETQKAKGQEQWFRVSLRNLLGYYNQSAGGSHTLQQMSGCDLGSDWRLLRGYLQFAYEGRDYIALNEDLKTWTAADMAAQITRRKWEQSGAAEHYKAYLEGECVEWLHRYLKNGNATLLRTDSPKAHVTHHPRSKGEVTLRCWALGFYPADITLTWQLNGEELTQDMELVETRPAGDGTFQKWASVVVPLGKEQNYTCRVYHEGLPEPLTLRWER'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords H2-Db major histocompatibility antigen
publication title How H13 histocompatibility peptides differing by a single methyl group and lacking conventional MHC binding anchor motifs determine self-nonself discrimination.
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system
total genus 70
structure length 276
sequence length 276
ec nomenclature
pdb deposition date 2001-08-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00129 MHC_I Class I Histocompatibility antigen, domains alpha 1 and 2
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1jufA02
3.30.500.10 Alpha Beta 2-Layer Sandwich Murine Class I Major Histocompatibility Complex, H2-DB; Chain A, domain 1 MHC class I-like antigen recognition-like 1jufA01
3O6ML 4F9LC 4OLVH 1BX2A 4JJ5A 5JIKA 1SYVA 4DCQA 1ZVSA 2O5YH 4MDJA 5ACLA 2AXHA 2GFBA 2WSKA 2A6DB 5C0DB 5AUMA 2DWDB 5C6TL 1T0PB 2XACC 5ESQB 1QBML 1BBDH 9CGTA 5AWNH 3CVHL 4OFPA 5DQDH 4M6AA 1UVQA 1AR1D 3SHSA 3OJMB 4LNRB 1GAFL 2VDKL 3QIWA 3MRFB 4YPGA 1JVKA 3HB3C 3N1PC 4TSCL 1YECH 1MCNA 1IT9H 1JWSB 5CJ5A 2QKIA 1BJ8A 3DUUB 3NACH 3V6FA 3C5JB 1T7YA 4BQ9A 3VXOA 5D1ZA 1XF1A 5CILH 3I75B 4TUKH 2HLAB 4QY8A 4DGYL 1GGBL 2G2RA 4PJXB 4HG4J 1E6OL 2IMNA 3MLUH 1QEWB 2XWBB 1YYML 4YEFA 2BOCB 3MO1B 4N5EC 3QXDA 2CIKA 4WEUD 3L3DA 4R4BB 4Y5YA 3RGVB 1RZKL 2E7LE 2VXTL 1YEDA 4PLNC 43CAB 1K8IB 3UROR 4NQCA 4U7SA 2JJSC 5E8OB 4U6YA 1AD0B 3LS5L 1INQA 5FHBL 4OD3H 1J86A 3U0TA 5EZLA 5HHPA 3GHEH 3MBXH 4G42B 4GS7C 3UJJL 4JFFA 2AK1L 3C8HA 5E2UL 3HHRB 3BT2L 2GK2A 5DJAA 2OK0L 4X4MA 4L5FH 5FECA 4WUUE 3H9YA 1RMFL 5F6IB 1CR9L 2VISA 2ADGA 4XH2A 1NBQA 1JGUH 4BH8A 1HIML 5EORL 4JFEB 2P7TA 2X4PA 3X13B 1DUZB 1GJIA 3BZDA 1XF2A 3B2VL 43C9A 1I1YA 3IXAB 4MZ2A 4NSKB 4XNMB 1NAMH 4HFWB 4QRRD 2YPVL 4IMKC 4XXCA 3IVKA 1CE1L 3WFZA 2ADJB 5GRUL 3QQNA 4KHXH 4HPOH 4XP4L 3X11A 5ID1B 5KSAC 2HWZH 4F7PA 4Q9RH 2P43B 2GK0A 3MQIA 3QXAB 5DRWB 2BNQD 1J8HB 1WT5A 2A1WH 1VKXA 2WQ8A 4BK4A 2Q86A 3A67H 4YC2C 4PJGA 1RZJL 4PV9B 5IGXL 3NA4A 3RDTA 4RZCA 5JW4N 1RJZA 1Y18B 2ZUSA 3MRBA 3BRGC 4BZ1L 3MRKB 4G9FE 1RIUL 3SJVB 4JZNB 1NFDE 2RBLA 2OLDA 3BQUC 3HNTL 4Y5VA 5BVJB 2ILLA 1D3CA 1A6TB 3GMQB 1FZMB 3T4AA 3FN3A 2XQYK 4OLXH 5I8EA 1X5IA 1J1XH 3DVFA 3G08A 5D7IB 4RGOH 1ZT4A 1GXEA 3VFTB 3VWJC 3QQ9C 2DLEA 2AXJA 1MH5B 4FHBD 5I1AA 4GUPB 2X4OB 3O4LA 3CC5B 4D3CL 1VFMA 4M43H 1Y0LA 5FOJA 1IFHL 3MCKB 3ARTA 5KS9F 1A6WH 1MUJA 4X6DA 1FG2A 2HFTA 4RWHA 1DEEB 4HX1A 4F15C 2ERJB 2Z4QA 2GUOA 1FC2D 3MRCB 4FQ2H 4Y5XA 4KH2A 2XTJE 4DGIL 3HN3A 2V17H 3ZLQC 4H20H 2QTEA 5BRZA 1QSZA 2QR0A 4ZD3L 1UB5B 3FRUB 1VGEL 4CADA 4R8WL 3MFFA 5IVXF 3B9KB 4YHYC 5KW9H 4UZGA 4MA1C 4NQDA 1CLCA 1JMXA 3FAXA 4RMSA 4EDWH 3C5ZD 1VPOH 4O2FB 2MHAB 2NCMA 2Y07L 4NQEE 3PGCA 1TPXC 4G6FD 3HE7D 4WTWA 5D1QA 5LCVL 2DYPB 3QUXA 5IUSA 1BVLA 3U7AA 3HI6H 5HHMA 2DBJA 1LEGA 2R2CA 5F6HI 1GGUA 1R5VA 1QFWH 4WU5A 5IT2L 3DBXA 4MJ6B 3MYJA 4NHCH 1WBZA 4PGEA 2IC2A 4XPFH 4HWBH 3VFSB 5CP7B 2VZ3A 4X6CA 3IJYA 2LE9A 4MAYC 2IAMA 3HS0B 4E5XA 5AEAA 1UZ8B 4FQIH 4GW1A 3DX8A 3VG9C 3ARWA 3TZVC 1L6XA 4P4RB 3INUL 1UWGL 3ELAT 1RVFL 3S9DB 1DTUA 1YEHL 5CGTA 3RWGB 5I66A 5IG7A 1BD2A 5ABDE 4LAJH 4PLJD 5DFTA 5EO1B 3KLAA 4K3DH 1GZPA 3OAZH 4KK8D 2XI9A 4NWUL 2WY3A 2DKUA 4J3TA 1N4XH 1VACA 4P5KB 3V6OA 4CMMB 2ZCLL 1KENH 1QO3A 1PEWA 2OR7A 4CRPA 5KVEH 1KB5L 1ZSDB 3PWJB 3QUML 1TFHA 1T7WA 4Z77A 4MB5A 2BHUA 4ZFFB 3FAWA 2OL3B 3B9VA 4Q6YA 3CVIL 1I9JH 1LNUB 5E4EC 2AK4D 5HHVH 2JJVA 3B2UC 2IG2H 4RQQB 3TPUB 1LO2L 3RWFB 4Z7UF 2ZUUA 1FH5L 1N3NB 2G75B 1W8NA 5JZ7D 1NCCH 2R2BA 4LP4A 5CD3B 4L8CB 3T04D 3JUZA 5A40E 2VL5B 2FYYA 4JPIA 3VDCA 1OPGH 1NDMA 1W0WB 5CBAB 2IH1B 5K93A 1MCHA 3KYKL 4YAQA 5E2WH 2R4RL 1T0NA 2ARJA 4W68A 5F9OH 5TF1L 1AGBA 3SDAC 1SEBA 2HTKD 2FEDC 4KQ4L 3FN0L 2X1QA 3JV4B 5EULV 3E8UH 1KEGH 3QJHB 1FZJB 4OGXL 4HDIA 5LBSL 5TH2B 5HVHB 3ULSB 3ARDC 3F62A 1EO8H 1S9VB 2UZYB 1GYAA 1I9RH 2BCKA 5C09A 4CMHB 5ANMA 5GGVH 2VDOH 4NNYB 3WKML 4W4OA 1DBBH 3TBTA 1Z3GL 3JV0A 4HPYH 2Q76A 2DMKA 3WFCL 3PWPE 4F2MA 1HK6A 5EH1A 3DSNA 3TT1L 3BGFB 4ETQA 1J8HD 1IC5L 5F1NB 2V2WB 4DGVH 2WIMA 5IR1B 3E3QA 3EOAA 5T33H 3CVHA 4HS8L 2XQYG 3FQRB 2FX8L 3PHQA 1M71A 5KVDH 1HDMB 4ZUUB 1TVDA 3WEXA 4XZUA 1REIA 1QBLL 2FRGP 1F2XK 4M61B 5BV7L 4OF7A 4HC1L 5F44A 3VI4F 2R9HC 3QNYB 1SY6H 3LCYA 1AJ7L 2ED8A 4DUXA 1KXQE 2PN5A 1YPZB 5KSBF 5CJXA 1CDYA 1F90H 1OGTB 4MD4A 1UADC 1T21A 4POZC 2PYFB 5JO5B 1DQJA 3DUHA 2XFXB 3MR9A 2H32B 4LSVH 3ZKMD 2XY1A 2DQHL 5CEZH 4NRXA 4QT5B 1TZIB 1UH3A 5T5FH 3VFVB 1QRNE 1S5IL 3BN9D 3L3OB 1B9ZA 3R4DA 1P9MC 5C2BL 3UTTE 4PRIA 3MJ6A 4ZUWB 2EKJA 3NIGF 4DK3A 2J8UA 2ICWB 3G6JB 4FZEL 1DDHB 5L8LB 3D39D 4IM8A 1S9YA 2JB6B 2VR9A 4YO0A 4OFIA 3LEVL 5JHDB 5E08L 5IVXE 1MRDH 2P47B 4LDOB 4R90L 1PZ5A 5TDPB 1T7ZA 5DWUH 1NL0H 2ZOKA 2HP4A 3WFHB 4Y2DC 4OSUH 5EB9A 3P2TA 2LFGA 1IKFL 4B0MM 2R2EB 4RRPG 3OG6B 1RUQL 1EEYB 2DTMH 2AJ3A 4O58H 4L1DA 3QFJD 4JRXB 3NCYS 5JIIA 3AS2A 4PJDE 4JPKH 3ERYA 1IGFH 4Z7VA 3R0NA 3KPRE 3TBSB 4OD1H 3E6FB 3CCHA 4PGCA 5DVKA 4P2QE 1M7IA 1D5BB 3A6BL 2COQA 3DO3A 5EZIL 3UPRB 3SDCC 4HT1H 4WUKL 5E2VH 3UMTA 3WN5B 3MV9E 4PIRF 3QXVA 4ZTPH 1RIHL 7FABH 4NZRH 2R39A 3JBG7 1AXTL 4YNYB 4PJHA 5I30H 2FHBA 4HGWA 4N9OB 1F8TH 5LGHL 4XCNB 5CUSH 1DLHB 1FCCA 1DQLL 1PKQA 4N8VA 4JFDD 3PL6B 1TZHA 3ZL4H 5KVGH 3BMWA 3U7YH 2V5YA 2YD3A 4JGJA 1JTTA 4NHUB 4P46C 5GGRA 4WTZG 1HWGB 3JTSB 1MCSA 2DD8L 1T5WB 3S35X 5IESL 5F70A 2A73A 1QFWI 1XF5B 1QVOB 2GJ6E 3HI5H 2HRPH 1MAMH 4OTXL 3RZCC 4G43A 1HINL 3VXQA 3HC4L 1AY1H 1NAKH 5DLMH 5DJDB 1MELA 5FA4B 1RU9H 4LGSB 2UZIH 3F8UB 4Z7WA 5FUOL 1S78D 3S8WA 1FVCA 2RFXB 4ACPA 1RUPL 1LMKA 4Z7UE 5L2KD 4KKAD 1B4JH 4R26H 3LQAH 4J3XA 2OMBA 3ZTNL 1YQ2A 1FNLA 3BPNC 4P2OD 1EEZA 3CK0H 5SWZB 2DIBA 3B3IB 3ARQA 3BEWA 4FXGA 3HMXL 2VE6B 4XWOD 1MRCL 1I8IA 3VFRB 3KPQB 4WHTB 3RZWA 4OZ4A 3V0WL 4YHIA 3KYAA 3QRGL 1KPRA 4R4NC 5CGMA 4RISL 2D7OA 3BEVA 2AGJL 4KUZL 2OCFD 3O9WA 2V7NB 4OLZH 3U1SH 5GRWA 4FABL 3AMLA 1CGSL 3QWOA 3REVA 5DO2D 5D9SA 1AGFA 4ZMAT 3I50L 5A2IH 4BQ6A 3BYTA 2CDEB 2ITDA 1KJ2H 1PGRB 5DD0L 1PSKH 4XPAH 3UEZA 5E6ZA 1KB9K 5C0BB 2X5PA 1I3RA 4IRZH 2PO6A 4G3YL 2EYRA 2Z35A 1KF9B 2EDHA 5DFVC 1AI1L 4EI6A 1MHEB 3BP4A 4R7NB 4AM0B 1ULVA 1CF8L 5I2IA 1FIGH 3C60A 2H3NB 5EOQH 4U1GC 5CWSA 3PDOB 4FXLA 4M5ZH 3ZKMC 1C08B 3R8QA 1BQHG 1NGQL 3FQNB 3VI4E 3VXUA 5DRZB 1HHGA 1NC2A 1Q72H 4LU5L 4I2XB 3EOTL 1ORQB 1LE5A 3HRZB 5KSBE 1BVKA 3F6LA 1F58L 4HIXL 1Q9WB 3U9PH 1T04B 3VH8B 3Q5YA 1ZS8A 5HGHA 5J6HA 3W82A 2GAZA 3Q6GH 5K9JH 1INDL 4QXTA 4W4NA 1QOKA 1VFAB 3KPOA 3QUYA 1N6QL 5F7WC 1UEYA 2LVEA 3VJ6B 3KAAA 4JZJA 3DMMC 4P9HL 3MACL 4UDTA 4K3EH 5D6DC 4UT7L 1QFUH 1JI1A 3MV11 3FOLA 2P5ED 3NIGE 3MLTB 1WICA 4GRWH 4XNXL 1XCQB 5B39B 5D2LB 3TYFB 1I8KA 1A1NB 3IU3B 2A6KB 2FGWL 3O41B 3O6LL 4XWGL 3OF6A 4JRYA 4YDJB 3RBGA 4RGMC 3DX6B 4WGWB 3ZHKA 1LP9B 3GJEA 3VCLA 4YIQB 5D71H 1FNFA 3TF7C 5IFAH 3GDBA 5E8NB 5JHDD 4XNQA 4ONFL 5C8JB 4JGMA 1WIUA 1IM9A 4E9LA 4PJFA 1FL3A 4Z7QF 3WIIL 5MHSE 4RA3A 4B7IA 3H9SA 1HI6A 4XP6L 3OAYK 1C12A 5IMKA 1JHTA 2EC9U 1U8OA 5F93C 1YEKH 1HXMB 5F9WB 2EE9A 4JRXD 5D93C 1T1ZB 1U92B 3OKDA 1GGIH 2EEAA 4LARL 4F8TA 3CU1A 1NCNA 4GKZB 4HUNB 4RFEB 4J12A 3L3IB 1AKJD 2ZUWA 3TLRA 3TYGH 3BUYB 3OQ3B 3P0YL 4HBCL 2VDRH 4PJ9A 4XB7A 1MQKH 3BRFA 3JTTA 4KPHL 1RUKL 1FDLL 2F54E 4H8WL 3MGTA 2R0WH 1MI5B 2LU7A 1PG7L 3OKYA 1ZA3A 2E3VA 2R0ZH 5DYOA 3JWOH 2FJHB 1BVZA 4GG8A 5DD6B 1R3KA 1X5JA 4RGNC 3WLWC 1MWAA 1YQVH 3NCFB 4BFIB 4L29B 4WHDA 5MERB 1T7VA 3T2NH 3GSUA 4EI5A 4PY8J 1IBGL 4Q0XL 1QLRB 4HUXB 1C16A 5FGCE 2WW8A 2C4FU 4PRDB 3MPCA 5JPMB 2GCYB 5GRVK 4MDIA 1S78C 1OTUD 4APQA 1A9EA 1XH3A 3KPPB 2IPUK 1RJLB 4YFDB 1N2RA 4ZFZB 4I3RL 3EYOB 2OMNA 1H3XA 3DTXA 3SDXA 3TBWB 2QQKH 4PYGA 4WJ5B 1UEMA 5TDOA 4DUWA 4N0CA 2DJUA 3TIEA 2XXCB 4GAJH 1RUMH 4I0PC 2VDPL 1T0MA 1DE4A 1A3QA 2DQIL 1DANT 2QJDA 2X4SA 5CEXA 4YHNB 4MCYB 5DGRA 4TTGA 2VL4A 2NXYC 5KSAB 1OP9A 2FB4H 1FAIH 2ZUQC 1T3FB 1PVHA 4O2CB 2D31A 1EUUA 1RK1A 2DM4A 5JW3L 2CSPA 4ZNCD 3W5NA 2ZOLA 3GNMH 3T0EB 4ENED 3GMNA 3T77A 2P8MA 2VSCA 35C8H 3MMEA 3VXNA 2VLRB 1V7ML 4HV8A 5JLZA 2R69L 1I9IH 4Z78A 3WJJA 5E4IA 1P69B 4EBQH 5BOPA 1Q9OB 1JE6A 3GSNH 5KSUB 5E1AA 2E7LA 5GSVB 2R1XB 1R3JB 1EAPB 1OT2A 3BKJL 3OGCB 4TSAH 1NC4A 3CUPB 1GL4B 3IAPA 1RD6A 4ODSL 3K1KC 3IS0X 3P4OA 2A6IA 1NLDH 5DFWH 5C0BD 1DL7H 2HFGL 3BWAB 5DEFA 1G7LB 4J1UB 4HKZB 4PP1C 1WEJL 4WUUA 1GOFA 4FQLH 4ZO8A 1ZLSH 3TBYB 5A2JH 3G5XA 4I5BA 4YHZH 3J8F7 5CKAA 4PJ5E 5IVZA 1BF2A 1HZHH 4OFKA 1FN4A 3T1FB 2XWJA 4UTAH 1EERB 1N8ZA 4J3OC 3VWKB 2QSTA 4ZUTB 4GG6F 4ZS7H 3QDAA 3D3VB 1TCRB 1A4JB 1CTNA 25C8H 4CVWA 4RWYL 4LLDA 4QXUH 1QFWM 4IMLB 3L7FB 1VADA 4QRRE 1H8NA 3CXDL 2N1KA 3VGEA 1ZEAH 3V4VH 4J8RB 4HIJA 2UVFA 3MOBH 1BZ7B 1BBJA 5DVOA 4KXZI 2BNQE 4DZBB 4FG6D 4U4BA 1ND0B 4QHKI 5I1KL 5IMMA 4PJIF 4L4VA 2G5BA 3MRPA 4WFFD 1RULL 4Y1AB 3BDYH 2BVQA 2R56H 2OJZH 3S5LB 4Y19A 3GUTA 1NMAH 4XVTH 3KYNA 1KTDA 5IWLC 2ZSVA 1HQ4B 4ZFGL 2BVYA 1XF3A 4I48A 1DBJL 4TPRH 4Y16C 4FNLL 3OZ9H 4Q9QH 1KIQA 4LPWA 1OAYL 5CIPB 3CZJA 4XMLH 4QKXB 4QRPB 4MAYB 1WWWX 1FVDA 4I8DA 4QXWA 2H9GB 5CGYC 4Z7QE 1F4AA 3O6FC 3STBA 3OB8A 1KIRB 3HMXA 3BH9B 5T3XL 2Z91A 1WUNT 4ZSOA 3IFPB 3GMMB 3UTQA 3WLBB 1KCSL 2DOCA 4PV8A 3TJEL 3TZVB 3UTZA 4OZIB 2IPKB 3AXLB 2YPLB 4R9HA 1AC0A 2WBJC 1TTUA 4KK5D 2HJFA 3WD5L 4LLWA 4GAYB 3TPKA 5AG8A 4WEBL 1KCUH 3TEUA 1EGJH 2CO6B 3L7EA 3WDHA 1NKOA 5HBBA 4LIQE 5D5MF 1MFAL 1KULA 1BM3L 5HVWA 3BD3A 2WINB 4U05A 2NQCA 5I75C 1YN7B 4HUUA 2NNAA 3RY4A 4GSDH 3DROB 4QRTB 3QQ4B 4GLRH 4UAOC 3BO8B 5GZND 4OUUB 4O9HL 1L7TH 4X99A 3C2AH 2XZQL 3HTLX 4N0RA 3RU8H 1IEBB 3O2WL 4NC1C 4DN4L 1ZHKA 3P30L 1JZ2A 3QBTB 1I8MB 3WHXA 3DX9B 1HCFX 4XRCB 2IPUG 2PYEA 5EZJB 4ZUSA 5C70A 3ARFA 4NQEA 3WE6A 4UV7H 4IOSD 3S96A 5AYUH 4KWUA 3NZ8A 1FO0B 3LQAC 5D1XA 5FYLL 3DO7B 4MYWB 5FDWA 1K6QH 4Y4FC 1BHGA 4M6OH 4MLIA 5KN5A 2OJEB 4XCFH 3RX5A 4NP4L 4OLYH 1IGML 1U8NB 3LEXA 2X4RA 1GIGH 1KLGA 3SDAB 4MWFA 5ICXB 3AB0C 4MXQC 4ODBD 4P57B 4OZGB 4ZPTA 3P0GB 4I18B 1JPFB 5L6YL 3PP4L 4IRSD 2VB5A 5J3HD 3PGDB 5LQBH 1HHKA 4BYHA 3FONB 2MCG1 2CUHA 5EO0A 2Y5TA 1CLOL 3RL2A 1W8OA 3FO2B 1CFSB 3OAYH 5E6IA 5FYKD 4CN4A 4B53A 1XF4A 4ZO6A 2HLFD 3H9HA 4XT1C 4U0RC 5GGUA 3QQ3B 2AV1A 1QSEB 3ULUH 3T0ED 3W9EA 5JXED 1LO5A 4YH6A 2VLRD 4UV4H 1AGDA 3RNQB 4NDMA 5GS2H 2GSGB 4RFOH 5TGBB 3LB6C 2VSDA 4JRWA 1J7VR 4LCUA 4LPVA 5DVLA 3KJ4C 1LK2A 1D5ZB 3TVMC 4NRZA 2AK4E 3IJHB 2P5WA 3P11H 2BC4A 4NT6B 2YC1A 1OM3L 2AEIT 3V6ZB 4ZQKB 3U4EA 1J0YA 2NY4D 1OAKH 1KJ3L 4TNVK 1H8OA 3O2VH 1JPSL 4P9MH 1X5AA 1ZHNA 4GG6E 1OARL 2D7TL 4G8GA 3C6LC 4PD4K 3M1BA 5F96L 3ARBB 3IB4A 5B8CA 3GSOA 3ZE1F 3EO1B 3CLFL 3C2SA 4BELD 1JRHI 5IEHB 1GSMA 1XR9A 1U3YA 2EXWD 3MXVH 3BZEB 3GSQA 3RL1B 2QQQA 5IVOA 5T1LA 4AEEA 1EVTC 2IBZX 1VEPA 4YX2L 1A47A 4Y2DB 1X7QA 4LHUA 2ICEB 4U49A 3WIFA 1N26A 2BERA 4PJIE 1OW0C 4EUPG 1MLBA 1FSKB 3KGRA 1JF1B 1NGYA 3GSXA 1CE6A 3U9UA 1SBBA 4G8EB 4F7EB 4LAQH 4LLYB 1H3PL 1T6VN 3FB7A 4WW1A 5KSVB 5AZEH 4N8CH 3FB6B 2B5IB 5E24E 1NANH 1YMMB 3QCUL 3SDCB 3UBXA 2WV3A 2EDBA 5I9QB 3HZKB 3VU2A 5ICYA 5FF6A 4GXUN 1WZKA 4YK4C 2V5SA 5A16A 1M6OA 4TQEL 2F5AH 5DMGC 2Q7YB 1INEH 1NCWL 3MRNB 1AC6A 3FO1B 5GZOD 4QRPD 4PBXA 3EO0B 3NAAH 5BW7A 5DA0B 5EUOA 3QDMB 1Z0NA 1F3JA 3GZKA 3JWOC 4NO5A 4X6EB 2ZG1A 4HS3A 1AGEA 5GZNC 1B0WA 5BZWB 5I1IH 3SGKA 3V9FA 2VLJB 1KBGH 2XRAH 3VFGH 3UDWC 4ODXA 4AG4L 2YPLD 3TFKA 4S1SL 4V1DD 4DUVA 1FGNH 4IRJB 3S4SB 3EDFA 5D5ME 1HILA 1X4YA 4J4PC 1GGCL 2AJVH 2HG5A 1T1WA 2XA8H 2GITB 1QRNA 4F7MB 4O4YH 4P46B 3BKCH 5HGAB 3UTTA 1Z9MA 3OR7A 3PJSA 5INCB 5GS1C 1K5NA 3A6CH 2JF1A 1Y6NR 2B1HL 3W0WB 4AENA 2BNRA 2BVPA 3D39E 2GW5A 5HY9A 3EYFB 2Y06H 3ROLA 4JG0L 3SE9L 4PRHB 2E7CA 5IVXA 1CDBA 4BSWB 3PWNB 2EZ0D 3G6JF 4FFWD 5IMLB 4LCWB 1KEMH 3TO2B 5JPNB 4PG2C 1PD6A 3CIQA 5J06A 3GMOB 5GHWH 2AABL 3RRQA 2KPNA 1NAMB 1RHHB 3ZE2F 4RIRA 2E6QA 3K81A 4G8FB 4P3DA 3VG0L 5D7JA 3QFJE 3HC0B 3N9GL 1JNLL 4PJDA 1KLUA 3BPNB 4ELMA 5J3HC 4GRLB 3KPRA 1E0OB 1HEZB 4ZAKB 3QULA 3Q3GB 4JB9L 1IM3B 2DLFH 1UM6L 2EH8H 3FB5B 3B5TA 1EH9A 3CDFA 4BSVB 2HVJA 3ILPA 1S7VA 2F53B 2ZPKL 3MLRH 3SKJH 3BE1L 2YSSA 5IHZA 1HSBA 1P7QA 2YD4A 3GBMH 4YBLC 5FUZH 5TF0A 5HHQA 2DICA 1D5IH 4PRBB 1IAOA 4MD0A 4L3ED 4N8PA 1PBYA 4XBPA 4X4XB 1IMHC 3TO4A 1UXWA 3E2HB 4WRLA 4K3GA 4JFDE 2NY1D 1V3KA 5AZ2L 4G8IB 4U6TA 5CMAB 1AO7D 4D0BB 3ULUD 4JY5L 3RX8A 4GKSB 3ZHDA 4KRNA 2R4SL 4U1IA 2X7LA 3N0PB 4POUB 3H0TA 1A6UL 2NX5B 4HS6A 1XIWA 4PJ8A 3NTCL 4PUBL 1DN2A 5JNYB 3BH8A 2GJ6A 1HOCB 1QSED 1UKTA 3LH2H 1KJVB 3N1QC 3NABL 2IGFL 1NFIA 1MFBH 5ADOL 2NY4C 1UM5H 1T4KA 1U8KB 1O7SA 1G7QB 1WF5A 1D6EA 2Y4SA 5LXGH 3O3UN 5D2NE 4N9GA 2C1PB 1J88A 2WLZA 4Z7UA 5L2KE 5EC1B 2BXZA 2J7LA 1Q94B 2X1PA 2JIXA 2X4TB 3LKPB 3DVNA 4NO0B 4JREC 3PHOA 3D6GA 2BMKB 3CFEA 5FGBC 3GMRB 3VFWB 5F8QC 1OAQL 1WBXB 5I73B 1NQBA 4QRSB 1KCLA 2YKLL 1S7XA 2HN7A 5F89B 3UYOD 3SKOA 1DBML 1JGLL 2DQCL 4LBEB 3WUWG 5LAXB 3TCLB 1C5BH 4FQCH 3ZE1E 2ID5A 4NQSB 4WNQA 4GKNA 3AU1A 3FT3A 1CXIA 2PXYC 4QO1A 4YHKH 2XQBL 3SKUD 1HQRB 2B1AL 5AAMA 1TJGL 2MKLC 3HG1B 3BIAX 1CFTA 3F5WA 4PFEA 3BW9A 4HAFA 3PNWB 2V2XB 4PB0H 4L9LC 2CDGA 3QG6B 4ZDHB 4AH2A 3VDBA 5H2BA 3T65B 1MCKA 3MRLB 3OKNB 4M1GL 3ARGC 3RIFK 4ZOEA 5D93B 4UOW0 4R0LA 5I74B 5J12B 1FGVH 1L7IH 3FFCB 1UA6H 3TV3L 1K2DB 4FQHB 5C3TA 2XNAB 1HE7A 1GZQA 3F7VB 3Q1SL 3V5HB 1LD9A 3D48R 1LEKB 3HUJB 2JCCA 4J2XA 5TE4L 5C0ND 2P4AB 4D9LH 4H5SA 1VFUA 3LRSB 2NY3B 3ZYIA 2IALA 1IJ9A 1MCCA 4TYUA 4YHML 1AQDA 3LN5B 3QDMD 2APVA 2QQLL 2VZTA 3IRPX 3CFDA 3SPVB 2W0FA 1CZ8H 4IS6B 1P4IL 2VLJD 1S9WB 4FFWC 5H35B 4GRWF 3NN8B 3LKSA 5MEOA 2VLKB 4EN3B 1PKOA 1VFBB 2P5EE 5FO9B 1FG9C 4F80A 3TJHA 4HZLA 4X9HA 1KYOK 2NY5L 4X9FA 3IT8D 5L9DH 5A43C 3PE9A 2OTWA 1U91B 1A4KA 3THML 3F7YB 1Q9LB 1U8MB 3PHSA 3EO9L 4UTBH 4QHNA 3IDJB 2BJMH 4L4TA 3G6JE 4IIQB 2OP4L 3WUWB 1IEAB 2DL9A 1C8PA 1ZK9A 4PBVC 1KJMB 5HYEA 3WFEH 4XVJH 5JHDE 3SY0B 4WY7L 4ZXBA 4JO2L 2BY2A 4LVHC 5A3IC 4CNIB 3P3YA 5CJOH 4M7JL 3ZE2E 4I0PB 1JZ5A 2H1PL 4M5YL 1V7NL 4NPYB 1DBAH 3LMJL 3ZZ1A 1ES0B 1N5AA 2H2PC 5I1DA 5DD1H 2EDEA 2GYSA 2BSSB 3LRGA 3O6MH 2B4CL 4PJ7F 2ZUQB 1QBAA 1V8HA 1ZWIB 2KQMA 4RMUA 4TOYH 1Z9LA 5E2TL 3VRJB 4JO3L 4M7ZC 4XB8A 4EVNB 1D9KA 3U83A 3O45B 2JKXA 4MSWB 2ZCKL 5C6TH 2NY1C 1ZANH 3H7BB 4LPXA 1F4WH 4YBHA 2CLZB 1JV5A 2EIZA 3CVHH 4M9PA 3ULUC 1G1CA 3FCTB 5FCUL 4KRPD 4N8VG 2EDDA 3OKEB 3QFDA 1NLBL 1XGPB 2VDKH 2J6EA 1MLCB 2F53D 1MF2H 2A83B 1EZVY 4H1LB 3FZUD 1JZ6A 1YEFH 4IHOA 1MFEH 2APTA 2EXYD 4OCWL 5H37G 4CVXA 2MNUA 1H3WM 4XGZB 3MRDB 3U36B 1MFNA 2EE3A 3DVGB 3WIHA 3TH3T 1PQZA 1DSFH 5HGDA 1NSNL 1Z2KA 3RTQA 1RZGB 1IAIH 1CL7H 4AYFA 2VOTA 4YXKL 1ACZA 3X14B 4FQ1H 4NHUE 1CFQB 6FABL 3P4MB 2GJZB 4NC1E 2R1WB 3KPSA 3QIUC 4ERSL 5EOCJ 1XGYH 1LDPH 3CLEH 3N1GC 3TP4A 4WFHD 1QLEH 4NO3A 3QO0A 3LS5H 4NQXA 3HI1A 1BFVH 1KC5L 4W70A 4N0UB 2ZP0T 3BVNA 4JO1L 4M93B 3UJJH 3UC0L 1LEIA 5E8PA 4UT6L 1CGTA 1S7WB 2AI0L 1GGTA 15C8L 1WC7A 3BT2H 4ODTH 5D1QD 3KPNB 1DBKL 2MMXA 4JM4L 1UJ3A 4M1DL 4KROC 4KV5F 3IETB 5HJ3A 5HXMA 5CFHA 4OGAD 4U2ZA 1D7FA 4U1SB 3QIWC 2XPGB 2R1YA 2L4OA 4JO4H 2Z31B 3ULVL 1BFTA 1WIOA 1UQSA 1G7MB 5DTFB 2EEBA 2X2YA 3PV6A 1G7JA 2YD5A 4XPHL 4W6WB 2X6MA 1R24A 5IB5A 1CLYL 5D1ZC 3NPSC 2HH0L 2R29L 2IAMD 5SWSB 2GIYA 2QQNH 4RBPK 1KPUA 4WHYG 1MCBA 5J11B 1CE1H 5GRUH 1ZA6A 3ROOA 4P2RB 3UJIH 2CO7B 3V5KA 3OXRA 3I2CH 4I77L 2V2TA 4OZHB 3PWUB 2LVCA 1A1MB 2AKRB 4Y5YC 4PRPA 5C07D 1E6JH 5DS8B 4EOWL 4M6ML 4CVUA 2OXHA 3HG1D 1RZJH 3NFSL 1U3ZA 5IGXH 3HAEA 1FL5A 1YMHA 2WBJB 4Z95L 4P23A 5F21B 5GGSB 5C0NC 4M1CD 4XPTL 4BZ1H 1TVBA 1BQLL 3E6HA 5DJCA 1FYTB 3MNVA 4GOSA 3GSVB 1K4DB 1OOAA 2P46B 2JB5H 4S11A 3HNTH 4JANB 4FQJL 4OM0H 3KLSA 3K4ZA 1IL1B 4AT6A 5DRXB 1M7DB 3FFCD 4OF3A 1U6AH 2CLRB 5F1IA 4UAOB 1H5BB 2IH3B 3DRTB 1EFXA 2RGSA 4Y8DC 1NMCC 3ESUF 3S37H 3ES6A 4WCYH 5FO8A 2AJZB 4M48H 3OMZA 2VQ1B 1Z6JT 3QZWB 4XXDA 1BWMA 4QRRA 1AD9B 4JLRA 4CW1A 4UU9A 5DK2A 1IFHH 1P4LB 4G6AD 1XGUA 4PY7B 2NY3D 4LSRH 4GFTB 1OAZL 4GRWE 1OGAB 5B4MD 4XXCC 1MY5A 3LIZH 3STLA 3IDXH 4XI5D 4F57L 5BXFB 7CGTA 3GRWL 4G6ML 4PGBB 3D9AH 1KTRL 2D7QA 4WFFE 4G6JH 2E9WA 1WT5C 4TULH 4EN3D 4PLKD 4Y4FB 1E4XL 2IBGA 3BP7B 4ZD3H 5DQJA 4YDLC 3VD4A 2I07B 3K2MC 2CH8A 2FGZA 5EC2A 3RDTC 3JUYA 3PGFH 2MQCA 2YD8A 4WWKA 4X8JA 5C09D 3EDJA 2D3VA 4PR5A 5GISH 1K85A 1I1RA 4FOMA 3AY4A 4Y5VC 4PJBF 1YEEH 4Y4HA 3FFDA 4OLUL 2R15A 4KRPC 5CAYB 5D7LA 4PJ7E 4NC0B 5DT1H 5EU6A 5DJXA 5K59F 3KR3H 3L5XH 4LSTL 1MVUB 5D8JL 1JHLL 2VKWA 4C83B 4OCMC 1FL6B 4OZIF 3AS3A 2EXYC 1C5DA 5DK0A 4PRNB 4F37K 3KLHD 1KT2B 5TFSH 4BQBA 1P84K 4AEIL 3KS0J 1I7RA 1A6AB 1BLNA 4XNYH 3WFBH 3G9AB 2J8OA 2UWEF 1I7UB 1PEZA 2XN9B 2R8SL 4HHAB 4FA8A 3KS0H 1LGVA 3MV7D 5EZOL 1AXIB 4Y7MA 3INUH 3D0VB 3X3FH 2I25N 2YUVA 5L7XH 4I0CC 4OCRL 4Y5XC 4WEMB 1QHPA 3OAUH 3DURB 5DURD 2VXVL 1FNGA 3KJ4B 2W59A 5EN2B 3C5ZA 3QUMB 3TVMB 4L8BB 4FFZH 4G80A 4I9WD 3P0VL 3FO0H 4O02H 3HE7A 3GJFA 3MGOB 4YDIH 2J8HA 2OM5A 1KYOJ 1CQYA 5E00B 1T83A 4ESKA 2FO4A 1PG7W 5MP6L 2X4UB 3QUXC 3NH7L 5IBTL 4KY1H 5KVMC 4Q6IB 2APXA 2MTPA 2J88L 4F7TB 3GBNL 4KK6D 2QADD 1ETZB 2DWDA 5GS0L 3BIBX 3RAJL 2OR9L 5DVNA 3BPOC 1MCPL 2ATPB 3OG4B 3NFPB 3TN0B 1QRKA 3FTGA 4KV5E 5IB3A 1W72B 4XC1H 1K9TA 2X4NA 5HYSB 4LNRA 5C0IB 4UNUA 1PDKA 5IIEB 4DAGL 3MRFA 4IEFB 4OGYL 3G04A 3KYKH 1JWSA 2R4RH 3MLWL 4XHJD 3DGGB 5FYKE 5TF1H 5JORA 4YHPB 4KI5D 3DUUA 4KQ4H 3QHFL 2DQDL 3IFNH 3ULUF 3D0LB 4N0FB 1IQWL 1IC7H 3C5JA 2Z31D 3E1F1 5I71B 4CDHA 4KJWD 4KZDL 3I75A 2HLAA 5JMOC 4PJXA 2M2DA 2OR8A 4P5TB 2Y23A 1UWXK 1JGVH 5C0FB 4HXAH 4K8RL 3MREA 1QEWA 5FOBB 2XWBA 3V6OC 1QYGL 3MO1A 4YK4B 4TVPL 5EPMB 3NFNB 1DEDA 4P2RD 5IBUG 1MIML 3RGVA 3GIZH 43CAA 5F7HA 1NGXB 1AD0A 4G5ZH 1MWAH 3QIBD 1WZ1H 3EDDA 2FHFA 3C08H 3MC0A 5J8OA 5FUCE 1QBLH 2EDLA 2YUXA 2NZIA 2X40A 3KLDA 5BCAA 2GJJA 4OZFG 4LEXL 4X7EC 5GGTA 5EA0H 1S7TB 1AJ7H 4LP5A 4A2MA 4ZG1A 4IOIB 2YA0A 3GK8L 2CQVA 2NR6D 3GI8L 3MV01 1SQ2N 4P4KD 1UACL 4JFEA 5HYJE 3LEYL 2ESVB 1LO0H 3I3EA 4JG1H 3X13A 1DUZA 1P7KA 2YD1A 1NGPH 4O51B 3QXUA 4ZOAA 1D5MA 3IXAA 4NSKA 4HFWA 4X7DC 3QCTH 3TH4T 2ZKHH 2Z0BA 4HCRL 3M17B 2RHEA 3BD4A 3LKRB 5ID1A 3DV4B 2ADJA 4PJIA 5EBMB 4W4OC 3QXAA 5DRWA 3QDGB 1J8HA 4FZEH 3QH3B 3VFUB 4KKBC 2O26U 4JDVB 3MRHB 4OBSA 2P8LB 3EBAA 3OR6B 3EFDH 5AG9A 4PV9A 2WP3T 1JFQL 3U4AA 2R0KH 3E3QC 3CSGA 1Y18A 3H42L 3MRKA 5F9AC 4RBPH 3F58H 1RK0B 3SQOL 3SJVA 4JZNA 4PJBE 3L6FB 5BVJA 4QRPE 1DQDH 4YBLB 4OD2A 3GSNB 3GMQA 1A6TA 3P73A 5IBUB 1CBVL 1FZMA 4PB9L 5K59E 4TSBL 1I3GL 5IM7B 4P59L 4HMDA 4YXHL 3SKMB 5D7IA 4OZIE 3OX8B 2YPLE 5CJXC 3VFTA 4V1DE 4OCYL 5GIRB 3VXPB 4F33B 1MEXL 5EZIH 5F88B 4GUPA 1KN4L 2X4OA 5BVPH 3CC5A 1UKSA 3BRDA 2UWEE 4JR9H 5IK3B 5F3HB 2UY6A 2W0LA 3UTSD 4QRUB 5ALCL 1AXTH 3QR2A 3P77B 1NC2D 1CDHA 5LGHH 3MLZH 3D39A 3QEGH 5ESAB 4EKXA 3T0AA 1BFOB 4MNQB 3GHBL 1H0DB 4HJJH 3P9WB 3ARSA 4HJ0D 4RX4D 4K3JH 3L3JB 3NIFF 1UB5A 3FRUA 3ZO0A 5IW3A 1EHXA 5ADPL 1FNEB 1GOGA 3B9KA 4KJPD 5IESH 4HKXB 2QADC 1UC6A 4O2FA 2MHAA 1NCTA 4OIIL 4E41B 1XCTA 3CNKA 4JREB 2DAVA 1KIPA 3OF6D 5CZXD 4JRYD 3O2DL 1UH4A 1FNHA 4UIMA 3K8KA 4MJ6A 1ADQL 1EVUA 3OJ2C 2XKNB 4GQ9H 2B20A 3CGTA 3VFSA 4LQFH 5CP7A 3ETBF 1IM9D 3QDJB 3C6SB 4YJZL 2H6PB 1U8HB 3I3DA 1R3IL 3GRWA 3HS0A 2PXYB 3QB7C 3H9SD 4KGLA 4QF1B 2YMXH 1UZ8A 4L3EE 5JQ6H 5HI4C 4D0CB 3HMXH 3D18B 2VZOA 3G6DH 4H88H 3RWJB 4P4RA 3I02B 1RZJC 4UINL 1HNFA 2DJ4A 3X3GL 3V0WH 1AO7E 3B6SB 3QCVL 3RWGA 3ULUE 1ZXQA 3QRGH 1EIBA 4L9LB 1YEJL 4LRNL 5DGQA 3MUGB 2FBJL 2FJGB 3SDDB 5EO1A 3V52L 2B0SL 1AFVL 5ID0B 4GBXB 1CGSH 5DUBA 5IHUL 1X6NA 1BQSA 2BY3A 5FHAH 4KZEH 3G5ZB 1QSEE 1UWEL 3DPBA 3UYPA 1MQ8A 4NQTA 4P5KA 4CMMA 4NOBA 1T20B 5HYFA 1QSFD 5JUEL 2VXQL 1UCTA 1ZSDA 4GAFB 5DD0H 3PWJA 3T3MF 1I1AC 1TDQA 5C6PB 2DWEB 3FHQA 5D2NA 4ZFFA 2VDQL 5TQ0L 2OL3A 3L5HA 3VXRD 2Q7NA 4NJ9H 3MOAL 2FDBP 1SJEB 1H3TA 1BZQK 1LNUA 2I5YH 3H6JA 4FFVD 5L2KA 2KKQA 1CF8H 3MJ9L 3MRQA 3RVWC 4JCLA 4P2OA 1AHWB 4APQD 4RQQA 3RWFA 4HFUH 5EWIL 3K8LA 1JYNA 4FN0A 1RZ7L 1N3NA 2G75A 1ZTXL 1WV7T 2XA3A 3FT2B 4LASL 5F7DA 1F2QA 5CD3A 4L8CA 2VL5A 2EYTA 4MA7H 4LU5H 3EOTH 4L8DB 4I4WB 3K2UL 3WS3B 4MJIB 1B3JA 4O00A 4X6CF 4YGVA 3WCYA 4P5MA 5CBAA 2IH1A 5T5NG 3ILQC 5IOPB 3GO1H 4OAWB 1IGIL 3ARXA 2NLJB 1DUYA 4LHUG 2PW1B 1INDH 4X9IA 3JV4A 1N6QH 4YDKL 4K7PL 1I3UA 2D0FA 5T1KD 3GKZA 1G6RL 3O9WC 1XAUA 5TH2A 3OKMB 4LVHB 1EFQA 4Q97A 1S9VA 1E4KC 1A3RL 4NNYA 1S3KH 4A6YA 3EJYC 1EBAA 2Y36L 4JM2B 2HFFB 4WTXA 3NBNA 5ACMA 3OKKA 2EDWA 2VNCA 3M8OH 1QNZH 1OQXA 1U93A 3QDGD 2PO6C 3SGJA 5F1NA 2V2WA 5ACZB 3EYVB 5IR1A 4NKMB 5C0AB 2DQGL 4NWTL 3FQRA 5DHYA 3C60C 1HDMA 1UWXH 4NQCE 3BZFA 2VDLH 4NKOB 1CFVL 3S7GA 1BZ9B 4XP6H 4X7FC 3MUY1 3V4UH 2P42B 4RMRA 2C9AA 3QNYA 3CFKB 1N59A 3QDME 2DLTA 3AAZB 1YPZA 4S1RL 1F11B 1OGTA 2VLJE 1MCRA 2PYFA 5J89A 4MJ2A 4Y89A 5JO5A 2Y72A 3K46A 4JKKA 2P5EA 3QUYC 4TNVF 2H32A 2EIDA 4MQ7A 4Q58C 4QT5A 1RUKH 1FDLH 4JZJC 4H8WH 1BEYL 3L3OA 2FLBT 4RFNC 2YK1H 4ZUWA 3T2PA 5A2KH 3QIUB 2I9LB 2VH5L 3HZMA 1A14L 4PS4L 1OLZA 2ICWA 2BY0A 1MAKA 3G6JA 1F13A 1KIUA 1DDHA 3NIFE 2JB6A 1P6AB 3I3BA 4IJ3C 1BX2B 3MLXH 4XMKH 2OSLA 5JHDA 1IBGH 4MJ5B 1SYVB 4S2SB 2EO9A 4MDJB 4YHOL 4X7CC 4G6KH 5J9PA 5JOFB 1EJOH 2GT9B 5TDPA 2GFBB 4MNGB 5DUPH 3WFHA 1F4HA 5DJ0A 3UJTL 3HNVH 1C5CL 4C56B 2R2EA 4XVUD 4Y19D 1EEYA 1Q0XL 5GGQL 3TNMA 4I3RH 2AJSL 4JRXA 4P2CG 3SKNA 1CD1A 5EIQA 3MBED 4FFYL 2F15A 5EU3B 3LKQB 1EXUB 1JN6B 2C3WA 4NZUH 3J7HA 1CICD 3HR5B 5DDHB 3TBSA 4NKDA 4CVZA 5T3ZL 4JFZL 4CJ0A 1D5BA 1EJ6A 3NPSB 3UPRA 3T3PF 3L3GB 1SEQL 1ACYL 4BFEA 3DIFB 3B8YA 2F53E 2BDNL 2DIJA 4PJ9C 5B3JF 1EEUA 4PTTB 3QXDB 3FB8B 4YNYA 1H9VA 1ZLVK 4E0RB 3O4LE 4XCNA 2ZNXA 2VXSL 1DLHA 3BJLA 1L0XA 2QSVA 2DQUL 1QP1A 3EZ8A 4U6YB 1WBYA 1KFAH 4MVBD 3PL6A 1GPOL 2Q8AL 1U3HB 1V7MH 4XPBL 2FD6L 3S88L 1A6VL 4PJEB 4XP5L 4EI5C 3CSYB 1UYWL 4NHUA 4JFFB 4CU7A 3IJSB 1C1EH 4KHTL 3QISA 3UAJC 2J8UF 5DQ9B 1K8DB 2IPTH 3SDDD 4WFHE 4UMGA 2H26B 3IFLH 4GBXD 4APQC 5BRZE 2UY7A 4K7FB 1XF5A 3T3ME 1QVOA 1K4CA 3MGAA 1S7SB 4XH2B 1NMCB 4BH8B 1R5IB 5IMOA 2VLMD 4Q9CA 5DJDA 1A6ZB 2FATL 1JHKH 2X4PB 3IAQA 4N0CC 1T2QH 2A9NH 5FA4A 5F72S 4HKBA 2Z93A 2RFXA 1WEJH 1I1YB 5ILTL 4S1DC 4LHJB 3IVKB 2Q3AA 5SWZA 4CN6A 2WNGA 2GK0B 1N5YH 2VE6A 4X6CE 3KPQA 4WHTA 3JWDH 2FL5B 2X44D 4PJGB 3T0XA 2J5LB 2NZ9D 4UBDD 1MRFL 4RZCB 1RJZB 2WBWB 3FQXB 1JF6A 5TE6H 2X1XR 4PJHF 3QXTA 3WJJC 5FKAB 4JN1L 4C57C 1V05A 4KI1A 1IZKA 5I1KH 4KKLD 1OLLA 2E7LC 5C07E 1F4XL 4Y5VB 1BD2E 2WWKT 3HG1E 4MCZB 5E6ID 1ZV5A 4GAGL 2CDEA 4NJAH 5I8EB 1HH9B 4N0YH 3O6KL 4YUEH 3MX0A 1CXHA 4HAGA 2YEZB 1U36A 5C0EB 5FYJH 4QYOB 4LLUA 3IU4L 5C0BA 4DOHB 1ZT4B 4JM2D 5SWQB 4Y4KB 4YBQD 1OAYH 3C9NB 2AEPH 4DZ8A 4U3HA 2DIAA 2ZSWB 1DLFL 4R7NA 2XWTA 2EDTA 3MUHL 1K3ZA 2Y1VA 3DX7A 1GHFL 5C0AD 1I7ZB 2NPLX 4UIKH 3PDOA 3GFUA 3ABZA 2HT2C 1FO0L 3LPWA 1C08A 3RI5F 4JDZA 3FQNA 2PF6A 4HX1B 4GW4A 1RIVH 4I2XA 1NCUA 1ORQA 4FQXD 2P5WD 5HI3C 3HRZA 1Q9KB 2X9WA 4YEEA 1EO7A 2DLHA 2ED7A 3LRHA 4CADB 3RGHA 5I76B 4YR6B 1VFAA 3MV8B 1N7ML 3VJ6A 3WSQL 3S3PA 4O9HH 3PGCB 4BFBD 2E8ZA 4G8GD 4HIHB 3QUXB 5B39A 3O2WH 1BVLB 4DN4H 3TYFA 2RR3A 2AERT 1BGXL 4X6BA 3RVVD 3HPJB 1A1NA 2BSTB 3WNPA 1CXKA 2A6KA 5GSRB 4XVSL 1DP0A 1WBZB 4YDJA 4Y0GA 3DX6A 4K23L 3UYRH 5C09E 1LP9A 4WV1B 4YIQA 5FFLA 2L7UA 5T1LD 2Y6SC 5TQ2H 5JDSB 1J5OH 4LHUD 5B38G 1V3MA 3SE4A 5GRZA 1TENA 3BPOB 4CGTA 2XZAL 1B90A 5C8JA 1RI8A 3ZKNC 4HMCA 2JK5B 5E94B 3RJDA 4G7VH 4PJ7A 1AE6H 3HR6A 1G7PB 2PTTA 2CJUL 5IQ7L 2EE6A 3BIKB 5HHXH 3DX8B 4OV5B 1CFNB 3VFNA 5J0BA 5DJZB 2EH7L 4OLWL 3RIFF 2YRZA 3VMPA 1HXMA 1EA9C 5EBGA 4F58H 5IG7B 4RCAA 5IJVB 2E27L 1U92A 3U46B 1MJ8L 3T3PE 5L6YH 4RFEA 3L3IA 3PQYB 3MV7E 2DQEL 4GMTL 4BZYA 5I1GL 1A3LL 3BUYA 5B3JE 4X5WB 1BAFL 4I3GA 3WFDL 2ARJQ 1BQHA 2XTJC 5FM4A 3LS4H 1N0XL 4EIZC 1MI5A 3BKML 3KXFB 4CDGC 5JW4M 3GKWL 2XT1B 5KAQG 3TFKD 1DFBL 1CGYA 2FJHA 3FRPG 5DD6A 2VXUH 4HGKC 4I9WE 4BFIA 5C9JB 4S0UC 4FTVB 1EMTH 3CPLB 3Q5TA 5KOMC 3GJFK 2VZVA 1X5KA 3ARFC 1FE8L 4NRYB 2O5YL 1YY8A 2J8UE 1RAMA 4LVNC 5JPMA 5D1XC 2GCYA 4DFIA 3VDAA 2BNRD 4GMSH 4NCC1 5EIIB 1A7OH 4OGZA 4OCNC 3KPPA 3LD8B 1BBDL 5F7EL 5AWNL 3LPGA 1RJLA 2Z8SA 4F7CA 5DQDL 5EG6C 4JPIB 1LHZA 4HXBH 4ZFZA 2NMSA 3EYOA 2DI7A 2XZCH 1U8PA 3HZVB 3EKCA 1Q0YH 1IT9L 3TBWA 1SJVA 1T0NB 2VKXA 3G6AB 5I1CL 1JIBA 1PY9A 1NDGB 2PKDA 3NACL 4IRSA 4KJQC 3MRRB 5EUKB 4XCEA 5B38B 5C0GB 4RAHA 3NMEA 5CILL 2H45A 4TUKL 1M1SA 5DUML 5EU4A 3AROA 2D9QB 4MCYA 4HULB 2BCKB 2HKFH 1OAXH 1T3FA 4KFZC 3LZFH 5FXCH 4MA8L 5E6IC 4TVSa 2NY2C 3T0EA 5IVNA 4OD3L 3T0BA 1P7QD 3RUGB 2VLRA 3RY5A 3QJFB 2ARWA 4PJHE 4OLEA 3GHEL 3MBXL 4FRWA 3QI9B 3PHQB 3BP5B 3BZ4B 1Q9OA 5KSUA 5E5RB 1PKQE 2J6EH 1KPVB 1XFPA 2R1XA 4XPGL 3GBLA 2NY0C 5JIHA 1R3JA 1EAPA 3BSZL 1RY7B 1ZLVH 4D9RE 4L5FL 2BHYA 3TCXA 1YEGH 1X5GA 1G1YA 3EHBD 3WNMA 3CUPA 1CN4A 2R2HB 3HC3H 3WIHH 5C0JB 1OSPL 4ONOA 4PP8C 5T3XD 3L5WB 4MD4B 1T21B 3DETD 1KV3A 4R3SB 4NNPH 5FO7B 3BWAA 4TQEH 4Y4KD 1G7LA 4J1UA 4K94H 4H8WC 2FX9H 3GI9H 2CDFB 1NAML 2WUCH 3SDXF 2K7PA 4PRIB 3L5JA 3T1FA 2Z9TA 4HPOL 3VWKA 1T89A 2HWZL 4Q9RL 3W39B 4ZUTA 4NM4L 3D3VA 1TCRA 5J13B 1A4JA 5JDJA 1QHOA 3RVVC 5B8CC 3UO1H 1GGCH 4IMLA 4KK9D 3L7FA 3RVUC 3MROA 2ZUVA 2X89D 1BJ1J 5I8OH 4J8RA 3ZDYE 3VXMB 1BZ7A 1IAKB 2ZOKB 3Q0HA 1U8QB 5HHNB 2B1HH 3LOWA 5DD3L 4DZBA 3MV8D 2NXZB 5F3BB 2AJ3B 4NKIL 5T1DH 3GIVA 4Y88A 3I9GH 1S9XB 3RJQB 4OLXL 2MPAH 3I84A 5ALBH 1HQ4A 5FYLD 1G9NH 2DQTH 2VQUA 3CCHB 1CI5A 1M7IB 3CDGB 3LQZA 4PJBA 1VERA 2V5RA 4JGUA 4LGRB 4U6VH 4QRPA 2NY6C 1RPQA 1MREL 2H9GA 1ZHLB 4M43L 3R0MA 3BH9A 1YDPB 12E8H 3IFPA 1A6WL 3GMMA 2FSEB 5BW7C 5K9QI 3U4BH 4OZIA 5AD0A 5B21A 2XKUA 1B0RA 2YPLA 3AXLA 1R0AH 3HAEH 4JZOB 4M8VA 1WZMA 3SGKC 4LQ1A 2FX7L 4FQ2L 1OTTC 4PJAF 1U2CA 3BXNB 2V17L 3OXSB 5KJRH 1BOGB 3BE1H 4H20L 5DXWA 4Z0XB 4LKCB 3UTSE 1FLRH 2WINA 4FXKB 5KW9L 3BKYH 5INDB 3DROA 4QRTA 3QQ4A 2YUWA 1MJ7H 4EDWL 3BO8A 1V3JA 4NN7C 1VPOL 1A1OB 4OBRA 5C08D 5C0CB 5E9DB 1I3VA 4KVNH 1KSRA 4ORGB 1I1AB 1IEBA 2X09A 5F1OB 4NZDA 3IKKA 5ENWB 3QPQD 3KNBB 1I8MA 4QTHB 2F74B 3Q48A 4NHCL 3NTCH 3KVQA 5EZJA 2IQAB 3VW3L 4OUOA 4PUBH 4Z7WB 4XPFL 1Y6MR 4HWBL 1FVCB 4WFGD 1FO0A 2YD6A 2CK2A 3NABH 4UUJB 5D7JC 3DO7A 2RCSH 4WW2B 4JRYE 4M7KH 1EEZB 4L4TD 1BECA 1B0GB 1FFQA 4FQIL 4KAQH 1WWCA 2OJEA 2W38A 1R5WB 1U8NA 3BD5A 3JWDC 5CLTA 1J0ZA 5F6HJ 2O5ZH 2JJTC 3SDAA 4YHIB 4WI8A 2P24B 4P57A 3VFOB 3BEVB 4OZGA 5M95B 3H9SE 4I18A 4L3EA 1JPFA 4LPUA 2W9LA 1HYSC 2G60H 1DQMH 4QLRA 5FK9B 4K3DL 1AXSB 3PGDA 2AEQH 3FONA 2OYPA 2J1KA 5IW1B 4MA3B 3T0WA 1AO7A 3TO4C 1DBMH 1WTLA 3QO1B 3QPXL 3FO2A 1PY4A 3NA9H 2Q6WB 4F37F 5HVGB 1CFSA 1CGUA 1KENL 4J6RH 2VERN 3IF1A 1J1OH 4LIQH 2Z92B 2EYRB 2B1AH 1QSEA 1TJGH 3P40A 5MI0C 4PJ8C 1I9JL 1XGQB 1XIWC 1KG0B 3U6RA 5I2IB 1DVFB 3L95A 3HMWL 4XNUH 5HHVL 1QSFE 5I16B 1T22B 2AJUL 4WO4C 2IG2L 3RNQA 4K9EL 2GSGA 3QI9D 2UZXB 3CX5K 5TGBA 1T1XB 3VXUB 1HHGB 3VXRE 4XCCH 1OPGL 1UXSB 2DI8A 3ARYA 3IJHA 3D25B 5JIPA 4D9QD 2F5BL 5F9OL 4DK6A 3KPSD 3GJFH 1MJJB 2E7BA 2GSIB 2MQ0A 3AFLA 3VGBA 3V6ZA 4ZQKA 3KPOB 1IRAY 3E8UL 3QUYB 3QYCA 1KEGL 1A2YB 3Q1SH 4HF5H 5TE4H 4UDTB 3SDXE 4RFNB 2X10A 4LLVA 4OCXL 3B43A 1L9MA 1EO8L 4JN2A 4R2GB 5GGVL 5DC9B 2VDOL 5IJKA 4KJYB 1JGEB 1RJYB 1Z5LB 2P8PA 3ARBA 4HPYL 3K3QA 4LSPH 2B2XH 4HQQH 2ZNWA 4IJ3B 3RQ3A 1NCBH 3EO1A 1ZGLM 1J05B 4KKCC 3DXAD 2JJUA 3V4PH 5GGRY 4DGVL 3BZEA 4NOFA 2EEDA 2BRRH 1M05B 2H2SC 2HT3D 3UTOA 2GTWB 2ICEA 2IFGA 3F12B 5GGSY 3U30C 4PJFB 5KVDL 3THMH 4KTDL 3UXFA 2ENYA 3QWQB 1JF1A 4HKJB 1C12B 2XG5A 4JDTH 4G8EA 2NXZD 2FH6A 4HH9A 5IB4A 4F7EA 3RY6A 3B9DA 1SY6L 4R0LC 5K9KA 5KSVA 4M7JH 1EDQA 4C4KO 4HWEH 3DLQR 1V7NH 1SBSL 1T6WA 4PRPD 2VZUA 3WXWL 1JPGB 2D4DA 2Q7YA 2B4CH 3MRNA 4LSVL 1WFOA 3FQWB 5CEZL 2PR4L 2Z8RA 3FO1A 4P23D 3MA9H 4JO3H 2CUIA 3QDMA 5ERWB 1QFPA 4TTDD 4G9DA 4X6EA 3NIDF 5I8CB 5DYOB 5HI5C 3C5SA 3QEHA 4ZTOH 2VLJA 4PJAE 1X5FA 4GG8B 3RVXC 3SO3C 4BFGA 4IRJA 3S4SA 1P2CA 3F7RA 4XTRD 4EI5B 2UV3A 2GITA 1NBVH 5DSCB 1TETH 4UNVA 1MRDL 3IKCB 1TIUA 4WI5A 3CFCH 1EFXD 5INCA 3TJHC 4X8XA 5DWUL 5GGTH 1L0YA 4U1KA 4OSUL 1TQCC 2CKBB 3EYQC 1G7IB 3W0WA 5KZCD 2DTML 3EYFA 5JOEA 4PRHA 1NKRA 4BSWA 3PWNA 3CZFB 3VGAB 4X7SL 1L8JA 5CZKA 5T5NF 5E9DD 5IMLA 4LCWA 3TO2A 4JPKL 5JPNA 4YXKH 1IGFL 5D96C 4ZXBC 4OD1L 3TIEB 3GMOA 4L4VE 3NCBB 1NCAH 5LVEA 1RHHA 1T0MB 4G8FA 4Y19E 4MD5B 5HDOA 5DC0A 1KXTB 2X4SB 1I85A 4HT1L 5CEXB 5CEYA 3HC0A 5E2VL 2YOCA 4ONHB 4DJMA 4EUPA 4CL7A 3G9VA 4ZTPL 4NZTH 4JO1H 3OPZH 7FABL 4GRLA 5IP4A 3HRPA 1F6FB 1HEZA 4WWKD 4ZAKA 1EV2E 2ZOLB 32C2A 3Q3GA 1IM3A 1D9KC 3Q5OA 3SDYH 3FB5A 2WQRA 1SMOA 1CXLA 3T77B 4E42B 1A5FH 4JM4H 4BSVA 4ZSOE 2F53A 4Y4HD 5EUOF 3ZL4L 5KVGL 5D7LD 3U7YL 4Z76B 3CFBB 5EU6D 4PRBA 4IOFD 5E1AB 2VABB 2E6PA 3E2HA 3R06B 3WXVH 1RQ5A 1A7QH 3NCEB 1JJUA 4G8IA 2AXGB 2P45B 4O2EB 3HI5L 1LQVA 2HRPL 4DEPC 2VC2H 5CMAA 2EDXA 4D0BA 5IFJB 1UB6B 3KG5A 1JK8A 4GKSA 4UT9L 3RTQC 1FPTL 2K9UA 1IKNA 1PYWB 3S34H 1NAKL 5DLML 2NX5A 4PJEF 2AEWA 4K94C 5DEFB 1RU9L 4AMKH 5JNYA 4WFED 3S3SA 1HOCA 4JAMB 3NFSH 1KJVA 4U3XA 1B4JL 4R26L 3LQAL 3AREB 1P5UA 1U8KA 4Z95H 1G7QA 5IVZB 2PYEE 1FN4B 2GTZB 2VLME 4XPTH 2X4QB 2C1PA 4LLDB 1AR1C 4FQJH 1ZHBA 2SEBA 3NZHH 3UPAA 5HGGS 5GRJH 4PJDF 4CBPA 5EC1A 4HIJB 1UJ3C 4ELMF 1Q94A 1FJ1B 5HSFA 2X4TA 1BBJB 3LHPL 4NO0A 2EDNA 4OLZL 3MA7B 2BMKA 3GMLB 3U1SL 1CT8B 3FN9A 1OY3B 3D2UB 3VFWA 1MAJA 1WBXA 2VJXA 5I18H 4HK3J 4OV6F 3MRPB 4S1QH 5IROC 3RWIA 2VDNH 3WHE0 2WWMD 1S7QB 2KUTA 4LBEA 3KYNB 4J3WA 4R2GD 1G9NC 5LAXA 3TCLA 1KJ2L 4NQSA 4R7DB 2D0HA 4I48B 4PREA 1PSKL 2VYRE 3OWEA 4G9FB 4IRZL 1KIQB 5JOPD 5HGBA 3QHZH 4UOJA 3GRWH 1NFDB 5C07A 3AM8A 4GQPH 1OSZB 3HG1A 2FIRT 1FVDB 1QPXA 1FIGL 4K2UH 5EU5B 3JV6B 2D4FA 5EOQL 3N50A 4PV8B 4GJTB 4M5ZL 3VA6A 3PNWA 4ELKB 2V2XA 3QG6A 4P23C 3O3BB 3T65A 3OKNA 4ZS6D 3H2WA 4X5LA 1Q72L 5F7KC 1FZOA 5K9OB 3L7EB 3FFCA 3U9PL 3U0PB 5C0AE 5E5MB 2EE2A 3RGVD 1HH6A 4OLUH 3Q6GL 4FQHA 1FORL 2XNAA 4MB3A 2NNAB 1OD7A 3CX5J 4J3VA 1ITCA 3QUZB 3F7VA 5CJQH 2HJKB 4FMFA 4LSTH 4XAWH 3CMOH 2BSRB 3HUJA 1LEKA 4DVBA 5C0RH 1JHLH 3K4DA 2P5WE 2XTJB 4K3EL 3NIDE 4U1LB 1QFUL 3LRSA 1JNHB 1PLGH 5D7SL 2OL3H 1YYLL 5EOTB 3LN5A 5F7MC 1PX3A 3SPVA 3MFGB 2AV7B 3U0WH 1YNTA 4IS6A 4LCCB 5J56B 5H35A 3S3JA 2FEEL 3NN8A 4NQEB 1DANU 4DKFH 1CIDA 4EN3A 5D71L 1MPAH 2DKSA 4G8GE 5FO9A 3HCVB 2UYLB 5IFAL 5D1XB 2C3XA 1W72L 4JFED 3D85B 3EZJB 1AR2A 5CCKL 1RZ8B 4I3SH 2DBLH 1JCKA 4Q74A 3F7YA 1Q9LA 1U8MA 3CXHK 2JJWA 2FO1A 3IDJA 5CZVH 5ESVB 3P0VH 4IIQA 3T2OA 5DHVA 3WUWA 1IEAA 3TNNA 1KJMA 4QWWD 1YEKL 3B83A 4WWKC 4LCIH 2DDQH 3SY0A 4Z0BH 4CNIA 2YA2A 4YXLH 4RAVB 5MP6H 3AY4C 1GGIL 3NH7H 3VD5A 1CDCA 5IBTH 1ES0A 4Y4HC 4ZOCA 3MCLH 4QTIL 5EU7C 4A6YH 2ZZUT 2BSSA 3IDNB 4U7KA 2F8XC 1I4FB 5GJTH 2WP3O 2FR4A 1MQKL 1ZWIA 5I17B 2J88H 3CJJA 4R6UA 1XGTB 1A0QH 2R0WL 4EVNA 4M7LT 4MSWA 2R0ZL 1MCDA 3JWOL 4XAKD 2NY2B 5HVFB 3H7BA 1NH6A 4OKVB 3IDGA 3MV7A 3OKOB 3SJVD 2CLZA 4U1NB 3TESA 3BPLB 3ULVD 5EUOE 4P2YA 3FCTA 2JCCF 4DVRH 3MZTA 3MLVL 3W9EB 1M7XA 1XGPA 5D6CB 5CKGA 2A83A 4H1LA 4ZFOB 1T5XB 1V3LA 3RIAK 2ATKB 2EYSB 4O5LL 4A2LA 3QHFH 4XGZA 1J0KA 3MRDA 3QNZB 5DI8B 3N1MC 3SCMB 1A7PH 3V8CA 3DVGA 3C5ZC 1LK2B 3JXAA 4K8RH 4OT1H 3ZHLA 3HE7C 1F45A 2GQHA 2OTUB 4PJEE 1QYGH 2QQKL 2BNRE 2H32H 3X14A 5HDQL 4TVPH 4GAJL 4WWID 1T83C 3P4MA 2R1WA 3S36H 3WS6A 1LDSA 1FQ9C 3OL2A 4R96A 4JFYB 2NW2B 4U6HB 3VI3F 5IKCB 3KWWB 4N0UA 1ZHNB 2FB4L 3B9KD 3BPCB 3P9LA 1FAIL 1MJUH 2AVGA 3N85H 4HD9A 1JNJA 3ARED 3ZKSD 1S7WA 5CD5D 1II4E 3EIFA 5B8CB 1NFKA 5T1MB 2ZUTA 1ZKAA 1UCBL 1U58B 3KPNA 2DYPD 3S97C 35C8L 4ELME 3HE6B 1P1ZB 4LEXH 3IETA 1I9IL 4U1SA 2ZG3A 3GI8H 1AGCA 1ROWA 3VRIB 2XPGA 1LILA 4EBQL 3PWPB 2Z31A 3GSNL 5B22A 1MLBB 3HLAB 4PLJC 4HUVB 4MX7B 5DTFA 1OF2B 3GSXB 3U9UB 1TMCB 3D2UD 4KK8C 3C8DA 3FB7B 4TSAL 5TPWL 2A0LD 1R6VA 1U8JB 4LDEB 2CPCA 4P2RA 1U41A 3S37X 2X70B 1NLDL 5ICYB 2B4CC 5FYJE 2NY6B 3PWUA 5C7XH 2PW2A 4NQVB 1A1MA 2AKRA 5L2JB 3RGVC 1I8LA 2HTLD 3QIBA 5DS8A 1ZLSL 1X5YA 4FQLL 4D8PB 5I1HH 4YHZL 1SHMA 4HS3B 3MJ7A 4HIIB 1HZHL 5KAQF 3EOBB 1TXKA 5GGSA 5T3XE 3MZGB 4NC2B 5E5UB 3O8XB 4ZS7L 4PBWD 4LSQH 3GSVA 5JZ7C 25C8L 2ZWLT 1FVEA 5KS9B 4QXUL 1U2HA 1KXVC 2E5EA 5DA4A 1QRNB 1UJTA 2VWEC 1IL1A 4RDQG 5DF0A 1ZEAL 3UTTB 3V4VL 5DRXA 3VH8G 1M7DA 2A6JA 4P4KA 3MYZA 2CLRA 3RKDD 1K5NB 3O4OB 1H5BA 2IH3A 3DRTA 2HTKC 1RZIA 4OCYH 1MEXH 2AJZA 3QNXA 2O61B 2VQ1A 3QZWA 1AD9A 3BDYL 2R56L 2OJZL 4N1CA 1NMAL 1P4LA 2DQJH 4PY7A 4XVTL 5B39G 3ME0A 3V2AR 2KH2B 3MODH 5EDXA 1OGAA 4KU1A 1JUFB 3QHTC 3PDGA 4GRMB 4NO2A 4DFHA 3OZ9L 4Q9QL 3MV8E 5E8DH 5BXFA 1E4XI 4MQXD 4WU7B 5D7JB 1G6VK 4PGBA 4XMLL 5FV1L 4YDVA 1FNSH 1JNNH 5C71A 3BP7A 5FYLE 1F6LL 4QHKJ 4KXZH 3D85D 3LSOB 2J4WH 4P2QB 4X6FB 2BVTA 5F9DC 4K07A 3KYMB 3MV9B 5L0QC 1KCUL 5LGKA 1EGJL 3LVEA 4XC3H 3AMKA 5I6XB 5CHNB 5DJYB 3TA3B 4GT7A 3BYYA 2VIRB 4XCYB 5GS0D 4U1JB 3TO4B 4C83A 1L7TL 3RWDB 3C2AL 3DUSB 4PRNA 1TLKA 3SOBH 1KT2A 3L9RA 3UTSA 4DQOL 2CR6A 3BN9C 2EDRA 4OQTH 1A6AA 4U1IB 2JCCE 1I7UA 4HHAA 5MI0B 4U6XA 4UV7L 1WIPA 5C08E 5LKNA 3D0VA 4RX4A 2GJ6B 4WO4B 1YA5A 2ERJC 3QCVH 3T8XB 3ZE0F 1ZLUK 4KKNA 1RJCA 4LRNH 4K8RD 1K6QL 3DURA 2D03L 4M3KB 4M6OL 1KB5A 2HRLA 4LCYB 5EN2A 1AFVH 3BUTA 3OGOE 3QUMA 4GXUM 1CS6A 4L8BA 3B9KC 4TVPD 4OLYL 4WFGE 3SCMD 1KTKE 1LQSR 4Z7UB 1GIGL 1HXYB 5E00A 3BN3B 4M4PA 2XTLA 4X7TB 4L4TE 4M00A 2X4UA 4WI3A 2VITB 3DYMA 3VXTA 4YQXH 5E2JA 2VDQH 4WI4A 5TQ0H 3VI3E 5LQBL 4Q6IA 1YC8A 4TUOB 1EBPA 2HN7B 4ISVA 1IGYB 4NFBA 2WIIB 4N1HB 3FKUS 5FA3B 4LLMA 1MCEA 3ARVA 3EYSH 3PWVB 1TQBC 5EWIH 5J1AB 3KPMA 1RZ7H 2ATPA 5EBLA 2M26A 3NFPA 3R1GH 1J11A 3TN0A 1TZGL 1W72A 3ARUA 2IADB 5JXAL 3K2UH 3PWLA 3QEUB 3V5DB 5HYSA 1G6RB 4NYLA 4TNWK 5IIEA 3HE6D 2ZJSH 4RAUB 1IGIH 2AW2A 2NW3A 4UV4L 3BW9B 4M6NH 4YHPA 4QCIB 4HZAA 3WO3B 3D0LA 4N0FA 2CDGB 4AH2B 5H2BB 4K7PH 4P3CH 2OI9C 4V2CB 4ZUVB 2DJSA 4MLSA 1NBYA 4P5TA 5FB8B 5C0FA 1QSFA 2HMID 1G0DA 3P11L 5FOBA 3O81A 5KBNC 2Y36H 5K33A 4PLOB 1NGWA 1MCOL 2ICWI 1GC1H 4GS7B 2C3VA 3VXRA 4G59A 1OAKL 3PL6D 1LD9B 1BPVA 2ZUXA 3FJTA 3O2VL 5GRVL 5KSBB 5I15H 5I1EH 5D2NC 4HC1A 4P9ML 1JTOA 2OX5A 1SM3H 2P48B 6CGTA 4D9QE 4XBGB 4KKAC 3KPSE 1YJDL 4LVEA 4ZNEA 3CFDB 3Q6FB 4HIEB 4DTGH 1MFDH 4P2OC 4JKLA 1B6DA 2GY7B 3O8XD 4XWOC 5MEOB 3SE8H 2MSPA 4AQOA 2IFFL 3MXVL 4HZLB 1IC4H 2EICA 3MJ8A 1TQCB 3BDXA 5FKPB 1R3LB 5LGJB 3VD9A 5T1KA 3O3AB 4YHLH 5DK3A 4JHWL 3DXAE 1A7RH 3GSRB 4O51A 1VCAA 3O3DB 5DO2C 5E95B 4LAQL 3S5LG 1BEYH 5SWZD 5HVHC 3M17A 5AZEL 4YC2B 4N8CL 4NCDA 4CMHC 5EBMA 1URLA 4JQIL 2VH5H 1N6VA 4PS4H 2F58H 5I1DB 1O7VA 5FYKH 1ZT1B 3QDGA 3ZSSA 4XP9L 2F5AL 1JRHH 5I1LB 1INEL 1FBIH 4JDVA 4PJXF 5DMIH 2P8LA 3OR6A 4GO6B 1KUMA 1S7RB 1WCQA 3BGFC 3NAAL 4F9PA 3BQUB 3SGJC 2A9ML 4FQQB 5I1IL 1U95B 8FABB 3H3PH 4KUCD 1JWMB 3AS0A 1VA9A 4JY6B 1KBGL 2XRAL 4PRPE 1JV5B 2EIZB 5C1MB 3EUUA 4P2QD 1GGYA 4MS8D 1RK0A 2WWKO 1FGNL 1H3VA 5JW5A 3VWJB 2XA8L 2F54B 3MV9D 3SN6N 4O4YL 3JTCA 3BKCL 2CXGA 4IHOB 4NUGH 4OB5H 1J10A 4PJAA 5IM7A 4NFDA 1VGKA 5CBEB 3OX8A 3TA3D 5GIRA 3VXPA 2W07A 4F33A 4IDJH 5F88A 3GB7A 2Y06L 4K8RC 1GOHA 2LAAA 3LKNB 5J1SC 4NBXB 4F15B 3RTQB 1BJMA 5FGCB 5E7FA 1OP3K 5I8KH 3OKLB 4ZYKB 1P4BH 2XY2A 3IDIB 3O11B 4QRUA 3P77A 4OZFA 5GHWL 5ELIA 3FO9B 1Q1JH 4TN9A 5ESAA 3CFJA 1YC7A 4X9BA 2VXSH 3ZE0E 4YHYB 1RSFA 4MNQA 4NO3B 1H0DA 4MA1B 2R0LH 1A6VH 3L3JA 4XP5H 1TPXB 4D2NA 4DW2H 3CFIC 3LQMA 1FNEA 3TBVB 3ZTJG 3FQUB 2DLFL 1N64L 1NGZA 4JKMA 3CH1B 3MBEA 5AAWA 1G0XA 4JFQB 3SKJL 2BFVH 3IXTB 3HA0A 4WI2A 1LE9B 2D2OA 1CICA 4XMPH 2AQ1A 3GBML 5FUZL 3EYUH 2EC8A 4JHAH 1J1PH 2GEEA 1UQSB 2XKNA 1CDIA 3D69A 4NQUA 5J7CC 1G7JB 3MLSH 5IBLD 5IB5B 4FZ8H 3VG9B 2QHLA 5EU7E 3ULVF 4PG9B 1MNUH 2P1YA 5D7LE 1KB9J 3C6SA 3QDJA 5ILTH 1U8HA 5EU6E 2MOVA 3SBWA 1P7HL 4QF1A 3EOYG 5D7IF 3RWCB 4D0CA 2ICCA 3D18A 4AIZB 2YBRB 3RWJA 4MVBA 3I02A 1IEHA 5CS7A 2DM2A 2WBKA 3LH2L 3B6SA 5BS0B 5LJYH 1MFBL 1A7NH 4MQTB 3PL6C 1MRFH 1YNKL 3IDYC 3MUGA 3L5IA 3ARZA 2FJGA 2FJFB 5F9JB 3SDDA 1TVBB 5ID0A 2G5RA 4JN1H 5DJCB 5LXGL 1OTUC 1QQDA 4GBXA 5EBWB 1HHIB 2VDML 2Y7QB 1VSCA 4WFEE 5I19H 3G5ZA 1MI5D 5F7UA 3CAFA 2NY7H 3WJLA 3QSKB 5MEQB 1T20A 4U1MA 1RFDL 4PJ5B 2W9EH 4ODHH 3MRIB 4JY4A 4QXGH 5E4EB 5F1IB 3U7WH 3OHXB 2CGRH 2F19H 5F7NC 3EFFB 2DWEA 1ZLUH 3UCRA 1OCWH 1MVFA 5IFHH 5A2LH 4M4RA 1DLFH 5IB2B 3WNLA 4EDXA 4JLRB 1A6PA 4CW1B 4LSSH 5DK2B 4BA8A 1CQKA 1AHWA 1AP2A 1C5BL 4FQCL 1SJHB 1BF8A 2BNQB 1JGDB 3FT2A 2VMFA 4YHKL 4KDTA 4UQ2B 4I4WA 3WS3A 3WV0A 4ENEC 3PF2A 4MJIA 3LV3A 3LPFA 1MSPA 2YN3A 3HFMH 5CINL 4OAWA 3ARDB 4BKLA 2NLJA 1OAUH 4LRIA 5JOPE 1D6VH 4PB0L 1CXFA 1N7MH 3RP1A 1X3DA 1CVSC 5KSAD 3OKMA 1NBZB 3STZB 2GY5A 3DSFH 1FGVL 2W60B 1L7IL 4QHUB 1QFHA 4XBEL 2FH8A 1MHCB 1FFOB 1U8LA 1UA6L 2FNBA 4JM2A 3K80A 4PJXE 1T7XA 4K23H 5HTSA 5J1TC 5ACZA 4NKMA 5C0AA 3C8KB 3BQUD 2VAAB 4KMTL 5IQ7H 1CZ8L 4ODVL 2XZZA 1XZ0B 4NKOA 5L8KB 1F02I 2R23B 4FQXA 3S4SG 5T3ZD 3G5YB 1KNOA 3CFKA 2PCPB 4M03A 3FL7A 4ODUB 3QQ9D 1FYHB 3AAZA 1WITA 4WDIB 4JEGB 2VWEE 1IVLA 1YUHB 1FNGB 3LDBC 2DQEH 1IGTB 4UTBL 2BJML 1A3LH 4FG6C 1JZ7A 4B41A 3RHWK 3DECA 3WFEL 5E6YA 3WFDH 4XVJL 1D5XB 4MGXA 3VWKD 3NCCB 4JFEE 5DR5L 4AEFA 3D3VD 4YWGL 2I9LA 1DBAL 4NM8H 1HN1A 3P9MA 4D0DB 2K7QA 4UB0H 4G7YH 1JPTH 1KCVH 2FZ3B 2CLVA 1RUAH 3JSSA 4KTEH 3IFOB 4MJ5A 3QP3A 1FE8H 4S2SA 4TOYL 3MSPA 4S0TD 3K74B 3SO5A 5JOFA 2GT9A 1OHQA 4BK5A 1J8HE 4MNGA 3SE4C 5IBLC 1ZANL 1ZGLA 1F4WL 5F7EH 4Z18A 4KDWA 4Y1AD 4C56A 2W92A 3FTGB 5IB3B 2D7MA 4KK5C 4M62H 4X4YB 2X4NB 1FP5A 1RHFA 2IANB 1HYRC 5EU3A 3LKQA 1EXUA 1XEDA 4CU6A 3G04B 1MF2L 1JN6A 3IDUA 2YZ8A 5JORB 5I1CH 5F9WC 1YEFL 2QV2A 1MFEL 3HR5A 3N1FC 4XAKE 5DDHA 5FM8A 4NNXA 2KZWA 1OTSD 3SJVE 2BZDA 1QKZH 5BMFL 2X41A 1MFCH 1ORSA 3TWCH 4MAYD 3ULVE 1HKLL 5JR1H 3L3GA 1I1FB 5DUMH 5A1AA 5BQ7B 3T1WA 3DIFA 1DSFL 3MREB 5JHLH 4P49A 3TZVD 1IAIL 2YPKB 5D7IE 1CL7L 5E03A 1YPZF 1A8JH 4PTTA 4FQ1L 1GC1C 3FB8A 4MA8H 4E0RA 1XGYL 2PUQT 1LDPL 1NUDA 3CLEL 2DN7A 1QLEL 4X98B 2AK4B 1HSAA 2O5XH 1BFVL 1U3HA 5EOCL 3U82B 4JFXB 1WGOA 4PJEA 5BS0D 1FNAA 3CSYA 4AK1A 5E99H 3HPLA 3IJSA 1FZKB 3RZCB 4TRPH 1OP3H 5DQ9A 5EO9A 1K8DA 4XPGH 4LLQB 2H26A 4ODTL 5D72H 3VFPB 3PIQB 2P49B 1FV1A 1HHHB 3BSZH 4K7FA 2ED9A 5IHBA 4GG6B 3SGDH 2QSCH 4X80L 3D1MC 3RPIB 4HUWB 2OQJB 4PJ5D 1S7SA 5LWYH 1OSPH 1R5IA 4JO4L 1IE5A 1A6ZA 3F7QA 3UZVB 4AL8H 1A9BB 3B2UD 4JHZA 4IRSC 3TT3H 1P7KB 3BAEL 3H9ZA 4NGHH 1D5MB 5DD5H 2CXKA 2QQNL 2BOBA 4PJIB 3IGAB 5TE7H 4EUPH 1RV6X 3UJIL 1X4ZA 4NM4H 3I2CL 2HLFC 1CU4L 3FMGH 3SDAD 5ISZB 5DJ8A 3RKPA 2FEDD 2H8PB 3VMNA 1E6JL 1DN0B 2FL5A 1G7HB 3T0EC 4YE4H 3GSWB 5JXEC 5KTEH 3FQXA 2JELH 3ARDD 3SGEI 1CGXA 1AQKH 3GMPA 5J6GB 5L0QB 5DD3H 4JPWH 3P4NB 4KDVA 5FKAA 5I1JL 5KVFH 3MLYL 2JB5L 5DMJB 4X0KB 1VHPA 4NKIH 4MCZA 4OM0L 5GQBA 4OD2B 2BVUA 2WUBH 5LG1A 3P73B 1QA9B 1J8KA 5H8DA 1HH9A 5IEKB 2AJXH 2HKHL 1U6AL 2YEZA 1E28B 5C6WH 5C0EA 4QYOA 4POYA 4WI9A 2CK0L 5SWQA 1NUGA 4HBQA 4U1GB 4Y4KA 5D5MB 4IDLA 3S37L 4WCYL 3C9NA 4M48L 5FUCC 2ZSWA 3PXJA 1MREH 3RI5K 1QR1B 1EK3A 5FGRA 5SX4I 4LSRL 1SJXA 1I7ZA 3S35L 2R9HD 3LIZL 4N5UA 3IDXL 3D39B 4QNPE 3VWKC 1T89C 3L1OH 2FX7H 3D9AL 1H3GA 2XOTA 1Q9KA 2X89A 1MCFA 4G6JL 3TPUE 4TULL 4POZD 4Q9BA 3DMMB 2EXWC 3DHJA 3I6GB 3BOVA 5I76A 4Z8FH 4YR6A 3MV8A 5BO1H 3PGFL 2N56A 3NGBC 4N90D 2X05A 3QFJB 2ORBL 1UM4H 4OM1H 1LO4H 1NMBL 2FHCA 3B9AA 4JFPB 4RGMB 1R3HB 5GISL 4HIHA 4OIBA 4EEEA 3ARBD 1XCTB 4MAUH 1ZVYA 4W6YB 1YEEL 1KIPB 5IB1A 3HPJA 2BSTA 3MNWA 5DVMA 5ITBL 1KTLB 4UIMB 5GSRA 5DT1L 2I60H 1W0VB 5E8EB 3VW3H 3KR3L 3L5XL 3VFMB 4WV1A 4KUCF 4AEHH 4Y2DD 2NTFB 5JDSA 1OTSC 4AIOA 1ZVHA 1TQBB 4DN3H 3I85A 3IDMB 5TFSL 5GZOC 1M4KA 1A64A 4U1HB 3DYOA 4U7MA 4XNYL 2JK5A 3QUKB 5E94A 3WFBL 2MWCA 1G7PA 3BIKA 4OV5A 1CFNA 4JFDB 5DJZA 3EAKA 1NUFA 2LAGB 4KVCH 3X3FL 1B2WH 5L7XL 2AJYH 1YNLH 5IQ9B 2EDFA 2IAND 1CK0H 1YMMD 5IJVA 3SDCD 3H3KA 4H1LG 3U46A 5D7KD 3OAUL 1LK3H 4QHLA 4C55A 2OI9B 4OJFH 5D70L 3PQYA 2J2ZA 1YN6A 4AQ1B 4FFZL 5DUBB 3FO0L 5C08A 4O02L 4DKEH 2IQ9L 4RGNB 1UT9A 1YPZE 4X5WA 3KDMB 3LY6A 3QPXH 4RDQF 4YDIL 2EZ0C 3KXFA 1JWUB 3ESVF 2MCPH 4IRJD 4MB4A 4KY1L 5D2NB 4TVPE 5F71A 5C9JA 5F7FA 4FTVA 4P46D 1EHAA 3CPLA 1IZJA 1IC1A 4PD4J 5L2KB 4NRYA 3MRQB 3HMWH 4JE4B 5FM5M 5D2LF 2AJUH 4U31A 4P2OB 4EJ1C 2LABA 4NZJA 4K9EH 3W0WD 5DZLA 3GM0A 5EIIA 4LPTA 5F7DB 3RZCD 4XP1H 4PRHD 2A77L 2EYTB 4XC1L 1LP9F 1LO3H 3IRZA 4LCWD 3PDDA 4ONGH 2FIKB 4YGVB 2YA1A 3HZVA 4P5MB 2XYCA 5DHVH 2ADIB 3RNKB 2F5BH 3G6AA 1DUYB 4YLQT 2NXYB 1NDGA 3KPTA 3IFNL 3MRRA 5EUKA 2BVOB 3REWA 1IC7L 1MY7A 2N7AA 5B38A 5C0GA 3T4YB 4JRXE 1GRWA 4I18C 3RWEB 4M8QB 4PTUB 1T66D 4OCXH 4GRLD 4Z5RB 1JGVL 4HXAL 4JFOA 3PG2A 4AIXA 1QBMH 5DJ2B 4ZAKD 4A6YB 1QBBA 2YRPA 4MHHG 3NOIA 2YD7A 3DV6B 3OKKB 5J4MA 3QA3A 4Q2ZB 1GAFH 4L8SC 4R4ND 4AY0A 4TSCH 1U93B 3UX9B 3GIZL 1L9NA 5ISZD 3MRGA 3RUGA 2BX5A 4G5ZL 1MWAL 3QJFA 1WZ1L 3PABB 2E7MA 3C08L 5DHYB 3QI9A 3BP5A 5C3LD 3RIAF 4DGYH 1GGBH 5ITFB 3BZ4A 5DEGA 3HZYB 1E6OH 4KTDH 5TJWK 1KPVA 3BZFB 4H1LH 3SGDI 3WL9B 4L3AA 5JA8B 1YYMH 5TDNB 5EA0L 2CKBL 3FRPA 1Q8MA 2FWOB 1N59B 5DFVD 1RZKH 3QRFM 2VXTH 2R2HA 5C0JA 4PGDB 2NX5D 2LTQC 1SBSH 4H26B 3L5WA 5FHBH 4OF6A 4R3SA 1LO0L 5FO7A 3WXWH 4JG1L 1HNGA 1NGPL 2P5EB 3QZWG 5KS9E 3BHBA 2B39A 2PR4H 3LKOB 4MQ7B 2AK1H 2CDFA 3H8NA 5E2UH 3QCTL 2ZKHL 3DRQB 1FLTX 2OK0H 2OZ4L 3HZMB 5IJKC 3W39A 2CRMA 5SX5K 4EQ3A 2W0KA 3OB0K 1RMFH 3ARBC 3DXAA 1CR9H 3OBAA 2OSLB 3IS1X 1HIMH 3EFDL 5EORH 5SWZE 4NO0D 5J9PB 2R0KL 3DMMD 3VXMA 1IAKA 1W0YT 2GI7A 3B2VH 1EHLL 1U8QA 5DJ0B 5HHNA 2YPVH 3KPLB 3F58L 4HWZB 1CD8A 4KQ3L 4Y16B 2CRZA 1FSKC