1JUFA

Structure of minor histocompatibility antigen peptide, h13b, complexed to h2-db
Total Genus 70
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
70
sequence length
276
structure length
276
Chain Sequence
GPHSMRYFETAVSRPGLEEPRYISVGYVDNKEFVRFDSDAENPRYEPRAPWMEQEGPEYWERETQKAKGQEQWFRVSLRNLLGYYNQSAGGSHTLQQMSGCDLGSDWRLLRGYLQFAYEGRDYIALNEDLKTWTAADMAAQITRRKWEQSGAAEHYKAYLEGECVEWLHRYLKNGNATLLRTDSPKAHVTHHPRSKGEVTLRCWALGFYPADITLTWQLNGEELTQDMELVETRPAGDGTFQKWASVVVPLGKEQNYTCRVYHEGLPEPLTLRWER
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title How H13 histocompatibility peptides differing by a single methyl group and lacking conventional MHC binding anchor motifs determine self-nonself discrimination.
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system
molecule keywords H2-Db major histocompatibility antigen
total genus 70
structure length 276
sequence length 276
ec nomenclature
pdb deposition date 2001-08-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00129 MHC_I Class I Histocompatibility antigen, domains alpha 1 and 2
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1jufA02
3.30.500.10 Alpha Beta 2-Layer Sandwich Murine Class I Major Histocompatibility Complex, H2-DB; Chain A, domain 1 MHC class I-like antigen recognition-like 1jufA01
4P2QE 3SCMB 1I7RB 4XPBH 3T0EC 3C5ZD 3UX9B 1F97A 3WFEL 1IFHH 2RR3A 5DJXA 2O5YH 2WWMD 3W9EA 4ORZC 5CJOH 4N5UA 3KHOA 3QZWB 4GKOA 3L1OH 3QCUL 4OIIH 4KRPB 5E5UB 2OZ4A 3BIBX 4JHBA 2ZKHH 4OTXL 4OZHA 1S7XB 5CIPB 3V6ZB 2AK4A 3TVMB 2VAJA 3QCTL 1I75A 3LV3A 4G8EB 4KVNH 4KDTA 3QJFB 1ZGLA 3PWNA 4ZODA 3VI3F 4WI9A 3UC0L 1DE4A 3RWDB 4ONHB 1YECL 5EZJA 2YPKB 4EOWH 3T4AB 1RK1A 3FRUB 4HMCA 1JUFB 3RX7A 1HDMA 1N5YH 3U0PA 3P4OB 5I0DA 5M94B 4X9HA 4P49A 2GK0B 1EGJA 1YEDB 2EYSB 4HUUB 4NJ9H 4Y4HA 1E4JA 3BIAX 3H42L 3QULA 4NZRL 2Q87A 1XIWB 1RK0A 3I6KB 3MGTB 3QDGE 5F7HA 5DHYA 3TWCH 3IGAA 4PJXA 3ZHLA 4MWFB 3RTQC 5HD8C 2CPCA 2LVEA 1YDPA 4JFPA 1FDLH 1MCPL 1IZKA 5LBSL 4PLJC 3RY5A 2C3VB 1AE6L 4Q0XH 4JM2D 2R2CA 3WO4C 2APFA 3LS5H 3HCVB 5C09E 2D7QA 5EZIL 4MDIB 4YQXL 1ZAGA 1DBML 1O7VA 2GY7B 1TJIH 3AY4C 4KHXH 4Y4KB 3KAAA 3QQ4A 4H8WH 2EO1A 5ESAA 5B3JF 4BKLB 5DUPH 5F3HB 1U8IA 1DBAL 5ESAB 1QO3B 3GMPB 4OFYA 1C5CL 4OCXL 4N0CD 4V1DE 1A5FH 2Y06L 3O4OB 3F5WA 1QO3A 5CP7A 1NCDH 4PJIB 3K2UH 3MA7A 4Y19E 3QEUB 4Z77B 4O2CA 4JPKL 4OCXH 4ELKB 4ENED 5ESQB 3DHMA 4LPUA 3GMNB 5DK2A 1IAIH 3T2QA 3NZ8A 3WXVH 4P46B 5E8OA 2WBJD 1UVQB 4C4KT 2B2XL 3ZYIA 4N90E 5DFTA 5DUML 1W0VA 4WV1B 1EIBA 5TDNB 4YDIH 4QRRA 3REVA 5EZLB 3IRZA 2YEZA 3VWJA 3WEXA 4BSWA 4FXKB 1NGQH 1FNEA 4QHLB 5HHPB 2J88L 4BQCA 3MUHL 3QFDB 2H6PB 2H41A 1PG7W 4MD5A 5TE7L 4JDVB 1BHGA 1N2RB 4L1HA 1X9QA 3TP4A 5H94B 4TUJA 3O6FA 4YC2B 3TC9A 3BP6B 2FBOJ 1P9MA 3CSGA 3CJJA 4OZGF 4PP1D 3O3UN 4NSKA 5T1DL 5LGJB 3D3VE 3BP6A 1CFVH 3L5XL 4MJIA 1YYLH 3ZTJG 1I9IH 3RDTD 1YY8B 4JGMA 3FT4A 1OT1A 3RZCD 4HXBL 1ETZB 1MRCL 3UPRB 1GHFL 4RBPK 2VLKA 3QNZA 2R1WA 5CZXD 1CQKA 3LKPA 1S9YA 1HEZB 4CJ0A 2OTUA 2DB8A 1H0DA 3LB6D 2Q7YA 3KYNB 1MREH 2DQDH 4NKOB 1JNHA 1HN1A 3Q5YA 1EV2E 3QPQC 3EDFA 3UJIL 3CZFA 3EJJX 2V5MA 2EH7L 1I3RB 3BSZL 3PE9A 3ZDXE 4LCIL 1G7JB 1QEWA 2C1PA 3LKRB 1BAFH 4KK6C 2IQ9L 4IOFC 1A7BA 3LEXA 4TVPD 4RMUA 1WWAX 4JPKH 2WBJB 3E0GA 4ZDHB 4Z95H 3MRPA 2PYFB 1BJ1H 4KV5E 4LQFH 1T1XB 1KCSL 1A22B 4PYHA 5GSVA 1M05B 3BGFC 4M03A 1DBAH 4U1LB 3SPVB 4ETYA 4FQXA 5GSRB 5DRZA 1ES0A 2H2SC 1CICB 3TH4T 3LKSB 1N8ZB 2Y36H 4I2XE 4UNUA 5I9QB 4LKXB 1IC7L 2MQ0A 5JHDB 2FLBT 1XF4A 4IRJB 5DJCB 2XTJE 1FC2D 3FFDB 1RJZA 3WUWA 5AWNH 3PF2A 4EVNA 4PRIB 2R39A 4WTZG 1KN4H 1ZS8A 3Q6FA 4JRWA 1KACB 1YYML 1NLDL 5GS0C 4WRLA 1LE9A 1J11A 4EVNB 3D87B 5HVHB 4MAYD 3HE7D 4PRBB 1TMCA 1YJDH 4QLRA 4LCYA 5T3ZE 1CL7L 4NQUA 5ILTH 1BQLL 1FZMA 3E3QE 1AQDA 5C0ND 2GK2A 1JZ3A 2DKSA 5BS0D 3BP7B 4AT6A 3HC4L 1HCFX 3JSSA 1I8KA 2I26N 1D6EA 5GGTH 2ARJQ 4YX2L 3O2WH 3MRDA 4PJ9C 4OFPA 1DANU 1T7VA 4KGJA 5C9KA 1AXIB 2W0FB 1JRHL 3NFNA 5JW3H 4U2ZA 2XICA 5ENWA 1BMGA 3W9EB 5HD8D 1LO0L 2WM0A 3KLAA 3WD5H 2BC4B 3QULB 3MV01 3C9NA 3VCLA 1WC7A 4LCIH 2A73B 4ONFH 1I3UA 3OJ2C 2AEQH 3CUPB 3BSZH 4PJFB 1D5XB 1PKQE 1G1CA 1CDGA 2CUHA 1NGYB 2NW2A 1VFAB 4ELME 4OLVL 4FQQB 3ARUA 1N0LA 4G42B 2CDFB 1PY4A 5D7SL 1G7IB 5IBLC 1X5FA 3MJ9H 4JDVA 1DJSA 3BKYH 2PYEB 3B2VH 1RAMA 3CDGB 3HE6C 3MRLB 1J12A 4IMKA 4YE4L 4X7TA 2EICA 5FHAH 5ETUA 1DQJA 4MJIB 1OP3K 1I85A 1DL7L 3EOBA 3QUMB 3SDXF 4OT1L 3GJFH 1XGRB 2XZAH 4HZLB 3HZVA 2UVEA 4ZTOH 5B3NA 1JGEB 2EIZB 3G9VA 1J18A 3EYFB 4HWNA 4D8PA 2W9DL 2A2QT 4M5YL 3CIQA 4OIAA 4PJ8D 1KG0B 1C12B 1MRDH 1CXHA 4PJEB 1GOFA 4RIRA 1CL7H 1AGDB 5FFLA 3QIUB 5FUOH 2AK4D 2IH1B 4MJ4A 3WE6B 4K71C 1DFBH 5EOTA 3ULUL 4I5BA 3BHBB 1YA5A 1OAUL 3UTQB 3X14B 3H3PH 5AG9A 2PW2A 5GIRA 3MBEB 4C58B 1T4KB 4P2QA 1IJ9A 1C8PA 2XN9E 2AVGA 1RZJC 2CK2A 2P5WD 2X70B 2IG2H 4O2EB 3C2AL 4P4KA 1OAUH 2ERJB 3GKWL 4X83A 1QBAA 4BZ1H 1CGXA 1CFSA 1I4FB 1UM5L 3IDXH 4DEPB 1SY6A 5M7QA 4OCWL 5E2JA 4TNVK 1D5MB 2CRZA 3RDTC 3FB5B 5SWZB 1BIIA 5GJTL 2X4UB 3ZTJH 4XCYB 1B2WH 4OCSL 4E42A 4XNQB 3HC3H 1CDBA 2WP3T 3P4NA 5TQ2L 2AK4E 3RVTC 3JTTB 2XXMB 5I1KL 4BZYA 1ZT4B 4LMQE 2H26A 2KDGA 2J5LB 2HKFH 3VI4E 1R24A 3QEHA 1M7DA 2BMKB 4MNHB 4CN1A 1F3JA 5GPRA 1I9EA 1Y18A 3B8SA 4YR6B 4O58L 4ZOAA 4YHYC 2Z31C 1T1WA 2R8SH 1TCRB 4ACPA 1KB5B 4C56B 1UWXH 2MPAL 5INDA 3MJ6A 4LSSH 1PKQB 2VXQL 3MRCA 2F19H 3O8XB 4HGWB 1T21A 3VXRA 5CBAB 5FEBA 2EH8L 4DVRL 5DI8A 2VWEE 2DQJL 2IPKA 2X4SA 4GW1B 5B38A 5KSBB 3E6FB 2Y72A 3CSYB 5EORL 3A67H 3ARFD 3X12A 1OGAA 1N0XH 1Z0NA 3VCLB 2UYLA 2P7TB 3ARDB 4WEBH 4DOHE 5LG1A 3QPXH 4PJFA 1V7NL 3MROB 1CK0H 5F9OL 4XBGB 1FCGA 3BJ91 4DVBA 2DQCH 5IOPA 2DQFA 2R4SH 1AD9A 4MNQD 3PABA 5E2WH 3C8HA 1W8NA 5KOMC 2GYSA 3PP3H 3TFKC 2BXYA 2Y5EA 5IMMA 2GJ6D 5C86A 3X3FL 3BPNC 3LKQA 1F00I 3WYRA 1JFQL 1CT8A 1KNOA 1X5HA 4OZGA 2DL2A 3RI5F 2RAMA 4JFDB 1IGFH 3TYGH 4R7DA 3LKRA 3V95A 2F5BH 3HRPA 4J12A 3C5ZA 1U8PB 3TM6A 3EYSH 4ZTPH 1OTUC 1CXEA 1DR9A 1G7PA 4P5KA 5T3ZD 1KEGL 4AG4H 5IB2A 1MCWM 5DO2D 2HJKB 4QEGA 3WO3B 1MVUA 4QTIL 2R69L 3QG7L 4U3XA 3FQTA 3BQUC 4NFCA 4OM0H 5FXCH 4DTGH 1W0WB 4FQXB 4PRHD 3U4EB 4DKDC 2V2XA 3WIFA 4AL8L 2JF1A 2X4RB 3IFPB 2Y25A 3FQTB 4BH7B 1LEGA 1DANT 1TZGH 1A6VH 5C7XL 3WHXB 4E41B 2R0WH 5BXFB 4MDIA 3RVUD 2AK4B 4KRLB 3TVMA 1QFWM 3OF6A 4WEUD 2XG5A 4P2OC 1D6VL 4NM4L 4YFEA 2X9WA 5MEQB 1A14H 4PGBA 1YNKH 1T1ZA 1MAMH 3GM0A 4D2NA 4YGVB 4G8GB 1S9KC 2WWKT 1MREL 4RCAA 4XAKE 3ULUF 4HWEH 1HNGA 5DK3A 2PUQT 5D7LE 4NNYB 2BP3A 5F70A 3P11H 1DLFH 3MLUH 1CLZH 1U58A 3ULVH 3MV8B 3QPXL 1MSPA 3FN9A 1BOYA 2DJSA 1NGZB 2DJ4A 5DJDA 3S4SG 4GUPA 3WBDA 4HZLA 2BNUA 4R7NB 3ALXA 2QSVA 4E0RA 3WKNA 4NT6A 5HHMD 4ZUTA 1FSKB 5L88L 2NY1B 1FAIL 2JJWA 4DGYH 1XZ0A 3HAEA 4GRLC 3G5YA 1GGTA 1R3HB 4BSVA 1UQSA 3FRPG 3QAZC 4MB5A 5CD3B 3T0WA 3RGVA 5EIIB 1LP9E 4UNVA 4NIKB 4M6ML 4X9IA 2HFEA 3SDDC 2DICA 3QFDA 3C08H 3OZ9L 4MXWL 2YA2A 2OK0H 4PJFE 3QUYA 5L7XL 2DAVA 5HPMB 1L8JA 1OP5K 3QXAA 1W72A 2VDML 1KYOJ 3QNXB 2ZPKL 1AH1A 1TTFA 1ZA6B 3LS4H 5HSFA 4BFIB 1GC1L 4G43B 5IJVB 1HXMA 3D5OF 2Z92B 1JCKA 4JFEB 4UQ3A 4ZFFB 1HI6B 1SYSB 3VXMA 1JFMA 3MLTB 5BZWA 4S10A 2FWOB 2G75A 3DPBA 4JO2L 3EYFA 4XNQA 4OCWH 1QTYT 3CU7A 3GBNL 2DQFB 3MX0A 1C5CH 1WIOA 3MFFA 1P7KB 1E0OB 1VKXB 4G6ML 2PXYD 3DX9B 1V3MA 3OJDA 1YEFH 2NY3C 4ZPVB 3VFSB 3JUYA 3GSRA 4QOKB 4NO5A 2FB4L 1UB6A 1CICD 1WBZA 1IGJB 2DLEA 5AEAA 3FQUB 3HNVL 4QF1A 3SDCA 3EO1A 5TPWH 5EZIH 3NCYP 1MI5B 1HCVA 3KPRA 2IAMD 3S98A 1KB9K 2PNDA 2N1KA 5F7WC 1MLBB 4F58H 1QR1B 3VXSB 5GSVB 1CFSB 1Q1JH 1YY9D 2AGJH 3IJHB 4Z7WE 4M7JH 3WFEH 1FYHB 3EOTH 4N5EA 2B1HH 1T6WA 1FO0L 4IOIA 1Q94A 4U1NB 5SV4A 1T22B 1LD9A 3F12B 2K1MA 4I3RH 4IBLT 5BRZA 1H8SA 3EIFA 3VXSD 2G5BA 3P30H 4J4PA 5IFHH 3LHPH 4QT5A 3KR3H 3CLEH 4KI5D 3ARBB 1IEBB 4IMKC 4P5TA 3RUGA 3WSQL 4FFEX 1RZGB 4YR6A 2VLLA 4KZEL 3RWJB 1ROWA 4AENB 1MHPL 4HC1H 1A1MB 2ZWLT 3MRLA 1P1ZB 2X4OA 3MGOB 1C5BL 4JQIH 4PB9H 5I8CB 5JTWA 2A0LD 4F9LA 2LVCA 2OL3L 3T4YB 4X0KA 3KYKH 3BQUD 4ZFGH 4L8SB 1FNLA 4MA3B 1BPVA 3QDJA 4I0PB 4M48H 3MV9D 3DUUA 3TESA 4LU5H 1Z3GL 4S1QL 5HVFB 2O5YL 5C2BH 1OAXL 4HJJL 1G9ML 1EXUB 1N64L 4Y1AD 3NIFF 1FJ1B 5EOCH 5C8JB 1MCQA 4K3DL 3RU8L 4BH8A 3UTQA 3X14A 4JFXA 4GAGL 3LSOA 4OD3L 1AHWC 2H32H 2Q76A 3NIDE 4XCFL 4JFXB 2F54B 5CKGA 1GOHA 4XCCH 1MWAL 3QDME 4HUKB 4PUBH 4NRXA 4OF0A 4MAUL 3NA9H 3CAFA 4M7JL 4XGZA 1XF3A 2JELL 3FB8B 1JGLL 1TVHA 2ORBH 4N8VG 5I15L 2NY6D 2EO9A 1JGUL 1D5ZA 5GRUL 4X6FA 5HHXL 4W6XB 1SYVB 1VB9A 4QRSA 3Q1SH 3WNOA 5CUSL 1FAKT 2F15A 4LSQL 1M4KA 3BVNA 4XBPB 1FSKC 2UUDK 1JHLH 3N06B 2F5AL 4M4PA 1VEPA 3SGKC 1K2DA 1YEEL 2VIRB 4GRLD 4K7FA 1OPGL 1V3JA 5FYKE 5I1EL 3ARYA 1MVFA 4L9LC 4B41A 1A6UL 2OCFD 2NW3A 6FABL 1FYTD 3UYRH 1XF2B 1FO0A 1AGEA 4YHML 1T4KA 4P2QB 3VFVB 4F7MB 4BSWB 3GFUA 3I3DA 3PDDA 4P9HH 3UJTH 3REVB 2FJFA 1MCKA 3ARZA 5B8CC 2NTSP 2YXMA 5H94A 1PJ9A 5CEZE 3UTPD 1GYAA 4LCUA 3O11A 5SWZD 4EN3B 4LCWE 5SWQA 2PW1B 4IDJL 1C1EL 4KJQC 1L7IH 1MCOH 1W72B 3QNXA 4Y5XA 2WLZA 5DMGC 5JUEL 5F9WB 4YLQT 4FQLL 3E3QC 5EUOF 1HH9A 4JRXB 4X4XB 1ZLWK 5BQ7B 5TQ0H 1YY8A 3MV8E 4XNMA 4PJXF 1FIGH 2R2BB 1GC1C 3BP4A 4U1KA 2R0KH 2DM4A 2XZQL 4UBDC 3IU4H 2W59A 4Y4FA 4OZGE 1CG9A 1NGXA 2BERA 4XP4H 4HCRA 2N7AA 1AI1L 4PV8A 4ONHA 1VPOL 1T1YB 2BOBA 5EOTB 1VKXA 3QDGB 5C0RH 1FFNB 2IH3A 4G9DB 1QG3A 3CFDA 3VW3H 1FG2B 4W4NA 1GGIL 1NMAL 5DI8B 5C08D 1ZVYA 4HV8B 5D7KD 1R3IL 2WUCH 2DQTH 4KK5D 3K8KA 1X7QB 3ZKXB 4DKEL 4WU7A 1RZKL 3QDMB 1V7MH 2OJEB 4HW6A 3QWOA 1BFOA 1B4JH 4LEXL 1YNKL 2UVFA 3ET9F 4ZUWA 1IGIL 1J5OH 4LBEA 4RGNC 3QWOB 1KJ2L 3RY6A 4JREB 3W82A 1N6QL 3ARED 3UCRA 4WI4A 1TJHH 3MRBB 4EUPB 2Y1VA 1VADA 4EDWL 2V5RA 4NHCL 3LN4B 5GGSB 1XCTB 3RI5K 1MHCA 4KI5C 4KKAD 2P8LB 3F12A 4K71B 4GKSB 2VLMD 1Z9LA 1XF4B 2ZUXA 3CDCA 4V1DD 2Q8BL 3BKJH 1ZTXL 5KW9L 5E03A 3OKKA 5ITFB 3SJVB 4PP2A 1QBBA 4OFDA 5IM7A 5DVLA 5EWIH 5T3XD 1LO5B 4FQ1L 5E8NB 5CZVH 5KANI 1U8IB 4WUUE 1JZ6A 3ZT7A 2XQYK 3QQ3B 1LO5A 4XTRC 1D9KB 3VG0L 1X6LA 1F6FB 4KVCL 3IRPX 5C9JA 1FQ9C 1W8OA 3T4AA 1RD6A 1FORH 5DJDB 3U7YH 2LAAA 2YC1A 4PFEA 4G7YH 2V7NA 4CVZB 4BYHA 1NAKL 4ELMF 1MI5E 1MEXH 1NBQA 2BC4A 3SY0B 4UTAL 2UZXB 2YPVH 1NEUA 4I3SH 2FO1A 4G6KH 1T03H 3NFNB 3G5XB 3VXSE 1EFXD 3CFJA 3GUTA 2EDRA 2HA1A 1XIWA 3SKJH 3GMMA 4PGCA 5FHBL 3EO0A 3W5MA 5E4EC 1CN4A 3TGXA 3THMH 2R1YA 4DVBB 5KSAB 3EFDL 4BH8B 2GJZB 1PYWB 5FGRA 1M7IA 3JWOH 3SGEI 3GGWA 4HPYH 1CFTB 4Z7WF 3HE7C 3VXTA 2FJGB 5K59E 2ADFH 2FHBA 2B0SL 2AERT 1CGTA 2JB5H 2JK5A 3CU1A 4NO0A 4TN9A 1KPRA 1WCBB 4G5ZL 4HGKC 3HFMH 4G8FB 5F89B 4AMKH 3SCMD 4ZSOA 2VXQH 5FYKL 4UOJA 5I19H 3VFTA 3K1KC 3H2WA 1KJ2B 1A2YA 3DVGB 3QCUH 4MSWB 4PJ9D 4UINH 4WFEE 2PF6A 4WO4A 4JG1L 4HF5L 2UY7A 4KROD 3VFWB 2MSPA 2VRAA 1JHKL 3PXJA 5IESH 2XFXB 4OGXL 4PJBA 1G7HA 4M1GL 4ZFOA 5J56B 5TE4H 4XVSL 3QQNA 2X1QA 3FO2B 2HJLB 2EDLA 2AV7B 4FP8L 3TO4D 3NZ8B 3TLRA 1FL6B 4DKFL 3TN0D 4WWKC 1BF8A 4Z7UB 2Q76B 3QT2A 3LIZH 2UUDH 4R4FH 1FN4B 3PV6A 3O6FC 5IVXA 1QFUH 1RZFL 3CVIH 3WJLC 5E6IB 3LQZB 4NPYA 5DJZB 1X5AA 5DZLA 3S96B 5E6YA 2V2WA 3GSNH 5IB5A 1NH6A 3KNBA 5K9JL 4FN0A 3S97C 1JMXA 1OB1A 3QUZD 1QQDA 3UPAA 2A6DA 1DEDA 4PRIE 2VXVL 4MAYC 1Q9LA 4JY6B 2VR4A 3O9WD 4R26L 3QSKB 3B9KB 4MJID 3RUGE 5KSVA 4D3CH 4PJIE 5IW1B 2RHEA 2WBKA 2XWBB 3DGGB 1H5BC 4PJ5D 1MIMH 1LDPL 2AAVA 4JFFB 3V0WL 3IVKB 4KUCF 1NANH 2BVQA 1WQVT 1T83A 4WVRA 4KJWC 5E7FA 4AM0B 2IBGA 1EUTA 2P43B 2R56L 5C2BL 4O4YL 2ZG2A 5D7LD 4Y4HC 5F7DA 1WISA 2W07A 3EFDH 2C1PB 4P23B 1DEEB 3SE9H 3MRDB 4ZYKA 1UA6H 3GBLA 3RVWC 1DQQB 2NY6B 1NFDB 3BOVA 5D1ZC 4RMWA 4I13B 3DO7A 1A6WH 1YEKH 3A67L 1BD2A 4DKEH 3HB3C 2AEPL 3PWJA 5MI0C 1FE8L 3BKCH 4ODTH 4PJ5E 3SDAB 4YIQB 3QA3B 3WS3A 3JV5A 4RGMC 4MJIE 4ZQKB 2XWTA 5TDOA 3PGDA 3UEZA 3SDAA 1TENA 4YGAB 2DQHL 2HWZL 3RVVD 5L2KA 2DQEL 5DC0A 4LKXA 2FDBP 1OQOA 2G2RA 4RNRB 1AD0A 2GITA 4LEOA 1I1AA 3SJVA 3KLSA 3GMLA 1ZTXH 4LAJH 4KVNL 1T5XA 3VXOB 4GH7B 1OTTD 4YHIA 5HHOE 4QHNA 3KLDA 1T5XB 3VXOA 4JM4H 2MCPH 4PJ8B 4RMTA 5CKAA 1PY9A 3H8NA 4D8PB 5IVZA 4PJ8A 7FABH 3DUSA 1QFWI 1MJ7L 1HWGB 3ZKNC 3ARFC 3HLAB 3OR7A 3GDBA 4NCC1 2DQUL 5HI3C 2D7MA 4XC3L 4U1NA 3FZUC 4JM4L 5HHQB 1UCBH 2W9EL 2NW3B 3D25B 1FVCA 3V0VA 1RZKC 5DD5L 5DMJB 5IQ7H 1QVOA 2VTFA 3WL9A 2HFTA 1BFVH 4GKNA 5CGYC 3CK0L 4RWYL 2YUWA 2UV3A 1RURH 2V7HA 3O3AA 4D0CA 3ARDD 4A6YB 1FZOB 1DVFC 1QSED 3E6HB 2DLGA 5KSAD 1MIML 4IRSC 3FO9A 4OZFH 4A6YA 5F3HA 3NZHH 1GJIA 3P0VH 1OSPH 2OXHA 4WTXA 2R23B 2FR4A 3BN3B 3KJ4C 2EDHA 2R9HD 1MCEA 5F8RC 4UU9B 3N50A 1T0PB 5K33A 1K9TA 2NY2D 1TZHA 3U0TA 2XA3A 1JYWA 4KMQA 1OT2A 3GSOB 3QUZB 4YHKL 3F7VA 1EEQA 3S4SA 1UXSA 1EAJA 2OMNA 4MXWH 4G6AC 4UTBH 3S3PA 3BGMB 4K7PL 3TO4C 3H3KA 5D8JL 3DI3B 4RMRA 4LRNL 5IBTL 5EB9A 4F7MA 3SQOL 3NPZB 1JF1A 4RRPG 5F6IB 1A0QH 4AM0A 3W9DA 4JPIB 4F80A 4G9DA 4WHYH 4XPGL 3MBXL 4G6JL 2EC9T 3LSOB 2VLJD 3ZKXC 4H20L 2AS5M 4XVSH 3SGDH 1FNAA 4KHTL 3ROLB 5IROC 4QTHB 2X9XA 3ZDYF 3PWUA 4ELMA 3MACL 5IBTH 1A6TB 1NEZG 1I7ZA 2QEJA 5IT2L 3WFHA 5F7EL 4HIIB 3OJVC 3PWUB 2AI0H 2P47B 3ZZ1A 4ELMB 3HZYB 3PV6B 4ZXBD 5JR1L 2OJZL 1MHEB 4NQDA 5TF1H 4DOHB 4LP5A 4EUPH 1RIHH 1UADC 3OAZK 3PWJB 4I77H 2ZUTA 1FGNH 4X6FB 3MMEB 1BBDL 4FOMA 5I1HH 1N6UA 4L4VB 4YIQA 3WIHA 3RVTD 5E24E 3QEQD 1CD0A 3BFOA 3BP4B 4U1KB 2XKUA 2Q6WA 1SJHB 4DZ8A 4BSJA 2EDJA 4JQXC 3CLFH 4P99A 2EDBA 1SJVA 3OKDB 4X4YA 1LP9F 3ERYA 4BM7A 1G7HB 4U1JA 1U8NA 1A7OL 5FA3A 5E70A 3WNKA 1NLBH 2FHFA 1OSPL 3BUYB 3BDXA 3RJQB 3W5NA 5D1XC 4UZGA 2HJLA 2VZUA 4ZFZA 4HKBB 1A6VL 1BVKA 2OR9H 1FL5B 5BCAA 4K9EH 1MFCH 3K7UA 3CK0H 1N3NA 4P46D 1QR1A 2FJFB 3KYMB 1EBAA 1T7YA 4ZO6A 5GRVK 4NC1E 1HIMH 3KPRB 4GRWH 4PY7B 1GH7A 4PJBF 1XIWC 5HGAB 1S9WB 4MZ3A 3N1QC 1G0YR 3RWCB 1QHPA 5HHQA 4PS4H 1P4IL 1F5WA 3FT3A 1FNGB 5IW6B 4TRPL 1L0QA 2ZJSH 3OXSB 1JNLL 3TT1H 1C5BH 3D18B 4MNHA 3HE6A 4KKNA 1B3JA 4GW4B 5DMYA 3BZ4A 4G6FD 4F15B 4MD0B 2ADJA 2DQCL 3OWEA 2QQLL 4XMPH 3NCYS 3REWA 1QOKA 1DBKH 4XAKD 3RL2A 4HEME 1XGYH 1CT8B 4P3WA 5HHOD 1EFXA 1UH3A 2OP4L 4Y16B 5C0AA 2FL5A 2J4WL 4H88L 4GMTH 4J3XA 2Z35A 4J1UB 4X6CF 4KTDL 1UM5H 4MA8L 2VLRA 1S7TA 2P48B 1YEDA 4OF7A 5CEYA 1DQML 3DBXA 1YPZE 1U8QB 1YN6B 2ARJA 3IDNB 5FO7B 2WWMC 1C16B 4M4RA 1AXSB 3I6LD 3C60B 3MJ8A 3Q3GA 5BO1H 1KTRL 3O0RL 2LAGB 1P5UA 3RIFF 4KK8D 3ETBF 1LHZA 2R1YB 5C0CD 2DWEB 4PBVC 1J88A 4PJ5B 2DIBA 3RQ3A 1WWBX 3KPQA 4P2RA 3ZDZE 4KKCD 4XGZB 5IVXE 2CKNA 5E0QA 3TPUB 5EO1B 1XGTA 1QKZL 1BLNB 4I48B 2VH5L 1KC5L 3G9AB 3O3EA 3QI9B 3OF6D 3V5HB 4NZTH 3IF1A 4LIQE 5EO1A 4UDUB 2P1YA 4JM2A 12E8H 1M1SA 1S3KL 3QUMA 4ZO9A 3C09C 4LLWA 4C59B 4UQ3B 4M7ZC 2V5SA 4GRWF 2AXFA 3K2UL 1F6LL 3WLBB 5EU5A 1U3JA 3MJGX 4X98B 5CFHA 5HHOB 2ITCA 3B4NA 3GHEL 4QRPE 5I16B 2EDYA 1CICC 2XWBA 2DTMH 4R97C 5DD6B 3PWLB 4LRIC 3ARPA 2QR0A 1Y6NR 2V2XB 3WIFB 4KQ4L 5JIPA 3DI2B 2ZOKB 4AH2B 2F58L 5SWSB 2A77L 4LVOB 3FCTA 5DQJA 3WHE1 1G7QA 1KIPA 2X70A 4JZOA 4JPIA 4F37K 1VFAA 1IKFH 4OLYH 3T0VA 3O6KL 1CL7I 1JRHH 3NPSB 1LE5B 4FP8H 1AGCB 3NTCL 3WIIL 5IIEA 4PY7A 5CGYD 1NFDA 2M1KA 5D2LB 3KNBB 1M6OA 3KPLB 4A2MA 1ZHNB 4HDIA 1N2RA 4R90H 3SDAC 2BRRH 1EHNA 4OUOA 4C83B 1VACB 4WY7L 4O51B 3KLHC 3CFCH 2VAAB 4NKMA 2Q7YB 4YBLB 3TO4B 1J1PL 1IT9L 2FZ3A 2KZ1B 4DWHA 1A7RL 1HHIA 4GW4A 4WFED 4OF6A 4M1CC 2IH3B 2HP4A 2YUZA 3VH8B 2PTVA 4NYLB 5IMKA 5MERA 2FBJH 1FG2A 4GXUM 4L3CA 3MOAH 2EIBA 3HNTH 4P46C 4Z76A 5I2IA 3P9MA 4XP6L 5F1OB 5ADOL 4EXPX 1QSZA 4OJFH 3G6AB 4WUUD 3JVGC 4N8CH 2BVPA 5GXBB 2O5XH 5D2NC 2BVPB 1I7ZB 4F8QA 3B9KD 1XR8A 1MFDH 4K2UL 4Z18A 1WGOA 1UACL 2D4DA 3HC0B 3IKKA 5D5MA 2MTPA 4PJAB 4KJQD 5D72H 5FM4A 1MCIA 5EFIA 4FTVB 3DTXA 3GRWA 4XVTL 2OTWA 5FB8A 3GKWH 3IGAB 3DX6A 5HHXH 1C7TA 1U8KB 2Z4QA 1U8HA 1FJ1A 1DVFA 4DZ8B 4HHAA 4GKSA 4XNXL 3EDJA 2E27H 3TCLB 3INUH 3NGBC 1Q38A 5DD3H 2QSCL 1NLDH 3QEHB 1A9BB 5GS0L 4JZJC 5IBUG 3FJTA 2XNAA 3WUWG 4OKVA 3DVIA 2QTEA 3HE6B 3AFLA 1IC7H 4NKIH 4V1DB 3MBEC 3K74B 1D9KA 1DQDL 3P30L 3EZ8A 3IJSB 1TMCB 4F3FB 4P5TD 3U36B 3BIKB 3GMPA 2VDRH 2DTSA 5CJQH 4CADA 1A8JH 5IG7B 2YC1B 1FVEA 4TTDC 5GJTH 4N8VA 3OKEA 4LVHB 3RDTB 3LEVL 5HI5D 4K3GA 1KXTB 1RUAL 4DQOH 1Q9KA 2SEBB 4WJ5B 2L7JA 3CZJA 2PTTA 5J1SC 1I9JH 4XC1L 3V5KA 1NKOA 1Q9OB 1T5WB 1INEL 4GS7B 1J0HA 3QDAA 3VXRE 4S1RL 4UUJA 5JIKA 2XI9A 3WKMH 1EXUA 2O5ZL 2IBBA 1N26A 2YRLA 3MLRL 4JPWH 1NMBH 4G8GA 3PGFH 4PD4K 1FNSH 2X4QA 3KPQB 1L9NA 3KJ6L 3WFCL 3MV11 3DETD 3DRQB 1I8LA 1OAKH 2DQGL 1UH4A 3ZL4H 2Y06H 3GMLB 3BRDA 1BQHB 4LIQH 3FRUA 4J2XA 1U8LB 3SO5A 1EO8H 1X3DA 1YQVH 2QHRL 4HEPG 2I9TA 4X6DF 1E27A 3RWFB 4JG0H 1FO0H 3VFWA 3CH1A 3S5LB 3EDDA 1GPOH 4YWGH 3ULVF 4UOW1 4HS6A 3RWIB 3LKPB 2YUVA 5CEYB 5JPMA 5EBMB 1ED3B 4ZUUB 3RBGA 1U8QA 1YN6A 2ARJB 3VGHA 4KI5F 1E4XI 3BWAA 3E8UL 5EBMA 3H9ZA 5HGGS 3VXUA 5DC9B 4HT1L 2VWEC 3LRGA 1RUMH 5D5ME 1YPZB 2IMNA 3RKDC 4Z5RB 5EULV 2G5RA 2NY5H 2Q7NA 3L3OB 4WW2B 4H1LA 5J4MA 1OD7A 5EBLB 3WFZA 1CS6A 4S11A 4RFOL 5IHUL 2J2ZA 1A6UH 3MRPB 5E8PB 4NRXB 1HOCB 2LE9A 3IXAB 1NC4B 5BVPH 3QDMA 3QI9A 3FQWA 3O3EB 1TTGA 1KCUL 3QH3A 2IEPA 5EU6E 1PG7L 4MCYA 4ZUWB 3U82B 3T3PE 1SJHA 4UV7L 4JFDD 1RV6X 3E3QA 3H7LA 3WIHL 1A1OB 2PCPB 2ID5A 2X41A 3L3HB 1QFHA 1K8DA 3ILPA 3P4NB 4F57H 3OXSA 1PG7X 4JFFA 2XQBL 3BD5A 2KKQA 3K8LA 3QUKA 1GZPA 4YK4B 1I7UB 1UT9A 5DYOA 1Q0XH 3A6CL 5E4IA 4QHKJ 3QEGH 5E8NA 4QF1B 3MSPA 1OCWL 5ECJE 3G5YB 5C0AE 3W9DB 5GRXG 1HHKB 5T5FH 4NYLA 2MQ3A 4I18A 4EIZC 4O2FA 3GSXA 3ROLA 1NQBA 1PKQA 1NMCB 2VLRB 1CD1B 2Y5TB 1DEEA 2YKLL 3O11B 1DN0A 3QXAB 4X99B 2YWZA 4ODUB 5CWSB 4FQXC 4EI5A 1XGPB 3KLAB 1Q9KB 3SKUD 3QIBC 1U3HD 3QUZC 4DGIH 3GUTB 3PHSA 1AHWA 5KSBF 3F8UB 3BDBA 1RJCA 4Y1AE 4MVBC 1R3JA 3QIWB 5I1IL 3V5KB 5IW6A 1KLUA 2E7BA 5EOQH 5I30L 1JBJA 1PZUB 1BOGA 4FQPA 4YXKH 3EJZD 3P40A 3DX6B 5J13C 3O6LH 4AYFA 4NBXB 2G2RB 3OKDA 3QEQE 1A6ZA 2CKBL 4XBGA 1K6QH 4P2RB 3X3FH 2B2XH 3D2UD 3MBED 4JRXE 5I73C 2FGWL 5IV2A 2CGRH 4KDWA 2FJGA 2R29H 5DVMA 3T2PA 1U91B 3KPNB 1T1YA 2BOBB 3GSRB 1LNUB 1A7PH 1OLLA 2CH8A 2OTPA 5C0IB 4LGRB 1RJLA 1IGJA 2NX5B 1GZQA 3MA9L 2EDWA 4Y19A 4Z0XB 4X6EA 4X0KB 3TBVB 3I6GB 5D7JD 5F7YC 1PX3A 4FG6C 4GAYB 2DL9A 2J3SA 3MRQB 2WANA 4DVRH 4WGVB 5BW7A 3L5JA 5IB4A 4WWKD 5DHYB 2F19L 3MOAL 4K3HA 5DD1H 3B5TA 1CVRA 1HZHH 3MLZL 5I9QC 4F58L 1DBMH 4XNUL 5GQBA 5EU6A 2EXYC 5J11C 1FNGA 2NXZB 3QHZL 3BZFA 2FCBA 3D48R 3OAUL 3MRRA 4UQ2A 1YNTA 5KZCD 3BWUC 3VGBA 3ULVE 3EZJB 3AB0B 1EGJL 8FABB 4JFFE 3FO0H 4L4TD 4DUXA 4EEEA 5CLWA 2NNAB 3T8XA 2YPKA 1ZHBB 4TVPL 3SCMC 4N1HB 1WFUA 2OL3B 4R0LC 1NANI 2IGFL 4ODHH 1ERNA 1KPRB 3EGSB 3PWVB 3IT8D 1QQDB 4TVSa 4G8FA 2QLVB 2E5EA 1RUPH 1CFBA 3VFMA 2HLAB 4YBLC 3T09A 2CR3A 3KS0J 3WN5C 2B7DT 5LGKA 4WTWA 4QOKD 1T80A 3QHFL 3G5VA 5GGRY 2WIIB 1LGVA 5GJSL 3B9VA 1S7SB 4NGHH 3RKDD 3F7VB 3C9NB 1I7TA 1FFPA 3HMXL 3MLXH 4DCQA 4TYUA 2Z93A 3FB6A 3MJ7A 2GT9B 1KB5A 3TF7C 2DTML 5KANG 4LSRL 3EYVB 1UYWL 4JY5H 2HVKA 3HZMA 4Y1AA 2Q3AA 1KFAH 5HPMA 4HIJB 1UJ3A 2X4NA 5I1AA 3TNNB 3NCJL 3KPLA 5ESVB 2ZSVB 3CSYA 3H42H 4GBXD 1MCLA 4PJEF 3BAEH 1IAIL 4HS3A 3KPOB 4OZ4B 1JTPA 5I1KH 3I2CL 4OLUL 4P9MH 5FYJH 4HMDA 5CINL 3RAJH 1JYNA 5I0ZA 3CDYA 1YEGH 4D9LL 5JPMB 2P8MB 4JQVC 2H9GB 4JFDE 2XNAB 3PWLA 5ALBH 2ZUUA 1VFMA 2APXA 4QOKA 3BE1L 2W91A 3UTSE 5DUPL 2XPGB 5TJWK 1HWHB 4LASL 1X4ZA 5DD0L 3C6LC 3HKFA 5AD0A 2A9NH 3ARGD 3ZKND 5DSCA 3N1GC 4FXKA 1B4RA 1HHJB 3TBVA 1FFOB 3DMMC 4UV4L 4GRMA 5EBWB 3BPLB 3IXAA 5GS2H 3BDYL 1KJVB 1NCUA 1F3DH 2QQKH 1FLTX 3HB3D 4G80B 2OLDA 1LDSA 1QA9B 1GGCL 1TCMA 5DJXB 3IDIB 2C3WA 3L3IB 1J86A 3WDIA 4XMPL 1PQZB 3DX7B 3GO1L 4F33A 1CBVH 4OQTL 35C8L 4HCRL 4OF8A 1BQLH 4PRIA 2YMXH 3QJFA 1ZGLB 1Z9MA 2X1OA 2RGSA 4G8GE 1QSEA 5HHVH 1I8LC 3WNLA 2W60B 2W0PA 5GGUB 3NAAH 2C9AA 2WK2A 1A7NL 5J3HC 5CS7A 3RUGB 4JDZA 2MCG1 3T3ME 5JXAL 1JHTA 1NC2A 1XMWA 5B4MC 4NC0B 3RWHB 4JN2B 4G8IB 4LSDA 2EDEA 5C0AB 1T21B 1UKQA 4O2FB 4APQB 4YHIB 4ZDHA 2AEIT 4PREB 2CIIA 1J05B 4G8IA 1AIFA 2IAND 4N9GB 2R2HB 2YD6A 5GGTA 5GGVY 3DUUB 1JGVH 3DXAE 2AJVL 4KZDH 2Y4SA 2AJ3B 3ZTNL 5IGXL 1BD2E 5DRNA 4RSVA 5LWYL 1EJOL 1JTOA 3NABL 4PGEA 3WHE0 4W6WB 1YQ2A 1UENA 5T1KB 1N8ZA 2A9MH 3UTTE 5DHVH 5I76A 3QUML 3UBXA 2EH7H 3WUWB 3TPUA 1SMAA 1OP9A 4IRSD 2EECA 5AYUH 1U3YA 1KCVH 2W0KA 2YN5A 3OKKB 5ITFA 2WNGA 5E9DA 4HUVA 5ESVA 2YXFA 3GSVA 5H2BB 4PGDA 5I1DA 2H8PB 1RHFA 1YC7A 4KJPC 5F9WC 8FABA 5HYSA 4RFNB 2ZUQC 5C1MB 5DK0A 4PG2C 3FQNA 1S3KH 3GO1H 2J7LA 4KTEH 1I8KB 1ACYL 4F9PC 4N5ED 4GBXB 4LLWB 1ZLSH 2A83A 1UGNA 4OFIA 2NX5E 4M6OH 2HT4C 4KHTH 2IF7A 3EOTL 4YXHL 3ALPA 1WIUA 3KPRE 4X98A 5DJ6A 3KPRD 4GO6B 1IVLA 1RZ8A 3ILQC 1RULH 1WSST 3OAYH 4MQXD 3IDXL 1OY3B 3G5VB 1A7PL 4NKQB 1VCAA 2R2EB 2VNCA 4KK8C 4I18C 3VFVA 2WZPD 5DK2B 3EFFA 3RY4A 2KZWA 1K4CB 1ZWIA 3O0RH 5SX4H 4E41A 1JGDB 2Z93B 2YD9A 3W0WD 1FO0B 2OBGA 4JO4L 3WXVL 3V7AE 5DS8B 4JCMA 2CRMA 4G42A 2KQMA 4QRRD 3A6BH 2I24N 5HVGB 4TUJB 1B0WA 3B6SA 3WFDH 2XTLA 3VXSA 4JHAL 4QTHA 5MP6L 3B6SB 4OLZL 5LCVH 3W0WE 4JO3H 4LCCA 2VERN 4KRPD 3DV4A 4JFOB 2OP4H 1SY6H 5I18H 12E8L 4Y5XB 3LPFA 5J9PA 5HYJE 4JKWA 3D1MC 1KCUH 3L3JB 3WFDL 4K3JL 4QY8A 4OLUH 3JWNC 3D39B 3D0VA 4ZS7L 4ZAKC 4HFWA 4LSUL 4JRXA 4QT5B 1FPTL 3LQAH 4X4XA 3ES6B 5BQ7A 1KG0A 4P5TB 4WFFE 4X4YB 3QCVL 5IKCB 4RAVA 5J06A 3DXAA 1F8TH 5C0JB 3A6CH 4WIQA 2HJFA 4X6DB 5GGRA 2D4FA 1EFXB 1NPUA 3I85A 4I18B 5F1NA 1JUFA 3V0AC 3K8MA 3GSXB 4XNUH 3RNQB 1P5VA 4Y2DA 5FECA 4L4JA 3FO1A 2P4AB 1CDYA 4NWUL 5A2KH 4YO0A 2P5EB 4JVUA 2XZCL 3VWKA 4GAYA 3TPUE 3RNKA 2E7LE 1DSFL 2WIMA 5KBNC 3C87A 3SDAD 4EN3C 5DEGA 5HBBA 2GTZB 4L29A 4ZQKA 1OOAA 5DMGD 4XP1H 5DMIH 3QG6A 3GIZL 4NDMB 2B8OT 5GS0H 2P5ED 4KU1A 3ISWA 3PHQA 1ZEAL 5ID1B 2YPLB 1N6VA 3OB0H 4U2YA 3VJ6A 5ID0A 4P9HC 1YECH 3SKNB 4PBWD 1A6PA 4B7LA 4NUGL 1U8NB 5FA3B 1Y18B 1I9RH 1X5LA 4Y5VA 5ILTL 3FKUS 4NRZB 3RGVD 4PJEE 5B4MD 1EH9A 4EXKA 2Y6SD 4TRPH 3KHQA 5HYSB 5KJRH 1BVKB 4TULH 2CMRH 3F7RA 1OF2B 1RIUL 4RRPA 2A74B 5HDQH 4M93B 2X7LB 3PP4H 3UPCA 2PO6D 4FQJH 4XWGH 1S8DB 3Q6GH 5LVEA 4O4YH 2KUTA 1JPTL 1MELA 4G8GD 3MYJB 5F7UA 5SWSE 5C71A 3GMQB 5F1IA 1EMTH 3IDIA 3GHBH 3DBXB 3IDNA 1RUKL 2P7TA 2IADA 2OR8A 4E5XB 2NY7H 1E4XL 1KCKA 4UT7H 4YDKL 3WFCH 3D2UB 4LL9A 1QLFB 3VD7A 1LP9A 5HYEA 3W0WA 5IROA 1A4JB 3O6MH 4Y16D 3D2UA 1E6OH 2FEEI 3MRRB 4HWBH 2PTUA 2E3VA 3EO0B 2DRUA 3OV6A 5D2LE 3UBXB 1CFTA 4CMMB 5J6HA 1FNEB 2PR4H 5FGBC 5CEZL 3DRQA 4BZ2L 3LZFH 2VLLB 4YJZL 3DYMA 4C57C 4TUOA 4XPAL 1QD0A 3TA3A 4Z7OE 5K9JH 1MWAB 1YEHH 5JDJA 1MLCB 1HH6B 1RIVL 3VXME 1IGML 4R7DB 5L2KD 4PJHA 1JGUH 1VACA 4WEBL 1HQRA 2I27N 1ZANL 2C4FT 4PJHB 2NXYD 1IKFL 1MFDL 4K2UH 2AI0L 4HUUA 4Q7DA 4PJBB 1S9YB 1SJXA 4L8SA 3S34L 4JKMA 4U6HB 3HNSH 1WBYA 4RFEB 2Q3ZA 3L9RB 3QI9D 1RZJH 1NCAL 4I9WE 3FN0H 1CTNA 2DDQL 3QO0A 5L8KB 3QDGA 3WHXA 4LSPL 3LN9A 2DLFL 3RUGF 2CDGB 1C08B 2BNRD 1E6JH 4K7PH 3INUL 5ALCH 5HDBF 6CGTA 1WTLA 1FFOA 1J1PH 1UM4L 1FVDB 1IAOB 2VDLL 3QDJD 4Y5XC 4WFGD 5IVXB 4HFUL 4WW1A 4JKKA 4OCNC 5C3LD 3MLTA 5BZWB 3BAEL 4FXGB 3MRBA 4MS8C 3GJFA 1Q9WB 2COQA 3MTRA 5D6DA 3DVNB 1ZVHA 2A83B 3EJYC 3M17A 2FEDD 1GXEA 1MOEA 1Q9WA 2P8MA 4O51A 3SHSA 4LLMA 1JYXA 4TQEH 5FYLH 3SGJA 1LWRA 1EFQA 2J6EL 1F4WH 4GS7C 5I1JH 5KSVB 3ES6A 4P46A 4PY8I 5L0QC 3PXHA 5I1CL 1R3HA 4P2YA 1CDCA 1KIPB 1G7QB 5EIIA 3MXVH 2WINA 2ZCKH 3RZCA 2HKHH 2B1HL 2ICEB 3M8OH 5D2NA 5E7BA 2GFBB 3RL1B 3QUYB 2I5YL 2F8XC 2BOCB 1MJ7H 5E8EA 5C92A 5FA4A 5IMOA 1P84K 3QIBB 1A6TA 3CFCL 1EDQA 3MYZA 1QA9A 3NCBB 3UTOA 4EIGB 2IQAA 5LQBH 4NBYB 4LHUA 1SM3H 3KPOA 3MXVL 3S36H 3HMWH 1FV1A 1QSVA 2EDKA 3VXMB 4JPVL 5CJQL 3OG6B 2Q8BH 4UT6L 1EUUA 4PJHE 4KRPC 4JZJA 2OX5A 1IEBA 3QP3A 4L4TB 4Z8FH 4HHAB 1UXWB 5MENB 4PS4L 3D39E 1I1AB 2A77H 1D9KC 4XP9H 1A3LH 3B83A 3NACL 1DDHB 4KQ4H 4D94A 2E27L 1KUMA 5IQ9B 3S3SA 1TIUA 1UWGL 4LQ1A 5ITBL 1MCJA 4C4KO 3VD9A 1IQDA 1XR9B 1NFDF 2NX5A 4X6DE 4LARH 1VFBA 3CVIL 5HDBE 5E6ZA 3RHWF 1OLZA 2B39A 5IG7A 4NO2B 4WO4B 1CLOH 1TQBB 5FOJA 5T1LA 5D2LF 2OR9L 5JMRA 2EKSA 1DQLH 2F54D 4U6HA 1U3HC 2D31B 4MDJA 5MEPA 3BRGC 1TETH 3OR7B 3IFLL 3QXDA 2R2EA 4OFVA 4FQCH 4FFYL 1VADB 4JFEE 4HIHA 1EJ6A 5DRXB 1F58L 3H9SE 3HNTL 5E2TL 3FQXB 3PHOB 4KKLD 4KPHL 3RTQB 4QRTA 2B5IC 3TT3L 1OP3H 3MLYL 3V5HA 4M62L 1U9KA 4PRBA 3O41B 4HULB 3CFEA 1RFDL 1R0AH 5IHLB 4POZD 5BVJB 5SX5H 3EDEA 1U58B 4YHZH 4O00A 1VGEH 4LCCB 4X7SL 1IRAY 3FHAA 3BP7A 3R1GL 3P4OA 4NGHL 2HLAA 4R2GD 4PB0L 3BVNB 4XBPA 2A6KB 1ND0A 1Q9LB 1IAIM 1S7QA 3EGSA 3PWVA 4XPAH 2V7NB 4CVZA 2X10A 1KF9B 4P3DB 1GAFL 2FX7L 1B0RA 3T08A 3MRHA 1PEZA 2RFXB 2A1WH 4OGAD 1AXSA 2IFGA 4R4FL 5GRJL 5CHNA 2XYCA 4KDTC 4BSVB 4BUHA 5DRNB 2H32A 4UTBL 5C0JA 4IJ3C 3MV7B 4R97B 3ULUC 1G9NL 3RP1A 2EDQA 4DKFH 2AJUL 2X4NB 3PIQA 5F7DB 2H6PA 5CBAA 4ZO8A 2HVKB 3HZMB 3FHQA 4K7PX 3U1SH 4XVJH 5DVOA 4ZUSB 3SBWA 4EN3A 2O93L 3EOAB 4LSVH 3QXVA 4Y16C 4BFIA 1XF3B 4NN5C 1AR1C 4EI5D 2MFNA 1YY9C 4ODUA 3TNNA 1HOCA 4NZDA 1MLCA 4BK5A 2HVJA 2PO6A 4MYWB 2BK8A 2R9HC 3MXWH 2BNQD 4G43A 4ERSL 4FNLL 5K9OA 2WLYA 1TPXB 4BJLA 5BVPL 3Q5OA 3DHJA 4JVPA 5JR1H 4P2RE 4F7EB 3F6IA 1H0DB 1L6ZA 5ID0B 2FX9H 5B22A 3V52H 1AD9B 4CNIB 4NKOA 2VH5H 5DJ8B 4PTTB 1A4KA 1MCDA 1DBBH 2AABL 3U4BH 5J11B 3ESUF 5IV2B 1IC1A 1QRNB 4PRNB 3EFFB 4FQIH 3V4PL 4YHNB 5F71A 3UBXI 4LRNH 5DQJB 5EA0H 1H3GA 4ZPVA 2BJML 4I8DA 3H9SB 2CJUH 2P5EA 2VXSH 1VGKA 5T1LD 2V9TA 3T2OA 2XN9A 2CKBH 2EYTA 1UZ8B 2CKBB 1BFOB 4HUXA 4OZFG 1T04A 3O6LL 4GBXC 4KI5E 1MQKL 5IB4B 3DTXB 3PL6D 4V2CB 4QXGL 5CLTA 4YEEA 3H9SD 4NDMA 4I1NB 5CWSA 3HI6L 3LKNA 1GGUA 2XA8H 4LSTL 4KWUA 4FMFA 4MCZA 3SKNA 3M17B 3JTCA 2HFGL 4NUJB 1T22A 1SVCP 3FQXA 4L9DA 4PDCE 1OVZA 2ENYA 3KR3L 1MHHB 5HYJD 3QR2A 2V17H 4MD0A 3UXFA 3QISA 3DGGA 5GHWL 4CMHC 3KYNA 4PJCF 1CG9B 1NGXB 4PBXA 3U36A 5C0FA 3MCG1 4ZSOE 4GAJL 4IIQC 3STLA 4WW2F 1FVEB 5DT1H 3CGTA 4EDWH 5HHMA 3S8WA 2X4PB 4F7CA 4YXLL 4FFVD 5LKNA 2ICEA 1C1EH 1RJLB 2X89A 5A2JH 4P23A 2EDNA 4QYOB 1K3ZA 4YPGA 1MJUH 5B3JE 3B9AA 3T1FA 1MY7A 2CIIB 1NGPH 3OPZL 2IG2L 4AEEA 4HKJB 3S4SB 1S7TB 1XGPA 1RMFL 4FFZL 4MA8H 3LOWA 3ALWA 1KJMA 3O3BA 2UZIH 4ZNEA 3VGAB 1LDPH 5KOVC 3MGTA 1INDL 2D03H 1J0KA 3O4LE 3QXDB 4YDVA 2PXYA 4POYA 4K9EC 4PJXB 1AI1H 2NX5D 3AS2A 3MLVL 2EDXA 1JWMA 4NM8H 5L2JB 4PIRF 1ZLWH 3QEQA 4MX7A 3BZDA 3GSNB 5I1DB 3BMWA 4P2CG 2B1AH 2XKNB 4P0DA 3MNVB 5E9DB 3SOBL 2XY1A 4AIOA 3VGFA 3T8XB 5T5NG 1WBXB 3CH1B 2P24B 4KROB 2VDNL 2ITCB 4U3CA 2JELH 4XWOD 2B4CH 2A6KA 2HRPH 3SKOA 3ZT5A 2DIJA 1UYWH 4F2MB 4JFHE 4UBDD 4LSVL 4WI3A 4RFEA 1J8KA 3MZGB 2HTLC 5CP3H 4JDTH 4H20H 3TF7A 3DGCR 3V9FA 1IBGL 4HKZA 3OB0K 4XMLL 1FFPB 5A43C 3S88L 1ADQL 3BN9D 1A0QL 3UYRL 5DRWB 2YSSA 4LP4A 2HT3D 5I1EH 2BVUA 4RQQA 1QRKA 1AR1D 1QFWH 1QBLL 4EI5C 4GKZB 1IGYB 3KYKL 3QIBA 4KK5C 1M6OB 5CSZB 4JFYA 4QKXB 1BQHG 1CZ8L 4LHUB 3KXFA 2AJZA 4X7CC 4XCYA 1NJ9A 4F7TA 1KEMH 2C5DC 4JRYB 2R0ZH 1F11B 3O9WB 2FSEB 3RWGA 1U6AH 4P3CH 5F7NC 3GKZA 4HLZH 4JQXA 1TXKA 4Q58C 1NBVL 4WI2A 5J3HD 4Q6IA 5HHME 1N7MH 3L5HA 1P7HL 5FHBH 3JTSB 2BNQE 1PKOA 3GI9H 4L1DA 3LIZL 3MLSL 3TT3H 4PGJA 1AGDA 5MERB 4Z7NE 3DXAB 3H3BC 5IMKB 1IAII 5LAXA 1FRGH 4QXWA 1K85A 3IDMB 1KCRH 3GHBL 5F7KC 1KTLA 4I5BB 5GRVL 2MJWA 2X4OB 3T65A 5C6TH 5IKCA 2M2DA 5IQ7L 1F4WL 2Z31D 1I3RA 2AKRB 4LPXA 4FTVD 4PJXE 4X4ME 4BQ6A 1CD1A 4LU5L 1PD6A 4XXCA 1Q1JL 3I9GH 1IMHC 5EIQA 1T89A 3I50L 5T1LB 1RJYB 5F44A 1U3HB 1XR8B 3HHRB 1TNMA 1IGMH 2Z92A 3ZE0E 1JI1A 2X4UA 4TNWF 4MD4B 2W65B 2JJSA 4QNPF 5DFVC 5DVKA 4DN3H 2D2OA 3VJ6B 3LN5A 5JHLH 3ARBD 2K7QA 1BF2A 2NTFA 5IF0B 3NOIA 5SWSD 2V9QA 4Q6YA 3MRIB 4J6RH 3WSQH 4J3SA 4PP2B 3H9HA 4IRJD 5D1XB 4LOUC 1W72H 2XA8L 1P7KA 4LSTH 4R0LA 1CCZA 2WAHA 2YBRB 5I30H 3S36X 4JFDA 3DX9A 4Q9RL 4F3FA 4YFDB 4PJDF 4P4KC 2DQHH 2NY2B 4KQ3L 2CLRB 3MRNB 2ZOLB 4RWYH 1P4BL 3DJ9A 3J8F7 4H1LH 5F8QC 4S0UC 4HUMB 1BECA 1H3TA 4JG1H 4Z9KB 1U8OB 2HMID 1RU9L 2XN9B 1AXTH 1JIBA 4NQSA 3HLAA 4PPTA 3NCJH 5C0BA 3VXRD 3J7HA 3FOMB 4N90D 1MFBH 4WHYG 4YNYB 3G5XA 3O6FD 4AMKL 5IHZA 1ZLUH 5B39B 2VIRA 1CXKA 4K7FB 3SOBH 2R0ZL 3W0WB 2R8SL 4RZCB 4YDIL 1TVDA 5JXED 2VR5A 4GXVH 3BXNB 4XAWL 5D6CB 2QQLH 2X4TB 2BSED 3TYFA 4O58H 5HHNA 4MA1C 5DLML 2IADB 32C2A 3MROA 4QHMB 5CEZH 2X4TA 3WDJA 1B90A 3IYLW 1BEYH 4ZS7H 1A4JA 3H0TB 1VERA 3IDUA 4G6MH 4KRMB 1BWWA 4IEFB 4NN5B 5EG6C 4RNRA 3HRZA 3SDDB 2J6EH 2IPTH 4KJPD 3I3BA 1MCOL 5EU3B 1T2XA 1L9MA 3BESR 3GGWB 3ZKQD 1LO4H 4CBPA 2R4RH 4Y5YB 1UCTA 4HG4K 1TJHL 4YZFE 4ZAKD 2VDKL 2XACC 3R06B 4XWOC 1C7SA 2EEBA 3FQRA 3CMOL 2NYYC 4X9BA 1U8LA 4PREA 3M1BB 3GHEH 5FYLE 1H15B 1U92A 4X4MA 3GIVA 4PJ9B 3B3IA 4UT9L 3SDDD 1WK0A 5BMFL 1NUFA 4FMKA 4PJCB 4EQ2A 3K80A 3VG9C 4WHCA 3OZ9H 1RUML 5DJ6B 5CZVL 2DJUA 4NNXA 4JE4B 5JHDD 1H3PL 2CDGA 2X2YA 5C08B 5DHVA 2AJSL 4NWTH 4OKDA 4J3TA 4PJDA 4BK4A 1DN2A 1DUZB 3HE7B 5IB3B 1UB5A 3CVHH 1EERB 1WVZA 3B2UC 4LFHD 4PLJD 4JAMA 5KVFL 3C6SA 1MCWW 3RRQA 1ZLSL 1UB5B 5MEOA 3P4LA 4JAMB 3BH9B 4OF3A 1YNLL 2OL3A 4Z78B 2G60H 1R6VA 4JRXD 1C5DB 1DUYA 2VL4A 1SYVA 5D4QA 4F7TB 1K8DB 3DROB 3TH3T 1PW3A 4LARL 2NXYC 5ICZB 4QGYA 4DUWA 3X11B 1KIQB 3GSNL 1KLGB 4ODXA 5GISH 1YZZA 1F02I 2XRAH 5DGQA 3O3DA 3NVQA 4NM4H 1WZLA 3D0VB 1WFNA 3QJHA 2UWEB 5DJ2B 5GRYA 3SKMA 2Y07L 1MQ8A 5L6YL 5C0BE 4OBRA 4CKVX 1HSAB 1J1OL 4NOFA 3IVKA 5C7XH 4LPWA 1WLHA 4ZFGL 4NOBA 3HUJB 5JHLL 4E41E 2EYTB 5FA4B 5IMOB 4E9LA 4JFQA 1U8OA 2Q8AL 4NQVB 4JPVH 1UZ6F 4NO3A 2BNRE 4PJHF 3CVHB 1YEHL 3V6FB 3HMWL 4MXVE 4R4NC 1HQ4A 2JB6A 4OGXH 1EEUA 1F4XH 4YO0B 5JXAH 4PRHA 2NY0B 4GW1A 4HF5H 5ICXB 3VGDA 2HFFA 1PSKH 2CXKA 1XH3A 1VGEL 4OZIF 3RGHA 4DZBB 3MLPA 1T66C 1S7XA 1VA9A 1MQKH 1J8HB 4X9GA 3MV8D 1HH9B 4XXDB 4UT6H 4GRLA 1CDHA 4HCRH 1CE1H 4X9FA 1L4IA 4F57L 1QLEH 4OQTH 4FA8A 2HRLA 3BUYA 4FHBD 1NCWH 5I1JL 2KL6A 1V7NH 4HWZB 4JKLA 3RWHA 2BNQB 1F42A 2GJ6A 4XP5L 4JEGB 2X1WL 5ETUB 3V6BR 1G9EA 4OCLC 3BGAA 2P24A 4Y89A 5IEHB 5EUOE 1BVLB 4ENEC 5GISL 1AC0A 1UEYA 2A6JA 3CFKA 1XCQB 2XFXA 4NO2A 3HC0A 5D5MB 1RZKH 3IJYA 5IK3A 1S78C 3ECBA 5FYKD 1M05A 2A6JB 3RIFK 2ICWI 3T2NL 1U36A 5E08L 1L0XA 3LH2H 3OB8A 4MAUH 5KSUA 4OGZA 1EO5A 3MLYH 5D6CA 1J87A 1A7RH 1FVCB 1J10A 1PFCA 2IBZY 3MRIA 5AAWA 2JJTC 4GKNB 1A9BA 3GSNA 3FFCD 4KY1H 2CO6B 4P4KB 4Z8FL 2A9ML 2NNAA 1JP5A 1I9IL 5I17B 5CMAA 4UIKL 3KXFE 3T0XA 2EDFA 2DQIL 3T0EA 3I75B 5FUCE 2QHRH 3BD3A 1H3PH 4OCSH 1ZGLM 3TA3B 2E7HA 2XT1B 4LLDA 1GGCH 3QEUA 4Z77A 3U0TB 4APQA 2W92A 5I6XB 4YHOH 2NY4C 2ZSWB 2HAZA 1RIVH 2RFXA 1CIUA 1DCLA 1T6VN 1X6NA 3STZA 3GMNA 5HI4C 3SY0A 3JTSA 1I7TB 4DCQB 2AJYL 5IJKA 4RDQF 1AP2B 2WIIA 5IW3A 5SWSA 3CSPA 2ZG1A 1BQUA 3HMXH 3MLXL 5EH1A 3TBTB 5T1KA 1HHHB 2IC2A 5BZDA 4LLVA 4KZEH 4NQTA 3S34H 4QHMA 1NFIB 1NBZA 1HHHA 1F3RB 3RIAF 1BJ1J 3H0TA 1C08A 4DEPC 4JLRA 4L4TE 2FATL 4NQCE 4QRUB 1BJMA 2CLVB 2JCCA 1Z5LA 2IPKB 2X4SB 3QHTC 3G04B 1CYGA 4JRYA 3RJDA 1TVHB 5GGVH 5DZNA 1F3DJ 3DO7B 2ZSVA 4GXVL 4XAWH 4C83A 3A6BL 5K9OB 3Q6GL 4RISH 1KSRA 1ZA6A 3P9WB 1XT5A 3SQBA 2FD6L 2VDLH 2YN3A 3IDGA 2H1PL 4XZUB 3FQRB 3HE6D 4I0PC 1BFTA 1PGRB 3WCYA 1KGCE 4X8JA 4Y5VC 5EUOB 1Y6KR 3SGJC 1X5JA 2AXHA 1JNHB 2ZCKL 1AJ7H 4UT7L 3MLZH 5D7SH 4DGVL 4PJBE 5T3ZL 2P42B 5E08H 2VN4A 4OLXL 1LNUA 3ULUD 3RU8H 5BJTA 1LK2A 2DI9A 4ZD3H 3LPWA 2G9HB 1YEIL 5K9KB 5JO5B 1QP1A 4AG4L 1KIRA 1UB6B 5KVGL 1KCSH 5DS8A 5T3XE 4R4BB 1JF6A 2VC2H 1VFBB 1FN4A 3MRMA 4Z7NF 4KKAC 1S9WA 4LHUG 4NQVA 4K8RL 5C0GA 1MVUB 1X5GA 4CVUA 1CGYA 3CFKB 2GTZA 3QUXC 3FAWA 4EUPA 3S96A 2K9UA 2XTJC 2IPUG 1NJ9B 1T2QL 1FCCA 4G7VH 2BSTB 2BVOB 2AEPH 3GJFB 2R29L 1SM3L 3T0EE 4LNRA 1MNUH 5D7LA 5SX5K 1A1OA 5JW4M 3AREC 4X5XB 1K6QL 4POZC 5EZOH 2VKXA 4TSCH 1A14L 4FRWA 4Y5VB 1E6JL 3O3DB 1BX2A 4HC1A 2BHYA 1ORQA 2IALA 1A7NH 3AM8A 3UDWC 1SVZA 2W60A 2AJXH 3CDFA 1KCGC 3IDYB 4YHLH 2FR4B 4AT6B 3I75A 1TDQA 4GAGH 1IQWL 4Z76B 4PTUA 4OM1H 3BUTA 2JKXA 5C0EA 4APQD 4UU9A 1NCCL 4F37F 4G7YL 1AKJD 4NP4H 2X1PA 3DMMD 3PWPD 4IMLA 5I8CA 2GSIB 1ORSA 5FDWB 3F65A 4NQCB 1VFUA 3E6FA 4QXUL 5I71C 5A1AA 3LY6A 1PDKA 3MNZB 4E0RB 3PL6C 2ATKA 3MV7E 4UNTA 5DEGB 1PLGL 1U6AL 4P3CL 5E6ID 5CP3A 4PRPA 3VGGA 1KEML 5D93B 1BAFL 1GL4B 1G6RH 4XPFH 2EE6A 1T7WA 2NLJB 3G08A 4D0BB 4MWFA 2GJZA 2DLIA 3O2VH 4P4RB 3G08B 1IAKB 1RZ7L 3VFUB 2CDEA 3M45A 2RBLA 3CMGA 2DQDL 4RX4A 3UYPA 5L2KE 3HUJF 1KXVC 3HCVA 2EZ0C 4ZPTB 4OZGB 4JO3L 3TIEB 4KROC 4MS8A 5DK0B 3TBYA 1IM3B 5F3BB 1IGIH 3JWDL 1J5OL 3D9AL 3GSVB 2Q1EA 4FFVC 4QHNB 1IQDB 1NUGA 3MRGB 5FOBB 4FFWC 3GJFK 2VISA 3PGCA 4N8VB 4TNVF 4X7SH 3ZDZF 1XGUB 3RPIB 5IHBA 1ED3A 2QQNH 4N1CA 4A6YL 5JPNA 2DYPB 3RDTA 2GCYB 3VA6A 1HYSD 4S2SB 1GIGL 4O2CB 1OTUD 5FCUH 3QO0B 3I6LE 3NGBB 5J0BA 3NN8A 1B0GB 4AJ0A 4H25A 2X40A 1JGDA 4G5ZH 2BCKB 4ZFZB 3L5IA 1RQ5A 5JDSA 4MLSA 2JB5L 4KAQH 2EDTA 1XGQA 3IU4L 1FAIH 1GRWA 2QHLA 3L7EA 5C07B 5EZLA 2VZVA 2D9CA 3V8OA 1EJOH 4NM8L 1OL0A 1U42A 1U0QA 4QHLA 4PLNC 1GGYA 4ZUSA 3V7AG 3HC3L 2E6JA 4XI5D 3S35X 3DROA 5J9PB 2GEEA 1ZHNA 1VEMA 3WN5B 2F74A 1LD9B 4I3SL 3VRJA 4QWWD 3WS6A 3M8OL 3QXWA 2HT4D 4MQSB 3L3JA 2FRGP 5FM8A 1CFNA 1MJUL 3S35L 2GQHA 3ZMRA 2ADIB 4UDTB 1TJIL 2ILLA 3GJEA 2HTLD 3SGEH 1AP2A 1INEH 1DE4B 3RVWD 1F8TL 4UDTA 3T3PF 4H0HB 1RFDH 1WJ3A 5BS0A 1R0AL 5C0FB 1JF1B 3HUJA 2E7MA 3BEWB 5IB1B 3VXRB 1TZGL 2HJFB 3U9UA 1JPSH 4J1UA 3NA4A 1J05A 3OJMB 4X99A 1BVLA 1U3HA 4TVPH 1JPFB 4N68A 4JG0L 2PYFA 2ZNWA 3C5ZC 3R1GH 4J3WA 4WO4C 5C0BD 3LDBC 1R3LA 4UB0H 5E9DE 4PY8J 1J0JA 2I5YH 3OKNA 1ITBB 3PHQB 4Y8DC 5JW4R 1YYMH 1URLA 3K4ZA 1CLZL 2H3NA 3HN3A 4EOWL 3W39A 4P2OD 3B9KA 2WUCL 1JFQH 2E9IA 5DD1L 3KPPB 5I8KL 1TITA 2XG4A 5JA9A 1CE6B 3SDYL 3PWPE 1ZS8B 2BZDA 4WWKB 2D0HA 5JQ6H 4UAOB 1YMMA 3P4MA 4U4BA 1TJGH 5H2BA 1CE6A 4LGSB 4NN7B 1A3LL 4APQC 4CUCA 2QSTA 5T3XH 1A3RL 4WGWB 5FV2A 5D7JB 3UP1A 5BOPA 4G9FD 5I6XC 3OKEB 2NY0D 1O5DT 4DW2L 2AJVH 2NZ9C 2YPLD 1ZVSB 1CGVA 2GFBA 4HKXB 5F7EH 1NDGB 4ZYKB 4U1MA 3RWEA 5LGHH 5B39G 2ADGB 3Q2CA 4RMSA 5IEKB 4MAYA 2BSRB 3I2CH 5DR5H 2X89D 4NQSB 3QDHA 2CGRL 4EZMA 3K4DA 4S1DD 1MFAL 5I18L 1HINH 1FNHA 1EHLH 5EU6B 1T0MA 3LKOA 1AHWB 3DSFH 3T0ED 2DOCA 2NZIA 5HI3D 5L9DL 3AU1B 1SQ2N 4LLYA 1HKFA 4UILH 3QEGL 2NLJA 3O6ML 4L4TA 1UWXK 1T20A 4UUJB 3VI3E 5GGUA 4EKXA 4QRUA 3DSFL 4H5SA 3ZSSA 2R23A 3RGVC 3ZE2E 1HXYA 3O8XC 4HAGA 5GJSH 3SDDA 3MC0A 2VR9A 4XVTH 4JZNA 3C8KB 3O9WA 4KZDL 5HHMB 3SDXB 4GT7A 4JR9L 4WFHD 5IVNA 5JQHC 1QNZL 4ZOEA 2AK1H 5H37H 4P3DA 5JOFA 4M1DH 1NBYA 1LO3L 2F5AH 3NIGE 3C8DA 3WJJC 1BZ9B 4M6OL 3QIWC 2VLRE 2QADB 2VC2L 5DA4A 5CUSH 1BP3B 5DEFA 4Q74A 3ZO0A 1UH2A 4LVEA 3TV3H 1ZLVH 3FO0L 5CGTA 5KS9A 3I6KA 3MJ7B 2IAMB 5DHVB 1HILB 5E5MB 5KS9B 4WW2A 4ZXBC 4X6DA 3QHFH 4XNYH 2DI8A 3VXMD 4JLRB 1I1AC 1JHKH 5IESL 2J8HA 5DVNA 3HI1B 4QRTB 3QNYB 4D9LH 3E6HA 4XP1L 3IFOB 5DMIL 4AQOA 3V4UH 5E2TH 3OAYK 2CO7B 3MMEA 1J8HD 1QSFE 1NC4D 5MEOB 3AREA 4PRDB 1FFRA 1WEJH 1F90L 2W65A 2E6PA 3TH2T 1N59A 4RGOH 5TF0A 3KPSD 5SWZA 3UDWA 5FOBA 1JPSL 3L7FB 4NCC2 4Y0GA 1J9CT 4Y7MA 5DJ8A 4P4KD 8CGTA 5KVMC 1GZPB 4LHJB 3HPJB 2FJHA 4XPTH 2PCPA 4YHYB 1IILE 3KDMB 2IQ9H 4YEFA 1QRND 1UFUA 4DUVA 3F6LA 4IIQA 4YDJA 1ZA3A 2D03L 2YA0A 4TSAL 3UZEA 5TGBB 4JPWL 5KVEH 5DA0B 5DJ2A 1R5WA 2D3VA 1XIWD 5T3ZH 4YBHA 3P73A 5F88A 3S35H 1OF2A 5I74C 5DTFA 1KTLB 1D7FA 1WZKA 1A6WL 1YEKL 2A0LC 1T3FA 4KUCD 5HPOA 3V6OA 1RI8A 1DN0B 5HHVL 4LAQH 3NFSL 5E8DH 5JXEC 2R4RL 4FG6D 5IEKA 1P84J 35C8H 3GZKA 5DT1L 5E00B 1RUQH 2ESVE 2JJSC 2SEBA 3DV4B 3QFJA 2JIXA 1OGAB 1Z6JT 3S36L 4E5XA 5C0CE 2IFFL 1RZIB 2YD5A 2YWYA 3ZYZA 5J1AA 3FT4B 3WMSA 4NZUH 4X6CB 2N4IA 4OUUA 5FF6B 4DZBA 1AGBB 25C8H 3X17A 3HG1A 4OZHF 2ADIA 1A6ZB 3D3VD 2OR7A 2BNQA 1BZ7B 4DJMA 1KULA 3IKCB 2QKIB 4HD9A 3P9LB 1CDJA 5KS9E 2V17L 4F15C 1E4KC 3PQYE 4R96B 4M7LT 1JPGB 2HG5A 1WCQA 3FO1B 2EIZA 3L5WB 1IQWH 4PJCE 5LCVL 4HUXB 3GIVB 4DW2H 4ETQA 1ZHLB 1TPXC 2NXYB 2XWJB 3AUVA 4NBZB 1P6FA 4KJYA 1QSFB 5GZND 5J13B 5JIIA 1U93B 2XRAL 4Y4FD 4H1LB 2VSCA 1QSEB 3S5LG 3WNNA 4BFBD 3H9HB 2APTA 1EEZA 3NABH 5CBEB 2V7HB 3LQMA 3C6SB 4GSDL 2BFVL 1Q0YL 1EEZB 2FYYB 2Y23A 3FO9B 4Z0BH 4MXQC 2E9BA 2EXYD 3UTSB 1M71B 2WV3A 5HYJA 2EDDA 5AYQA 3MNWA 3NFPA 5C09D 4U3HA 3BQUA 2E6QA 1T7ZA 1AIFB 3D9AH 3ARQA 3H9YA 3VWJD 4M8VA 5DJAB 5C0BB 4OM1L 5ACLA 1I8IA 4H26A 2BHZA 1H15A 4YHLL 2YZ1A 5E8OB 1I8IB 2ICWJ 4JHWL 3FB6B 4XX1G 1OCWH 3PNWA 4OLZH 1KCVL 1UXSB 5DXWA 2PTTB 3HUJE 4OLYL 3E8UH 3TEUA 1XGQB 1HHKA 4UT9H 3L7EB 3IFNH 4YHPB 4KUZH 3C6LD 1LE5A 2OM5A 1MH5B 2AJUH 1NBZB 2JTDA 5K9QI 4PJDB 2BRRL 1G0DA 4LVOC 1NAKH 1OSZA 2E7LA 5TQ2H 4WTZA 5EOQL 4F9LC 2AEWA 3NCEB 5DMKA 1G0XA 2XKNA 3MRFA 4PRHB 2D0GA 2JK5B 4JFOA 2H8PA 2LU3A 3U6RB 5GZOC 2P5WA 1QFWL 5DF0A 1P53A 1HINL 1AXTL 3TFKD 2K3TA 1J0YA 4U1GC 4NP4L 1DTUA 3MRGA 2XWTB 5TDOB 2GIYA 2DI7A 3HG1D 5IT2H 4PLOB 4KKCC 5ANMA 2Q8AH 4NFDA 4M5ZL 4XHQA 3DXAD 1UXWA 4H8WL 4RA0C 1V05A 3V79C 4OZIB 3AAZA 4PJEA 5DWUH 4WI8A 5GGRB 4Z7OF 3QJHB 3NN8B 1P6AB 1TETL 2LV4A 5AD0B 5DO2C 4J6RL 4B0MM 1OTSD 4NQCD 3KWWB 3BPOB 3LVEA 1RZ7H 4U1SB 1X7QA 5C08E 4IOSD 1QPXA 1ZVSA 3ZE1E 3CLFL 2OMBA 5JO5A 4NJAH 4YHKH 4FQCL 1FVDA 1YEJH 3MV9A 1FH5L 2ADGA 2DLTA 1I4FA 5FYKU 5IWLA 4KGLA 4DAGH 3AREB 2XXCB 1YMMD 1S7RA 1BFSA 3LN5B 2C3GA 5E00A 1JZ2A 2X44D 2L7UA 3U0WL 5ELIA 3ZL4L 3MLVH 3UZQA 3VRJB 2VO5A 1IC5H 1UWEL 5AYUL 3G6JB 2HLFD 1OARL 4P57A 4PJIF 4OKVB 4JKPH 5JIHA 4WI5A 1MHHA 4Y4KD 2YD7A 2IANE 2APVA 3U7AA 4HIEB 4OQ1A 2BY1A 3KGRA 4YFLI 5FK9A 4RA3A 4TVPE 2NMSA 5D9SA 4HH9A 1F4YL 3WJJA 1D6EB 1P4IH 2J8OA 1JHTB 1NC2B 1QZ1A 5T33L 4HH9B 4U1MB 3RWEB 1F90H 5CJ5A 5J57B 2H45A 4WUKL 1LILA 1EK3A 5KN5A 1A02N 1DBKL 2ATKB 2FX8L 4QYOA 2OS7A 3B5GA 4ZXBA 2XTJD 2VDKH 3MRHB 3X12B 5FDWA 2BNRB 4PRHE 2A73A 7CGTA 3IJYB 5IK3B 2BVEA 3QA3A 3WS3B 3TBSB 4OZFA 4Y4FC 3BDYH 3Q3GB 4K9EL 1FNSL 4LLVB 5SV3A 4X6CA 3PGFL 2MNUA 4K3EH 4PGEB 4YHPA 1NMBL 4YDVB 3B9EA 3HRZB 2I25N 4FQ2H 3MRJA 3MR9B 5HDOA 3LQAC 5EZOL 1AQKL 3HS0B 5I1CH 4EBQH 1A6AB 1MWAA 5DLMH 1ZSDA 2I60L 5FAAA 4HK0B 4XBEL 4HBCL 3EOYG 5D72L 4MJ5B 5IFAL 1ZT7B 1HXMB 1P7QB 5TH2A 1RUPL 2GJ6E 4L4VA 1JGEA 3C5ZB 4FABL 2YD8A 3U0WH 3QUXB 5I75B 5KAQF 4HKXA 3MA9H 1R5VB 3HA0A 4FQIL 3V4PH 1OTTC 1QRNE 2P5EE 3VI4F 4M6MH 2H9GA 4OZIA 5EBGA 1TJGL 1B0GA 1EZVX 4W6YB 4F2MA 4KTEL 1IEAA 5CEXB 4MQTB 1WAAA 4MNGE 4TUKH 2BY3A 2X4RA 3QUYD 4HX1A 3VRIA 3VD4A 4Q9RH 4QO1A 1SEBB 3CC5B 2ZOKA 5CJXA 5BXFA 5KTEL 1NGWB 3OKOB 3TBTA 3SDCB 4O2EA 4YUEL 3V6OE 2QSCH 4ZNCD 1IKNA 3SBWC 1NFIA 3W11D 4YXKL 4OV5A 3G6JE 2Z31A 4JY5L 4RAHA 1FZKA 1ZLUK 3KJ4B 5JNYB 1IGYA 3CFEB 3CXDH 4XRCB 1MIEH 4ZUVB 5JW5B 1OSZB 2ESVA 4MD5B 1ZHBA 3T0EB 4P9ML 5E94B 1A7QL 1I1CA 2XIDA 3MACH 1S7UA 2CK0L 2IANA 3QFJE 2B1AL 4NNYA 1Q94B 4PJGF 3LKNB 3VU2A 2I9LB 3ZTNH 1HQRB 2KQNA 4DQOL 1ZT4A 3FRPA 3QWRD 3V7MA 3PL6B 4Q97A 1I8MA 3QBTB 3KDMA 3BT2L 5D96B 3HG1E 3ESVF 2UWEA 3NTCH 3B3IB 4ZS6D 3O2WL 1E6OL 3D39A 4HAFA 4CW1B 2R56H 4P23D 4XBEH 2NY2C 3UYOD 1NSNH 1E4KA 3G5ZA 1TFHA 1RMFH 4FFZH 4AL8H 5JMOC 4UIKH 4WFHE 3WDHA 1G6RL 3U9UB 3BP5A 4Z7VE 4PV8B 5DUBA 3VFGH 3OKMB 5JW4Q 1HDMB 5C0EB 1LK2B 3CFDB 1P9MC 2DQUH 2BVYA 3OAZH 3QHZH 1KB5H 3MUGA 3CNKA 4U49A 3NPSC 1YMHB 3FQWB 2JCCE 3UZVB 3MV9B 3OKNB 4EI6A 4U1GB 3O4LB 1RJYA 1MFNA 3NCMA 3N9GH 1T1XA 4YFLF 4JFEA 1BOGB 3HTLX 3OX8B 2JJTA 2EZ0D 2C4XA 3DVNA 4LQFL 4CMHB 2Y7QA 1S5IL 3GSUA 2BVTA 2PXYB 4X8JB 4TSBL 1Z9SA 3LN4A 5MENA 4IDLA 4QHKI 5EA0L 1D5IH 3MRJB 2FIRT 1DVFD 4HJ0D 5EN2B 4O9HL 2RB8A 4HLZG 2X05A 3MQIA 5TGBA 1ULVA 1QRNA 4WFGE 1I9RL 3ZHKA 4OZIE 5H35B 3UTSA 3AB0C 2GJJA 4LCYB 5IBUB 3QI9C 4LF3B 3WJLA 2MCPL 1WBXA 1T0NB 5D1QB 3F5WB 3BIKA 4HS8L 1F45A 4LDOB 5IJKC 3G6JF 5D1QA 2CJUL 4U33A 1P4BH 1PG7H 3MUJA 3SKOB 3UTTD 1YUHA 4GMTL 4JJ5A 1Y0LA 3OGCA 4YZFF 4XP9L 5T5NF 4M8QB 1K2DB 1I3GH 4GQ9H 1S8DA 2M8XA 1I3VA 4IJ3B 4MZ2A 4M9OA 32C2B 3FT2A 2J6EA 5EOCJ 1PZ5B 1KLUB 3EYOB 5DQ9B 2HYMA 2DD8H 4ZO7A 1AFVL 4XCEB 3WXWH 3MUZ1 1FIGL 1P4LB 1Q9OA 1T5WA 4JY4B 4UQ2B 3LEYH 5DJYA 4GRLB 3E1F1 4DGVH 3WEXB 1MCHA 1X5XA 5KG9A 4IRJC 3D85D 4U6VL 1I9JL 1MUJA 2EEDA 3JXAA 5D5MF 3B43A 5D7KE 2OSLB 4P2OB 1KCLA 5SWQB 1MUJB 3OR6B 4HDIB 5EU3A 1S7UB 2IANB 3CCHA 3R0MA 1NEZA 3K2MC 3U1SL 4GLRI 2YKLH 1JK8A 1G6RB 1V8HA 1GGBH 4HH8A 2BDNH 2ZZUT 2OI9C 3OG4B 1A1NA 1WBYB 1R5VA 2ZUWA 6FABH 2VKWA 2GHWB 4HS6B 5D1QD 4NKIL 2AXJA 3C60A 3G5ZB 3MJ8B 2AJXL 5D1XD 1H3VA 4M62H 5ADPH 1IEAB 5CEXA 3D0LA 3U79A 2IH1A 3TVMD 4Y1AB 1MH5A 2Z8WC 3F58L 1DUZA 3HE7A 1X5ZA 3KYOA 3SO3B 1G1YA 5C08A 3CVHL 5EU6D 1GVIA 1BM3L 1LEKA 1H3UA 3QEQB 4MX7B 3HS0A 3HPLB 4WU7B 4ZPTA 5MENE 1I85C 3O41A 5A2LH 5CMAB 3VDBA 3OQ3B 3IFOA 4QXUH 4DN4L 4XPTL 1FGNL 1IAOA 3UO1L 4YAQA 3V5DB 1M71A 3JV6B 1YNLH 1HZHL 4Y5YC 3WUZA 5F6HI 4HWBA 3RA7L 3GBMH 3N85L 3QG6B 4YC2C 1KLGA 4ODXB 4S1SL 2PN5A 2Y7QB 2NYYD 3BJLA 2F53D 4NN6C 3BI9X 1ACYH 1SBSL 2NTFB 2YRPA 5IF0A 2JE8A 4RFOH 5IHUH 3CMOH 5L8JB 5LXGH 3DLQR 3QB7C 3ARGC 5DJCA 4JY6A 4PG9A 3VD3A 2BJMH 4FFYH 4KTYA 4FQHA 3NACH 4Z0BL 5D70H 1GCFA 4XC3H 2NXZC 4RAUB 3SE3A 5MHSD 2DQGH 5A3IC 1OAKL 1F6AB 4IRSA 3IJSA 3UROR 1AJ7L 5K9KA 1JV5A 3OKLB 3KPTA 4XMKL 3O2DA 1I1AD 1MNUL 3VWJB 43CAB 2P46B 1CLYL 1GPOL 1KJVA 1T89C 1Z9OA 4YWGL 4DN3L 5LWYH 3D39D 5CSZA 1UACH 4AZ8A 3FOMA 4XT1C 1P7QD 1JF5A 1CLYH 2DYPD 3I50H 5ENWB 4PB0H 15C8L 1JPFA 2EDOA 1R5IB 3QO1B 3HI5H 2PYED 3DECA 1S9XB 4OCYL 4Z7QF 2P45B 3VA2C 3FT2B 4X5XA 1PSKL 3AS0A 4YH6A 4XZUA 2R1XB 1H5BA 4HWBL 4NQEB 3TA3D 3NAAL 5IBLD 4Y2DD 3VMPA 4P9HL 3UJTL 4NQXB 4I3RL 5HYIA 3GSWA 1A4KB 1CE1L 1IBGH 5IQ9A 1DQDH 3ZSTA 3MLSH 4Q2ZA 4NO0B 1AD0B 5BOZG 1CI5A 4L3CB 1OAXH 2GK0A 2Z35B 2VLKE 2G9HA 4U7MA 4Y2DB 1FZJA 5HDQL 2VXVH 4ETQB 1D9KD 2YD1A 1G7PB 4FQ1H 4P5KB 3K81A 4R4ND 1HNFA 4KJYB 1MRFL 5DDHA 1CZ8H 2VDRL 4PB9L 1BREA 1WAAE 5LGHL 5CJXC 5I1HL 1JNNL 3EO9L 1HILA 3BX7C 5E5MA 3PG2A 5C3TA 1JE6A 4OD2B 4OSUL 2RIKA 3I84A 4LRIA 3VFUA 3G6JA 4N8CL 4OI9A 3FONB 4XCEA 4OJFL 5DD0H 1XGTB 4LKCA 1FZKB 4V3DB 1F58H 4AQ1B 5KVEL 4TSAH 1V7ML 2NR6C 1FRGL 4J3UA 3BH9A 3O9WC 1K5NB 3OPZH 2V2WB 3FMGH 4KKLC 1S9VA 3TIDB 1K5NA 2VISB 3PGCB 3ARFA 3BO8A 3KVQA 5I66B 2GCYA 4I9WD 1UA6L 2AXGA 5IFJA 2ICCA 3ARFB 3BO8B 1JK8B 4N5EC 5KN5B 5BV7B 2YR3A 4YDLC 4LSRH 2ITDB 4ODWB 4XP6H 4MQ7B 1HKLL 4RGMB 3WLWD 2X9YA 1NCAH 4AH2A 5IHZB 5E1AA 1JWUA 4WW2C 3TVMC 2OYPA 1K4CA 3HNSL 4PYGA 5GRWA 4Z7VA 4CVXB 4HC1L 1WUNT 5TE6L 3BGMA 1JZ4A 4J4PC 4K94H 5C0CB 2DN7A 1LO4L 5C07A 2B5IB 3LMJH 3LH2L 4PLKD 3HAEH 1IAKA 3ZYJA 1KBGL 2C1OB 3KXFD 3TJHA 1LO2H