1JUSA

Crystal structure of the multidrug binding transcriptional repressor qacr bound to rhodamine 6g
Total Genus 76
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
76
sequence length
186
structure length
186
Chain Sequence
NLKDKILGVAKELFIKNGYNATTTGEIVKLSESSKGNLYYHFKTKENLFLEILNIEESKWQEQWKKEQIKAKTNREKFYLYNELSLTTEYYYPLQNAIIEFYTEYYKTNSINEKMNKLENKYIDAYHVIFKEGNLNGEWSINDVNAVSKIAANAVNGIVTFTHEQNINERIKLMNKFSQIFLNGLS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural mechanisms of QacR induction and multidrug recognition.
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Transcription
molecule keywords HYPOTHETICAL TRANSCRIPTIONAL REGULATOR IN QACA 5'REGION
total genus 76
structure length 186
sequence length 186
chains with identical sequence B, D, E
ec nomenclature
pdb deposition date 2001-08-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00440 TetR_N Bacterial regulatory proteins, tetR family
A PF08360 TetR_C_5 QacR-like protein, C-terminal region
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 1jusA01
1.10.357.10 Mainly Alpha Orthogonal Bundle Tetracycline Repressor; domain 2 Tetracycline Repressor, domain 2 1jusA02
4EEFG 3DPJA 1RKTA 3S1MJ 5HBUA 2ZB9A 2XSDC 2O7OA 3GTLJ 5DS9A 3PO2J 3QPLA 1ETOA 4FE4A 3CDLA 2JA6J 3BR3A 4X1EA 5F08A 3FK7A 5EFYA 2MG4A 5F0CA 3GTGJ 1DU6A 2ID6A 1Z0XA 3HDDA 2DMPA 3RQIA 5D1RA 5C4XJ 4IHXA 3IV5A 2H8RA 5E3LA 3Q3SA 3BRUA 1UG2A 2AHQA 1I3QJ 1TWAJ 3Q0UA 3JREA 3MKLA 2W48A 3VW2A 5HSZA 2R5YB 2IEKA 4A3BJ 3ANPA 5K7FA 1GVDA 1DU0A 3LWJA 1MSEC 2JA7J 4Y7NJ 4L62A 1P7IA 2XPWA 2VKVA 3RZDJ 3GTKJ 5M5WJ 2IBDA 4LOCA 4A3JJ 2D6YA 2GM4A 3B81A 1BJZA 1MBJA 3DEWA 3F0CA 1BL0A 2HKUA 2DA1A 3AQSA 3NAUA 5J3LA 3H0GJ 2ZCNA 2NS7A 1LE8A 2YU9J 2DA7A 4NDLA 5F04A 3SJMA 3LNQA 4XRSG 3B6CA 1MH3A 3COLA 2W53A 4V2GA 3CRJA 1U9OA 2LKXA 2LFBA 2JA5J 2NVTJ 2KT0A 3GBGA 3MNLA 2DA3A 4MFDA 2M9HA 3BG3A 4RDUA 1FJLA 5J1UA 1S7EA 4A3LJ 2E1OA 4I6ZA 2Y0SN 4GFKA 4FISA 4M3EA 2HOTA 5FKMA 2E2IJ 3F1BA 3VP5A 1K61A 4JNNA 1WH5A 4XRMA 3LSRA 4UUSA 4M3GA 3KKCA 5DAJA 5D18A 2QF7A 4MLOA 5IP6A 1YRNA 2VUMJ 2LTPA 5EF6A 3CCYA 1WI3A 3VW1A 5E3NA 2XDNA 1ZR2A 5CXIA 2HQ5A 3PO3J 3C07A 4UUTA 4MXMA 3JRCA 5EDNA 1JGGA 1HDDC 3S17J 5AQCA 1E3OC 2R0QC 1O4XA 3GZIA 4D5FA 1GDTA 3ANGA 2JWTA 3HEFA 3SFIA 3C2BA 3K7AJ 2FX0A 1JKOC 2LVSA 2ZCMA 4HKUA 4V2FA 3S1NJ 5K58A 1IJWC 2L7FP 3NXCA 2OF7A 1QVUA 2HOSA 2VKEA 1T33A 1JTYA 1TWCJ 2G7GA 3HOYJ 2OI8A 1X58A 3NRGA 4A3EJ 1ORKA 2K40A 2GLOA 3FISA 5D19A 1B8IB 2NP3A 3HB9A 2RAEA 2QCOA 3S16J 2XPUA 4G12A 3ZQFA 2NS8A 2DA5A 3K2AA 3G1LA 3ZQLA 5F0HA 2FQ4A 4DW6A 2NVYJ 4QIWN 3D1NI 2ME0A 1ETXA 1U9NA 2EBIA 3TEDA 1UMQA 3WHBA 3KKDA 4M6VA 2R5ZA 2XGCA 4RBOA 1P7JA 1LFUP 5FKOA 4ABZA 5F1JA 3CMYA 4A3CJ 4KWAA 3HIMA 3QPSA 1Q1VA 5FKKA 2E2JJ 1EF4A 2Y2ZA 2QKOA 1FIAA 3HOUJ 2DN0A 3CQZJ 5EEAA 3AQTA 1Z77A 3M3YJ 3P9TA 3IH3A 3HM5A 2Q24A 2CQQA 2DG8A 5IYBJ 1RKWA 1BA5A 2CUFA 4A3FJ 1IRZA 3OSFA 3OIOA 5EG0A 3GTQJ 3HOWJ 1GUUA 1U8BA 4C2MJ 4XIDA 1JT0A 3HTAA 4JYKA 1UHSA 3BNIA 3TP3A 4DYCA 1UI5A 5GPAA 2NP5A 4JL3A 3DCFA 3VW0A 3ON2A 3BT9A 2YVHA 1HDPA 1QPIA 2G7SA 4ME9A 2HI3A 3A01A 4A3IJ 4D5CA 3QKXA 3EUPA 1AKHB 4MK6A 4Y52J 1IGNA 5J1YA 5K7ZA 3BR5A 4ICHA 2L7MP 2MGQA 3O60A 3H3VK 4GFBA 3PPBA 3S5RA 5H9TA 1APLC 2QIBA 3ZOBA 2HOAA 3A03A 4GFLA 3HBLA 1VF9A 4IEJA 2L0KA 3JRAA 1MBEA 2K9QA 2MSYA 3BJBA 2GENA 2LD5A 1TWHJ 3S2HJ 1X2MA 2FJ1A 1MNMC 3BQYA 5IPAA 3JR9A 4GCLA 2ZOZA 4JX4A 2IAIA 3LSJA 1RPWA 3UKGA 4I76A 1JKRC 2O7TA 2RHAA 3BQZA 2CJJA 2QWTA 3W6VA 2DMQA 2TCTA 1YRNB 3S15J 5EGOB 1B72A 2UXHA 1TWGJ 1ZR4A 1ZKGA 4X6AJ 3G7RA 5DTDA 1MBKA 3JRDA 1JJ6C 1AU7A 1I6HJ 3VVYA 3HOZJ 1A5JA 4A3DJ 1ETQA 2NVXJ 3E7LA 4S0HB 1WGXA 1MSFC 1HOMA 3JRHA 4FE7A 3L1PA 3S14J 2ECBA 5CXGA 3FRQA 1POGA 3LSPA 4GCKA 3KNWA 4BBSJ 3G1MA 3SDGA 3HTJA 2H1KA 3IUVA 4BBRJ 2R7ZJ 5IP7J 2UXPA 3HOVJ 1RETA 3O8GA 3JRFA 3V6GA 3BCGA 2E2HJ 1NK2P 5IOYA 3BTIA 3ZQCA 4PXIA 3FIWA 2DG7A 2LR8A 1H88C 5J1RA 2REKA 4YZEA 3KZ9A 3T6NA 3HTHA 3NNRA 2XGDA 2PMZN 5M3MJ 1ZQ3P 4C3HJ 3NI7A 5GPCA 3GEUA 4NN1A 3Q0WA 2WUIA 1A6IA 3HKZN 2HXOA 3IH4A 1JJ8C 2ME6A 1WH7A 1W0UA 1QRYA 1XG1A 5F0FA 3VPRA 4AUXA 1ETWA 2ELKA 3ON4A 1T56A 4BKXA 5FKLA 5C44J 2WGBA 2EQRA 1TC3C 3QBMA 2JK3A 1FIPA 1IV6A 3CJDA 3BR6A 1Y1WJ 2ZCXA 1F43A 2Y9YA 1IUFA 5BNGA 2R5YA 4XRSA 5HAWA 1F36A 1IDZA 1MH4A 2XB0X 1U78A 2DA6A 2V57A 4IHWA 3JRGA 4BY1J 2GBYA 1OJLA 3OSGA 2CU7A 2LLKA 1PUFB 2NVQJ 4DZJA 2CUEA 2L7ZA 4AF5A 4JX5A 3NPIA 1GV2A 4MO7A 4C3IJ 2CQXA 5EYRA 1JKPC 2UXUA 1RESA 5C4YA 4HNVA 3BR0A 2ID3A 5M5XJ 1K83J 2DTZA 1IC8A 1AHDP 3Q0VA 4B3AA 3BTJA 1VFCA 1XS9A 5EG0B 1OCTC 4QTRA 5C4JJ 1JUSA 5M5YJ 1VNDA 1MBGA 4W1UA 5EZHA 4DYQA 5E3OA 3LJLA 1R9TJ 1JT6A 3JRBA 1CQTA 4C3JJ 3JRIA 2JA8J 3S1QJ 1OFCX 2CRGA 2XPVA 5FLVA 3A02A 1ZK8A 2WV1A 3MVPA 2D5VA 4A69C 2Y9ZA 2M34A 4MFEA 3LHQA 1HCRA 4A3GJ 3BG9A 2KDZA 2RASA 3MN2A 2R92J 2IU5A 2DMUA 3LSGA 2G3BA 3EGQA 3HOXJ 2L9RA 1GT0C 5IYDJ 5IYCJ 3PM1A 3M4OJ 2DA2A 2R93J 2M2EA 1UI6A 3CWRA 5GP9A 2LY9A 3GTOJ 2WAQN 3VOXA 2O8KA 4AC0A 1FTZA 5F27A 3ZQHA 3VUQA 3HGYA 3TW6A 2FBQA 5C3EJ 1MBFA 2N8GA 2JN6A 2MW8A 5M3FJ 1HF0A 1LFBA 3GTPJ 3VOKA 4B1RA 2DA4A 2HYJA 3BR2A 2PBXA 4NELA 5JLXA 2XB5A 1X2NA 2NX4A 1JUMA 2VPRA 2X9DA 5FJ8J 4J19A 2EZIA 3BR1A 1ZTRA 1JKQC 2F07A 5FMPA 4QSHA 3JSJA 1WCMJ 3GTJJ 2DMNA 3ZQIA 3BG5A 1IG7A 2XGEA 3ZQGA 4L5EA 1SFOJ 2UXIA 4JKZA 4CGRA 2ECCA 1AKHA 3BHQA 3RH2A 3I4MJ 4A93J 2EZKA 2JMWA 1Y1VJ 1H8AC 2JJ7A 1SGMA 4CYCB 2HDDA 1ETVA 3B6AA 1JTXA 3I4NJ 1RR7A 1IDYA 3TW7A 4AC6A 5E3MA 2G7LA 1JUPA 2M0CA 9ANTA 3E7QA 4AYBN 1ZGWA 2P81A 3HGGA 1NTCA 5IOZA 3G1OA 2YVEA 4D7MA 1BW5A 2QTQA 3A01B 4IHVA 1ITYA 5FGLA 2LP0A 3FKIJ 3HE0A 4B4CA 3WHCA 3RKQA 3V78A 5EZGA 3O8HA 1FTTA 3QQAA 1OCPA 2X48A 4XICA 2AO9A 2EZLA 4JP0A 1XC5A 1MBHA 2GFNA 5FHPA 3VVXA 3FK6A 4M3DA 2B63J 3RZOJ 3HTIA 5HODA 2E19A 1G2HA 2WB1N 3TP0A 1PUFA 1FEXA 2LK2A 4M3BA 4GCTA 4M3FA 1LE8B 4BXXJ 1ETYA 4DZPA 3PASA 2DMTA 2K9NA 2UXOA 3OOUA 3LOCA 1GV5A 5CW8A 2Y30A 3VIBA 2YUSA 2OERA 4MIMA 4BY7J 1I50J 4W97A 4A3KJ 2K9SA 3BTCA 5K7HA 3VVZA 2I10A 2HXIA 4FTHA 5FKNA 2TRTA 2OPTA 5EGOA 1B72B 2QOPA 1WPKA 2Y31A 2VI6A 1H89C 4DYRA 1ENHA 2M8GX 4UUSB 1BW6A 2COBA 4D7NA 3IH2A 4IHYA 1VI0A 2NOGA 3S2DJ 2FD5A 3BTLA 5FLMJ 4CYCA 3RD3A 4ACIA 1ETKA 5IP9J 2DJNA 2X6OA 2GUHA 2EH3A 4JX6A 1D5YA 4UDSA 2YS9A 4FCYA 3G56A 2EZHA 2PZ9A 1TWFJ 1SANA 4XK4A 4A3MJ 1NK3P 2ZOYA 1W0TA 2G0EA 2R5ZB 2O9LA 2HYTA 2XRLA 1HLVA 1B8IA 3S1RJ 1QVTA 3GTMJ 3NARA 5JLWA
chains in the Genus database with same CATH superfamily
1BOBA 1TW2A 2CYYA 4NC7A 1OQYA 2EV5A 3J7YJ 2XSDC 2MH2A 2O7OA 2E1NA 4DJAA 2VBYA 1ETOA 2PMZA 2DJIA 3CDLA 3DQVC 3QU3A 2KISA 2GAUA 5F08A 1FWZA 5F0CA 2KIMA 1DU6A 4E7KA 2ZY9A 3H3ZA 4PDKA 1HKQA 3MKLA 5HSZA 3ISPA 1C0WA 2R5YB 4KA4A 4BL0B 2IEKA 1O3SA 5K7FA 1ZG3A 2BE5F 3ZPLA 3KP5A 2BY0A 2L4AA 3GLXA 1DU0A 2JA7J 1Z6RA 2XPWA 1XMAA 2VKVA 2MD0A 4LOCA 5DUKA 1PJRA 3C2GA 3EYIA 1MBJA 3F0CA 4BDYA 4HA8A 4P9FA 4EATA 3H0GJ 3CF5F 2NS7A 3QODA 3FBNB 3FMRA 1V55H 3B6CA 1MH3A 4CCOA 4V2GA 3CRJA 2NVTJ 2X6YA 3GBGA 2NVUB 2Z16A 1IRFA 4KIBA 2OJED 4QLCU 1WJEA 4II3A 4LD5A 4QWQA 2M8EA 1TT5B 4FISA 2JQ7A 3VP5A 3BZCA 1O3QA 5BQTA 1MKMA 5D18A 2KJCA 1OYIA 2A3SA 2VUMJ 4RAZA 5EF6A 4G94A 1WI3A 3DTIA 1R4NB 2E7WA 5CXIA 2HQ5A 1RRJA 4UUTA 4MXMA 3JRCA 1JGGA 3FXJA 2QGUA 1O57A 2BV6A 2L02A 3HHGA 4M71A 4RAYA 3ABMH 3HEFA 3VYTB 3C2BA 2F5EA 1OPCA 1Y0UA 4WIBA 4MTDA 1LFPA 4HKUA 2DOFA 3TO9A 5K58A 1IZ1A 4M72A 1O7LA 2L7FP 3CUQC 2IVMA 5BS6A 1FOWA 4R8HA 2WC2A 5D8KB 1FX7A 3DF8A 3FISA 4YIFA 1H0MA 1ZYRF 4B47A 2RAEA 2KRCA 4OIRF 3S16J 4G12A 2DA5A 1EH8A 3EUHA 3K2AA 3OYHA 1YIJI 1FT9A 4OAYA 4DW6A 1YQAA 2ME0A 1U9NA 3ROUA 1ZAOA 4HF0A 1G3TA 2J5OA 4M6VA 1WJDA 1GXQA 4XR6A 2Y75A 3CCUI 1ZG5A 2OTLI 1LFUP 5FKOA 4ABZA 2DFFA 2ZSHB 2YX7A 3HIMA 1BI2A 1MJBA 4BE0A 4ASNA 2NYXA 5KNLA 4M9ZA 3P9KA 1EF4A 3H9JA 2DN0A 2NRAC 1XGMA 3FX3A 3TO6A 4EJUA 4O6JA 5DCMB 3M1CA 1F5TA 1RUNA 3PUFA 4I0BA 5ICEA 3OYCA 2DG8A 1RKWA 2V9KA 4A3FJ 1XSDA 5D6EA 1IRZA 5H6RA 3OYBA 1LJ9A 3GTQJ 1J75A 4AYBA 3OYJA 3HOWJ 3WG7H 1U8BA 1JT0A 3S32A 5DUIA 1EV7A 4JYKA 3BNIA 2O61A 2MLKA 1A31A 4JL3A 5GPAA 2R7XA 1B6AA 2CMPA 3KP6A 2PJPA 1VQOI 4KYWA 3HRMA 2NS0A 3ON2A 2OCEA 4NC8A 2H1LA 2G7SA 3A01A 3FXKA 4XOTA 2KMUA 1OR7C 2X85A 2LKSA 3BJOA 4KDPA 4CCJA 5DM7F 3EUPA 2Z3YA 4ENMA 5L3CA 3S5RA 1R00A 3PL8A 2WAFA 2QIBA 1FLIA 2HOAA 1YS7A 4GFLA 4KIFA 4IEJA 2YVXA 3JRAA 3VYUB 2K9QA 4RAGA 1W5TA 1QQIA 4CZCA 3HSRA 2LD5A 1TWHJ 2G9WA 2O0YA 3JR9A 2V79A 1UHWA 2B7EA 2R7QA 2ZOZA 1RPWA 3UKGA 2O7TA 4FASD 3BQZA 4BJ5C 4CICA 4KMFA 2TCTA 1YRNB 2UXHA 2BY3A 3MKWB 1B72A 3HL2A 1ZR4A 2PMHA 3E97A 1IV8A 1AU7A 1JJ6C 1I6HJ 2BHZA 3VVYA 1Z21A 3QYEA 4CA0A 1UJ8A 3MAJA 3M8JA 4R1HA 4U0YA 3PNVA 4PJNA 4AWXB 1MSFC 2IA0A 1HOMA 3OYKA 1SFXA 3NQOA 2K9MA 1VQ5I 3QOPA 1O3RA 2PEXA 2XRNA 3RSNA 4BBSJ 3KNWA 3SDGA 5FROA 5CPRB 3IUVA 1G6NA 2XAQA 5IP7J 2R7ZJ 3WTWC 2OZ6A 3JRFA 3V6GA 3SEZA 3F8CA 2HS5A 1FP2A 3BTIA 2O3FA 3OR2C 4A0YA 4YFNF 3CD6I 4PXIA 2PI0A 1TZLA 1W36D 2LR8A 3EUHC 3QAHA 4DGWB 1ZHFA 3F6OA 3T6NA 2H6CA 4EJOA 5M3MJ 4BQAA 1ZQ3P 1D1CA 1WWXA 3I4PA 3X2QH 2LY1A 3WU2C 4L0ZB 2DCEA 4RGRA 3IRQA 1S72I 2C6YA 1SFEA 1EJ9A 3MD2A 3QOEA 2ELKA 2FRHA 4C2UA 4BKXA 5C44J 3IHUA 1JHFA 5ILUA 4C2MA 5HOOA 4YRVA 2XF6A 3QBMA 1IXSB 3BR6A 2ZMEA 2ZCXA 4L9TA 5BNGA 2R5YA 4XRSA 4GGGA 2LG4A 2H8WA 1F36A 4GRIA 2XB0X 5CVRA 1P6RA 2M4KA 1W5CC 2DA6A 3JRGA 4N0BA 4ESJA 3OSGA 2A5YB 4F55A 2NVQJ 2CO5A 2KIUA 2L7ZA 3VDXA 2IW5A 2DK8A 3HSFA 1H9TA 2CQXA 1JKPC 1RESA 5B5EC 4BQOA 4HNVA 4M9SA 3U1KA 1T95A 5LHHA 5M5XJ 1I3AA 2X4HA 4E7LA 2JZYA 3HTSB 3P7NA 2ZMEB 3H9GA 4AIJA 3VSLA 2XAJA 2Q2EB 4XBFA 4DNCA 5IY5H 1OCTC 5LGTA 1I1GA 3KE2A 4EQQA 2HPMA 5M5YJ 4DQ2A 1Z05A 1R9TJ 1CQTA 3KLNA 2EFOA 3JRIA 1ZLKA 2JA8J 3S1QJ 1OFCX 1YW8A 2XPVA 4DBRA 3BP8A 4GYGA 2VQGA 3A02A 1ZK8A 3MVPA 2W25A 1YG2A 2F5VA 2F5FA 3KP7A 3IWFA 1FSHA 3CLQA 2IU5A 3I59B 3J7AO 5K1YA 3EGQA 3FXQA 1MMDA 1N25A 3KFWX 3HOXJ 5IYDJ 1EA3A 3PM1A 2MA3A 2W82A 2H09A 3K0LA 1Y6IA 3F6VA 2X1DA 4BS9A 1FOKA 4Z6YA 4XL9A 3VOXA 4XORA 2FMYA 4S05A 2O8KA 4G7ZF 3DEEA 1DP7P 2IXSA 3EUAA 2FBQA 4TV7A 1MBFA 1U5TC 2CQ7A 2JN6A 5LBQA 4ZH4F 1LEBA 2Y69H 2LYCA 2HYJA 4A0XA 3BR2A 3UR3C 4NELA 3DFGA 3TOAA 1HKSA 2E60A 2NX4A 2EJRA 1JUMA 2X9DA 4EM0B 5FJ8J 3FXRA 3PNYA 3CCRI 3J7AY 4PGHA 3WODF 4II2A 2K85A 1WCMJ 4WK8F 3BG5A 4A6DA 2JVHA 4IF4A 1MW7A 3ZQGA 5LHIA 1JE8A 4JKZA 1OR7A 1TQIA 2NOJB 1AKHA 4UY8I 3OYAA 3G6EI 3QP5A 1IN5A 3W6JB 2Z5UA 1S5LC 1H8AC 2JJ7A 2YPRA 3IP4B 2BEOA 4CYCB 3FXLA 3K1PA 3HRTA 3B6AA 1JTXA 4RA2A 4XSXF 1RR7A 1QZEA 2BOLA 2CFOA 3TW7A 1WKMA 4AIDA 1ZARA 2M0CA 9ANTA 4AYBN 3WTYC 1ZGWA 2W24A 5IOZA 3K70D 3G1OA 2XHKA 4HQEA 1TQMA 4LIUA 3CO6C 3S8PA 1YJ9I 1Y8RB 2DFIA 1R5GA 4NHJA 1A36A 5FGLA 3HE0A 3FKIJ 2R4GA 4G7OF 1IUYA 3OR1C 4LB5A 3O8HA 1FTTA 2QWWA 3TDZC 1W1WE 3PFIA 2AO9A 4RM2A 3AG1H 1MBHA 2GFNA 2IRFG 2PBIA 4KMUX 3FK6A 2ELHA 4M3DA 4YEJA 5HODA 3HTIA 3TP0A 2HU9A 4M3BA 2V1XA 4M3FA 5LEKA 1ETYA 5E20A 4DZPA 3PASA 1I5ZA 3HSEA 4O3MA 2STWA 5F1RA 4U0VA 1HC8A 1GV5A 3R4KA 1IN7A 1LEAA 5CKTA 2P0WA 4XKWA 2ETHA 4A3KJ 4RGXA 1QHHD 4FTHA 3M8EA 1Z7UA 2IT0A 1NHAA 1OMIA 2OPTA 1CF7A 2K3PA 2ZFUA 2M3AA 1WPKA 5KHDA 1DPRA 4EJWA 4LLGF 1AA7A 3E5UA 4HLXA 3J80Z 1FYMA 3H3UA 3CCJI 2VC1A 2M8GX 1P4XA 5HDKA 2A6EF 4P5OA 3V8JA 3PNTA 4U88A 1SAUA 4ZYEA 3CP2A 3IH2A 1BR1A 2Z2SB 1VI0A 2NOGA 1FBSA 3SZTA 2FD5A 3BTLA 3S2DJ 2ZXIA 5HLIA 1FOYA 3RD3A 2EH3A 3OYEA 3FF5A 2PZ9A 2GWRA 1TWFJ 1SANA 3FXOA 4A3MJ 3DXJF 2HVQA 3C3WA 4MNUA 2KRFA 5LRRA 4RB2C 2HYTA 2ZXHA 4YG2F 2XRLA 1B8IA 1VQKI 5ILVA 3NARA 1B9NA 3QPTA 4XLAA 3LSKA 4EEFG 3CCLI 3GXOA 3DPJA 1N75A 2ADUA 3HRSA 4IQ4A 3GW2A 5HBUA 3GTLJ 2EIMH 5DS9A 1QPMA 1Z67A 4M74A 2DLLA 4MTEA 1X3UA 2JSPA 4QPQA 4PJMA 1U5TB 2LC2A 2M7BA 1YFHA 1YJWI 3BR3A 2CGPA 2JA6J 1X3WB 3GTGJ 4I02A 2M0MA 4UVAA 3HDDA 5C4XJ 3PSFA 1PYVA 3ZN1A 3IV5A 2H8RA 5E3LA 4HDUA 2WAQA 3BJ6A 3Q3SA 2E34A 1UG2A 2HNHA 2MFZA 2AHQA 4Y33A 3S3MA 1I3QJ 3Q0UA 3FDYA 2W48A 2XAGA 2DW4A 2LY2A 3WTTC 2JA2A 4HV6A 2FXAA 3P5JA 4RLQA 1K4SA 4U9LA 1ZELA 1GHCA 2HZDA 1X4PA 4F52A 4XOPA 3CC2I 4Y7NJ 4B3XA 5CVIA 5M5WJ 2IBDA 3ERED 2CW7A 3ESWB 2L2OA 2GM4A 4HF1A 1MMAA 3B81A 2DA1A 3AQSA 2KPMA 3JAMK 3HZJA 5F04A 3LA2A 3SJMA 3LNQA 4EGZA 2B3WA 4XN3A 4ENKA 2HZTA 4IRHA 1PP7U 2W53A 5L3BA 2LKXA 2VE9A 2JA5J 1R5HA 3PSIA 3MNLA 4NNJA 1FMWA 4HYEA 2M9HA 3BG3A 4F3QA 4KFCA 2DU9A 3TO7A 1KA8A 4A3LJ 2E1OA 2A07F 3ASNH 2QQ8A 2P5KA 4NQWB 2K5CA 5HNHA 2E2IJ 3F1BA 4U87A 1WH5A 4XRMA 3LSRA 4S04A 4UUSA 4M3GA 5GTHC 2QF7A 4MLOA 4UNOA 1FP1D 5JHUA 2DQRA 1YRNA 1YOVB 1T6SA 2VKHA 1R1TA 5E3NA 2EV6A 2FBKA 4G7HF 2XAUA 3C07A 1S6LA 3C7JA 2MH9A 3HYIA 2HWVA 5EDNA 1ZG1A 5TGTA 3S17J 1E3OC 2R0QC 3HPGA 3I53A 2OUMA 3BDDA 1T0FC 2VIXA 4BE1A 2ESNA 3VYSB 2FX0A 3FKJA 3KEYA 4BDZA 2HQRA 1LUJB 4V2FA 1IJWC 1ZRFA 1N78A 1F4KA 5H20A 2OF7A 2IS4A 1OYWA 3TKYA 4ETSA 3GLLA 4CXFA 1K79A 1TWCJ 3HOYJ 2E7XA 1X58A 1YO5C 1LPQA 4A3EJ 2X1EA 1BI0A 1ORKA 3BY6A 2GLOA 1B8IB 1HW2A 2NP3A 2QKLB 2QCOA 4ZYHA 1VQPI 1A04A 3ZQFA 1SD7A 3G1LA 4N9IA 3GF2A 4QIWN 3D1NI 2EBIA 5FD6A 1MD0A 2WADA 3VODA 4HX8A 3MZHA 1FZPB 3KKDA 3L2QA 1RIOH 1FBQA 2XGCA 4ZDLA 4RBOA 2QA4I 5JR3A 4A3CJ 1Z1DA 4U7DA 4C2TA 2K7LA 2Y48A 2K4BA 3QPSA 5FKKA 2E2JJ 3GWZA 1YX5A 4KICA 2PFVA 2Y2ZA 4BJTA 3ABUA 1DDNA 5EEAA 3DPLC 3RDIA 3BPXA 1OCZH 5A2QZ 1SVLA 4LLNA 4B09A 2ZXJA 2EIKH 2EK5A 4LK1F 1SAXA 3OYIA 1E17A 4ZJZA 3TL4X 5E8IA 2ZFWA 2M87A 3OSFA 4V19K 4ZDOA 2H6BA 3I0TA 2X6XA 2STTA 2DDAA 2BVMA 3OS0A 2HTSA 4XIDA 3I56I 1K78A 1MMNA 4GDFA 2VOOA 4Q5SF 2DFHA 4FQGA 2LBFB 2WBMA 3HTAA 2BY1A 1XDUA 1R36A 2QZ8A 1M1EB 1R1UA 4OD4A 4Q47A 5EEHA 1G3WA 3T1BA 2GA1A 2PJRB 3A2KA 5CYVA 1P92A 4BUPA 1IN8A 2KL4A 3UNGC 2F4IA 3ELKA 2X0LA 1I39A 3J80K 4RB3C 5HLTA 2K9LA 2OBPA 2ZC2A 1EH7A 1IGNA 1VQ6I 3SWHA 5HS8A 3BR5A 2RN7A 2E71A 4GFBA 2GQQA 2M1BA 2MABA 2A6HF 1LB2A 1WJCA 5CJ9A 2XROA 1APLC 1K78B 3A03A 1B59A 1XSXA 3FHNA 1VF9A 5D4RA 5F64A 3DP7A 3C1DA 4B44A 1G3YA 1LVKA 2YSRA 2GENA 3RKWA 3CJTB 3L2VA 4HAMA 3CJNA 5H2FC 1MNMC 3BQYA 4AIHA 3KEOA 4CCNA 5E18F 4JX4A 4G6TB 1FSEA 3OL4A 1MIJA 3E6BA 2HOEA 4LK0F 3M7GA 4HQMA 4MQ9F 1P4WA 5ICGA 3W6VA 2DMQA 2QWTA 4YFKF 1KGSA 1QHGA 1BM9A 2FMLA 5DTDA 3JRDA 4OD5A 4A0ZA 3G3ZA 1A5JA 2D2WA 2BW3A 1MMGA 3R0JA 3HTUA 4S0HB 1DPUA 4XSZF 1VQ9I 3MFKA 3JRHA 1QZZA 1KZHA 5CXGA 3FM5A 3MEXA 1TTYA 2BXZA 4GCKA 1E2XA 4Z2YA 1TT0A 2UXPA 2DQLA 2HGCA 1RETA 3O8GA 3IRRA 2WB1A 2V9VA 3BCGA 1R6RA 3MMYB 3M8FA 1NK2P 1WSUA 2E2HJ 2HQNA 2QQ9A 3L00A 4BNCA 2A68F 3OWTA 2DG7A 4M9XA 5J1RA 4CDGA 5IT9Z 1ON2A 3OYDA 3KZ9A 1GVJA 1USSA 4XLFA 4EJTA 2IPQX 1U6GA 3NNRA 4C3HJ 4CUGA 2EILH 5GPCA 4NN1A 1R7JA 2RDPA 2OTJI 2E1MC 2ZNYA 4JBAA 3IH4A 2UXXA 4IQJA 4BHBA 1TBXA 3ZRGA 1FBUA 3JAMZ 1W0UA 1QRYA 2O03A 5D8LB 1BJAA 3VPRA 4I98B 4BACA 3V42A 3CDHA 5FKLA 2AXLA 4PJJA 2WGBA 3FM3A 3K4BA 1Q1HA 1V4RA 3MCZA 1FIPA 1IV6A 3CJDA 2VOPA 1Y1WJ 2KLOA 2Y9YA 3ZMUA 5TISC 3CMEI 1IDZA 3E6CC 1XTAA 2J5PA 4F93B 5JVTA 1XGNA 3F21A 2HVSA 1OJLA 5LFAA 1IN4A 4U0WA 2Q1ZB 3GZ5A 4AF5A 1BOAA 2LF7A 3D5RC 4A5MA 2A5WA 1GV2A 4BE2A 1Y56A 3LAPA 1D8JA 2CQNA 2R7FA 5C4YA 2CWEA 3BR0A 3IC7A 1OCOH 2BGCA 2CS3A 2L01A 1AWCA 1HKTA 5CVUA 4K2EA 4OAZA 3COAC 3BTJA 1VFCA 5BPIA 1G8XA 1UHMA 2D1VA 3C2HA 2V6EA 1VNDA 2CFXA 2HKXA 2P7VB 4DYQA 1NH3A 3V7RA 5GAEJ 1USTA 4XKBA 4C3JJ 3LQRA 5FLVA 2ISZA 2D5VA 3DEUA 2AQEA 4A69C 3I54A 4ZTFA 3FHZA 2R7RA 2M34A 3LHQA 4A3GJ 2MLGA 2KDZA 3ECOA 1IO2A 3MN2A 3GCMA 2IGNA 2GXGA 5AIPA 4R79A 3PIPF 1WJAA 2JPCA 2E5ZA 3V7SA 1OCCH 2FSWA 2L9RA 3AG4H 1GT0C 3RI4A 3K6GA 1J09A 3Q9SA 2R93J 3SZGA 5AIQA 1VQ4I 4KN4X 4XONA 4IHSA 3PIOF 2WAQN 3J81Z 3GTOJ 2R7WA 5F6FA 3K10A 4BQNA 1FTZA 5F27A 3ZQHA 3HGYA 1X19A 3BOQA 3TW6A 2DI3A 1F1ZA 2ZNZA 1U5TA 3T8RA 3GTPJ 4B1RA 4P1WA 1ZLJA 3D5SC 2PBXA 2VB6A 3SZPA 4KNYA 4X0GA 2VPRA 3JSPA 1UZCA 2B9SA 3BR1A 1JKQC 1WRJA 5L3EA 2CQKA 4ZYGA 2DMNA 3WTSC 2DTRA 2VC0A 2GIZA 2XGEA 1D1AA 3HXLA 1SFOJ 4CGRA 2ECCA 3MWMA 5J4YA 4J01A 5ILSA 3G71I 2COMA 2FE3A 2EZKA 4PFPA 2JMWA 1UCRA 1FOXA 3GFLA 4HW0A 2W1OA 4AVZA 2FBIA 4UVCA 4RS8A 2QLZA 2RGVA 4BH9A 5LEJA 1XCVA 3E0JB 4AC6A 5E3MA 5B1BH 3KP3A 3E7QA 2Y0MA 1QBJA 3HGGA 4MQVA 1V5FA 2HEOA 1DUXC 4PFOA 3FXMA 1TQPA 3CJQB 3KZZA 1MJ9A 3K70C 2EINH 4IJAA 4PJLA 3KZYA 4B4CA 2OQRA 3REOA 2CH0A 2LKPA 5KAFC 1P9QC 3G73A 3DBRB 2P5VA 2LOOA 5CQEA 1J2XA 3PJRA 1WHUA 4ZC3A 3RZOJ 3H5NA 4KT5C 2E19A 1PUFA 3GUDA 4OIQF 2DMTA 2K9NA 2W00A 5J8FA 4GXOA 2UXOA 3LOCA 2UWMA 1UELB 5D4SA 5CW8A 2XF7A 2Y30A 2YUSA 1YS6A 4E6KG 4WCGA 4AU7A 2OERA 2F4MB 2JRMA 3I9V2 4MIMA 4HX4A 4W97A 1MMSA 5K7HA 4CSWA 3VVZA 2HXIA 1ONVA 1QNTA 1ZGJA 1D3YA 2A69F 4IVNA 4E7HA 3N4MA 1B72B 1SFKA 3NS4A 4KJZA 4B8XA 4BU2A 4H0EA 4HZFA 4E7IA 3K8PC 2DAOA 2Y31A 2VI6A 5KAIC 4HV5A 1ENHA 1XN7A 4BQQA 1DGRM 1SMTA 2OAZA 1BW6A 3DLLF 4IHYA 2DODA 4L18B 3Q9VA 3I64A 4CYCA 1T39A 2H27A 4ACIA 4ZYAA 3JSOA 3QYFA 3K4NA 2X6OA 4UVBA 2JSCA 5D5UB 3G56A 4XK4A 1E3PA 2G0EA 1L0OC 2O9LA 4PUSA 5JFRA 3S1RJ 3HUGB 3GTMJ 5JLWA 4NBQA 1RKTA 3S1MJ 3M1EA 5HS9A 3ABKH 1A35A 5FGMA 2ZB9A 1U2WA 4LMYA 3MZYA 1U8RA 2DBBA 2HFHA 1NG6A 1ZREA 1MDMB 3QPLA 3TOBA 2KFDA 1BC8C 3CF2A 3WGIA 3GZ6A 4AIKA 3DU6A 5CQGA 4BXUA 2ZJRF 2MG4A 4XKVA 2VL8A 2OZUA 2ID6A 1Z0XA 2OCCH 3CMAI 2DMPA 5D1RA 3JTGA 5B1AH 4IHXA 4LG0A 1RC9A 3H5RA 4LIVA 3RPQA 1T2KA 1SD4A 5HLHA 2BHYA 1SEUA 3JREA 3OS2A 3VW2A 1EKEA 3FXUA 1GLNA 2F4OB 2Z9OA 1G59A 3ANPA 2CUZA 2DT6A 5E1ZB 3LWJA 5DV5A 3DTEA 4IO9F 1MSEC 3KYLA 4EJVA 4XRFA 3GTKJ 4RB1A 4A3JJ 2VLAA 1BL0A 2WY8Q 1F9NA 3HJEA 2HKUA 3NAUA 1Z3XA 2FU4A 2ZCNA 2YU9J 2DA7A 3MKYB 4NDLA 1FC3A 4LLLA 4XRSG 1DQUA 3COLA 2IP2A 2JVGA 2HVRA 2F48A 4U9NA 2XAHA 2KT0A 3F72A 1XX5A 2DA3A 4EM2A 5J6XA 1FJLA 2XSJC 4ZTJA 2VJ4A 1S7EA 4IZZA 3ZMZA 3F8BA 4LJZF 3RPUA 2I8DA 1T38A 2OD5A 4M3EA 3LAJA 2HOTA 5CVVA 1K61A 1UAAA 3T0YA 3E5XA 2LTPA 3CCYA 4J00A 3S93A 4HNUA 4XLEA 4BHCA 2DOAA 1S7OA 3JW4A 4N4OB 2JTVA 3J81K 1X1DA 2WWYA 3AKZA 5AQCA 1LKXA 2A05A 4MEYF 1O4XA 1B9MA 1T0FA 4ITVA 2L7KA 1GDTA 3K7AJ 4LFUA 4FETA 2LVSA 3WTVC 2ZCMA 4H4KC 5TRDA 1BBYA 3HKZA 1SD6A 2R7OA 2VQCA 4YELA 1JGSA 1T33A 1JTYA 2VPLA 2PLYA 3PQJA 5GAGJ 2G7GA 2OI8A 3NRGA 5TJJA 2QENA 2K40A 3IWZA 3LA3A 5D19A 4HDVA 4XLNF 3CUQB 3LWFA 5E1XA 2XPUA 5L3GA 4Q4ZF 2V9PA 4YIRX 2G7UA 3OYMA 3V8KA 4HF2A 2O6GE 2NVYJ 1ETXA 2ZCWA 3TEDA 5FFXA 1UMQA 3WHBA 3F8MA 1RNLA 2ELJA 4KITB 3I55I 4IOAF 3BG7A 2R5ZA 3F9KA 1UFMA 4WX9A 1O7FA 3SYTA 1X1AA 1RUOA 3CP8A 5B66C 3HHHA 1XD7A 3FMSA 1FYKA 1Q1VA 3OY9A 5KK1A 1X4OA 3HOUJ 4G9YA 3L7WA 2CV0A 4ESFA 3OOPA 2L9NA 3IL2A 1KU3A 1Z77A 2VN2A 3W2AA 4EVIA 3RPUD 3P9TA 4LGWA 2KZGA 2Q24A 3PFYA 2DPUA 5IYBJ 5L3DA 1BA5A 2GZWA 3KCCA 3BC8A 3H9QA 3NWTA 3OIOA 1OCRH 2PG4A 3DKWA 5EG0A 3ECHA 5K5OA 1GUUA 3LSTA 4C2MJ 3R6SA 2XIGA 3OS1A 3K9TA 2W84A 2XKPA 3TP3A 1WJ5A 2RKHA 4CO8A 5LGUA 4QPOA 2BBYA 2LH9A 2X6WA 3DCFA 1D0YA 3IKVA 3KYDB 2Q8KA 3VW0A 3AL0B 1IXCA 4EM1A 2E1CA 2YVHA 1HDPA 1QPIA 3DBHB 5LGNA 2IA2A 1I6XA 4A3IJ 1R4MB 4D5CA 1WJBA 2G7HA 3QKXA 3CLOA 5IT3A 1AKHB 2IA1A 2BZTA 3WTZA 5LRSA 2L7MP 2MGQA 3F22A 3H3VK 4UV8A 3BZKA 3PPBA 3D5LA 3ZMSA 5H9TA 1YX3A 3KIOA 1FPQA 2KQRA 3ZOBA 3BZ6A 3HBLA 3RTRA 3I58A 4O5VA 2L0KA 1FNNA 4RGUA 2MSYA 3PUBA 5K5RA 3OIQA 3S2HJ 1WVRA 2O8XA 1X2MA 1IN6A 4HSTA 3QP6A 2FJ1A 1BI3A 5IPAA 5AONA 4GCLA 2HDCA 3LSJA 1AOYA 1KONA 4GO1A 3EYYA 5EGOB 4C30A 4XMYA 1DGWY 1ZKGA 3LSHA 4CCLA 4HRIA 2GOMA 3FWEA 2VXZA 2ZO4A 1IAWA 3T8TA 4CGZA 2R3SA 4CYDA 2LNBA 3E7LA 3CCMI 5FRNA 3I59A 3S14J 2LDUA 3BCBA 2ECBA 3RKXA 2XC7A 3ONQA 4RAFA 1H9GA 2CUJA 3LSPA 3QRFF 1BC7C 1PVEA 3G1MA 4WXDA 2H1KA 3GFMA 3SXYA 3HOVJ 1P4AA 5HNFA 3WGHA 3SEQA 1X1PA 4XKCA 3ZQCA 3BWGA 2PMUA 3R0AA 2TDXA 4NB5A 2A2FX 2KJBA 2REKA 4IXAA 4XNFA 3HTHA 3AG3H 2XGDA 2PMZN 2V1NA 1Z3YA 3Q0WA 2FJI1 2X1CA 1A6IA 3HKZN 2HXOA 2QUFA 3KP4A 3IAM2 5HDNA 3GO5A 1XG1A 4I99C 2XGXA 4AUXA 5JVGF 2K02A 2VQLA 3ZR8X 4ANJA 1TC3C 2QKMB 2Q0OA 4D1QA 2EA4A 5HAWA 4Y15A 4CHUA 4KISA 3VTIA 3V4GA 4E7SA 1U78A 4HOBA 4PSXA 4IHWA 1E3HA 4UUVA 2GBYA 4HX7A 2CSOA 2CU7A 1PUFB 4DZJA 4NQWA 1X1BA 3S3NA 1OKRA 4B48A 1HXDA 3RJPA 4MO7A 4C3IJ 3VWBA 5CVJA 4L5JA 5EYRA 1YLFA 3N05A 3GFIA 2BW3B 5E8GA 2XAFA 1GXPA 2HR3A 1AHDP 3ZMTA 2DPDA 2MC3A 3AL0C 3M9AA 3RQ4A 1YITI 2A61A 1YIOA 4QTRA 4CZZA 5ICFA 4IRVA 4ENJA 1MBGA 5E3OA 2KHMA 1W7PA 4E4HA 2KIQA 5A2QK 1PUEE 2ZMEC 1ULYA 5B3SH 1D5VA 1KYZA 1J0RA 3VOEA 5DDGA 1L3LA 1QZYA 2WV1A 4Y3OA 3SDBA 2KIFA 2Y9ZA 1FY7A 4MFEA 3H0DA 2HYFA 1HSTA 2ZKZA 3BG9A 2ICWG 3K4KA 2RASA 4F91B 2R92J 2DMUA 3LSGA 1PDNC 1I27A 3M07A 4EMSA 1XMXA 4U7BA 2A6TA 2DYSH 5IYCJ 3P9IA 3M4OJ 2RQQA 4YIIA 5EJCA 3BJAA 3GZNB 3HUGA 2M2EA 3DKXA 1UI6A 1U0JA 3CWRA 1IRXA 3BCAA 4A5NA 2EB7A 3ABLH 1KU9A 2QVOA 3VUQA 3L2CA 4Y4RA 3O2PE 5C3EJ 2ACJA 3HIFA 2BXYA 5M3FJ 2N8GA 2MBFA 1LFBA 2P8TA 3EDPA 3OYNA 4JOMA 4UXNA 1VQMI 4A12A 1WZ2A 4ZYDA 5JLXA 2GIVA 1X2NA 2HPIA 3D0SA 3V7CA 1KYWA 2RVCA 5ERIA 1TLHB 1ZTRA 2E1MB 1BIAA 2DK5A 3AG2H 3KYCB 2B0LA 1Z7LA 4PJ0C 2DT5A 3ZQIA 2OV7A 1IG7A 3LQQA 4ZDPA 3O3KA 4WXHA 2CW8A 3MQ0A 3H1CA 1K7AA 5HVQC 2VODA 3I4MJ 1S7AA 5KVRA 4MGRA 1Y1VJ 2VJIA 4N4NB 4Q48A 1XDSA 4G6QA 4I7HA 2HDDA 1XCBA 3KP2A 2KKOA 1Y39A 2UZKA 2R7UA 1IDYA 2ISYA 2VJ5A 3L2RA 5FLXK 2K27A 3DWLE 2ZJ2A 3E1SA 3ZCOA 2B1EA 3F8FA 3DU5A 2QQBA 3CC7I 1NTCA 3DPTA 3N97A 2YVEA 3RIRA 4D7MA 1BW5A 5K5QA 4G6DA 1FMVA 2GXBA 2QTQA 1LVAA 4IHVA 4JK1X 2AQFA 4M6YA 3WHCA 3RKQA 2D45A 2UXNA 3V78A 1ZH5A 3G4SI 1OCPA 2WTEA 2X48A 3NWSA 2EZLA 4JP0A 4HLYA 5DCFA 2PQ8A 4L9JA 3VVXA 2QEXI 2F5CA 2XASA 1QA6A 2WB1N 4MEXF 3F8NA 4GCTA 1LE8B 4YFXF 4BXXJ 1ACIA 5IT9K 3OOUA 5JI6A 3WTXC 4IKFA 3S3OA 3I5UA 3VIBA 5LHGA 2RREA 1HW5A 1YI2I 3OMYA 1I50J 4FHTA 3B02A 4L5IA 4BY7J 5ED4A 3GYHX 2BVLA 1WI9A 4D0PA 2IGOA 2I10A 2KZVA 2IS1A 3H92A 5FKNA 2VONA 2TRTA 3PQKA 3BLYA 4KIGA 3OYLA 1S9HA 2QOPA 3WGGA 1UG0A 4UUSB 1G4DA 1I1SA 2COBA 2PFBA 4D7NA 2FNAA 3CC4I 3WE2A 2Z33A 1QGPA 3L09A 5LLQA 3K2ZA 1B4AA 2FUG2 2FBHA 4P96A 1X1CA 1XB4A 4KT6A 2GUHA 1RZ4A 3CDIA 2IJLA 4JX6A 1S3JA 2LREA 4M6XA 1J9IA 2YS9A 4UDSA 3TQNA 3GEZA 2P6SA 4HNTA 3CESA 2GA2A 1W0TA 2LBFA 2R5ZB 3JCUC 3ML6A 1HLVA 2NAZA 4EV0A 1U3EM 4BHPA 1QVTA 1VQ8I 1S8NA 2YU3A 1R1VA 3K1MA 3P9CA 2IGMA 3FZVA 3GVAA 2L9SA 1NG7A 5J40A 4OIPF 2L5QA 3J7ZI 3PO2J 4XLCA 4BXFA 4WF2A 4FE4A 4FT8A 1WFXA 4X1EA 3ZMVA 3FK7A 5EFYA 4A2UA 3HOTA 2Q2EA 2MD5A 4I0AA 1Y8QB 3K4JA 3CJRB 2VKDA 1LNWA 3RQIA 4IPAA 5L3FA 2EFPA 1DP3A 5DD4A 1B1BA 4I2OA 3BRUA 2QSHX 4CCKA 3E5QA 5JHFA 2R7DA 3L9FA 1TWAJ 1TP4A 2QYOA 4ENNA 3OL3A 1CGPA 1BR2A 2FEZA 4A3BJ 1GVDA 1J7KA 1Z6TA 5HS7A 5DD8A 1R22A 3ZQQA 1P7IA 4L62A 1QO0D 3QWLA 1IXRC 2XV4S 3RZDJ 2RQPA 2KDOA 2D6YA 2R7SA 4P9UA 4ON0A 1BJZA 3DEWA 4DOZA 2M4GA 5D6FA 3EPZA 5J3LA 1YHQI 2FOWA 3SFZA 3VB2A 3KX2A 1LE8A 2R7TA 2W7NA 2OQGA 2ZXWH 3HC7A 3W2WA 1BI1A 1U9OA 3GMEA 5BOXA 4AM3A 3Q5FA 2LFBA 1P2FA 2QQAA 1D0XA 4A6EA 1R23A 3VFZA 4MFDA 2VBWA 4RDUA 5J1UA 3SHFA 5LD2C 2WV0A 5EEGA 3GFJA 4I6ZA 2Y0SN 4GFKA 4WXCA 1YJNI 3ULQB 4ZZDA 5FKMA 3R60A 2Z1DA 4JNNA 1SD5A 2FNPA 2UV1A 3KKCA 5DAJA 5IP6A 1T8IA 1XSVA 3KEQA 2HTJA 3ZN0A 2WY7Q 3E3VA 1KQ8A 2XDNA 3VW1A 1ZR2A 1CF7B 4KN7X 3PO3J 3ZXSA 2IS6A 2QSFX 1D1BA 4NUBA 2JPBA 2NNYA 1HDDC 4ZZLA 3GZIA 3ZP5A 4D5FA 3ANGA 2JWTA 3KZIC 3SFIA 4E7ZA 3W6KB 1JKOC 3A0HC 3S1NJ 3LSMA 3EQLF 3VSKA 4XLPF 1R58A 3NXCA 1QVUA 1W7PB 2HOSA 2VKEA 5ICCA 1Z91A 4L0YB 1KU7A 3DV8A 1TW3A 4XLHA 1ZGAA 3LL7A 3HB9A 4IL6C 3ABTA 1PP8F 2NS8A 4F92B 4HBLA 3ZQLA 5F0HA 2FQ4A 4P55A 3WTUC 2P7CB 1XMKA 5J47A 2JUCA 4OIOF 1EH6A 4OINF 5J8CA 3K1NA 5FLXZ 4I09A 1MNDA 2K86A 1P7JA 3CMYA 5F1JA 4KWAA 3TDUC 1V5GA 2VT2A 1JI8A 2L9VA 1WJFA 1VQ7I 2QKOA 1FIAA 1V5EA 3RYRA 2OA4A 3CQZJ 3CCSI 1K6OA 3AQTA 3M3YJ 1TNSA 5DEQA 3IH3A 3HM5A 4LB6B 3CZ6A 2CQQA 2M30A 4L9VA 5DM6F 1V54H 1K4TA 2CUFA 1UB9A 5GAHJ 2EFWA 3IAS2 2F2EA 2WA0A 2EFQA 2DOEA 3CCQI 1HSJA 1UHSA 4UV9A 2YX4A 3U2RA 4DYCA 4HG2A 1UI5A 5FFZA 2NP5A 2UUZA 2OC6A 3W2VA 5FB2A 3G2BA 1LDDA 3BT9A 4OMZA 2WAEA 3CO7C 1J59A 1T98A 2OU2A 3BROA 2VE8A 1SMYF 2HI3A 1SC7A 4ME9A 4AD9A 1R5ID 4L9NA 3OYGA 2QBYB 1FYLA 2DO7A 1G3SA 2CW0F 1STZA 1ZRDA 4MK6A 4Y52J 5J1YA 1BIBA 5K7ZA 1HW1A 2L4MA 3QPHA 3CUQA 3O60A 4ICHA 4OU0A 3R61A 1IRGA 4PSWA 4BGDA 2VBZA 3K4MA 1MBEA 3BJBA 5E1WA 4F7ZA 2E36A 2V4JC 3E6MA 1RI7A 3ERMA 4RMNA 3C18A 4Y13A 3CCEI 4DBQA 2JUGA 3U1DA 2IAIA 4KUMA 4PGGA 4I76A 3RKYA 1JKRC 2RHAA 4LITA 2CJJA 3WU0A 3S15J 1N77A 1BN5A 1X3ZB 1TWGJ 1LDKB 4X6AJ 3G7RA 1MBKA 4DIQA 5E17F 3MZ8A 3KETA 1ODDA 3HOZJ 1R71A 4A3DJ 1ETQA 2NVXJ 5D5VB 1V3FA 3B73A 1WGXA 3WU1B 1HBXG 2LMDA 1YW7A 2M7AA 2P6TA 4BEHA 4FE7A 3L1PA 2CV1A 2E5NA 2EFNA 1OYYA 3L2UA 3FRQA 1POGA 3LSIA 3HTJA 2XF5A 4FX4A 2F6CA 2BY2A 4BBRJ 5GADJ 4B43A 3BG6A 5IOYA 2NXNB 3W3CA 2HQAA 3U9GA 2K3FA 1W7PD 4BAYA 2GXAA 1KQ0A 2M45A 2V6CA 3FIWA 3A0BC 3A1YA 1H88C 4YZEA 3LA7A 2ZJQF 2HDWA 2RNJA 4ESBA 5HLGA 3NI7A 2CG4A 1R49A 5GTIC 3GEUA 3K4CA 5E79C 3U21A 2WUIA 1SVOA 1JJ8C 1KU2A 2ME6A 4OOIA 1WH7A 1W36C 1MJAA 1S29A 3KPHA 4AVPA 5F0FA 2PN6A 1ETWA 2RNGA 3ON4A 1T56A 3V8LA 1D8KA 2EQRA 2ZJPF 2JK3A 2KP6A 4BYYA 3AFHA 2ZBKA 2DXIA 1F43A 1IUFA 4GYIA 5J4VA 1MH4A 2HKOA 4OWRB 2V57A 4BY1J 3ZMDA 3WG9A 2LLKA 3AAFA 4HPQA 2CUEA 1XGSA 4M73A 1VTNC 4IRIA 4JX5A 1VQNI 4JQFA 4EGYA 3NPIA 4FX0A 2PJRA 4IHTA 2UXUA 5D5WB 3DTKA 2Y0SA 2V1UA 4Y17A 3DBLB 2DDBA 2FF4A 3LMMA 2JRTA 2ID3A 3EETA 4C9YA 1K83J 1W4MA 2DTZA 1IC8A 3CTAA 3Q0VA 3HRUA 3I71A 4B3AA 2K4JA 1IF1A 1XS9A 1J5YA 4RLFA 4CH7A 5EG0B 2I5UA 5C4JJ 1JUSA 2CV2A 3BPVA 3OIPA 2XVCA 2F5DA 3JTHA 2E35A 4W1UA 5EZHA 3LJLA 1LQ1A 1KQ9A 1JT6A 3JRBA 1BR4A 2CRGA 3QYBA 4PK4A 2XUBA 3E6DA 2P5LC 6PAXA 4RGSA 3H5AA 1MZBA 4UB8C 5BMZA 1HCRA 2DFEA 2X51A 3ASOH 5D5XB 3VYRB 3IUOA 1YW9A 4HEA2 4RB0A 2G3BA 4LG3A 1HQCA 3I3LA 1ON1A 5FD5A 4BJ6C 2DA2A 5DYMA 3NRVA 2DYRH 1SVMA 2EIJH 2XDVA 2W4SA 3L2WA 3HG9A 1XGOA 2LY9A 2M5WA 5GP9A 2W85A 4E7JA 4NC6A 1SFUA 1O3TA 1TL8A 1REPC 1T08B 4AC0A 2RC4A 1Z9CA 1JHHA 2FOKA 4IX7A 5CLSA 1YYVA 2VBXA 3FMQA 3K4LA 4D9JA 3WE3A 1HF0A 2MW8A 1ERDA 5BPDA 3CUOA 1E0EA 4GCVA 3VOKA 2DA4A 3ZQ7A 1OISA 2NNNA 2QSGX 2XB5A 2QBYA 4PCQA 1ZN2A 2JT1A 3DKYA 4MHGA 4J19A 2IGKA 2EZIA 4XN0A 1D0ZA 4RM3A 2F07A 5FMPA 2DT7B 2MYSA 4QSHA 3GX4X 3JSJA 3GTJJ 3HPHA 2L3DA 5DCMA 1LDJA 2V26A 4I01A 2VQHA 4L5EA 3F3XA 3TMOA 2YR2A 2O5RA 2UXIA 4LG0B 3LFUA 3BHQA 3O6BB 1W5SA 3RH2A 2VXDA 4A93J 2AS5F 4UHTA 3MKZA 2Z99A 1SGMA 3H35A 1YE9A 1ETVA 3TGNA 3I4NJ 4G8XA 3T5XA 1MDMA 2G7LA 1JUPA 2KRHA 4UB6C 2VASA 1A6QA 2P81A 3HOSA 2ZSIB 3OV8A 4WWCA 1OLTA 4IOCF 1QU3A 2AXTC 4PZJA 5HDGA 2RV8A 3NEUA 3A01B 1ITYA 2LP0A 4BEHB 1MNEA 5EZGA 4DVYP 3QQAA 2ESHA 2V1DA 4XICA 4IRGA 3RCOA 1XC5A 2EV0A 2BYVE 2P4WA 2D1HA 3KLOA 5FHPA 3ZGKA 1Y0NA 2B63J 2EWNA 2VT3A 3VEPA 3EUKL 1G2HA 2QM3A 2EPFA 2FQ3A 1ZRCA 1FEXA 3F23A 2LK2A 2VJJA 1K6YA 1XPXA 3QU6A 5FO5A 1YTYA 4XQFA 4E70A 3SQNA 3LFKA 1VQLI 2IS2A 4OMYA 4N9HA 2R7VA 5KCMA 2K9SA 2XKOA 3BTCA 3S2WA 1TNTA 3RYPA 4CCMA 2LF8A 5H6QA 2LRDA 3CCVI 3OYFA 1IW7F 3A4CA 4HSRA 5EGOA 2LSOA 3K69A 3IKTA 2W57A 3FBIB 1JXSA 1H89C 4XM3A 4DYRA 1RR8C 2FA5A 1MGTA 2H94A 5FLMJ 1ETKA 3DPUA 5IP9J 3CMMA 2DJNA 1WQ2A 1D5YA 3TBIA 3DLAA 5FRMA 4FCYA 2EZHA 2PX9A 3H36A 1NK3P 2GOXB 2ZOYA 2EA2A 2MC4A 2V7FA 1HA8A 2L54A 1VZ0A 2HYGD
chains in the Genus database with same CATH topology
4EEFG 3DPJA 1RKTA 3S1MJ 5HBUA 2ZB9A 2XSDC 2O7OA 3GTLJ 5DS9A 3PO2J 3QPLA 1ETOA 4FE4A 3CDLA 2JA6J 3BR3A 4X1EA 5F08A 3FK7A 5EFYA 2MG4A 5F0CA 3GTGJ 1DU6A 2ID6A 1Z0XA 3HDDA 2DMPA 3RQIA 5D1RA 5C4XJ 4IHXA 3IV5A 2H8RA 5E3LA 3Q3SA 3BRUA 1UG2A 2AHQA 1I3QJ 1TWAJ 3Q0UA 3JREA 3MKLA 2W48A 3VW2A 5HSZA 2R5YB 2IEKA 4A3BJ 3ANPA 5K7FA 1GVDA 1DU0A 3LWJA 1MSEC 2JA7J 4Y7NJ 4L62A 1P7IA 2XPWA 2VKVA 3RZDJ 3GTKJ 5M5WJ 2IBDA 4LOCA 4A3JJ 2D6YA 2GM4A 3B81A 1BJZA 1MBJA 3DEWA 3F0CA 1BL0A 2HKUA 2DA1A 3AQSA 3NAUA 5J3LA 3H0GJ 2ZCNA 2NS7A 1LE8A 2YU9J 2DA7A 4NDLA 5F04A 3SJMA 3LNQA 4XRSG 3B6CA 1MH3A 3COLA 2W53A 4V2GA 3CRJA 1U9OA 2LKXA 2LFBA 2JA5J 2NVTJ 2KT0A 3GBGA 3MNLA 2DA3A 4MFDA 2M9HA 3BG3A 4RDUA 1FJLA 5J1UA 1S7EA 4A3LJ 2E1OA 4I6ZA 2Y0SN 4GFKA 4FISA 4M3EA 2HOTA 5FKMA 2E2IJ 3F1BA 3VP5A 1K61A 4JNNA 1WH5A 4XRMA 3LSRA 4UUSA 4M3GA 3KKCA 5DAJA 5D18A 2QF7A 4MLOA 5IP6A 1YRNA 2VUMJ 2LTPA 5EF6A 3CCYA 1WI3A 3VW1A 5E3NA 2XDNA 1ZR2A 5CXIA 2HQ5A 3PO3J 3C07A 4UUTA 4MXMA 3JRCA 5EDNA 1JGGA 1HDDC 3S17J 5AQCA 1E3OC 2R0QC 1O4XA 3GZIA 4D5FA 1GDTA 3ANGA 2JWTA 3HEFA 3SFIA 3C2BA 3K7AJ 2FX0A 1JKOC 2LVSA 2ZCMA 4HKUA 4V2FA 3S1NJ 5K58A 1IJWC 2L7FP 3NXCA 2OF7A 1QVUA 2HOSA 2VKEA 1T33A 1JTYA 1TWCJ 2G7GA 3HOYJ 2OI8A 1X58A 3NRGA 4A3EJ 1ORKA 2K40A 2GLOA 3FISA 5D19A 1B8IB 2NP3A 3HB9A 2RAEA 2QCOA 3S16J 2XPUA 4G12A 3ZQFA 2NS8A 2DA5A 3K2AA 3G1LA 3ZQLA 5F0HA 2FQ4A 4DW6A 2NVYJ 4QIWN 3D1NI 2ME0A 1ETXA 1U9NA 2EBIA 3TEDA 1UMQA 3WHBA 3KKDA 4M6VA 2R5ZA 2XGCA 4RBOA 1P7JA 1LFUP 5FKOA 4ABZA 5F1JA 3CMYA 4A3CJ 4KWAA 3HIMA 3QPSA 1Q1VA 5FKKA 2E2JJ 1EF4A 2Y2ZA 2QKOA 1FIAA 3HOUJ 2DN0A 3CQZJ 5EEAA 3AQTA 1Z77A 3M3YJ 3P9TA 3IH3A 3HM5A 2Q24A 2CQQA 2DG8A 5IYBJ 1RKWA 1BA5A 2CUFA 4A3FJ 1IRZA 3OSFA 3OIOA 5EG0A 3GTQJ 3HOWJ 1GUUA 1U8BA 4C2MJ 4XIDA 1JT0A 3HTAA 4JYKA 1UHSA 3BNIA 3TP3A 4DYCA 1UI5A 5GPAA 2NP5A 4JL3A 3DCFA 3VW0A 3ON2A 3BT9A 2YVHA 1HDPA 1QPIA 2G7SA 4ME9A 2HI3A 3A01A 4A3IJ 4D5CA 3QKXA 3EUPA 1AKHB 4MK6A 4Y52J 1IGNA 5J1YA 5K7ZA 3BR5A 4ICHA 2L7MP 2MGQA 3O60A 3H3VK 4GFBA 3PPBA 3S5RA 5H9TA 1APLC 2QIBA 3ZOBA 2HOAA 3A03A 4GFLA 3HBLA 1VF9A 4IEJA 2L0KA 3JRAA 1MBEA 2K9QA 2MSYA 3BJBA 2GENA 2LD5A 1TWHJ 3S2HJ 1X2MA 2FJ1A 1MNMC 3BQYA 5IPAA 3JR9A 4GCLA 2ZOZA 4JX4A 2IAIA 3LSJA 1RPWA 3UKGA 4I76A 1JKRC 2O7TA 2RHAA 3BQZA 2CJJA 2QWTA 3W6VA 2DMQA 2TCTA 1YRNB 3S15J 5EGOB 1B72A 2UXHA 1TWGJ 1ZR4A 1ZKGA 4X6AJ 3G7RA 5DTDA 1MBKA 3JRDA 1JJ6C 1AU7A 1I6HJ 3VVYA 3HOZJ 1A5JA 4A3DJ 1ETQA 2NVXJ 3E7LA 4S0HB 1WGXA 1MSFC 1HOMA 3JRHA 4FE7A 3L1PA 3S14J 2ECBA 5CXGA 3FRQA 1POGA 3LSPA 4GCKA 3KNWA 4BBSJ 3G1MA 3SDGA 3HTJA 2H1KA 3IUVA 4BBRJ 2R7ZJ 5IP7J 2UXPA 3HOVJ 1RETA 3O8GA 3JRFA 3V6GA 3BCGA 2E2HJ 1NK2P 5IOYA 3BTIA 3ZQCA 4PXIA 3FIWA 2DG7A 2LR8A 1H88C 5J1RA 2REKA 4YZEA 3KZ9A 3T6NA 3HTHA 3NNRA 2XGDA 2PMZN 5M3MJ 1ZQ3P 4C3HJ 3NI7A 5GPCA 3GEUA 4NN1A 3Q0WA 2WUIA 1A6IA 3HKZN 2HXOA 3IH4A 1JJ8C 2ME6A 1WH7A 1W0UA 1QRYA 1XG1A 5F0FA 3VPRA 4AUXA 1ETWA 2ELKA 3ON4A 1T56A 4BKXA 5FKLA 5C44J 2WGBA 2EQRA 1TC3C 3QBMA 2JK3A 1FIPA 1IV6A 3CJDA 3BR6A 1Y1WJ 2ZCXA 1F43A 2Y9YA 1IUFA 5BNGA 2R5YA 4XRSA 5HAWA 1F36A 1IDZA 1MH4A 2XB0X 1U78A 2DA6A 2V57A 4IHWA 3JRGA 4BY1J 2GBYA 1OJLA 3OSGA 2CU7A 2LLKA 1PUFB 2NVQJ 4DZJA 2CUEA 2L7ZA 4AF5A 4JX5A 3NPIA 1GV2A 4MO7A 4C3IJ 2CQXA 5EYRA 1JKPC 2UXUA 1RESA 5C4YA 4HNVA 3BR0A 2ID3A 5M5XJ 1K83J 2DTZA 1IC8A 1AHDP 3Q0VA 4B3AA 3BTJA 1VFCA 1XS9A 5EG0B 1OCTC 4QTRA 5C4JJ 1JUSA 5M5YJ 1VNDA 1MBGA 4W1UA 5EZHA 4DYQA 5E3OA 3LJLA 1R9TJ 1JT6A 3JRBA 1CQTA 4C3JJ 3JRIA 2JA8J 3S1QJ 1OFCX 2CRGA 2XPVA 5FLVA 3A02A 1ZK8A 2WV1A 3MVPA 2D5VA 4A69C 2Y9ZA 2M34A 4MFEA 3LHQA 1HCRA 4A3GJ 3BG9A 2KDZA 2RASA 3MN2A 2R92J 2IU5A 2DMUA 3LSGA 2G3BA 3EGQA 3HOXJ 2L9RA 1GT0C 5IYDJ 5IYCJ 3PM1A 3M4OJ 2DA2A 2R93J 2M2EA 1UI6A 3CWRA 5GP9A 2LY9A 3GTOJ 2WAQN 3VOXA 2O8KA 4AC0A 1FTZA 5F27A 3ZQHA 3VUQA 3HGYA 3TW6A 2FBQA 5C3EJ 1MBFA 2N8GA 2JN6A 2MW8A 5M3FJ 1HF0A 1LFBA 3GTPJ 3VOKA 4B1RA 2DA4A 2HYJA 3BR2A 2PBXA 4NELA 5JLXA 2XB5A 1X2NA 2NX4A 1JUMA 2VPRA 2X9DA 5FJ8J 4J19A 2EZIA 3BR1A 1ZTRA 1JKQC 2F07A 5FMPA 4QSHA 3JSJA 1WCMJ 3GTJJ 2DMNA 3ZQIA 3BG5A 1IG7A 2XGEA 3ZQGA 4L5EA 1SFOJ 2UXIA 4JKZA 4CGRA 2ECCA 1AKHA 3BHQA 3RH2A 3I4MJ 4A93J 2EZKA 2JMWA 1Y1VJ 1H8AC 2JJ7A 1SGMA 4CYCB 2HDDA 1ETVA 3B6AA 1JTXA 3I4NJ 1RR7A 1IDYA 3TW7A 4AC6A 5E3MA 2G7LA 1JUPA 2M0CA 9ANTA 3E7QA 4AYBN 1ZGWA 2P81A 3HGGA 1NTCA 5IOZA 3G1OA 2YVEA 4D7MA 1BW5A 2QTQA 3A01B 4IHVA 1ITYA 5FGLA 2LP0A 3FKIJ 3HE0A 4B4CA 3WHCA 3RKQA 3V78A 5EZGA 3O8HA 1FTTA 3QQAA 1OCPA 2X48A 4XICA 2AO9A 2EZLA 4JP0A 1XC5A 1MBHA 2GFNA 5FHPA 3VVXA 3FK6A 4M3DA 2B63J 3RZOJ 3HTIA 5HODA 2E19A 1G2HA 2WB1N 3TP0A 1PUFA 1FEXA 2LK2A 4M3BA 4GCTA 4M3FA 1LE8B 4BXXJ 1ETYA 4DZPA 3PASA 2DMTA 2K9NA 2UXOA 3OOUA 3LOCA 1GV5A 5CW8A 2Y30A 3VIBA 2YUSA 2OERA 4MIMA 4BY7J 1I50J 4W97A 4A3KJ 2K9SA 3BTCA 5K7HA 3VVZA 2I10A 2HXIA 4FTHA 5FKNA 2TRTA 2OPTA 5EGOA 1B72B 2QOPA 1WPKA 2Y31A 2VI6A 1H89C 4DYRA 1ENHA 2M8GX 4UUSB 1BW6A 2COBA 4D7NA 3IH2A 4IHYA 1VI0A 2NOGA 3S2DJ 2FD5A 3BTLA 5FLMJ 4CYCA 3RD3A 4ACIA 1ETKA 5IP9J 2DJNA 2X6OA 2GUHA 2EH3A 4JX6A 1D5YA 4UDSA 2YS9A 4FCYA 3G56A 2EZHA 2PZ9A 1TWFJ 1SANA 4XK4A 4A3MJ 1NK3P 2ZOYA 1W0TA 2G0EA 2R5ZB 2O9LA 2HYTA 2XRLA 1HLVA 1B8IA 3S1RJ 1QVTA 3GTMJ 3NARA 5JLWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4EEF G;  3DPJ A;  1RKT A;  3S1M J;  5HBU A;  2ZB9 A;  2XSD C;  2O7O A;  3GTL J;  5DS9 A;  3PO2 J;  3QPL A;  1ETO A;  4FE4 A;  3CDL A;  2JA6 J;  3BR3 A;  4X1E A;  5F08 A;  3FK7 A;  5EFY A;  2MG4 A;  5F0C A;  3GTG J;  1DU6 A;  2ID6 A;  1Z0X A;  3HDD A;  2DMP A;  3RQI A;  5D1R A;  5C4X J;  4IHX A;  3IV5 A;  2H8R A;  5E3L A;  3Q3S A;  3BRU A;  1UG2 A;  2AHQ A;  1I3Q J;  1TWA J;  3Q0U A;  3JRE A;  3MKL A;  2W48 A;  3VW2 A;  5HSZ A;  2R5Y B;  2IEK A;  4A3B J;  3ANP A;  5K7F A;  1GVD A;  1DU0 A;  3LWJ A;  1MSE C;  2JA7 J;  4Y7N J;  4L62 A;  1P7I A;  2XPW A;  2VKV A;  3RZD J;  3GTK J;  5M5W J;  2IBD A;  4LOC A;  4A3J J;  2D6Y A;  2GM4 A;  3B81 A;  1BJZ A;  1MBJ A;  3DEW A;  3F0C A;  1BL0 A;  2HKU A;  2DA1 A;  3AQS A;  3NAU A;  5J3L A;  3H0G J;  2ZCN A;  2NS7 A;  1LE8 A;  2YU9 J;  2DA7 A;  4NDL A;  5F04 A;  3SJM A;  3LNQ A;  4XRS G;  3B6C A;  1MH3 A;  3COL A;  2W53 A;  4V2G A;  3CRJ A;  1U9O A;  2LKX A;  2LFB A;  2JA5 J;  2NVT J;  2KT0 A;  3GBG A;  3MNL A;  2DA3 A;  4MFD A;  2M9H A;  3BG3 A;  4RDU A;  1FJL A;  5J1U A;  1S7E A;  4A3L J;  2E1O A;  4I6Z A;  2Y0S N;  4GFK A;  4FIS A;  4M3E A;  2HOT A;  5FKM A;  2E2I J;  3F1B A;  3VP5 A;  1K61 A;  4JNN A;  1WH5 A;  4XRM A;  3LSR A;  4UUS A;  4M3G A;  3KKC A;  5DAJ A;  5D18 A;  2QF7 A;  4MLO A;  5IP6 A;  1YRN A;  2VUM J;  2LTP A;  5EF6 A;  3CCY A;  1WI3 A;  3VW1 A;  5E3N A;  2XDN A;  1ZR2 A;  5CXI A;  2HQ5 A;  3PO3 J;  3C07 A;  4UUT A;  4MXM A;  3JRC A;  5EDN A;  1JGG A;  1HDD C;  3S17 J;  5AQC A;  1E3O C;  2R0Q C;  1O4X A;  3GZI A;  4D5F A;  1GDT A;  3ANG A;  2JWT A;  3HEF A;  3SFI A;  3C2B A;  3K7A J;  2FX0 A;  1JKO C;  2LVS A;  2ZCM A;  4HKU A;  4V2F A;  3S1N J;  5K58 A;  1IJW C;  2L7F P;  3NXC A;  2OF7 A;  1QVU A;  2HOS A;  2VKE A;  1T33 A;  1JTY A;  1TWC J;  2G7G A;  3HOY J;  2OI8 A;  1X58 A;  3NRG A;  4A3E J;  1ORK A;  2K40 A;  2GLO A;  3FIS A;  5D19 A;  1B8I B;  2NP3 A;  3HB9 A;  2RAE A;  2QCO A;  3S16 J;  2XPU A;  4G12 A;  3ZQF A;  2NS8 A;  2DA5 A;  3K2A A;  3G1L A;  3ZQL A;  5F0H A;  2FQ4 A;  4DW6 A;  2NVY J;  4QIW N;  3D1N I;  2ME0 A;  1ETX A;  1U9N A;  2EBI A;  3TED A;  1UMQ A;  3WHB A;  3KKD A;  4M6V A;  2R5Z A;  2XGC A;  4RBO A;  1P7J A;  1LFU P;  5FKO A;  4ABZ A;  5F1J A;  3CMY A;  4A3C J;  4KWA A;  3HIM A;  3QPS A;  1Q1V A;  5FKK A;  2E2J J;  1EF4 A;  2Y2Z A;  2QKO A;  1FIA A;  3HOU J;  2DN0 A;  3CQZ J;  5EEA A;  3AQT A;  1Z77 A;  3M3Y J;  3P9T A;  3IH3 A;  3HM5 A;  2Q24 A;  2CQQ A;  2DG8 A;  5IYB J;  1RKW A;  1BA5 A;  2CUF A;  4A3F J;  1IRZ A;  3OSF A;  3OIO A;  5EG0 A;  3GTQ J;  3HOW J;  1GUU A;  1U8B A;  4C2M J;  4XID A;  1JT0 A;  3HTA A;  4JYK A;  1UHS A;  3BNI A;  3TP3 A;  4DYC A;  1UI5 A;  5GPA A;  2NP5 A;  4JL3 A;  3DCF A;  3VW0 A;  3ON2 A;  3BT9 A;  2YVH A;  1HDP A;  1QPI A;  2G7S A;  4ME9 A;  2HI3 A;  3A01 A;  4A3I J;  4D5C A;  3QKX A;  3EUP A;  1AKH B;  4MK6 A;  4Y52 J;  1IGN A;  5J1Y A;  5K7Z A;  3BR5 A;  4ICH A;  2L7M P;  2MGQ A;  3O60 A;  3H3V K;  4GFB A;  3PPB A;  3S5R A;  5H9T A;  1APL C;  2QIB A;  3ZOB A;  2HOA A;  3A03 A;  4GFL A;  3HBL A;  1VF9 A;  4IEJ A;  2L0K A;  3JRA A;  1MBE A;  2K9Q A;  2MSY A;  3BJB A;  2GEN A;  2LD5 A;  1TWH J;  3S2H J;  1X2M A;  2FJ1 A;  1MNM C;  3BQY A;  5IPA A;  3JR9 A;  4GCL A;  2ZOZ A;  4JX4 A;  2IAI A;  3LSJ A;  1RPW A;  3UKG A;  4I76 A;  1JKR C;  2O7T A;  2RHA A;  3BQZ A;  2CJJ A;  2QWT A;  3W6V A;  2DMQ A;  2TCT A;  1YRN B;  3S15 J;  5EGO B;  1B72 A;  2UXH A;  1TWG J;  1ZR4 A;  1ZKG A;  4X6A J;  3G7R A;  5DTD A;  1MBK A;  3JRD A;  1JJ6 C;  1AU7 A;  1I6H J;  3VVY A;  3HOZ J;  1A5J A;  4A3D J;  1ETQ A;  2NVX J;  3E7L A;  4S0H B;  1WGX A;  1MSF C;  1HOM A;  3JRH A;  4FE7 A;  3L1P A;  3S14 J;  2ECB A;  5CXG A;  3FRQ A;  1POG A;  3LSP A;  4GCK A;  3KNW A;  4BBS J;  3G1M A;  3SDG A;  3HTJ A;  2H1K A;  3IUV A;  4BBR J;  2R7Z J;  5IP7 J;  2UXP A;  3HOV J;  1RET A;  3O8G A;  3JRF A;  3V6G A;  3BCG A;  2E2H J;  1NK2 P;  5IOY A;  3BTI A;  3ZQC A;  4PXI A;  3FIW A;  2DG7 A;  2LR8 A;  1H88 C;  5J1R A;  2REK A;  4YZE A;  3KZ9 A;  3T6N A;  3HTH A;  3NNR A;  2XGD A;  2PMZ N;  5M3M J;  1ZQ3 P;  4C3H J;  3NI7 A;  5GPC A;  3GEU A;  4NN1 A;  3Q0W A;  2WUI A;  1A6I A;  3HKZ N;  2HXO A;  3IH4 A;  1JJ8 C;  2ME6 A;  1WH7 A;  1W0U A;  1QRY A;  1XG1 A;  5F0F A;  3VPR A;  4AUX A;  1ETW A;  2ELK A;  3ON4 A;  1T56 A;  4BKX A;  5FKL A;  5C44 J;  2WGB A;  2EQR A;  1TC3 C;  3QBM A;  2JK3 A;  1FIP A;  1IV6 A;  3CJD A;  3BR6 A;  1Y1W J;  2ZCX A;  1F43 A;  2Y9Y A;  1IUF A;  5BNG A;  2R5Y A;  4XRS A;  5HAW A;  1F36 A;  1IDZ A;  1MH4 A;  2XB0 X;  1U78 A;  2DA6 A;  2V57 A;  4IHW A;  3JRG A;  4BY1 J;  2GBY A;  1OJL A;  3OSG A;  2CU7 A;  2LLK A;  1PUF B;  2NVQ J;  4DZJ A;  2CUE A;  2L7Z A;  4AF5 A;  4JX5 A;  3NPI A;  1GV2 A;  4MO7 A;  4C3I J;  2CQX A;  5EYR A;  1JKP C;  2UXU A;  1RES A;  5C4Y A;  4HNV A;  3BR0 A;  2ID3 A;  5M5X J;  1K83 J;  2DTZ A;  1IC8 A;  1AHD P;  3Q0V A;  4B3A A;  3BTJ A;  1VFC A;  1XS9 A;  5EG0 B;  1OCT C;  4QTR A;  5C4J J;  1JUS A;  5M5Y J;  1VND A;  1MBG A;  4W1U A;  5EZH A;  4DYQ A;  5E3O A;  3LJL A;  1R9T J;  1JT6 A;  3JRB A;  1CQT A;  4C3J J;  3JRI A;  2JA8 J;  3S1Q J;  1OFC X;  2CRG A;  2XPV A;  5FLV A;  3A02 A;  1ZK8 A;  2WV1 A;  3MVP A;  2D5V A;  4A69 C;  2Y9Z A;  2M34 A;  4MFE A;  3LHQ A;  1HCR A;  4A3G J;  3BG9 A;  2KDZ A;  2RAS A;  3MN2 A;  2R92 J;  2IU5 A;  2DMU A;  3LSG A;  2G3B A;  3EGQ A;  3HOX J;  2L9R A;  1GT0 C;  5IYD J;  5IYC J;  3PM1 A;  3M4O J;  2DA2 A;  2R93 J;  2M2E A;  1UI6 A;  3CWR A;  5GP9 A;  2LY9 A;  3GTO J;  2WAQ N;  3VOX A;  2O8K A;  4AC0 A;  1FTZ A;  5F27 A;  3ZQH A;  3VUQ A;  3HGY A;  3TW6 A;  2FBQ A;  5C3E J;  1MBF A;  2N8G A;  2JN6 A;  2MW8 A;  5M3F J;  1HF0 A;  1LFB A;  3GTP J;  3VOK A;  4B1R A;  2DA4 A;  2HYJ A;  3BR2 A;  2PBX A;  4NEL A;  5JLX A;  2XB5 A;  1X2N A;  2NX4 A;  1JUM A;  2VPR A;  2X9D A;  5FJ8 J;  4J19 A;  2EZI A;  3BR1 A;  1ZTR A;  1JKQ C;  2F07 A;  5FMP A;  4QSH A;  3JSJ A;  1WCM J;  3GTJ J;  2DMN A;  3ZQI A;  3BG5 A;  1IG7 A;  2XGE A;  3ZQG A;  4L5E A;  1SFO J;  2UXI A;  4JKZ A;  4CGR A;  2ECC A;  1AKH A;  3BHQ A;  3RH2 A;  3I4M J;  4A93 J;  2EZK A;  2JMW A;  1Y1V J;  1H8A C;  2JJ7 A;  1SGM A;  4CYC B;  2HDD A;  1ETV A;  3B6A A;  1JTX A;  3I4N J;  1RR7 A;  1IDY A;  3TW7 A;  4AC6 A;  5E3M A;  2G7L A;  1JUP A;  2M0C A;  9ANT A;  3E7Q A;  4AYB N;  1ZGW A;  2P81 A;  3HGG A;  1NTC A;  5IOZ A;  3G1O A;  2YVE A;  4D7M A;  1BW5 A;  2QTQ A;  3A01 B;  4IHV A;  1ITY A;  5FGL A;  2LP0 A;  3FKI J;  3HE0 A;  4B4C A;  3WHC A;  3RKQ A;  3V78 A;  5EZG A;  3O8H A;  1FTT A;  3QQA A;  1OCP A;  2X48 A;  4XIC A;  2AO9 A;  2EZL A;  4JP0 A;  1XC5 A;  1MBH A;  2GFN A;  5FHP A;  3VVX A;  3FK6 A;  4M3D A;  2B63 J;  3RZO J;  3HTI A;  5HOD A;  2E19 A;  1G2H A;  2WB1 N;  3TP0 A;  1PUF A;  1FEX A;  2LK2 A;  4M3B A;  4GCT A;  4M3F A;  1LE8 B;  4BXX J;  1ETY A;  4DZP A;  3PAS A;  2DMT A;  2K9N A;  2UXO A;  3OOU A;  3LOC A;  1GV5 A;  5CW8 A;  2Y30 A;  3VIB A;  2YUS A;  2OER A;  4MIM A;  4BY7 J;  1I50 J;  4W97 A;  4A3K J;  2K9S A;  3BTC A;  5K7H A;  3VVZ A;  2I10 A;  2HXI A;  4FTH A;  5FKN A;  2TRT A;  2OPT A;  5EGO A;  1B72 B;  2QOP A;  1WPK A;  2Y31 A;  2VI6 A;  1H89 C;  4DYR A;  1ENH A;  2M8G X;  4UUS B;  1BW6 A;  2COB A;  4D7N A;  3IH2 A;  4IHY A;  1VI0 A;  2NOG A;  3S2D J;  2FD5 A;  3BTL A;  5FLM J;  4CYC A;  3RD3 A;  4ACI A;  1ETK A;  5IP9 J;  2DJN A;  2X6O A;  2GUH A;  2EH3 A;  4JX6 A;  1D5Y A;  4UDS A;  2YS9 A;  4FCY A;  3G56 A;  2EZH A;  2PZ9 A;  1TWF J;  1SAN A;  4XK4 A;  4A3M J;  1NK3 P;  2ZOY A;  1W0T A;  2G0E A;  2R5Z B;  2O9L A;  2HYT A;  2XRL A;  1HLV A;  1B8I A;  3S1R J;  1QVT A;  3GTM J;  3NAR A;  5JLW A; 
#chains in the Genus database with same CATH topology
 1BOB A;  1TW2 A;  2CYY A;  4NC7 A;  1OQY A;  2EV5 A;  3J7Y J;  2XSD C;  2MH2 A;  2O7O A;  2E1N A;  4DJA A;  2VBY A;  1ETO A;  2PMZ A;  2DJI A;  3CDL A;  3DQV C;  3QU3 A;  2KIS A;  2GAU A;  5F08 A;  1FWZ A;  5F0C A;  2KIM A;  1DU6 A;  4E7K A;  2ZY9 A;  3H3Z A;  4PDK A;  1HKQ A;  3MKL A;  5HSZ A;  3ISP A;  1C0W A;  2R5Y B;  4KA4 A;  4BL0 B;  2IEK A;  1O3S A;  5K7F A;  1ZG3 A;  2BE5 F;  3ZPL A;  3KP5 A;  2BY0 A;  2L4A A;  3GLX A;  1DU0 A;  2JA7 J;  1Z6R A;  2XPW A;  1XMA A;  2VKV A;  2MD0 A;  4LOC A;  5DUK A;  1PJR A;  3C2G A;  3EYI A;  1MBJ A;  3F0C A;  4BDY A;  4HA8 A;  4P9F A;  4EAT A;  3H0G J;  3CF5 F;  2NS7 A;  3QOD A;  3FBN B;  3FMR A;  1V55 H;  3B6C A;  1MH3 A;  4CCO A;  4V2G A;  3CRJ A;  2NVT J;  2X6Y A;  3GBG A;  2NVU B;  2Z16 A;  1IRF A;  4KIB A;  2OJE D;  4QLC U;  1WJE A;  4II3 A;  4LD5 A;  4QWQ A;  2M8E A;  1TT5 B;  4FIS A;  2JQ7 A;  3VP5 A;  3BZC A;  1O3Q A;  5BQT A;  1MKM A;  5D18 A;  2KJC A;  1OYI A;  2A3S A;  2VUM J;  4RAZ A;  5EF6 A;  4G94 A;  1WI3 A;  3DTI A;  1R4N B;  2E7W A;  5CXI A;  2HQ5 A;  1RRJ A;  4UUT A;  4MXM A;  3JRC A;  1JGG A;  3FXJ A;  2QGU A;  1O57 A;  2BV6 A;  2L02 A;  3HHG A;  4M71 A;  4RAY A;  3ABM H;  3HEF A;  3VYT B;  3C2B A;  2F5E A;  1OPC A;  1Y0U A;  4WIB A;  4MTD A;  1LFP A;  4HKU A;  2DOF A;  3TO9 A;  5K58 A;  1IZ1 A;  4M72 A;  1O7L A;  2L7F P;  3CUQ C;  2IVM A;  5BS6 A;  1FOW A;  4R8H A;  2WC2 A;  5D8K B;  1FX7 A;  3DF8 A;  3FIS A;  4YIF A;  1H0M A;  1ZYR F;  4B47 A;  2RAE A;  2KRC A;  4OIR F;  3S16 J;  4G12 A;  2DA5 A;  1EH8 A;  3EUH A;  3K2A A;  3OYH A;  1YIJ I;  1FT9 A;  4OAY A;  4DW6 A;  1YQA A;  2ME0 A;  1U9N A;  3ROU A;  1ZAO A;  4HF0 A;  1G3T A;  2J5O A;  4M6V A;  1WJD A;  1GXQ A;  4XR6 A;  2Y75 A;  3CCU I;  1ZG5 A;  2OTL I;  1LFU P;  5FKO A;  4ABZ A;  2DFF A;  2ZSH B;  2YX7 A;  3HIM A;  1BI2 A;  1MJB A;  4BE0 A;  4ASN A;  2NYX A;  5KNL A;  4M9Z A;  3P9K A;  1EF4 A;  3H9J A;  2DN0 A;  2NRA C;  1XGM A;  3FX3 A;  3TO6 A;  4EJU A;  4O6J A;  5DCM B;  3M1C A;  1F5T A;  1RUN A;  3PUF A;  4I0B A;  5ICE A;  3OYC A;  2DG8 A;  1RKW A;  2V9K A;  4A3F J;  1XSD A;  5D6E A;  1IRZ A;  5H6R A;  3OYB A;  1LJ9 A;  3GTQ J;  1J75 A;  4AYB A;  3OYJ A;  3HOW J;  3WG7 H;  1U8B A;  1JT0 A;  3S32 A;  5DUI A;  1EV7 A;  4JYK A;  3BNI A;  2O61 A;  2MLK A;  1A31 A;  4JL3 A;  5GPA A;  2R7X A;  1B6A A;  2CMP A;  3KP6 A;  2PJP A;  1VQO I;  4KYW A;  3HRM A;  2NS0 A;  3ON2 A;  2OCE A;  4NC8 A;  2H1L A;  2G7S A;  3A01 A;  3FXK A;  4XOT A;  2KMU A;  1OR7 C;  2X85 A;  2LKS A;  3BJO A;  4KDP A;  4CCJ A;  5DM7 F;  3EUP A;  2Z3Y A;  4ENM A;  5L3C A;  3S5R A;  1R00 A;  3PL8 A;  2WAF A;  2QIB A;  1FLI A;  2HOA A;  1YS7 A;  4GFL A;  4KIF A;  4IEJ A;  2YVX A;  3JRA A;  3VYU B;  2K9Q A;  4RAG A;  1W5T A;  1QQI A;  4CZC A;  3HSR A;  2LD5 A;  1TWH J;  2G9W A;  2O0Y A;  3JR9 A;  2V79 A;  1UHW A;  2B7E A;  2R7Q A;  2ZOZ A;  1RPW A;  3UKG A;  2O7T A;  4FAS D;  3BQZ A;  4BJ5 C;  4CIC A;  4KMF A;  2TCT A;  1YRN B;  2UXH A;  2BY3 A;  3MKW B;  1B72 A;  3HL2 A;  1ZR4 A;  2PMH A;  3E97 A;  1IV8 A;  1AU7 A;  1JJ6 C;  1I6H J;  2BHZ A;  3VVY A;  1Z21 A;  3QYE A;  4CA0 A;  1UJ8 A;  3MAJ A;  3M8J A;  4R1H A;  4U0Y A;  3PNV A;  4PJN A;  4AWX B;  1MSF C;  2IA0 A;  1HOM A;  3OYK A;  1SFX A;  3NQO A;  2K9M A;  1VQ5 I;  3QOP A;  1O3R A;  2PEX A;  2XRN A;  3RSN A;  4BBS J;  3KNW A;  3SDG A;  5FRO A;  5CPR B;  3IUV A;  1G6N A;  2XAQ A;  5IP7 J;  2R7Z J;  3WTW C;  2OZ6 A;  3JRF A;  3V6G A;  3SEZ A;  3F8C A;  2HS5 A;  1FP2 A;  3BTI A;  2O3F A;  3OR2 C;  4A0Y A;  4YFN F;  3CD6 I;  4PXI A;  2PI0 A;  1TZL A;  1W36 D;  2LR8 A;  3EUH C;  3QAH A;  4DGW B;  1ZHF A;  3F6O A;  3T6N A;  2H6C A;  4EJO A;  5M3M J;  4BQA A;  1ZQ3 P;  1D1C A;  1WWX A;  3I4P A;  3X2Q H;  2LY1 A;  3WU2 C;  4L0Z B;  2DCE A;  4RGR A;  3IRQ A;  1S72 I;  2C6Y A;  1SFE A;  1EJ9 A;  3MD2 A;  3QOE A;  2ELK A;  2FRH A;  4C2U A;  4BKX A;  5C44 J;  3IHU A;  1JHF A;  5ILU A;  4C2M A;  5HOO A;  4YRV A;  2XF6 A;  3QBM A;  1IXS B;  3BR6 A;  2ZME A;  2ZCX A;  4L9T A;  5BNG A;  2R5Y A;  4XRS A;  4GGG A;  2LG4 A;  2H8W A;  1F36 A;  4GRI A;  2XB0 X;  5CVR A;  1P6R A;  2M4K A;  1W5C C;  2DA6 A;  3JRG A;  4N0B A;  4ESJ A;  3OSG A;  2A5Y B;  4F55 A;  2NVQ J;  2CO5 A;  2KIU A;  2L7Z A;  3VDX A;  2IW5 A;  2DK8 A;  3HSF A;  1H9T A;  2CQX A;  1JKP C;  1RES A;  5B5E C;  4BQO A;  4HNV A;  4M9S A;  3U1K A;  1T95 A;  5LHH A;  5M5X J;  1I3A A;  2X4H A;  4E7L A;  2JZY A;  3HTS B;  3P7N A;  2ZME B;  3H9G A;  4AIJ A;  3VSL A;  2XAJ A;  2Q2E B;  4XBF A;  4DNC A;  5IY5 H;  1OCT C;  5LGT A;  1I1G A;  3KE2 A;  4EQQ A;  2HPM A;  5M5Y J;  4DQ2 A;  1Z05 A;  1R9T J;  1CQT A;  3KLN A;  2EFO A;  3JRI A;  1ZLK A;  2JA8 J;  3S1Q J;  1OFC X;  1YW8 A;  2XPV A;  4DBR A;  3BP8 A;  4GYG A;  2VQG A;  3A02 A;  1ZK8 A;  3MVP A;  2W25 A;  1YG2 A;  2F5V A;  2F5F A;  3KP7 A;  3IWF A;  1FSH A;  3CLQ A;  2IU5 A;  3I59 B;  3J7A O;  5K1Y A;  3EGQ A;  3FXQ A;  1MMD A;  1N25 A;  3KFW X;  3HOX J;  5IYD J;  1EA3 A;  3PM1 A;  2MA3 A;  2W82 A;  2H09 A;  3K0L A;  1Y6I A;  3F6V A;  2X1D A;  4BS9 A;  1FOK A;  4Z6Y A;  4XL9 A;  3VOX A;  4XOR A;  2FMY A;  4S05 A;  2O8K A;  4G7Z F;  3DEE A;  1DP7 P;  2IXS A;  3EUA A;  2FBQ A;  4TV7 A;  1MBF A;  1U5T C;  2CQ7 A;  2JN6 A;  5LBQ A;  4ZH4 F;  1LEB A;  2Y69 H;  2LYC A;  2HYJ A;  4A0X A;  3BR2 A;  3UR3 C;  4NEL A;  3DFG A;  3TOA A;  1HKS A;  2E60 A;  2NX4 A;  2EJR A;  1JUM A;  2X9D A;  4EM0 B;  5FJ8 J;  3FXR A;  3PNY A;  3CCR I;  3J7A Y;  4PGH A;  3WOD F;  4II2 A;  2K85 A;  1WCM J;  4WK8 F;  3BG5 A;  4A6D A;  2JVH A;  4IF4 A;  1MW7 A;  3ZQG A;  5LHI A;  1JE8 A;  4JKZ A;  1OR7 A;  1TQI A;  2NOJ B;  1AKH A;  4UY8 I;  3OYA A;  3G6E I;  3QP5 A;  1IN5 A;  3W6J B;  2Z5U A;  1S5L C;  1H8A C;  2JJ7 A;  2YPR A;  3IP4 B;  2BEO A;  4CYC B;  3FXL A;  3K1P A;  3HRT A;  3B6A A;  1JTX A;  4RA2 A;  4XSX F;  1RR7 A;  1QZE A;  2BOL A;  2CFO A;  3TW7 A;  1WKM A;  4AID A;  1ZAR A;  2M0C A;  9ANT A;  4AYB N;  3WTY C;  1ZGW A;  2W24 A;  5IOZ A;  3K70 D;  3G1O A;  2XHK A;  4HQE A;  1TQM A;  4LIU A;  3CO6 C;  3S8P A;  1YJ9 I;  1Y8R B;  2DFI A;  1R5G A;  4NHJ A;  1A36 A;  5FGL A;  3HE0 A;  3FKI J;  2R4G A;  4G7O F;  1IUY A;  3OR1 C;  4LB5 A;  3O8H A;  1FTT A;  2QWW A;  3TDZ C;  1W1W E;  3PFI A;  2AO9 A;  4RM2 A;  3AG1 H;  1MBH A;  2GFN A;  2IRF G;  2PBI A;  4KMU X;  3FK6 A;  2ELH A;  4M3D A;  4YEJ A;  5HOD A;  3HTI A;  3TP0 A;  2HU9 A;  4M3B A;  2V1X A;  4M3F A;  5LEK A;  1ETY A;  5E20 A;  4DZP A;  3PAS A;  1I5Z A;  3HSE A;  4O3M A;  2STW A;  5F1R A;  4U0V A;  1HC8 A;  1GV5 A;  3R4K A;  1IN7 A;  1LEA A;  5CKT A;  2P0W A;  4XKW A;  2ETH A;  4A3K J;  4RGX A;  1QHH D;  4FTH A;  3M8E A;  1Z7U A;  2IT0 A;  1NHA A;  1OMI A;  2OPT A;  1CF7 A;  2K3P A;  2ZFU A;  2M3A A;  1WPK A;  5KHD A;  1DPR A;  4EJW A;  4LLG F;  1AA7 A;  3E5U A;  4HLX A;  3J80 Z;  1FYM A;  3H3U A;  3CCJ I;  2VC1 A;  2M8G X;  1P4X A;  5HDK A;  2A6E F;  4P5O A;  3V8J A;  3PNT A;  4U88 A;  1SAU A;  4ZYE A;  3CP2 A;  3IH2 A;  1BR1 A;  2Z2S B;  1VI0 A;  2NOG A;  1FBS A;  3SZT A;  2FD5 A;  3BTL A;  3S2D J;  2ZXI A;  5HLI A;  1FOY A;  3RD3 A;  2EH3 A;  3OYE A;  3FF5 A;  2PZ9 A;  2GWR A;  1TWF J;  1SAN A;  3FXO A;  4A3M J;  3DXJ F;  2HVQ A;  3C3W A;  4MNU A;  2KRF A;  5LRR A;  4RB2 C;  2HYT A;  2ZXH A;  4YG2 F;  2XRL A;  1B8I A;  1VQK I;  5ILV A;  3NAR A;  1B9N A;  3QPT A;  4XLA A;  3LSK A;  4EEF G;  3CCL I;  3GXO A;  3DPJ A;  1N75 A;  2ADU A;  3HRS A;  4IQ4 A;  3GW2 A;  5HBU A;  3GTL J;  2EIM H;  5DS9 A;  1QPM A;  1Z67 A;  4M74 A;  2DLL A;  4MTE A;  1X3U A;  2JSP A;  4QPQ A;  4PJM A;  1U5T B;  2LC2 A;  2M7B A;  1YFH A;  1YJW I;  3BR3 A;  2CGP A;  2JA6 J;  1X3W B;  3GTG J;  4I02 A;  2M0M A;  4UVA A;  3HDD A;  5C4X J;  3PSF A;  1PYV A;  3ZN1 A;  3IV5 A;  2H8R A;  5E3L A;  4HDU A;  2WAQ A;  3BJ6 A;  3Q3S A;  2E34 A;  1UG2 A;  2HNH A;  2MFZ A;  2AHQ A;  4Y33 A;  3S3M A;  1I3Q J;  3Q0U A;  3FDY A;  2W48 A;  2XAG A;  2DW4 A;  2LY2 A;  3WTT C;  2JA2 A;  4HV6 A;  2FXA A;  3P5J A;  4RLQ A;  1K4S A;  4U9L A;  1ZEL A;  1GHC A;  2HZD A;  1X4P A;  4F52 A;  4XOP A;  3CC2 I;  4Y7N J;  4B3X A;  5CVI A;  5M5W J;  2IBD A;  3ERE D;  2CW7 A;  3ESW B;  2L2O A;  2GM4 A;  4HF1 A;  1MMA A;  3B81 A;  2DA1 A;  3AQS A;  2KPM A;  3JAM K;  3HZJ A;  5F04 A;  3LA2 A;  3SJM A;  3LNQ A;  4EGZ A;  2B3W A;  4XN3 A;  4ENK A;  2HZT A;  4IRH A;  1PP7 U;  2W53 A;  5L3B A;  2LKX A;  2VE9 A;  2JA5 J;  1R5H A;  3PSI A;  3MNL A;  4NNJ A;  1FMW A;  4HYE A;  2M9H A;  3BG3 A;  4F3Q A;  4KFC A;  2DU9 A;  3TO7 A;  1KA8 A;  4A3L J;  2E1O A;  2A07 F;  3ASN H;  2QQ8 A;  2P5K A;  4NQW B;  2K5C A;  5HNH A;  2E2I J;  3F1B A;  4U87 A;  1WH5 A;  4XRM A;  3LSR A;  4S04 A;  4UUS A;  4M3G A;  5GTH C;  2QF7 A;  4MLO A;  4UNO A;  1FP1 D;  5JHU A;  2DQR A;  1YRN A;  1YOV B;  1T6S A;  2VKH A;  1R1T A;  5E3N A;  2EV6 A;  2FBK A;  4G7H F;  2XAU A;  3C07 A;  1S6L A;  3C7J A;  2MH9 A;  3HYI A;  2HWV A;  5EDN A;  1ZG1 A;  5TGT A;  3S17 J;  1E3O C;  2R0Q C;  3HPG A;  3I53 A;  2OUM A;  3BDD A;  1T0F C;  2VIX A;  4BE1 A;  2ESN A;  3VYS B;  2FX0 A;  3FKJ A;  3KEY A;  4BDZ A;  2HQR A;  1LUJ B;  4V2F A;  1IJW C;  1ZRF A;  1N78 A;  1F4K A;  5H20 A;  2OF7 A;  2IS4 A;  1OYW A;  3TKY A;  4ETS A;  3GLL A;  4CXF A;  1K79 A;  1TWC J;  3HOY J;  2E7X A;  1X58 A;  1YO5 C;  1LPQ A;  4A3E J;  2X1E A;  1BI0 A;  1ORK A;  3BY6 A;  2GLO A;  1B8I B;  1HW2 A;  2NP3 A;  2QKL B;  2QCO A;  4ZYH A;  1VQP I;  1A04 A;  3ZQF A;  1SD7 A;  3G1L A;  4N9I A;  3GF2 A;  4QIW N;  3D1N I;  2EBI A;  5FD6 A;  1MD0 A;  2WAD A;  3VOD A;  4HX8 A;  3MZH A;  1FZP B;  3KKD A;  3L2Q A;  1RIO H;  1FBQ A;  2XGC A;  4ZDL A;  4RBO A;  2QA4 I;  5JR3 A;  4A3C J;  1Z1D A;  4U7D A;  4C2T A;  2K7L A;  2Y48 A;  2K4B A;  3QPS A;  5FKK A;  2E2J J;  3GWZ A;  1YX5 A;  4KIC A;  2PFV A;  2Y2Z A;  4BJT A;  3ABU A;  1DDN A;  5EEA A;  3DPL C;  3RDI A;  3BPX A;  1OCZ H;  5A2Q Z;  1SVL A;  4LLN A;  4B09 A;  2ZXJ A;  2EIK H;  2EK5 A;  4LK1 F;  1SAX A;  3OYI A;  1E17 A;  4ZJZ A;  3TL4 X;  5E8I A;  2ZFW A;  2M87 A;  3OSF A;  4V19 K;  4ZDO A;  2H6B A;  3I0T A;  2X6X A;  2STT A;  2DDA A;  2BVM A;  3OS0 A;  2HTS A;  4XID A;  3I56 I;  1K78 A;  1MMN A;  4GDF A;  2VOO A;  4Q5S F;  2DFH A;  4FQG A;  2LBF B;  2WBM A;  3HTA A;  2BY1 A;  1XDU A;  1R36 A;  2QZ8 A;  1M1E B;  1R1U A;  4OD4 A;  4Q47 A;  5EEH A;  1G3W A;  3T1B A;  2GA1 A;  2PJR B;  3A2K A;  5CYV A;  1P92 A;  4BUP A;  1IN8 A;  2KL4 A;  3UNG C;  2F4I A;  3ELK A;  2X0L A;  1I39 A;  3J80 K;  4RB3 C;  5HLT A;  2K9L A;  2OBP A;  2ZC2 A;  1EH7 A;  1IGN A;  1VQ6 I;  3SWH A;  5HS8 A;  3BR5 A;  2RN7 A;  2E71 A;  4GFB A;  2GQQ A;  2M1B A;  2MAB A;  2A6H F;  1LB2 A;  1WJC A;  5CJ9 A;  2XRO A;  1APL C;  1K78 B;  3A03 A;  1B59 A;  1XSX A;  3FHN A;  1VF9 A;  5D4R A;  5F64 A;  3DP7 A;  3C1D A;  4B44 A;  1G3Y A;  1LVK A;  2YSR A;  2GEN A;  3RKW A;  3CJT B;  3L2V A;  4HAM A;  3CJN A;  5H2F C;  1MNM C;  3BQY A;  4AIH A;  3KEO A;  4CCN A;  5E18 F;  4JX4 A;  4G6T B;  1FSE A;  3OL4 A;  1MIJ A;  3E6B A;  2HOE A;  4LK0 F;  3M7G A;  4HQM A;  4MQ9 F;  1P4W A;  5ICG A;  3W6V A;  2DMQ A;  2QWT A;  4YFK F;  1KGS A;  1QHG A;  1BM9 A;  2FML A;  5DTD A;  3JRD A;  4OD5 A;  4A0Z A;  3G3Z A;  1A5J A;  2D2W A;  2BW3 A;  1MMG A;  3R0J A;  3HTU A;  4S0H B;  1DPU A;  4XSZ F;  1VQ9 I;  3MFK A;  3JRH A;  1QZZ A;  1KZH A;  5CXG A;  3FM5 A;  3MEX A;  1TTY A;  2BXZ A;  4GCK A;  1E2X A;  4Z2Y A;  1TT0 A;  2UXP A;  2DQL A;  2HGC A;  1RET A;  3O8G A;  3IRR A;  2WB1 A;  2V9V A;  3BCG A;  1R6R A;  3MMY B;  3M8F A;  1NK2 P;  1WSU A;  2E2H J;  2HQN A;  2QQ9 A;  3L00 A;  4BNC A;  2A68 F;  3OWT A;  2DG7 A;  4M9X A;  5J1R A;  4CDG A;  5IT9 Z;  1ON2 A;  3OYD A;  3KZ9 A;  1GVJ A;  1USS A;  4XLF A;  4EJT A;  2IPQ X;  1U6G A;  3NNR A;  4C3H J;  4CUG A;  2EIL H;  5GPC A;  4NN1 A;  1R7J A;  2RDP A;  2OTJ I;  2E1M C;  2ZNY A;  4JBA A;  3IH4 A;  2UXX A;  4IQJ A;  4BHB A;  1TBX A;  3ZRG A;  1FBU A;  3JAM Z;  1W0U A;  1QRY A;  2O03 A;  5D8L B;  1BJA A;  3VPR A;  4I98 B;  4BAC A;  3V42 A;  3CDH A;  5FKL A;  2AXL A;  4PJJ A;  2WGB A;  3FM3 A;  3K4B A;  1Q1H A;  1V4R A;  3MCZ A;  1FIP A;  1IV6 A;  3CJD A;  2VOP A;  1Y1W J;  2KLO A;  2Y9Y A;  3ZMU A;  5TIS C;  3CME I;  1IDZ A;  3E6C C;  1XTA A;  2J5P A;  4F93 B;  5JVT A;  1XGN A;  3F21 A;  2HVS A;  1OJL A;  5LFA A;  1IN4 A;  4U0W A;  2Q1Z B;  3GZ5 A;  4AF5 A;  1BOA A;  2LF7 A;  3D5R C;  4A5M A;  2A5W A;  1GV2 A;  4BE2 A;  1Y56 A;  3LAP A;  1D8J A;  2CQN A;  2R7F A;  5C4Y A;  2CWE A;  3BR0 A;  3IC7 A;  1OCO H;  2BGC A;  2CS3 A;  2L01 A;  1AWC A;  1HKT A;  5CVU A;  4K2E A;  4OAZ A;  3COA C;  3BTJ A;  1VFC A;  5BPI A;  1G8X A;  1UHM A;  2D1V A;  3C2H A;  2V6E A;  1VND A;  2CFX A;  2HKX A;  2P7V B;  4DYQ A;  1NH3 A;  3V7R A;  5GAE J;  1UST A;  4XKB A;  4C3J J;  3LQR A;  5FLV A;  2ISZ A;  2D5V A;  3DEU A;  2AQE A;  4A69 C;  3I54 A;  4ZTF A;  3FHZ A;  2R7R A;  2M34 A;  3LHQ A;  4A3G J;  2MLG A;  2KDZ A;  3ECO A;  1IO2 A;  3MN2 A;  3GCM A;  2IGN A;  2GXG A;  5AIP A;  4R79 A;  3PIP F;  1WJA A;  2JPC A;  2E5Z A;  3V7S A;  1OCC H;  2FSW A;  2L9R A;  3AG4 H;  1GT0 C;  3RI4 A;  3K6G A;  1J09 A;  3Q9S A;  2R93 J;  3SZG A;  5AIQ A;  1VQ4 I;  4KN4 X;  4XON A;  4IHS A;  3PIO F;  2WAQ N;  3J81 Z;  3GTO J;  2R7W A;  5F6F A;  3K10 A;  4BQN A;  1FTZ A;  5F27 A;  3ZQH A;  3HGY A;  1X19 A;  3BOQ A;  3TW6 A;  2DI3 A;  1F1Z A;  2ZNZ A;  1U5T A;  3T8R A;  3GTP J;  4B1R A;  4P1W A;  1ZLJ A;  3D5S C;  2PBX A;  2VB6 A;  3SZP A;  4KNY A;  4X0G A;  2VPR A;  3JSP A;  1UZC A;  2B9S A;  3BR1 A;  1JKQ C;  1WRJ A;  5L3E A;  2CQK A;  4ZYG A;  2DMN A;  3WTS C;  2DTR A;  2VC0 A;  2GIZ A;  2XGE A;  1D1A A;  3HXL A;  1SFO J;  4CGR A;  2ECC A;  3MWM A;  5J4Y A;  4J01 A;  5ILS A;  3G71 I;  2COM A;  2FE3 A;  2EZK A;  4PFP A;  2JMW A;  1UCR A;  1FOX A;  3GFL A;  4HW0 A;  2W1O A;  4AVZ A;  2FBI A;  4UVC A;  4RS8 A;  2QLZ A;  2RGV A;  4BH9 A;  5LEJ A;  1XCV A;  3E0J B;  4AC6 A;  5E3M A;  5B1B H;  3KP3 A;  3E7Q A;  2Y0M A;  1QBJ A;  3HGG A;  4MQV A;  1V5F A;  2HEO A;  1DUX C;  4PFO A;  3FXM A;  1TQP A;  3CJQ B;  3KZZ A;  1MJ9 A;  3K70 C;  2EIN H;  4IJA A;  4PJL A;  3KZY A;  4B4C A;  2OQR A;  3REO A;  2CH0 A;  2LKP A;  5KAF C;  1P9Q C;  3G73 A;  3DBR B;  2P5V A;  2LOO A;  5CQE A;  1J2X A;  3PJR A;  1WHU A;  4ZC3 A;  3RZO J;  3H5N A;  4KT5 C;  2E19 A;  1PUF A;  3GUD A;  4OIQ F;  2DMT A;  2K9N A;  2W00 A;  5J8F A;  4GXO A;  2UXO A;  3LOC A;  2UWM A;  1UEL B;  5D4S A;  5CW8 A;  2XF7 A;  2Y30 A;  2YUS A;  1YS6 A;  4E6K G;  4WCG A;  4AU7 A;  2OER A;  2F4M B;  2JRM A;  3I9V 2;  4MIM A;  4HX4 A;  4W97 A;  1MMS A;  5K7H A;  4CSW A;  3VVZ A;  2HXI A;  1ONV A;  1QNT A;  1ZGJ A;  1D3Y A;  2A69 F;  4IVN A;  4E7H A;  3N4M A;  1B72 B;  1SFK A;  3NS4 A;  4KJZ A;  4B8X A;  4BU2 A;  4H0E A;  4HZF A;  4E7I A;  3K8P C;  2DAO A;  2Y31 A;  2VI6 A;  5KAI C;  4HV5 A;  1ENH A;  1XN7 A;  4BQQ A;  1DGR M;  1SMT A;  2OAZ A;  1BW6 A;  3DLL F;  4IHY A;  2DOD A;  4L18 B;  3Q9V A;  3I64 A;  4CYC A;  1T39 A;  2H27 A;  4ACI A;  4ZYA A;  3JSO A;  3QYF A;  3K4N A;  2X6O A;  4UVB A;  2JSC A;  5D5U B;  3G56 A;  4XK4 A;  1E3P A;  2G0E A;  1L0O C;  2O9L A;  4PUS A;  5JFR A;  3S1R J;  3HUG B;  3GTM J;  5JLW A;  4NBQ A;  1RKT A;  3S1M J;  3M1E A;  5HS9 A;  3ABK H;  1A35 A;  5FGM A;  2ZB9 A;  1U2W A;  4LMY A;  3MZY A;  1U8R A;  2DBB A;  2HFH A;  1NG6 A;  1ZRE A;  1MDM B;  3QPL A;  3TOB A;  2KFD A;  1BC8 C;  3CF2 A;  3WGI A;  3GZ6 A;  4AIK A;  3DU6 A;  5CQG A;  4BXU A;  2ZJR F;  2MG4 A;  4XKV A;  2VL8 A;  2OZU A;  2ID6 A;  1Z0X A;  2OCC H;  3CMA I;  2DMP A;  5D1R A;  3JTG A;  5B1A H;  4IHX A;  4LG0 A;  1RC9 A;  3H5R A;  4LIV A;  3RPQ A;  1T2K A;  1SD4 A;  5HLH A;  2BHY A;  1SEU A;  3JRE A;  3OS2 A;  3VW2 A;  1EKE A;  3FXU A;  1GLN A;  2F4O B;  2Z9O A;  1G59 A;  3ANP A;  2CUZ A;  2DT6 A;  5E1Z B;  3LWJ A;  5DV5 A;  3DTE A;  4IO9 F;  1MSE C;  3KYL A;  4EJV A;  4XRF A;  3GTK J;  4RB1 A;  4A3J J;  2VLA A;  1BL0 A;  2WY8 Q;  1F9N A;  3HJE A;  2HKU A;  3NAU A;  1Z3X A;  2FU4 A;  2ZCN A;  2YU9 J;  2DA7 A;  3MKY B;  4NDL A;  1FC3 A;  4LLL A;  4XRS G;  1DQU A;  3COL A;  2IP2 A;  2JVG A;  2HVR A;  2F48 A;  4U9N A;  2XAH A;  2KT0 A;  3F72 A;  1XX5 A;  2DA3 A;  4EM2 A;  5J6X A;  1FJL A;  2XSJ C;  4ZTJ A;  2VJ4 A;  1S7E A;  4IZZ A;  3ZMZ A;  3F8B A;  4LJZ F;  3RPU A;  2I8D A;  1T38 A;  2OD5 A;  4M3E A;  3LAJ A;  2HOT A;  5CVV A;  1K61 A;  1UAA A;  3T0Y A;  3E5X A;  2LTP A;  3CCY A;  4J00 A;  3S93 A;  4HNU A;  4XLE A;  4BHC A;  2DOA A;  1S7O A;  3JW4 A;  4N4O B;  2JTV A;  3J81 K;  1X1D A;  2WWY A;  3AKZ A;  5AQC A;  1LKX A;  2A05 A;  4MEY F;  1O4X A;  1B9M A;  1T0F A;  4ITV A;  2L7K A;  1GDT A;  3K7A J;  4LFU A;  4FET A;  2LVS A;  3WTV C;  2ZCM A;  4H4K C;  5TRD A;  1BBY A;  3HKZ A;  1SD6 A;  2R7O A;  2VQC A;  4YEL A;  1JGS A;  1T33 A;  1JTY A;  2VPL A;  2PLY A;  3PQJ A;  5GAG J;  2G7G A;  2OI8 A;  3NRG A;  5TJJ A;  2QEN A;  2K40 A;  3IWZ A;  3LA3 A;  5D19 A;  4HDV A;  4XLN F;  3CUQ B;  3LWF A;  5E1X A;  2XPU A;  5L3G A;  4Q4Z F;  2V9P A;  4YIR X;  2G7U A;  3OYM A;  3V8K A;  4HF2 A;  2O6G E;  2NVY J;  1ETX A;  2ZCW A;  3TED A;  5FFX A;  1UMQ A;  3WHB A;  3F8M A;  1RNL A;  2ELJ A;  4KIT B;  3I55 I;  4IOA F;  3BG7 A;  2R5Z A;  3F9K A;  1UFM A;  4WX9 A;  1O7F A;  3SYT A;  1X1A A;  1RUO A;  3CP8 A;  5B66 C;  3HHH A;  1XD7 A;  3FMS A;  1FYK A;  1Q1V A;  3OY9 A;  5KK1 A;  1X4O A;  3HOU J;  4G9Y A;  3L7W A;  2CV0 A;  4ESF A;  3OOP A;  2L9N A;  3IL2 A;  1KU3 A;  1Z77 A;  2VN2 A;  3W2A A;  4EVI A;  3RPU D;  3P9T A;  4LGW A;  2KZG A;  2Q24 A;  3PFY A;  2DPU A;  5IYB J;  5L3D A;  1BA5 A;  2GZW A;  3KCC A;  3BC8 A;  3H9Q A;  3NWT A;  3OIO A;  1OCR H;  2PG4 A;  3DKW A;  5EG0 A;  3ECH A;  5K5O A;  1GUU A;  3LST A;  4C2M J;  3R6S A;  2XIG A;  3OS1 A;  3K9T A;  2W84 A;  2XKP A;  3TP3 A;  1WJ5 A;  2RKH A;  4CO8 A;  5LGU A;  4QPO A;  2BBY A;  2LH9 A;  2X6W A;  3DCF A;  1D0Y A;  3IKV A;  3KYD B;  2Q8K A;  3VW0 A;  3AL0 B;  1IXC A;  4EM1 A;  2E1C A;  2YVH A;  1HDP A;  1QPI A;  3DBH B;  5LGN A;  2IA2 A;  1I6X A;  4A3I J;  1R4M B;  4D5C A;  1WJB A;  2G7H A;  3QKX A;  3CLO A;  5IT3 A;  1AKH B;  2IA1 A;  2BZT A;  3WTZ A;  5LRS A;  2L7M P;  2MGQ A;  3F22 A;  3H3V K;  4UV8 A;  3BZK A;  3PPB A;  3D5L A;  3ZMS A;  5H9T A;  1YX3 A;  3KIO A;  1FPQ A;  2KQR A;  3ZOB A;  3BZ6 A;  3HBL A;  3RTR A;  3I58 A;  4O5V A;  2L0K A;  1FNN A;  4RGU A;  2MSY A;  3PUB A;  5K5R A;  3OIQ A;  3S2H J;  1WVR A;  2O8X A;  1X2M A;  1IN6 A;  4HST A;  3QP6 A;  2FJ1 A;  1BI3 A;  5IPA A;  5AON A;  4GCL A;  2HDC A;  3LSJ A;  1AOY A;  1KON A;  4GO1 A;  3EYY A;  5EGO B;  4C30 A;  4XMY A;  1DGW Y;  1ZKG A;  3LSH A;  4CCL A;  4HRI A;  2GOM A;  3FWE A;  2VXZ A;  2ZO4 A;  1IAW A;  3T8T A;  4CGZ A;  2R3S A;  4CYD A;  2LNB A;  3E7L A;  3CCM I;  5FRN A;  3I59 A;  3S14 J;  2LDU A;  3BCB A;  2ECB A;  3RKX A;  2XC7 A;  3ONQ A;  4RAF A;  1H9G A;  2CUJ A;  3LSP A;  3QRF F;  1BC7 C;  1PVE A;  3G1M A;  4WXD A;  2H1K A;  3GFM A;  3SXY A;  3HOV J;  1P4A A;  5HNF A;  3WGH A;  3SEQ A;  1X1P A;  4XKC A;  3ZQC A;  3BWG A;  2PMU A;  3R0A A;  2TDX A;  4NB5 A;  2A2F X;  2KJB A;  2REK A;  4IXA A;  4XNF A;  3HTH A;  3AG3 H;  2XGD A;  2PMZ N;  2V1N A;  1Z3Y A;  3Q0W A;  2FJI 1;  2X1C A;  1A6I A;  3HKZ N;  2HXO A;  2QUF A;  3KP4 A;  3IAM 2;  5HDN A;  3GO5 A;  1XG1 A;  4I99 C;  2XGX A;  4AUX A;  5JVG F;  2K02 A;  2VQL A;  3ZR8 X;  4ANJ A;  1TC3 C;  2QKM B;  2Q0O A;  4D1Q A;  2EA4 A;  5HAW A;  4Y15 A;  4CHU A;  4KIS A;  3VTI A;  3V4G A;  4E7S A;  1U78 A;  4HOB A;  4PSX A;  4IHW A;  1E3H A;  4UUV A;  2GBY A;  4HX7 A;  2CSO A;  2CU7 A;  1PUF B;  4DZJ A;  4NQW A;  1X1B A;  3S3N A;  1OKR A;  4B48 A;  1HXD A;  3RJP A;  4MO7 A;  4C3I J;  3VWB A;  5CVJ A;  4L5J A;  5EYR A;  1YLF A;  3N05 A;  3GFI A;  2BW3 B;  5E8G A;  2XAF A;  1GXP A;  2HR3 A;  1AHD P;  3ZMT A;  2DPD A;  2MC3 A;  3AL0 C;  3M9A A;  3RQ4 A;  1YIT I;  2A61 A;  1YIO A;  4QTR A;  4CZZ A;  5ICF A;  4IRV A;  4ENJ A;  1MBG A;  5E3O A;  2KHM A;  1W7P A;  4E4H A;  2KIQ A;  5A2Q K;  1PUE E;  2ZME C;  1ULY A;  5B3S H;  1D5V A;  1KYZ A;  1J0R A;  3VOE A;  5DDG A;  1L3L A;  1QZY A;  2WV1 A;  4Y3O A;  3SDB A;  2KIF A;  2Y9Z A;  1FY7 A;  4MFE A;  3H0D A;  2HYF A;  1HST A;  2ZKZ A;  3BG9 A;  2ICW G;  3K4K A;  2RAS A;  4F91 B;  2R92 J;  2DMU A;  3LSG A;  1PDN C;  1I27 A;  3M07 A;  4EMS A;  1XMX A;  4U7B A;  2A6T A;  2DYS H;  5IYC J;  3P9I A;  3M4O J;  2RQQ A;  4YII A;  5EJC A;  3BJA A;  3GZN B;  3HUG A;  2M2E A;  3DKX A;  1UI6 A;  1U0J A;  3CWR A;  1IRX A;  3BCA A;  4A5N A;  2EB7 A;  3ABL H;  1KU9 A;  2QVO A;  3VUQ A;  3L2C A;  4Y4R A;  3O2P E;  5C3E J;  2ACJ A;  3HIF A;  2BXY A;  5M3F J;  2N8G A;  2MBF A;  1LFB A;  2P8T A;  3EDP A;  3OYN A;  4JOM A;  4UXN A;  1VQM I;  4A12 A;  1WZ2 A;  4ZYD A;  5JLX A;  2GIV A;  1X2N A;  2HPI A;  3D0S A;  3V7C A;  1KYW A;  2RVC A;  5ERI A;  1TLH B;  1ZTR A;  2E1M B;  1BIA A;  2DK5 A;  3AG2 H;  3KYC B;  2B0L A;  1Z7L A;  4PJ0 C;  2DT5 A;  3ZQI A;  2OV7 A;  1IG7 A;  3LQQ A;  4ZDP A;  3O3K A;  4WXH A;  2CW8 A;  3MQ0 A;  3H1C A;  1K7A A;  5HVQ C;  2VOD A;  3I4M J;  1S7A A;  5KVR A;  4MGR A;  1Y1V J;  2VJI A;  4N4N B;  4Q48 A;  1XDS A;  4G6Q A;  4I7H A;  2HDD A;  1XCB A;  3KP2 A;  2KKO A;  1Y39 A;  2UZK A;  2R7U A;  1IDY A;  2ISY A;  2VJ5 A;  3L2R A;  5FLX K;  2K27 A;  3DWL E;  2ZJ2 A;  3E1S A;  3ZCO A;  2B1E A;  3F8F A;  3DU5 A;  2QQB A;  3CC7 I;  1NTC A;  3DPT A;  3N97 A;  2YVE A;  3RIR A;  4D7M A;  1BW5 A;  5K5Q A;  4G6D A;  1FMV A;  2GXB A;  2QTQ A;  1LVA A;  4IHV A;  4JK1 X;  2AQF A;  4M6Y A;  3WHC A;  3RKQ A;  2D45 A;  2UXN A;  3V78 A;  1ZH5 A;  3G4S I;  1OCP A;  2WTE A;  2X48 A;  3NWS A;  2EZL A;  4JP0 A;  4HLY A;  5DCF A;  2PQ8 A;  4L9J A;  3VVX A;  2QEX I;  2F5C A;  2XAS A;  1QA6 A;  2WB1 N;  4MEX F;  3F8N A;  4GCT A;  1LE8 B;  4YFX F;  4BXX J;  1ACI A;  5IT9 K;  3OOU A;  5JI6 A;  3WTX C;  4IKF A;  3S3O A;  3I5U A;  3VIB A;  5LHG A;  2RRE A;  1HW5 A;  1YI2 I;  3OMY A;  1I50 J;  4FHT A;  3B02 A;  4L5I A;  4BY7 J;  5ED4 A;  3GYH X;  2BVL A;  1WI9 A;  4D0P A;  2IGO A;  2I10 A;  2KZV A;  2IS1 A;  3H92 A;  5FKN A;  2VON A;  2TRT A;  3PQK A;  3BLY A;  4KIG A;  3OYL A;  1S9H A;  2QOP A;  3WGG A;  1UG0 A;  4UUS B;  1G4D A;  1I1S A;  2COB A;  2PFB A;  4D7N A;  2FNA A;  3CC4 I;  3WE2 A;  2Z33 A;  1QGP A;  3L09 A;  5LLQ A;  3K2Z A;  1B4A A;  2FUG 2;  2FBH A;  4P96 A;  1X1C A;  1XB4 A;  4KT6 A;  2GUH A;  1RZ4 A;  3CDI A;  2IJL A;  4JX6 A;  1S3J A;  2LRE A;  4M6X A;  1J9I A;  2YS9 A;  4UDS A;  3TQN A;  3GEZ A;  2P6S A;  4HNT A;  3CES A;  2GA2 A;  1W0T A;  2LBF A;  2R5Z B;  3JCU C;  3ML6 A;  1HLV A;  2NAZ A;  4EV0 A;  1U3E M;  4BHP A;  1QVT A;  1VQ8 I;  1S8N A;  2YU3 A;  1R1V A;  3K1M A;  3P9C A;  2IGM A;  3FZV A;  3GVA A;  2L9S A;  1NG7 A;  5J40 A;  4OIP F;  2L5Q A;  3J7Z I;  3PO2 J;  4XLC A;  4BXF A;  4WF2 A;  4FE4 A;  4FT8 A;  1WFX A;  4X1E A;  3ZMV A;  3FK7 A;  5EFY A;  4A2U A;  3HOT A;  2Q2E A;  2MD5 A;  4I0A A;  1Y8Q B;  3K4J A;  3CJR B;  2VKD A;  1LNW A;  3RQI A;  4IPA A;  5L3F A;  2EFP A;  1DP3 A;  5DD4 A;  1B1B A;  4I2O A;  3BRU A;  2QSH X;  4CCK A;  3E5Q A;  5JHF A;  2R7D A;  3L9F A;  1TWA J;  1TP4 A;  2QYO A;  4ENN A;  3OL3 A;  1CGP A;  1BR2 A;  2FEZ A;  4A3B J;  1GVD A;  1J7K A;  1Z6T A;  5HS7 A;  5DD8 A;  1R22 A;  3ZQQ A;  1P7I A;  4L62 A;  1QO0 D;  3QWL A;  1IXR C;  2XV4 S;  3RZD J;  2RQP A;  2KDO A;  2D6Y A;  2R7S A;  4P9U A;  4ON0 A;  1BJZ A;  3DEW A;  4DOZ A;  2M4G A;  5D6F A;  3EPZ A;  5J3L A;  1YHQ I;  2FOW A;  3SFZ A;  3VB2 A;  3KX2 A;  1LE8 A;  2R7T A;  2W7N A;  2OQG A;  2ZXW H;  3HC7 A;  3W2W A;  1BI1 A;  1U9O A;  3GME A;  5BOX A;  4AM3 A;  3Q5F A;  2LFB A;  1P2F A;  2QQA A;  1D0X A;  4A6E A;  1R23 A;  3VFZ A;  4MFD A;  2VBW A;  4RDU A;  5J1U A;  3SHF A;  5LD2 C;  2WV0 A;  5EEG A;  3GFJ A;  4I6Z A;  2Y0S N;  4GFK A;  4WXC A;  1YJN I;  3ULQ B;  4ZZD A;  5FKM A;  3R60 A;  2Z1D A;  4JNN A;  1SD5 A;  2FNP A;  2UV1 A;  3KKC A;  5DAJ A;  5IP6 A;  1T8I A;  1XSV A;  3KEQ A;  2HTJ A;  3ZN0 A;  2WY7 Q;  3E3V A;  1KQ8 A;  2XDN A;  3VW1 A;  1ZR2 A;  1CF7 B;  4KN7 X;  3PO3 J;  3ZXS A;  2IS6 A;  2QSF X;  1D1B A;  4NUB A;  2JPB A;  2NNY A;  1HDD C;  4ZZL A;  3GZI A;  3ZP5 A;  4D5F A;  3ANG A;  2JWT A;  3KZI C;  3SFI A;  4E7Z A;  3W6K B;  1JKO C;  3A0H C;  3S1N J;  3LSM A;  3EQL F;  3VSK A;  4XLP F;  1R58 A;  3NXC A;  1QVU A;  1W7P B;  2HOS A;  2VKE A;  5ICC A;  1Z91 A;  4L0Y B;  1KU7 A;  3DV8 A;  1TW3 A;  4XLH A;  1ZGA A;  3LL7 A;  3HB9 A;  4IL6 C;  3ABT A;  1PP8 F;  2NS8 A;  4F92 B;  4HBL A;  3ZQL A;  5F0H A;  2FQ4 A;  4P55 A;  3WTU C;  2P7C B;  1XMK A;  5J47 A;  2JUC A;  4OIO F;  1EH6 A;  4OIN F;  5J8C A;  3K1N A;  5FLX Z;  4I09 A;  1MND A;  2K86 A;  1P7J A;  3CMY A;  5F1J A;  4KWA A;  3TDU C;  1V5G A;  2VT2 A;  1JI8 A;  2L9V A;  1WJF A;  1VQ7 I;  2QKO A;  1FIA A;  1V5E A;  3RYR A;  2OA4 A;  3CQZ J;  3CCS I;  1K6O A;  3AQT A;  3M3Y J;  1TNS A;  5DEQ A;  3IH3 A;  3HM5 A;  4LB6 B;  3CZ6 A;  2CQQ A;  2M30 A;  4L9V A;  5DM6 F;  1V54 H;  1K4T A;  2CUF A;  1UB9 A;  5GAH J;  2EFW A;  3IAS 2;  2F2E A;  2WA0 A;  2EFQ A;  2DOE A;  3CCQ I;  1HSJ A;  1UHS A;  4UV9 A;  2YX4 A;  3U2R A;  4DYC A;  4HG2 A;  1UI5 A;  5FFZ A;  2NP5 A;  2UUZ A;  2OC6 A;  3W2V A;  5FB2 A;  3G2B A;  1LDD A;  3BT9 A;  4OMZ A;  2WAE A;  3CO7 C;  1J59 A;  1T98 A;  2OU2 A;  3BRO A;  2VE8 A;  1SMY F;  2HI3 A;  1SC7 A;  4ME9 A;  4AD9 A;  1R5I D;  4L9N A;  3OYG A;  2QBY B;  1FYL A;  2DO7 A;  1G3S A;  2CW0 F;  1STZ A;  1ZRD A;  4MK6 A;  4Y52 J;  5J1Y A;  1BIB A;  5K7Z A;  1HW1 A;  2L4M A;  3QPH A;  3CUQ A;  3O60 A;  4ICH A;  4OU0 A;  3R61 A;  1IRG A;  4PSW A;  4BGD A;  2VBZ A;  3K4M A;  1MBE A;  3BJB A;  5E1W A;  4F7Z A;  2E36 A;  2V4J C;  3E6M A;  1RI7 A;  3ERM A;  4RMN A;  3C18 A;  4Y13 A;  3CCE I;  4DBQ A;  2JUG A;  3U1D A;  2IAI A;  4KUM A;  4PGG A;  4I76 A;  3RKY A;  1JKR C;  2RHA A;  4LIT A;  2CJJ A;  3WU0 A;  3S15 J;  1N77 A;  1BN5 A;  1X3Z B;  1TWG J;  1LDK B;  4X6A J;  3G7R A;  1MBK A;  4DIQ A;  5E17 F;  3MZ8 A;  3KET A;  1ODD A;  3HOZ J;  1R71 A;  4A3D J;  1ETQ A;  2NVX J;  5D5V B;  1V3F A;  3B73 A;  1WGX A;  3WU1 B;  1HBX G;  2LMD A;  1YW7 A;  2M7A A;  2P6T A;  4BEH A;  4FE7 A;  3L1P A;  2CV1 A;  2E5N A;  2EFN A;  1OYY A;  3L2U A;  3FRQ A;  1POG A;  3LSI A;  3HTJ A;  2XF5 A;  4FX4 A;  2F6C A;  2BY2 A;  4BBR J;  5GAD J;  4B43 A;  3BG6 A;  5IOY A;  2NXN B;  3W3C A;  2HQA A;  3U9G A;  2K3F A;  1W7P D;  4BAY A;  2GXA A;  1KQ0 A;  2M45 A;  2V6C A;  3FIW A;  3A0B C;  3A1Y A;  1H88 C;  4YZE A;  3LA7 A;  2ZJQ F;  2HDW A;  2RNJ A;  4ESB A;  5HLG A;  3NI7 A;  2CG4 A;  1R49 A;  5GTI C;  3GEU A;  3K4C A;  5E79 C;  3U21 A;  2WUI A;  1SVO A;  1JJ8 C;  1KU2 A;  2ME6 A;  4OOI A;  1WH7 A;  1W36 C;  1MJA A;  1S29 A;  3KPH A;  4AVP A;  5F0F A;  2PN6 A;  1ETW A;  2RNG A;  3ON4 A;  1T56 A;  3V8L A;  1D8K A;  2EQR A;  2ZJP F;  2JK3 A;  2KP6 A;  4BYY A;  3AFH A;  2ZBK A;  2DXI A;  1F43 A;  1IUF A;  4GYI A;  5J4V A;  1MH4 A;  2HKO A;  4OWR B;  2V57 A;  4BY1 J;  3ZMD A;  3WG9 A;  2LLK A;  3AAF A;  4HPQ A;  2CUE A;  1XGS A;  4M73 A;  1VTN C;  4IRI A;  4JX5 A;  1VQN I;  4JQF A;  4EGY A;  3NPI A;  4FX0 A;  2PJR A;  4IHT A;  2UXU A;  5D5W B;  3DTK A;  2Y0S A;  2V1U A;  4Y17 A;  3DBL B;  2DDB A;  2FF4 A;  3LMM A;  2JRT A;  2ID3 A;  3EET A;  4C9Y A;  1K83 J;  1W4M A;  2DTZ A;  1IC8 A;  3CTA A;  3Q0V A;  3HRU A;  3I71 A;  4B3A A;  2K4J A;  1IF1 A;  1XS9 A;  1J5Y A;  4RLF A;  4CH7 A;  5EG0 B;  2I5U A;  5C4J J;  1JUS A;  2CV2 A;  3BPV A;  3OIP A;  2XVC A;  2F5D A;  3JTH A;  2E35 A;  4W1U A;  5EZH A;  3LJL A;  1LQ1 A;  1KQ9 A;  1JT6 A;  3JRB A;  1BR4 A;  2CRG A;  3QYB A;  4PK4 A;  2XUB A;  3E6D A;  2P5L C;  6PAX A;  4RGS A;  3H5A A;  1MZB A;  4UB8 C;  5BMZ A;  1HCR A;  2DFE A;  2X51 A;  3ASO H;  5D5X B;  3VYR B;  3IUO A;  1YW9 A;  4HEA 2;  4RB0 A;  2G3B A;  4LG3 A;  1HQC A;  3I3L A;  1ON1 A;  5FD5 A;  4BJ6 C;  2DA2 A;  5DYM A;  3NRV A;  2DYR H;  1SVM A;  2EIJ H;  2XDV A;  2W4S A;  3L2W A;  3HG9 A;  1XGO A;  2LY9 A;  2M5W A;  5GP9 A;  2W85 A;  4E7J A;  4NC6 A;  1SFU A;  1O3T A;  1TL8 A;  1REP C;  1T08 B;  4AC0 A;  2RC4 A;  1Z9C A;  1JHH A;  2FOK A;  4IX7 A;  5CLS A;  1YYV A;  2VBX A;  3FMQ A;  3K4L A;  4D9J A;  3WE3 A;  1HF0 A;  2MW8 A;  1ERD A;  5BPD A;  3CUO A;  1E0E A;  4GCV A;  3VOK A;  2DA4 A;  3ZQ7 A;  1OIS A;  2NNN A;  2QSG X;  2XB5 A;  2QBY A;  4PCQ A;  1ZN2 A;  2JT1 A;  3DKY A;  4MHG A;  4J19 A;  2IGK A;  2EZI A;  4XN0 A;  1D0Z A;  4RM3 A;  2F07 A;  5FMP A;  2DT7 B;  2MYS A;  4QSH A;  3GX4 X;  3JSJ A;  3GTJ J;  3HPH A;  2L3D A;  5DCM A;  1LDJ A;  2V26 A;  4I01 A;  2VQH A;  4L5E A;  3F3X A;  3TMO A;  2YR2 A;  2O5R A;  2UXI A;  4LG0 B;  3LFU A;  3BHQ A;  3O6B B;  1W5S A;  3RH2 A;  2VXD A;  4A93 J;  2AS5 F;  4UHT A;  3MKZ A;  2Z99 A;  1SGM A;  3H35 A;  1YE9 A;  1ETV A;  3TGN A;  3I4N J;  4G8X A;  3T5X A;  1MDM A;  2G7L A;  1JUP A;  2KRH A;  4UB6 C;  2VAS A;  1A6Q A;  2P81 A;  3HOS A;  2ZSI B;  3OV8 A;  4WWC A;  1OLT A;  4IOC F;  1QU3 A;  2AXT C;  4PZJ A;  5HDG A;  2RV8 A;  3NEU A;  3A01 B;  1ITY A;  2LP0 A;  4BEH B;  1MNE A;  5EZG A;  4DVY P;  3QQA A;  2ESH A;  2V1D A;  4XIC A;  4IRG A;  3RCO A;  1XC5 A;  2EV0 A;  2BYV E;  2P4W A;  2D1H A;  3KLO A;  5FHP A;  3ZGK A;  1Y0N A;  2B63 J;  2EWN A;  2VT3 A;  3VEP A;  3EUK L;  1G2H A;  2QM3 A;  2EPF A;  2FQ3 A;  1ZRC A;  1FEX A;  3F23 A;  2LK2 A;  2VJJ A;  1K6Y A;  1XPX A;  3QU6 A;  5FO5 A;  1YTY A;  4XQF A;  4E70 A;  3SQN A;  3LFK A;  1VQL I;  2IS2 A;  4OMY A;  4N9H A;  2R7V A;  5KCM A;  2K9S A;  2XKO A;  3BTC A;  3S2W A;  1TNT A;  3RYP A;  4CCM A;  2LF8 A;  5H6Q A;  2LRD A;  3CCV I;  3OYF A;  1IW7 F;  3A4C A;  4HSR A;  5EGO A;  2LSO A;  3K69 A;  3IKT A;  2W57 A;  3FBI B;  1JXS A;  1H89 C;  4XM3 A;  4DYR A;  1RR8 C;  2FA5 A;  1MGT A;  2H94 A;  5FLM J;  1ETK A;  3DPU A;  5IP9 J;  3CMM A;  2DJN A;  1WQ2 A;  1D5Y A;  3TBI A;  3DLA A;  5FRM A;  4FCY A;  2EZH A;  2PX9 A;  3H36 A;  1NK3 P;  2GOX B;  2ZOY A;  2EA2 A;  2MC4 A;  2V7F A;  1HA8 A;  2L54 A;  1VZ0 A;  2HYG D; 
#chains in the Genus database with same CATH homology
 4EEF G;  3DPJ A;  1RKT A;  3S1M J;  5HBU A;  2ZB9 A;  2XSD C;  2O7O A;  3GTL J;  5DS9 A;  3PO2 J;  3QPL A;  1ETO A;  4FE4 A;  3CDL A;  2JA6 J;  3BR3 A;  4X1E A;  5F08 A;  3FK7 A;  5EFY A;  2MG4 A;  5F0C A;  3GTG J;  1DU6 A;  2ID6 A;  1Z0X A;  3HDD A;  2DMP A;  3RQI A;  5D1R A;  5C4X J;  4IHX A;  3IV5 A;  2H8R A;  5E3L A;  3Q3S A;  3BRU A;  1UG2 A;  2AHQ A;  1I3Q J;  1TWA J;  3Q0U A;  3JRE A;  3MKL A;  2W48 A;  3VW2 A;  5HSZ A;  2R5Y B;  2IEK A;  4A3B J;  3ANP A;  5K7F A;  1GVD A;  1DU0 A;  3LWJ A;  1MSE C;  2JA7 J;  4Y7N J;  4L62 A;  1P7I A;  2XPW A;  2VKV A;  3RZD J;  3GTK J;  5M5W J;  2IBD A;  4LOC A;  4A3J J;  2D6Y A;  2GM4 A;  3B81 A;  1BJZ A;  1MBJ A;  3DEW A;  3F0C A;  1BL0 A;  2HKU A;  2DA1 A;  3AQS A;  3NAU A;  5J3L A;  3H0G J;  2ZCN A;  2NS7 A;  1LE8 A;  2YU9 J;  2DA7 A;  4NDL A;  5F04 A;  3SJM A;  3LNQ A;  4XRS G;  3B6C A;  1MH3 A;  3COL A;  2W53 A;  4V2G A;  3CRJ A;  1U9O A;  2LKX A;  2LFB A;  2JA5 J;  2NVT J;  2KT0 A;  3GBG A;  3MNL A;  2DA3 A;  4MFD A;  2M9H A;  3BG3 A;  4RDU A;  1FJL A;  5J1U A;  1S7E A;  4A3L J;  2E1O A;  4I6Z A;  2Y0S N;  4GFK A;  4FIS A;  4M3E A;  2HOT A;  5FKM A;  2E2I J;  3F1B A;  3VP5 A;  1K61 A;  4JNN A;  1WH5 A;  4XRM A;  3LSR A;  4UUS A;  4M3G A;  3KKC A;  5DAJ A;  5D18 A;  2QF7 A;  4MLO A;  5IP6 A;  1YRN A;  2VUM J;  2LTP A;  5EF6 A;  3CCY A;  1WI3 A;  3VW1 A;  5E3N A;  2XDN A;  1ZR2 A;  5CXI A;  2HQ5 A;  3PO3 J;  3C07 A;  4UUT A;  4MXM A;  3JRC A;  5EDN A;  1JGG A;  1HDD C;  3S17 J;  5AQC A;  1E3O C;  2R0Q C;  1O4X A;  3GZI A;  4D5F A;  1GDT A;  3ANG A;  2JWT A;  3HEF A;  3SFI A;  3C2B A;  3K7A J;  2FX0 A;  1JKO C;  2LVS A;  2ZCM A;  4HKU A;  4V2F A;  3S1N J;  5K58 A;  1IJW C;  2L7F P;  3NXC A;  2OF7 A;  1QVU A;  2HOS A;  2VKE A;  1T33 A;  1JTY A;  1TWC J;  2G7G A;  3HOY J;  2OI8 A;  1X58 A;  3NRG A;  4A3E J;  1ORK A;  2K40 A;  2GLO A;  3FIS A;  5D19 A;  1B8I B;  2NP3 A;  3HB9 A;  2RAE A;  2QCO A;  3S16 J;  2XPU A;  4G12 A;  3ZQF A;  2NS8 A;  2DA5 A;  3K2A A;  3G1L A;  3ZQL A;  5F0H A;  2FQ4 A;  4DW6 A;  2NVY J;  4QIW N;  3D1N I;  2ME0 A;  1ETX A;  1U9N A;  2EBI A;  3TED A;  1UMQ A;  3WHB A;  3KKD A;  4M6V A;  2R5Z A;  2XGC A;  4RBO A;  1P7J A;  1LFU P;  5FKO A;  4ABZ A;  5F1J A;  3CMY A;  4A3C J;  4KWA A;  3HIM A;  3QPS A;  1Q1V A;  5FKK A;  2E2J J;  1EF4 A;  2Y2Z A;  2QKO A;  1FIA A;  3HOU J;  2DN0 A;  3CQZ J;  5EEA A;  3AQT A;  1Z77 A;  3M3Y J;  3P9T A;  3IH3 A;  3HM5 A;  2Q24 A;  2CQQ A;  2DG8 A;  5IYB J;  1RKW A;  1BA5 A;  2CUF A;  4A3F J;  1IRZ A;  3OSF A;  3OIO A;  5EG0 A;  3GTQ J;  3HOW J;  1GUU A;  1U8B A;  4C2M J;  4XID A;  1JT0 A;  3HTA A;  4JYK A;  1UHS A;  3BNI A;  3TP3 A;  4DYC A;  1UI5 A;  5GPA A;  2NP5 A;  4JL3 A;  3DCF A;  3VW0 A;  3ON2 A;  3BT9 A;  2YVH A;  1HDP A;  1QPI A;  2G7S A;  4ME9 A;  2HI3 A;  3A01 A;  4A3I J;  4D5C A;  3QKX A;  3EUP A;  1AKH B;  4MK6 A;  4Y52 J;  1IGN A;  5J1Y A;  5K7Z A;  3BR5 A;  4ICH A;  2L7M P;  2MGQ A;  3O60 A;  3H3V K;  4GFB A;  3PPB A;  3S5R A;  5H9T A;  1APL C;  2QIB A;  3ZOB A;  2HOA A;  3A03 A;  4GFL A;  3HBL A;  1VF9 A;  4IEJ A;  2L0K A;  3JRA A;  1MBE A;  2K9Q A;  2MSY A;  3BJB A;  2GEN A;  2LD5 A;  1TWH J;  3S2H J;  1X2M A;  2FJ1 A;  1MNM C;  3BQY A;  5IPA A;  3JR9 A;  4GCL A;  2ZOZ A;  4JX4 A;  2IAI A;  3LSJ A;  1RPW A;  3UKG A;  4I76 A;  1JKR C;  2O7T A;  2RHA A;  3BQZ A;  2CJJ A;  2QWT A;  3W6V A;  2DMQ A;  2TCT A;  1YRN B;  3S15 J;  5EGO B;  1B72 A;  2UXH A;  1TWG J;  1ZR4 A;  1ZKG A;  4X6A J;  3G7R A;  5DTD A;  1MBK A;  3JRD A;  1JJ6 C;  1AU7 A;  1I6H J;  3VVY A;  3HOZ J;  1A5J A;  4A3D J;  1ETQ A;  2NVX J;  3E7L A;  4S0H B;  1WGX A;  1MSF C;  1HOM A;  3JRH A;  4FE7 A;  3L1P A;  3S14 J;  2ECB A;  5CXG A;  3FRQ A;  1POG A;  3LSP A;  4GCK A;  3KNW A;  4BBS J;  3G1M A;  3SDG A;  3HTJ A;  2H1K A;  3IUV A;  4BBR J;  2R7Z J;  5IP7 J;  2UXP A;  3HOV J;  1RET A;  3O8G A;  3JRF A;  3V6G A;  3BCG A;  2E2H J;  1NK2 P;  5IOY A;  3BTI A;  3ZQC A;  4PXI A;  3FIW A;  2DG7 A;  2LR8 A;  1H88 C;  5J1R A;  2REK A;  4YZE A;  3KZ9 A;  3T6N A;  3HTH A;  3NNR A;  2XGD A;  2PMZ N;  5M3M J;  1ZQ3 P;  4C3H J;  3NI7 A;  5GPC A;  3GEU A;  4NN1 A;  3Q0W A;  2WUI A;  1A6I A;  3HKZ N;  2HXO A;  3IH4 A;  1JJ8 C;  2ME6 A;  1WH7 A;  1W0U A;  1QRY A;  1XG1 A;  5F0F A;  3VPR A;  4AUX A;  1ETW A;  2ELK A;  3ON4 A;  1T56 A;  4BKX A;  5FKL A;  5C44 J;  2WGB A;  2EQR A;  1TC3 C;  3QBM A;  2JK3 A;  1FIP A;  1IV6 A;  3CJD A;  3BR6 A;  1Y1W J;  2ZCX A;  1F43 A;  2Y9Y A;  1IUF A;  5BNG A;  2R5Y A;  4XRS A;  5HAW A;  1F36 A;  1IDZ A;  1MH4 A;  2XB0 X;  1U78 A;  2DA6 A;  2V57 A;  4IHW A;  3JRG A;  4BY1 J;  2GBY A;  1OJL A;  3OSG A;  2CU7 A;  2LLK A;  1PUF B;  2NVQ J;  4DZJ A;  2CUE A;  2L7Z A;  4AF5 A;  4JX5 A;  3NPI A;  1GV2 A;  4MO7 A;  4C3I J;  2CQX A;  5EYR A;  1JKP C;  2UXU A;  1RES A;  5C4Y A;  4HNV A;  3BR0 A;  2ID3 A;  5M5X J;  1K83 J;  2DTZ A;  1IC8 A;  1AHD P;  3Q0V A;  4B3A A;  3BTJ A;  1VFC A;  1XS9 A;  5EG0 B;  1OCT C;  4QTR A;  5C4J J;  1JUS A;  5M5Y J;  1VND A;  1MBG A;  4W1U A;  5EZH A;  4DYQ A;  5E3O A;  3LJL A;  1R9T J;  1JT6 A;  3JRB A;  1CQT A;  4C3J J;  3JRI A;  2JA8 J;  3S1Q J;  1OFC X;  2CRG A;  2XPV A;  5FLV A;  3A02 A;  1ZK8 A;  2WV1 A;  3MVP A;  2D5V A;  4A69 C;  2Y9Z A;  2M34 A;  4MFE A;  3LHQ A;  1HCR A;  4A3G J;  3BG9 A;  2KDZ A;  2RAS A;  3MN2 A;  2R92 J;  2IU5 A;  2DMU A;  3LSG A;  2G3B A;  3EGQ A;  3HOX J;  2L9R A;  1GT0 C;  5IYD J;  5IYC J;  3PM1 A;  3M4O J;  2DA2 A;  2R93 J;  2M2E A;  1UI6 A;  3CWR A;  5GP9 A;  2LY9 A;  3GTO J;  2WAQ N;  3VOX A;  2O8K A;  4AC0 A;  1FTZ A;  5F27 A;  3ZQH A;  3VUQ A;  3HGY A;  3TW6 A;  2FBQ A;  5C3E J;  1MBF A;  2N8G A;  2JN6 A;  2MW8 A;  5M3F J;  1HF0 A;  1LFB A;  3GTP J;  3VOK A;  4B1R A;  2DA4 A;  2HYJ A;  3BR2 A;  2PBX A;  4NEL A;  5JLX A;  2XB5 A;  1X2N A;  2NX4 A;  1JUM A;  2VPR A;  2X9D A;  5FJ8 J;  4J19 A;  2EZI A;  3BR1 A;  1ZTR A;  1JKQ C;  2F07 A;  5FMP A;  4QSH A;  3JSJ A;  1WCM J;  3GTJ J;  2DMN A;  3ZQI A;  3BG5 A;  1IG7 A;  2XGE A;  3ZQG A;  4L5E A;  1SFO J;  2UXI A;  4JKZ A;  4CGR A;  2ECC A;  1AKH A;  3BHQ A;  3RH2 A;  3I4M J;  4A93 J;  2EZK A;  2JMW A;  1Y1V J;  1H8A C;  2JJ7 A;  1SGM A;  4CYC B;  2HDD A;  1ETV A;  3B6A A;  1JTX A;  3I4N J;  1RR7 A;  1IDY A;  3TW7 A;  4AC6 A;  5E3M A;  2G7L A;  1JUP A;  2M0C A;  9ANT A;  3E7Q A;  4AYB N;  1ZGW A;  2P81 A;  3HGG A;  1NTC A;  5IOZ A;  3G1O A;  2YVE A;  4D7M A;  1BW5 A;  2QTQ A;  3A01 B;  4IHV A;  1ITY A;  5FGL A;  2LP0 A;  3FKI J;  3HE0 A;  4B4C A;  3WHC A;  3RKQ A;  3V78 A;  5EZG A;  3O8H A;  1FTT A;  3QQA A;  1OCP A;  2X48 A;  4XIC A;  2AO9 A;  2EZL A;  4JP0 A;  1XC5 A;  1MBH A;  2GFN A;  5FHP A;  3VVX A;  3FK6 A;  4M3D A;  2B63 J;  3RZO J;  3HTI A;  5HOD A;  2E19 A;  1G2H A;  2WB1 N;  3TP0 A;  1PUF A;  1FEX A;  2LK2 A;  4M3B A;  4GCT A;  4M3F A;  1LE8 B;  4BXX J;  1ETY A;  4DZP A;  3PAS A;  2DMT A;  2K9N A;  2UXO A;  3OOU A;  3LOC A;  1GV5 A;  5CW8 A;  2Y30 A;  3VIB A;  2YUS A;  2OER A;  4MIM A;  4BY7 J;  1I50 J;  4W97 A;  4A3K J;  2K9S A;  3BTC A;  5K7H A;  3VVZ A;  2I10 A;  2HXI A;  4FTH A;  5FKN A;  2TRT A;  2OPT A;  5EGO A;  1B72 B;  2QOP A;  1WPK A;  2Y31 A;  2VI6 A;  1H89 C;  4DYR A;  1ENH A;  2M8G X;  4UUS B;  1BW6 A;  2COB A;  4D7N A;  3IH2 A;  4IHY A;  1VI0 A;  2NOG A;  3S2D J;  2FD5 A;  3BTL A;  5FLM J;  4CYC A;  3RD3 A;  4ACI A;  1ETK A;  5IP9 J;  2DJN A;  2X6O A;  2GUH A;  2EH3 A;  4JX6 A;  1D5Y A;  4UDS A;  2YS9 A;  4FCY A;  3G56 A;  2EZH A;  2PZ9 A;  1TWF J;  1SAN A;  4XK4 A;  4A3M J;  1NK3 P;  2ZOY A;  1W0T A;  2G0E A;  2R5Z B;  2O9L A;  2HYT A;  2XRL A;  1HLV A;  1B8I A;  3S1R J;  1QVT A;  3GTM J;  3NAR A;  5JLW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...