1JUSA

Crystal structure of the multidrug binding transcriptional repressor qacr bound to rhodamine 6g
Total Genus 76
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
76
sequence length
186
structure length
186
Chain Sequence
NLKDKILGVAKELFIKNGYNATTTGEIVKLSESSKGNLYYHFKTKENLFLEILNIEESKWQEQWKKEQIKAKTNREKFYLYNELSLTTEYYYPLQNAIIEFYTEYYKTNSINEKMNKLENKYIDAYHVIFKEGNLNGEWSINDVNAVSKIAANAVNGIVTFTHEQNINERIKLMNKFSQIFLNGLS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural mechanisms of QacR induction and multidrug recognition.
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Transcription
molecule keywords HYPOTHETICAL TRANSCRIPTIONAL REGULATOR IN QACA 5'REGION
total genus 76
structure length 186
sequence length 186
chains with identical sequence B, D, E
ec nomenclature
pdb deposition date 2001-08-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00440 TetR_N Bacterial regulatory proteins, tetR family
A PF08360 TetR_C_5 QacR-like protein, C-terminal region
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 1jusA01
1.10.357.10 Mainly Alpha Orthogonal Bundle Tetracycline Repressor; domain 2 Tetracycline Repressor, domain 2 1jusA02
3JRDA 4NDLA 2XGEA 2NVTJ 4C2MJ 4BBSJ 1A5JA 2D6YA 4Y52J 1MBFA 3IH3A 3RZOJ 2CUEA 3VVYA 2JA5J 5EGOA 1WH5A 2JK3A 1D5YA 3G1OA 3NRGA 2XRLA 4A3IJ 5C4JJ 1H88C 1ETQA 3PM1A 3RZDJ 3BR1A 5BNGA 1PUFB 3ON2A 3DCFA 1AKHA 4MK6A 5FMPA 3BR3A 2YS9A 1W0UA 3E7LA 1CQTA 1UI6A 2RHAA 3VPRA 3PO3J 2W53A 3S15J 4LOCA 4BXXJ 3HOZJ 2LK2A 5C4YA 4QIWN 2LD5A 2E2JJ 3IH4A 3S17J 1ENHA 4M3EA 2QTQA 3A01A 5EZHA 5D1RA 2K40A 2EZHA 4ICHA 5EFYA 5DTDA 1IUFA 1VI0A 4G12A 3GTMJ 2HXOA 5IYBJ 1S7EA 5F0FA 2GFNA 2WUIA 3HDDA 4A3CJ 4JKZA 2K9QA 4DW6A 1JTXA 2M8GX 1SFOJ 2HQ5A 2ME6A 4GCTA 1GV5A 1MNMC 3C2BA 1SGMA 1UI5A 2WB1N 1A6IA 2XB5A 3QKXA 2QOPA 3JSJA 3FK6A 2HDDA 2L7FP 5CW8A 3CDLA 4W1UA 4JL3A 2MW8A 4C3IJ 3ZQCA 3FK7A 4CYCB 1JKOC 5E3NA 1ETWA 3Q0UA 4B4CA 3BTIA 3OSFA 5K58A 4DYRA 5EDNA 2IBDA 2HYTA 2W48A 2M2EA 1H89C 2NS8A 2R5ZB 1OCPA 2ZCXA 3LSGA 3LSPA 4JNNA 1BA5A 1LFBA 4JX6A 1AHDP 2R7ZJ 4UDSA 4FISA 3GTJJ 3S1NJ 1H8AC 1JT6A 2UXOA 5E3LA 2G7LA 1GUUA 4JX4A 3KNWA 2R5ZA 3AQTA 5M3MJ 4AUXA 3MNLA 4I6ZA 2DTZA 1UHSA 3GTKJ 2H1KA 3S2DJ 2DMTA 1JKPC 2DG7A 5E3MA 2EZKA 2DA7A 2O7OA 2RAEA 3G56A 3FKIJ 4C3JJ 1LE8A 2GENA 3SJMA 2LLKA 3CWRA 2NX4A 2AHQA 3B6CA 4V2FA 1ZKGA 2VPRA 3Q0VA 1UG2A 1OJLA 5M5XJ 5F0CA 4GFBA 1IC8A 2OERA 1MH3A 4IHWA 1K83J 3E7QA 3F1BA 3LNQA 1RESA 2X9DA 3HB9A 2Y9YA 5EF6A 1RETA 3WHBA 3BTLA 2O9LA 3VW1A 4S0HB 1ZR2A 3KKCA 3MN2A 2G7GA 2L0KA 3CMYA 2PZ9A 2HKUA 5IOYA 4ABZA 3LSJA 1VF9A 5IYCJ 2YVEA 2FQ4A 2UXPA 2XSDC 3CCYA 1MSEC 1POGA 1RPWA 3QQAA 2Y30A 4M3BA 1BW5A 4HNVA 2NVYJ 5DAJA 2E2HJ 2UXIA 4CGRA 4IHYA 3IV5A 2CJJA 1JTYA 4M6VA 1ZGWA 1JJ6C 1DU6A 2V57A 4D7MA 2XGCA 2DA2A 2YUSA 1TWFJ 5F0HA 3HOXJ 2R92J 5IP7J 2Q24A 1FTZA 2DG8A 1MBGA 5F08A 2TCTA 1YRNB 3G7RA 5H9TA 5IYDJ 3OSGA 4XRSA 3RQIA 1O4XA 1ZK8A 2VI6A 1ETKA 2CU7A 3GTPJ 2ZB9A 2YVHA 3HOVJ 3HOWJ 1G2HA 5HODA 2Y0SN 5C4XJ 1ZQ3P 3NI7A 4FE4A 4W97A 1ETXA 3VUQA 1TWHJ 3BG3A 5EGOB 3KKDA 4A93J 2HXIA 2ID6A 5IOZA 3BTJA 3F0CA 1MBHA 1JT0A 2ZOZA 4UUSA 3RKQA 1F43A 4XRMA 9ANTA 3HKZN 2D5VA 3B6AA 1OFCX 2ECCA 3COLA 2L7MP 1T33A 3DPJA 2LY9A 3FIWA 5EG0A 1B8IA 2GM4A 3GTOJ 1P7IA 2XDNA 5IP9J 2LKXA 4NN1A 2QKOA 1U9OA 5IPAA 3L1PA 3HOUJ 1QVTA 2YU9J 3BRUA 5M5YJ 4IHVA 2HI3A 3HE0A 5M5WJ 2JN6A 2EBIA 2DMPA 1VNDA 4J19A 5HBUA 4HKUA 2DMNA 2DA6A 2KT0A 4JYKA 4PXIA 1HCRA 2I10A 2DA5A 4M3GA 2ZCMA 4YZEA 2CQQA 4QSHA 1ETOA 3RH2A 2JA8J 3VVZA 2X6OA 2QCOA 2Y31A 4AC0A 2HOSA 3CQZJ 2UXHA 5J3LA 5C3EJ 3VOKA 1ETVA 4D5FA 2LR8A 3WHCA 2KDZA 4DYCA 3S14J 1ITYA 3T6NA 3FISA 3ANGA 1TC3C 5E3OA 1RKWA 5EG0B 2VKEA 3MKLA 3SDGA 1B8IB 4GFKA 3OOUA 2XB0X 2QF7A 5JLXA 3JRGA 2HOTA 4L5EA 4A3LJ 5DS9A 3LJLA 2L7ZA 2NVXJ 3S1MJ 1I6HJ 2ELKA 4A3DJ 3HTIA 5CXIA 3QBMA 1PUFA 3LOCA 3JR9A 4A3FJ 5CXGA 3I4MJ 2IEKA 2MG4A 4MIMA 2G0EA 3HBLA 2JA7J 3S2HJ 2NP3A 5K7FA 2HOAA 5J1YA 2REKA 1BJZA 2M9HA 2M34A 4A3GJ 3EGQA 1IDYA 3BJBA 3QPLA 1Y1WJ 3TP0A 4BBRJ 3FRQA 3K2AA 2JJ7A 2E2IJ 3BG9A 3VOXA 5HAWA 1MBKA 2NS7A 1EF4A 4D5CA 2DA4A 4EEFG 4RDUA 4UUTA 4FE7A 2ID3A 3A03A 1WPKA 1HDDC 2RASA 2OF7A 3VVXA 3S16J 2DMUA 3IUVA 1TWGJ 1HDPA 2CQXA 4ACIA 2IAIA 5FKMA 3JRHA 3OIOA 1IRZA 2ZCNA 4A3JJ 1JGGA 2LTPA 1UMQA 3HM5A 5J1RA 5HSZA 3TEDA 1JUSA 1T56A 5EYRA 1MBJA 3GTQJ 3HEFA 1WGXA 2GLOA 2DA1A 1HOMA 2PBXA 2O7TA 4GCLA 2EH3A 4CYCA 3S1RJ 2ME0A 1K61A 2G7SA 3O8HA 1JJ8C 3HIMA 3K7AJ 3P9TA 4BKXA 3AQSA 1WCMJ 3Q0WA 3ZQLA 4A3KJ 1W0TA 2MGQA 5F04A 1IG7A 2L9RA 3CRJA 3H0GJ 3BQYA 2EZLA 5FKNA 4XRSG 4AF5A 2E19A 5EZGA 3O60A 3V6GA 2B63J 2XPVA 5FGLA 4DZPA 2CUFA 2NVQJ 3HTHA 1X58A 2VKVA 1GT0C 5GPCA 2FJ1A 3JRAA 2WGBA 3NNRA 5FKOA 2DJNA 4DYQA 1F36A 2XPUA 4QTRA 1FIPA 4V2GA 3JRFA 4XICA 3TW7A 3GBGA 5K7ZA 3NAUA 3MVPA 1AKHB 2GBYA 3VIBA 3LHQA 3QPSA 3ANPA 1I50J 3TP3A 3ZQGA 1FJLA 4BY1J 1FTTA 2DMQA 3VW0A 3GTLJ 1DU0A 4M3FA 3GZIA 1B72B 2HYJA 1NTCA 3LWJA 5FKKA 3NXCA 1IJWC 1GV2A 3G1LA 2COBA 5J1UA 2QWTA 3I4NJ 3D1NI 3JRBA 5F1JA 5FLMJ 1B72A 2F07A 2VUMJ 4BY7J 4JP0A 2CRGA 2FD5A 3V78A 2PMZN 2G3BA 1Z77A 2MSYA 1ZR4A 2NOGA 4NELA 1MBEA 2P81A 4UUSB 2QIBA 3H3VK 2M0CA 3GTGJ 4MXMA 1TWCJ 4A3MJ 1LE8B 4MFDA 2JMWA 2FBQA 4A3EJ 2EZIA 2WV1A 1BW6A 2Y9ZA 1SANA 2WAQN 3SFIA 1AU7A 1QPIA 3C07A 1TWAJ 3IH2A 3BCGA 2AO9A 4X6AJ 4Y7NJ 2TRTA 4XK4A 4GFLA 1U78A 1YRNA 1XS9A 1Z0XA 3PO2J 1U8BA 4B3AA 3PPBA 3A02A 3JRCA 5D19A 4AYBN 3KZ9A 4IEJA 1Y1VJ 3A01B 3HTAA 3LSRA 2EQRA 3BR2A 2N8GA 2E1OA 1RR7A 2X48A 1X2MA 1HLVA 3M4OJ 2R5YB 5D18A 5AQCA 1ORKA 2ECBA 3HGYA 3HGGA 4MLOA 4DZJA 1E3OC 3VW2A 4XIDA 3BT9A 3NARA 3GEUA 2R5YA 2NP5A 3VP5A 1JKQC 5EEAA 3BR0A 3ZOBA 2LFBA 1QVUA 3BR6A 1FEXA 3RD3A 3S5RA 4AC6A 2OPTA 5JLWA 4FTHA 1LFUP 1IV6A 2JA6J 1NK2P 1I3QJ 2LP0A 2XGDA 3TW6A 4IHXA 1QRYA 1WI3A 3BG5A 3UKGA 2LVSA 1GDTA 1XG1A 2DN0A 3DEWA 3ZQIA 4I76A 1R9TJ 3PASA 4MFEA 1JKRC 5GP9A 3BR5A 4JX5A 2UXUA 2ZOYA 1MSFC 4A3BJ 2OI8A 3O8GA 1ZTRA 5M3FJ 2K9NA 3W6VA 4B1RA 3ZQFA 3BHQA 4A69C 4C3HJ 5IP6A 1HF0A 4M3DA 1JUMA 1U9NA 3ON4A 4FCYA 3CJDA 1BL0A 1X2NA 2R0QC 2JWTA 5C44J 2XPWA 4X1EA 3BQZA 4D7NA 1OCTC 3B81A 4ME9A 5FHPA 2DA3A 2K9SA 4L62A 3HOYJ 5FKLA 3HTJA 1JUPA 1FIAA 5FJ8J 4RBOA 3S1QJ 5GPAA 1IDZA 1GVDA 1MH4A 3Q3SA 4MO7A 2Y2ZA 3BTCA 2H8RA 1WH7A 2GUHA 1IGNA 3G1MA 5FLVA 1Q1VA 4KWAA 4GCKA 3BNIA 3M3YJ 2IU5A 3ZQHA 2R93J 1VFCA 3JREA 1ETYA 2FX0A 3JRIA 3NPIA 5F27A 1APLC 3EUPA 1P7JA 1NK3P 1RKTA 1XC5A 2O8KA 5K7HA
chains in the Genus database with same CATH superfamily
3JRDA 4WXDA 1GLNA 2NVTJ 2H09A 3RZOJ 2A61A 3D5LA 3DEUA 5EGOA 2JA5J 1XGSA 1IN8A 1UHMA 3NRGA 3RKYA 4A3IJ 2KJBA 4IF4A 3F9KA 3PM1A 1XCBA 5LRRA 2NRAC 1S6LA 2LYCA 4ON0A 5BNGA 1PUFB 2FMYA 4FQGA 2HVQA 5FMPA 4HW0A 3PSFA 2YS9A 2P5VA 2RHAA 1E17A 3H9JA 3ZN1A 2Z16A 5J8FA 3CCRI 2W84A 5IT3A 2ICWG 2VC1A 4QIWN 2L9SA 3IH4A 2LD5A 4RAYA 3S17J 3X2QH 3ULQB 1G3YA 4X0GA 4CSWA 4DQ2A 4N9HA 3OYGA 5GTHC 2ZJQF 1FC3A 4ICHA 1KGSA 3LQQA 1ZHFA 4Q4ZF 1VI0A 4G12A 5BQTA 3GTMJ 3CTAA 3BCBA 4KDPA 3AL0C 2DDBA 6PAXA 2DYSH 2FXAA 4CCOA 4YEJA 4DW6A 5L3DA 2ME6A 3U1DA 2JQ7A 2UXNA 5JFRA 3DBLB 2V6EA 4XQFA 3C2BA 3NRVA 1RR8C 2WBMA 4NQWA 1D1CA 2DT6A 5LEJA 5LHHA 2HDDA 2VOOA 3MKYB 1D3YA 3CDLA 1OCOH 1IRXA 2DPDA 4JL3A 3FK7A 1TBXA 4AM3A 3TO7A 3Q0UA 4B4CA 3FMQA 2IT0A 2E60A 2V79A 1J7KA 5EDNA 2DJIA 2IBDA 3PIOF 2HTJA 2R5ZB 3LSGA 3DLLF 1S8NA 1LFBA 4IXAA 2R7ZJ 3LSKA 4HX4A 4QPQA 4UDSA 3GTJJ 3S1NJ 1H8AC 1JT6A 5TJJA 5E3LA 3SWHA 1W5SA 5B3SH 3E3VA 2RDPA 3W6KB 2VJJA 2R5ZA 3HUGB 4I6ZA 4BACA 2B0LA 1FPQA 1IXCA 3P7NA 4BDZA 2DG7A 2EZKA 2O7OA 3ZMZA 2RAEA 3CUQA 2HVRA 1T6SA 5DV5A 1T2KA 4K2EA 2P5LC 2PMHA 5LGUA 4BGDA 2NX4A 4M9ZA 3K4LA 2JT1A 5CQGA 2WTEA 2KRCA 3L2RA 1OJLA 3EETA 4HF1A 1EH7A 4BHCA 1K4TA 3PSIA 3BZ6A 1S29A 2FA5A 1K83J 1OISA 3LNQA 1RESA 3I59B 3E6CC 1JI8A 3BJAA 4MGRA 2X9DA 3SDBA 1DQUA 2NS0A 4DOZA 2JVHA 3ELKA 1QNTA 3WHBA 4S0HB 4A0XA 3JSOA 4FHTA 3WTWC 3MN2A 2P0WA 1VQLI 1W7PB 1ZARA 4JBAA 2CQNA 4NNJA 1PJRA 1N25A 2AXLA 1WRJA 2Q1ZB 1MD0A 3CCYA 5GAHJ 2PMUA 3S32A 1UG0A 2XASA 3OYDA 2M5WA 3DKYA 3TBIA 4CGRA 1I3AA 4HLXA 2NXNB 2RNJA 4I0AA 3S3NA 2OBPA 3BLYA 2A6EF 4BE0A 1U8RA 1R1TA 1D0ZA 3DQVC 4HDVA 3IUOA 3RYPA 2HVSA 2AXTC 2BV6A 3FHZA 2L4MA 3I53A 3A1YA 1RRJA 1X1PA 2Z99A 3RDIA 1YFHA 3LSHA 1ZK8A 4HLYA 3BCAA 3E5XA 1W7PA 4EV0A 2VQHA 3DPLC 3GTPJ 5GADJ 5TGTA 1T8IA 2BW3B 3JTHA 5K5RA 3MWMA 3Q9SA 4II2A 1ZQ3P 4CUGA 3ABUA 2A3SA 3LSMA 1BI2A 5HNFA 3F8NA 3VUQA 3TOAA 4A93J 1Z7LA 4L9JA 1UZCA 2QQ9A 4PJLA 3CJTB 3BDDA 1JT0A 3RKQA 2LKSA 2HOEA 2QA4I 3E0JB 3HKZN 1YJ9I 2D5VA 5HLHA 2YSRA 2XAUA 2W25A 2LY9A 3CD6I 5F6FA 2UUZA 1R4MB 5E8IA 2KZVA 2QKOA 4U0WA 1IZ1A 1U9OA 5ICCA 2OUMA 4GYGA 5ILUA 2EILH 3NQOA 3PUFA 2AQEA 1W7PD 3OYHA 5D6FA 2JN6A 3IAM2 1MMNA 2GA2A 3EPZA 1VQ5I 2BOLA 2DPUA 5D5UB 1IAWA 2ZCMA 3CCVI 3RH2A 1ZN2A 3HPGA 4Q48A 3VVZA 1VQOI 1YO5C 2QCOA 3KETA 5C3EJ 3GVAA 4AU7A 1FT9A 1T98A 2NYXA 4BDYA 5DDGA 3WHCA 5HOOA 2KDZA 2PJRB 1ITYA 3T6NA 2ZKZA 1RKWA 2VKEA 3SDGA 4J00A 2RC4A 2A6TA 3OOUA 4XMYA 1U2WA 2X4HA 3SZTA 1JHHA 5DS9A 4I01A 1KU2A 2ADUA 1K6OA 3IKVA 2MH2A 4MEYF 1MDMB 4A3FJ 1I1SA 3I4MJ 1FOKA 3WG9A 2MC4A 3S2HJ 4MNUA 2JA7J 1U0JA 2NP3A 2BHZA 5K7FA 5FO5A 3OYFA 3B02A 2VIXA 4AYBA 2XSJC 3EGQA 2E35A 3C1DA 1IDYA 2F5FA 5K5OA 4U0VA 3BJBA 3O6BB 3R0AA 1Z7UA 4UV9A 4GGGA 1O57A 1EJ9A 5FLXK 4ZTJA 2EFNA 2CQKA 3ZN0A 4N4OB 2Z5UA 1EF4A 4ZYDA 4XM3A 3E97A 4RDUA 4EEFG 5HNHA 2VC0A 1XMAA 4UUTA 1VQKI 2PQ8A 1WPKA 4JQFA 3MZYA 1E3HA 3K4JA 2OCEA 4U7DA 3CCLI 1PUEE 5D5XB 2GXAA 1JGGA 1IO2A 2HR3A 3HM5A 1UMQA 4RLFA 2R7VA 2XKOA 3FBIB 4FX4A 1KONA 2L7KA 3EDPA 1TQPA 1YW9A 1YJWI 5A2QZ 1WJ5A 3J81K 3HRMA 3GYHX 2R7SA 1BN5A 4S05A 3LMMA 1TZLA 2JUCA 4ASNA 3CF2A 4OIRF 1O3QA 1K61A 1MMAA 2GIZA 4EM1A 3HIMA 3FMRA 1JJ8C 2H6BA 1TQIA 3Q0WA 2BY3A 3ZQLA 4RGUA 4A3KJ 3RCOA 1W0TA 4HSTA 1IG7A 4DNCA 1X1BA 3BQYA 4HX7A 2EZLA 5FKNA 2E1MB 3DPTA 4YFKF 3S3MA 2RQQA 3F23A 3HTUA 1I5ZA 1STZA 3IL2A 3V6GA 3NWTA 1PYVA 5FGLA 2F4OB 3CJQB 2IS2A 2W00A 3K9TA 4AD9A 2VKVA 1Q1HA 2WGBA 2DLLA 3I4PA 4DYQA 2R7TA 1VQ8I 1FIPA 2I8DA 3F8BA 3QPTA 4TV7A 3SEZA 5K7ZA 1QHHD 4OMYA 3WU1B 3MVPA 3KYLA 1R36A 2GBYA 4XKBA 2UV1A 4FETA 3QPSA 3ANPA 4HF2A 1FTTA 4CXFA 2W57A 3VW0A 1BJAA 3PL8A 1T38A 5H6QA 1BI3A 4KYWA 1FMWA 3CDHA 4RM3A 3CCQI 2HDCA 5B5EC 1FSHA 2COBA 3V8LA 5F1JA 5CVRA 1TTYA 1R22A 2CRGA 3I9V2 2FD5A 2X51A 1A36A 1Z77A 2MSYA 3J80Z 1KU7A 2M4KA 2J5PA 3DBHB 5LRSA 1V5GA 4WCGA 1NG7A 3SHFA 1TWCJ 2XKPA 1OR7C 4HSRA 4OU0A 3K4NA 4I98B 4A3EJ 2Y9ZA 1SANA 3QU3A 2HQAA 4C9YA 3V7CA 3HIFA 1BOAA 4XK4A 1I1GA 2VBXA 3ERED 4GFLA 5HDNA 1Z0XA 3PO2J 2GXBA 3H9GA 3A02A 3I59A 1G8XA 5AONA 2VJIA 4AYBN 5D19A 4I02A 2V7FA 1Z3YA 2DDAA 2F5DA 3LSRA 3LL7A 2YX4A 4L9NA 5KCMA 1S7AA 5K1YA 3H35A 2ZSIB 3OOPA 1CF7B 5FROA 1ORKA 3HGYA 3OL4A 2LH9A 1N77A 2OJED 3VW2A 4FX0A 4YELA 4RB2C 1W36C 2OV7A 5EEGA 2NP5A 4CCKA 3ZOBA 1B4AA 1T0FA 2LFBA 3HRUA 3QODA 3QOEA 1FEXA 3S5RA 5JLWA 2H8WA 2WA0A 5GAEJ 2EA2A 2ZXHA 3NWSA 4HQEA 2TDXA 4IHXA 1QRYA 2G7HA 3TOBA 1QZYA 1ULYA 2M3AA 5FD5A 3DEWA 4E6KG 2VE8A 4G6DA 4G8XA 1X1AA 1YHQI 2ACJA 4MFEA 3HL2A 1SVMA 1AA7A 2OCCH 4A3BJ 2OI8A 5CJ9A 2XIGA 3AFHA 3O8GA 4LG0A 3OYJA 2K9NA 2Q0OA 1J9IA 3I56I 5FGMA 3S3OA 4XLHA 2KP6A 3CJRB 1HF0A 2CG4A 4DJAA 2VOPA 1JUMA 2VXZA 1BL0A 3PNYA 2JWTA 4HDUA 3DEEA 2E1NA 1Z1DA 2IXSA 1WI9A 4XLAA 5C44J 3BQZA 3B81A 4U9NA 1ON1A 2HZDA 1O3TA 2DA3A 3MCZA 2IGOA 2K9SA 4L62A 4PGGA 4RGXA 4RBOA 3V8JA 3ZMVA 3S1QJ 2VN2A 2ZXWH 1MDMA 3TO9A 2XAGA 4NC6A 1SFKA 1SC7A 4ZJZA 2VE9A 2L4AA 1SEUA 3M3YJ 3BNIA 5DCMA 4RM2A 1W5TA 2K9LA 4ZYGA 5B66C 3JRIA 3NPIA 1SFEA 1P7JA 1S5LC 2HZTA 3CJNA 2QM3A 5D6EA 1XC5A 2O8KA 2CMPA 3SXYA 2RNGA 4BBSJ 2D6YA 3VVYA 3IH3A 2CUEA 4KMUX 2JK3A 3VTIA 4PDKA 2VBYA 4KT6A 5C4JJ 2PBIA 1NG6A 1LQ1A 4BHPA 4AIDA 3CESA 3BR1A 2QSGX 5GAGJ 2K3PA 4GCVA 2K5CA 5E8GA 2CYYA 3E7LA 1SMYF 1SD4A 2K9MA 2ZSHB 3VPRA 4LOCA 4XLPF 2QKLB 2E2JJ 2CSOA 3IP4B 1J09A 2M7AA 5E79C 3WE2A 4G7OF 2JZYA 3A01A 3REOA 5D1RA 4UVAA 2PI0A 3HRSA 5DTDA 1IUFA 1LJ9A 4A12A 3ECOA 1D0XA 4A2UA 3TL4X 4CA0A 4ITVA 1XSVA 4U87A 1EKEA 2QENA 2E5ZA 2WUIA 1MIJA 4A3CJ 4JKZA 4BQAA 3CUOA 5JVTA 2EIKH 2CW8A 2HQ5A 2KL4A 5FLXZ 2PFVA 1SGMA 3FZVA 1MJ9A 2WB1N 2DYRH 3QKXA 1HSJA 1RZ4A 1UAAA 4BS9A 2QOPA 4LLLA 1Z6TA 5J47A 3PNVA 4PJJA 4C3IJ 3KP6A 1JKOC 4CYCB 1ZGJA 3GXOA 2IP2A 3GFLA 5E3NA 3OSFA 3C3WA 4XRFA 1J75A 3FWEA 1OCPA 4BXFA 1MMDA 4Y3OA 3LSPA 2DFIA 4JNNA 1AHDP 3GZNB 2IS1A 3K4CA 4FISA 1BI1A 3GF2A 2UXOA 1X4OA 1UELB 1HKQA 1GUUA 3KNWA 3AQTA 5M3MJ 3G4SI 1KQ8A 2DTZA 3FXLA 1T08B 3J7ZI 3G73A 2H1KA 1JKPC 4BU2A 5E3MA 1JHFA 2DA7A 4NC7A 5LBQA 4D0PA 2GENA 1G4DA 2LLKA 3GCMA 4LB5A 2F5VA 4LLGF 2PMZA 1FWZA 4V2FA 2VPRA 1GHCA 2ZFUA 5D4SA 3JAMZ 1FP1D 3RKXA 1XN7A 2ISYA 4A5MA 5F0CA 3DP7A 5AIPA 5M5XJ 4E7HA 4S04A 4GFBA 4Y13A 4RAFA 4LB6B 4CCLA 3E1SA 3WODF 3CCEI 1DPUA 1J2XA 1H9GA 3WU0A 3E7QA 2RREA 4WIBA 3KP4A 3FXUA 2VQCA 4ZDLA 3CCSI 2R3SA 3S2WA 2STTA 1XD7A 5EF6A 4C30A 1RETA 3BTLA 1ZREA 3HUGA 2P7VB 4HQMA 3K1NA 4PGHA 1KZHA 3VW1A 3BG6A 4QLCU 1ZR2A 3K1PA 1ZRCA 4CYDA 2DOAA 4RB0A 5A2QK 3ZP5A 2X1DA 4ZTFA 4ZYAA 2EINH 4ABZA 1HC8A 2O0YA 2PLYA 1J59A 1VF9A 5IYCJ 1TW3A 2CWEA 2FQ4A 1UFMA 4IQ4A 1YOVB 3EUHA 2Y30A 5KAIC 4M3BA 1VZ0A 3RPQA 3BC8A 3ZCOA 2NVYJ 5DAJA 2RQPA 4DBQA 1IXRC 4XN3A 2CJJA 4YIFA 2W24A 3PUBA 1ZGWA 3DKXA 2R7WA 2QQBA 3IRQA 3TKYA 2YUSA 4B48A 5B1BH 1TWFJ 3ZQ7A 3H5AA 2DG8A 1MBGA 5E1ZB 3RKWA 4UXNA 2QKMB 1SAUA 3OSGA 1O4XA 5FB2A 2VI6A 1ETKA 2CU7A 4XLFA 2F2EA 2DU9A 3K0LA 5HDKA 1P4WA 4BJTA 3WGGA 1OPCA 2KJCA 3VYTB 2F6CA 5C4XJ 4XOTA 4KA4A 1OYWA 2X6WA 1XDUA 1TWHJ 3BG3A 5GTIC 4N9IA 2P8TA 1YIJI 2O3FA 5EGOB 3KKDA 1J0RA 1YIOA 2ID6A 2JSCA 3F0CA 4EJTA 5LHIA 1LVKA 9ANTA 3VYUB 3M9AA 2XF5A 2PJRA 3ERMA 2ELHA 3W3CA 3W6JB 1HQCA 5E18F 2PG4A 5EG0A 5D8KB 3ABLH 3FKJA 2FEZA 3F3XA 4NN1A 3ESWB 3DXJF 1BOBA 1U3EM 4KMFA 1K79A 4B47A 4EMSA 2ISZA 4IHVA 2H6CA 3HE0A 1MMSA 1IW7F 3WGHA 5HBUA 2EBIA 2Z2SB 1HKTA 1HKSA 3F8MA 2LF7A 4HKUA 4EJUA 4PXIA 4YG2F 4M3GA 4YZEA 1C0WA 1ETOA 4XN0A 4XSZF 2JA8J 3L2QA 4OWRB 4L18B 2YR2A 3CC4I 4AC0A 2LBFA 4F93B 2A05A 3WG7H 2HKOA 1EA3A 1B59A 4AIJA 3ANGA 2XAQA 1B8IB 3FHNA 4PK4A 1Z9CA 4GFKA 2XB0X 2QF7A 2F5CA 4UV8A 5JLXA 2HOTA 1ACIA 5IY5H 4L5EA 4RGSA 2JSPA 4A3LJ 2LY1A 3LJLA 2NVXJ 3G2BA 2ELKA 4A3DJ 5D8LB 2IS6A 1YQAA 3GFJA 4WF2A 4NBQA 5CXGA 5KK1A 3D0SA 2ELJA 3H3ZA 3U21A 3ABTA 4P55A 4MIMA 2M45A 3EUKL 2H94A 5J1YA 3MEXA 5FRMA 2PJPA 4OIOF 4O5VA 5HLGA 2A2FX 3F6VA 2HYFA 4LK0F 1BIBA 1LEAA 3QPLA 1FLIA 3R0JA 2JTVA 3BG9A 3VOXA 1MBKA 2RV8A 3WTTC 1YYVA 4PJNA 4D5CA 2CO5A 2R7FA 2ID3A 3I55I 1O3SA 2DMUA 3LSTA 3QYEA 3IUVA 3ISPA 1IN7A 1TWGJ 2V26A 5J8CA 2IAIA 1RIOH 3OIOA 2ZCNA 4A3JJ 2AS5F 2LTPA 3DKWA 4IRIA 5J1RA 2IA1A 2ZCWA 3ABKH 3OV8A 4P9UA 4XBFA 3LSIA 1MBJA 2K4BA 1X3ZB 3FM5A 3HEFA 4BH9A 1GXPA 4CCNA 2DA1A 4LFUA 1FMVA 4E7IA 1BR1A 2P6SA 3T0YA 3S1RJ 5BPDA 3P9TA 1ZG3A 3ZMSA 4BKXA 1GVJA 4ESJA 2L9RA 2EPFA 2XUBA 2K85A 2BY1A 1QO0D 2GZWA 2IPQX 3CO6C 4KT5C 4QWQA 3CMAI 4Q5SF 2WAEA 2ESHA 3CUQB 1V55H 4DZPA 2CUFA 5KHDA 2NVQJ 3HTHA 1I27A 2WC2A 1S72I 5GPCA 2AQFA 3M8EA 2Q8KA 3NS4A 5FKOA 2DJNA 1XMKA 4G6QA 4KIBA 2XPUA 5DEQA 5LFAA 2QBYB 3IAS2 3FXKA 2CW7A 2MD0A 4XSXF 5CKTA 3T1BA 5AIQA 3K70C 5LHGA 4H0EA 4A0ZA 3TP3A 1FJLA 2BY0A 2DMQA 4HG2A 1DU0A 3GZIA 2FBIA 2DBBA 3F8FA 5FKKA 2KIQA 1K78B 1GV2A 4GXOA 3HOSA 3W2WA 1R6RA 2QWTA 3D1NI 2M30A 3VSLA 1B72A 2F07A 1DPRA 4HA8A 4BY7J 3RPUA 1WHUA 2BZTA 3HSEA 2EIJH 1MGTA 1Z21A 2G3BA 3GZ5A 3TDZC 2FMLA 1ZR4A 2L01A 2P81A 2WWYA 2X6YA 3KPHA 2QIBA 3I58A 3H3VK 5E1WA 3J7AO 2VQLA 3CLOA 2M0CA 2VXDA 4A3MJ 1K6YA 1FY7A 2CUJA 3P9CA 1HXDA 5LD2C 1NHAA 2CV1A 3D5SC 5ILVA 1BW6A 1T0FC 1QZZA 2NNNA 3SFIA 3KE2A 3QU6A 1QPIA 3AG3H 3EUHC 3H36A 4R79A 3P5JA 2BYVE 3F22A 1XPXA 1E0EA 4MHGA 1LKXA 2DTRA 4X6AJ 3J80K 3CP2A 2TRTA 4XNFA 3A0HC 3RPUD 4U88A 1XS9A 1MJAA 2PEXA 1LVAA 3L00A 3JRCA 3WTSC 4M71A 3CUQC 4LJZF 1E2XA 5E20A 1YITI 4HV5A 3F72A 3O2PE 1X3WB 2EQRA 2E71A 2N8GA 3WU2C 1RR7A 2X48A 1OKRA 1U5TB 1HLVA 1EV7A 5LGTA 2EV5A 3H92A 4ETSA 4DZJA 1E3OC 1EH6A 2MLKA 4YFNF 3NARA 1JKQC 5EEAA 5JVGF 4KFCA 3HHGA 4OOIA 3L2UA 4AC6A 2V1UA 3L09A 2NVUB 4M73A 1NK2P 1I3QJ 5TRDA 3L9FA 3UKGA 1VQ6I 1KQ9A 2LVSA 1XG1A 3J7YJ 3C18A 1USSA 2XF6A 2L54A 3CZ6A 3PASA 5HS9A 5GP9A 1ZRFA 2UXUA 2ZOYA 1F9NA 1SVOA 5E1XA 4ANJA 4CZCA 5D4RA 3W6VA 2VB6A 4A69C 1FOYA 4N4NB 2ETHA 1U9NA 2Z3YA 3GO5A 5L3EA 1SD7A 2R0QC 1X3UA 1PVEA 1XMXA 3DV8A 4OIPF 2Q2EA 2XPWA 4X1EA 4ME9A 5FHPA 4M9SA 1FBUA 4JK1X 3CP8A 3HC7A 1F5TA 3GZ6A 3KP3A 5FKLA 3G6EI 3HOYJ 1JUPA 4LK1F 3OIQA 2RASA 3DBRB 4MO7A 4OIQF 3BTCA 3OL3A 3R60A 2BEOA 3N97A 2VBWA 2H8RA 2GUHA 3WTXC 2IRFG 5FLVA 5DCFA 4KITB 4GCKA 3DWLE 3A2KA 1JE8A 1M1EB 2IU5A 3K8PC 2KRHA 3LFUA 2QVOA 1D5VA 4F55A 3JREA 2NOJB 4Y17A 4E7LA 3IRRA 5F27A 1Z67A 2L5QA 3FF5A 4KN7X 3KCCA 4KN4X 1NK3P 5CQEA 1WJEA 3HYIA 5K7HA 4C2MJ 4U9LA 1ZH5A 1LB2A 1BIAA 4PJ0C 1D5YA 2IVMA 3G1OA 2Y48A 1MNDA 4RS8A 2XRLA 5KNLA 5FFZA 3QOPA 2R7XA 1P2FA 1HA8A 4D9JA 3K10A 2CUZA 3DPUA 3K4BA 4HX8A 4IQJA 2EFOA 3RZDJ 3T8RA 3BR3A 4CO8A 2F4IA 1UI6A 3I5UA 3K4MA 2K02A 4IHTA 3PO3J 2W53A 1EH8A 1KA8A 3HOZJ 2CV0A 2VT2A 3MKZA 4Z2YA 3KIOA 2KQRA 3ROUA 3FXQA 4M3EA 2EFQA 2RN7A 3CMEI 5EFYA 1ZGAA 2COMA 2DFEA 3GLLA 3LQRA 3RSNA 4ZH4F 1TL8A 1N78A 2L9VA 5H6RA 1K7AA 3U2RA 2MFZA 3A4CA 3BY6A 2HXOA 2MLGA 2LBFB 1OCRH 3PFIA 5F0FA 1TW2A 1WJCA 1B9MA 3K70D 4E7ZA 2L3DA 1JTXA 2M8GX 2QLZA 1UCRA 2WY8Q 2DO7A 2HYGD 1SFOJ 1VQ7I 2J5OA 1X1CA 3CCMI 4EATA 3TQNA 2JRMA 4HRIA 2M1BA 3OR2C 4NUBA 4XLEA 2OTLI 5JHUA 3K1MA 1A6IA 1T39A 1T95A 2OZ6A 1Z6RA 5H2FC 3JSJA 1ZRDA 2ZXIA 5CW8A 5KVRA 2FQ3A 2PX9A 2BHYA 1G59A 4W1UA 1VQ9I 1ETWA 2Z33A 4EM0B 3M8FA 3BTIA 5K58A 5ICFA 2HYTA 4WXHA 1K78A 3PJRA 2O5RA 1KQ0A 2M2EA 1H89C 2NS8A 3FDYA 2ZCXA 4YIIA 2M8EA 3OS1A 3ZXSA 5L3FA 1E3PA 4V19K 2B9SA 1V5EA 2KMUA 3QRFF 1WKMA 1Y8QB 4JX4A 4IHSA 4IZZA 4AUXA 1UJ8A 1CGPA 1UHSA 1ZELA 3OYIA 3S2DJ 4II3A 2STWA 2FJI1 2BGCA 2Z1DA 2LG4A 3FKIJ 1XX5A 1LE8A 3EYIA 3QP6A 1P9QC 4IOAF 4RGRA 1R1VA 2AHQA 4UVBA 2X1CA 1ZKGA 4XL9A 4AIKA 1L0OC 3M8JA 3Q0VA 5ICEA 1V4RA 3FXMA 1WZ2A 1UG2A 3IKTA 4L0ZB 1MH3A 3KZIC 2CW0F 1R5GA 2HTSA 5BMZA 5TISC 3AAFA 1DGRM 4EVIA 2BVLA 1VQ4I 3KLOA 4F91B 5J6XA 3OYKA 3G3ZA 2Y9YA 2F48A 2O9LA 1SVLA 1LDDA 3V8KA 2VQGA 1ZG5A 4J01A 4F52A 4M72A 2ZFWA 3KKCA 3VOEA 2G7GA 1HSTA 2L0KA 5L3BA 2H1LA 5EJCA 2NNYA 2PZ9A 2HKUA 5IOYA 4ZZDA 2ZJRF 2XSDC 4EJVA 1POGA 2ZBKA 2OQGA 3QQAA 4I09A 1KU3A 4HNVA 2A69F 4B44A 4HZFA 4IJAA 1K4SA 2E2HJ 2OAZA 1S9HA 1QZEA 4M6VA 3JTGA 1DU6A 2M87A 3KX2A 3S8PA 3ZMDA 2VKDA 2XGCA 3EUAA 3GMEA 2DA2A 5DYMA 5D5VB 3MKWB 2VT3A 2F4MB 5IP7J 1FTZA 3SZGA 4CICA 3D5RC 2TCTA 2V4JC 5H9TA 2QGUA 2X6XA 4XRSA 3RQIA 1LPQA 3VYRB 1LFPA 4IRGA 2HKXA 1R58A 2VLAA 1UB9A 5HS8A 3HOVJ 3HOWJ 5HODA 1SD6A 2Y0SN 1KU9A 3VSKA 2CQ7A 4RMNA 3WE3A 3NI7A 4EGZA 3HHHA 4BHBA 2MABA 2A07F 2P6TA 1YG2A 3BTJA 2V9KA 3V4GA 1MBHA 2XV4S 4M6YA 1AOYA 2ZOZA 3QP5A 3FXJA 1F43A 2R7OA 4XRMA 2IGKA 3P9IA 2WB1A 4XORA 1OFCX 3VODA 2Y0SA 2EV6A 1T33A 1X1DA 4CDGA 4UUVA 1B8IA 4UHTA 1OR7A 3C2HA 1P7IA 4E7KA 2DK8A 5IP9J 2LKXA 4O3MA 2QQ8A 4BJ5C 5IPAA 3HOUJ 2YU9J 4B09A 3LAJA 5BPIA 1Y0NA 4MTDA 1F4KA 3K6GA 1VNDA 2DMNA 2D45A 1HCRA 4ENNA 1S3JA 2DA5A 3OS0A 1B9NA 1YLFA 4QSHA 4MTEA 2XAFA 1YX5A 3L2CA 4OMZA 2HOSA 2UXHA 3VOKA 4LG0B 5J3LA 2V9VA 3KZZA 4D1QA 4D5FA 2LR8A 3S14J 1V54H 2M4GA 1YS7A 3FISA 1ODDA 5EG0B 3MKLA 2V6CA 2E1CA 4Y4RA 4XKVA 2D1VA 1I6HJ 2DW4A 1YX3A 1PP8F 1PUFA 1VQNI 3LOCA 3QBMA 3JR9A 5K5QA 2Z9OA 4OD4A 2W4SA 1MNEA 3BWGA 2V1XA 1V5FA 3HBLA 5DCMB 4DIQA 3LWFA 2EIMH 3QWLA 3SYTA 1BJZA 2V1NA 3L7WA 2M9HA 3HXLA 2M34A 2HEOA 4A3GJ 4XOPA 1A35A 1XGOA 3ML6A 2I5UA 4BBRJ 3K2AA 4RB1A 4RB3C 2PN6A 2KLOA 4HNTA 1O7FA 1FSEA 5HAWA 4LMYA 5JI6A 3ZQQA 2GXGA 4A0YA 3BG7A 3VB2A 2FU4A 3A03A 2ZC2A 1DDNA 3PIPF 2CQXA 1TNTA 4NC8A 3JCUC 3WTVC 5J40A 4BE2A 3E5QA 5HSZA 4DBRA 4P1WA 4CH7A 3TEDA 1JUSA 1T56A 2OC6A 5EYRA 3P9KA 3GTQJ 3KYDB 1WJDA 2KFDA 1HOMA 4F7ZA 1TP4A 2MBFA 4Y33A 5DD4A 2DAOA 3S93A 4CYCA 2G7SA 3K7AJ 2ZJPF 3C7JA 3AQSA 4PCQA 4ESFA 5DM6F 1RUNA 2GA1A 2OQRA 2Y75A 5F64A 3CRJA 2W85A 1IXSB 4XKWA 3GX4X 1OMIA 3CCJI 4L9TA 5L3GA 4F92B 4XRSG 4I0BA 3OYAA 2E19A 1L3LA 5EZGA 2K27A 1Y6IA 3ASNH 2X0LA 2FNPA 1FBQA 1X58A 1GT0C 3JRAA 2FJ1A 3NNRA 2O03A 3I3LA 2OZUA 1F36A 4QTRA 3ZMUA 4V2GA 5CYVA 3TW7A 3GBGA 1FYKA 3F8CA 4NQWB 1D8JA 2DCEA 3IHUA 3BP8A 2L2OA 2ZY9A 3FXRA 4A6EA 1IN4A 5F1RA 1A6QA 1I50J 2DQLA 1J5YA 4BY1J 2L9NA 4B3XA 1HBXG 2DI3A 4BYYA 1MMGA 3MQ0A 4FT8A 3RIRA 1KYZA 1B72B 1LEBA 4U7BA 1X4PA 1NTCA 2KISA 2WY7Q 2NAZA 5BOXA 3NXCA 4JOMA 1NH3A 3OYBA 5J1UA 3Q9VA 3I4NJ 3ABMH 1BC8C 5FLMJ 2R7UA 3H5RA 1TQMA 2RVCA 2VUMJ 3A0BC 4UVCA 1R23A 3V78A 3GLXA 2PMZN 3W2AA 1OYIA 2E36A 2BVMA 5ED4A 2NOGA 1TT0A 1W4MA 5DUKA 4LITA 2FBKA 3BJ6A 2V1DA 4UUSB 1VQMI 2KIUA 4I99C 1W1WE 5DUIA 1R7JA 2GQQA 3MFKA 1IF1A 2JMWA 2O6GE 4M6XA 3COAC 2EZIA 1SFXA 3L2WA 1AU7A 3C07A 1TWAJ 1BI0A 3BCGA 1MKMA 2DT5A 2FNAA 2IA2A 4Y7NJ 5JHFA 1ZLJA 4MEXF 2P7CB 1U78A 4QPOA 1YRNA 2IA0A 4L5JA 3I54A 3PPBA 4B3AA 1U5TA 2HQRA 2XDVA 2IJLA 3KZ9A 3SEQA 3QYFA 3A01B 4CGZA 4GDFA 3HTAA 1IN6A 3CDIA 1TNSA 3BR2A 1X2MA 2JA2A 1Z3XA 3M4OJ 2QWWA 4OD5A 5L3CA 3QPHA 2R5YB 5AQCA 3R4KA 2ECBA 3MAJA 3RI4A 5LLQA 4MLOA 4O6JA 2DT7B 3ZR8X 4E4HA 1DP7P 3GEUA 3JW4A 2O61A 4BQOA 4BUPA 4GYIA 1QVUA 1LUJB 1LDKB 4E7SA 3B73A 1D8KA 1LFUP 2JA6J 3K2ZA 4ZYHA 1BR4A 3EQLF 3KP7A 4M9XA 1WI3A 3V42A 4BEHB 3LA3A 4BXUA 4GO1A 1GDTA 2DN0A 2HU9A 1OYYA 2LF8A 4I76A 2B3WA 4ZDPA 3BR5A 3UNGC 3M07A 3NEUA 4JX5A 1MSFC 4P96A 1IV8A 1ZTRA 2HFHA 2YX7A 2YU3A 3FX3A 3ZQFA 3BHQA 4M3DA 4E70A 4FCYA 1X2NA 5KAFC 3OYNA 4RAZA 3PQJA 4D7NA 1ONVA 1P92A 2HGCA 2QZ8A 4HNUA 3HTJA 1HW5A 5FJ8J 1IDZA 4ZZLA 1MH4A 2Y2ZA 1WH7A 1IGNA 5CVVA 1VTNC 1Q1VA 3J81Z 4WX9A 3ZQHA 4AWXB 1FNNA 2R7QA 4OAYA 5HDGA 2UXXA 4UNOA 1ETYA 1R5HA 2FX0A 2LY2A 4BQQA 1B6AA 5IT9Z 1I6XA 3H9QA 3C2GA 1RKTA 2B1EA 1QQIA 4IOCF 4NDLA 2XGEA 1H0MA 2W82A 4Y52J 1MBFA 1QGPA 1A5JA 3PNTA 1WH5A 1SD5A 1H88C 4A6DA 1ETQA 3G71I 4UY8I 1I39A 5HVQC 1V3FA 2W1OA 3MD2A 3ON2A 2QBYA 3DCFA 1AKHA 4MK6A 1W0UA 1U6GA 1CQTA 1WJFA 3OWTA 3E6DA 3S15J 4BXXJ 5CVUA 2LK2A 2XAJA 3LA2A 3HPHA 3O3KA 4YFXF 3OYLA 4PUSA 5C4YA 1XTAA 2E7XA 3AKZA 4EJWA 1BBYA 3BJOA 1ENHA 1F1ZA 3L2VA 3CCUI 2QTQA 2CH0A 2ZMEC 2OTJI 2QYOA 5EZHA 4EM2A 1JXSA 2K40A 1PP7U 2EZHA 3M1EA 2JUGA 3H3UA 2FF4A 3ZMTA 4KUMA 2P5KA 4ZDOA 2Q2EB 1S7OA 5IYBJ 1HW2A 1IN5A 1S7EA 4G94A 3BZCA 2GFNA 1D1AA 3TMOA 4HBLA 4EQQA 3HDDA 1XSXA 2K9QA 1WFXA 2R7DA 4BJ6C 4GCTA 4HAMA 1GV5A 1MNMC 3TO6A 2FE3A 3OIPA 1UI5A 2ZXJA 2LSOA 3HKZA 2XB5A 2X1EA 1UHWA 5JR3A 4GRIA 3FK6A 3V7RA 3VYSB 2L7FP 2O8XA 5D5WB 3LAPA 3GW2A 3HRTA 2MW8A 2ZNZA 3ZQCA 5DM7F 1QBJA 2X85A 3MZ8A 3ECHA 3VEPA 3Q5FA 4BAYA 3SZPA 2BXZA 4ENMA 2MH9A 2Y69H 1A31A 4DYRA 1ZAOA 3KLNA 2W48A 4PSWA 3ZRGA 1R00A 2KZGA 1BA5A 2E7WA 4JX6A 3TDUC 3SQNA 3QAHA 5FD6A 3E6MA 2VL8A 4BL0B 2G7LA 5CPRB 3MNLA 4MQVA 1QA6A 2FBHA 2BE5F 3HSFA 3GTKJ 1ZLKA 2FUG2 2DMTA 4PSXA 4UB6C 1IRFA 4L9VA 1WQ2A 3JSPA 4KIFA 3G56A 4C3JJ 3SJMA 2GAUA 5EEHA 3CWRA 1WWXA 2LC2A 3B6CA 5J4VA 3GEZA 4HOBA 2LDUA 1IC8A 2OERA 2EWNA 4I7HA 1R5ID 4WK8F 4IHWA 3IC7A 5J4YA 1WJBA 3F1BA 1OQYA 4XKCA 2JRTA 2DOFA 3DFGA 3FMSA 3HB9A 3RYRA 3TGNA 1TLHB 1BR2A 2FOKA 2P4WA 3CMYA 3J7AY 1XSDA 1FBSA 1HW1A 3LSJA 4E7JA 2DQRA 3DU5A 2M0MA 3CC7I 3T5XA 1R49A 2YVEA 2UXPA 1ERDA 1QU3A 1MSEC 1IRGA 4ESBA 4Y15A 1LNWA 1RPWA 3GFMA 2KIFA 3DLAA 1BW5A 2EV0A 2HWVA 2D1HA 2FRHA 2YVXA 2UXIA 2XROA 4IHYA 3IV5A 1JTYA 4G9YA 1JJ6C 3E5UA 2V57A 4C2UA 3IWFA 4D7MA 3HSRA 1RUOA 5F0HA 3AL0B 3HOXJ 2R92J 4WWCA 2Q24A 2RGVA 4BEHA 4P9FA 5F08A 1FZPB 1FX7A 1YRNB 3G7RA 5IYDJ 4YRVA 1W36D 2ESNA 3ZPLA 2GIVA 2ZB9A 2YVHA 1G2HA 3KEOA 3HG9A 5CLSA 1FYMA 3KEYA 4CZZA 4FE4A 4W97A 4RLQA 4EJOA 1ETXA 1G3WA 1YW7A 2DXIA 4XLNF 2QSFX 4LG3A 2HXIA 4NB5A 5IOZA 3M7GA 5DD8A 5B1AH 4LLNA 2MA3A 4UUSA 2BXYA 2UWMA 2KRFA 4BQNA 3B6AA 2OA4A 2OU2A 2DFFA 3ASOH 2K3FA 2ECCA 3COLA 4G6TB 2QUFA 1Y39A 2L7MP 3DPJA 4HPQA 3FIWA 2EA4A 2HPIA 2ZMEA 2GM4A 3GTOJ 2XDNA 4ENJA 2KIMA 3FBNB 1WVRA 2WV0A 4ZYEA 3AG4H 4LIVA 3BPVA 3L1PA 1QVTA 2WAQA 4ZC3A 4HYEA 3BRUA 2L02A 5M5YJ 5HLTA 4LD5A 2HI3A 2M7BA 5M5WJ 4J19A 2DMPA 1RC9A 4KJZA 4OINF 2CGPA 4G7HF 2DA6A 2KT0A 4JYKA 3WGIA 2I10A 3H1CA 5ICGA 3V7SA 4KISA 2CQQA 4IRHA 3F21A 2LOOA 1XDSA 2G7UA 3HZJA 5CVJA 5E17F 3LFKA 2X6OA 2Y31A 3CQZJ 1VQPI 1MJBA 1IUYA 4LIUA 3DTKA 1ETVA 2DOEA 1YJNI 4IKFA 4DYCA 4Q47A 3U9GA 3GFIA 1TC3C 2EJRA 3DU6A 4IL6C 5E3OA 3GUDA 1TT5B 1G3TA 2YPRA 2ZJ2A 3GWZA 4HF0A 2JVGA 1LDJA 2VKHA 5CVIA 3JRGA 5FFXA 3QYBA 3JAMK 2HS5A 2HPMA 3VDXA 3CLQA 3VFZA 2L7ZA 3S1MJ 4PFOA 1XB4A 3HTIA 3PFYA 5CXIA 2EFWA 2IS4A 4PFPA 3I0TA 4PZJA 4AIHA 3WTUC 2IEKA 4UB8C 3HJEA 3RQ4A 2MG4A 1OCZH 1X19A 2LREA 2G0EA 3I64A 2MD5A 3W2VA 3HOTA 4L0YB 2XAHA 2CV2A 2ZNYA 2HOAA 4KNYA 1B1BA 2REKA 3BOQA 5ILSA 3U1KA 1O7LA 2VASA 5FRNA 4H4KC 4RAGA 1Y1WJ 3TP0A 4ENKA 3FRQA 1AWCA 2JJ7A 2D2WA 2XHKA 2E2IJ 3KFWX 2NS7A 2Y0MA 2QEXI 2DA4A 3FXOA 2K86A 4FE7A 3CMMA 3SFZA 1YTYA 1HDDC 2R7RA 4KICA 1P6RA 2KHMA 2OF7A 3S16J 3VVXA 3M1CA 3R61A 1HDPA 2E34A 2HQNA 4ACIA 4M74A 5FKMA 3RTRA 3JRHA 1IRZA 2KDOA 2A68F 1A04A 4IVNA 3CO7C 2FOWA 2LMDA 2H27A 2GLOA 1WGXA 4B43A 3FM3A 2PBXA 2O7TA 2ZO4A 4GCLA 1ZG1A 2VBZA 2EH3A 2V9PA 2QSHX 2ME0A 3O8HA 2OD5A 2WAFA 5H20A 1WCMJ 1Y56A 4L5IA 2HNHA 2IW5A 2MGQA 5F04A 2W7NA 2XVCA 4MQ9F 3H0GJ 2MC3A 4I2OA 2XRNA 4IX7A 2DFHA 2XGXA 3F6OA 4AF5A 1R1UA 2IGNA 2GWRA 4LGWA 3O60A 2B63J 2XPVA 1WJAA 4AVZA 2XF7A 3AG2H 4KIGA 3K4KA 2BBYA 3HTSB 2WADA 3UR3C 2XC7A 2GOXB 3WTYC 3JRFA 4P5OA 1O3RA 4XICA 2LRDA 3NAUA 4CCMA 2UZKA 1AKHB 2GOMA 3VWBA 3VIBA 2VODA 3WTZA 1G3SA 2EB7A 1WSUA 3LHQA 3ZQGA 5HS7A 3GTLJ 1FP2A 4IPAA 4R1HA 4DGWB 4M3FA 2CFXA 4G7ZF 2HYJA 3LWJA 1YE9A 4PJMA 2IGMA 3OYMA 1IJWC 3G1LA 3OY9A 3JRBA 2B7EA 4JP0A 1D1BA 2PFBA 5LGNA 2A6HF 4YIRX 4CHUA 1Y8RB 1MBEA 4NELA 1SMTA 4B8XA 4CCJA 1YS6A 4C2TA 3GTGJ 4MXMA 1PDNC 1KYWA 2KPMA 1LE8B 1Z91A 4MFDA 2EFPA 4FASD 2FBQA 4XLCA 1REPC 2WV1A 3ONQA 3KEQA 2WAQN 3EYYA 3IH2A 3LA7A 2AO9A 1RI7A 4IO9F 1W5CC 3OR1C 1ZYRF 3DTEA 1DGWY 1USTA 4N0BA 1U8BA 2BW3A 2C6YA 1CF7A 4IEJA 1OLTA 4Z6YA 5LEKA 3K69A 4R8HA 1Y1VJ 1SAXA 4NHJA 2EK5A 3OMYA 3H0DA 2E1OA 1U5TC 5IT9K 3IWZA 1YW8A 4EGYA 5D18A 2VONA 2LKPA 5ERIA 1FYLA 1H9TA 4XONA 4BNCA 3HGGA 3KP2A 3KZYA 4XIDA 3BT9A 2R5YA 3VP5A 3BR0A 2A5YB 2K4JA 3OS2A 3MZHA 2VPLA 3BR6A 1GXQA 2HDWA 3RD3A 3R6SA 1YI2I 2OPTA 2E1MC 2E5NA 4FTHA 1IV6A 1QPMA 1FOWA 2CFOA 2LP0A 2XGDA 3TW6A 2FSWA 3BG5A 1RNLA 2A5WA 3ZQIA 1R9TJ 1XGMA 1JKRC 1D0YA 2K7LA 2CS3A 3KYCB 2BY2A 3N4MA 3CF5F 5M3FJ 4C2MA 3PQKA 4B1RA 1G6NA 1SFUA 3T8TA 1P4AA 4C3HJ 5IP6A 1BM9A 3ON4A 2LNBA 4WXCA 3CJDA 3CC2I 1R71A 3KP5A 4IRVA 2JPBA 4HEA2 2DODA 1R4NB 1QHGA 1DUXC 1OCTC 2R4GA 1FOXA 3DF8A 4OAZA 1MW7A 3RJPA 1DP3A 2G9WA 4RA2A 1P4XA 1FIAA 2DK5A 1JGSA 5GPAA 1GVDA 3Q3SA 3OYEA 2KKOA 4U0YA 1Z05A 2ZMEB 3G1MA 2MYSA 4AVPA 1N75A 3BZKA 2QQAA 1BC7C 4KWAA 5BS6A 2VJ5A 1ON2A 1VFCA 2R93J 1MZBA 3OYCA 3AG1H 3MMYB 2VJ4A 2RKHA 4HV6A 4BE1A 3H5NA 3DTIA 2JPCA 4XR6A 4F3QA 1APLC 1Y0UA 3EUPA 3BPXA 3ZGKA 3N05A 4DVYP 3E6BA 1XGNA 5HLIA 1XCVA 3BROA 3I71A 1OCCH 4A5NA 2F5EA
chains in the Genus database with same CATH topology
3JRDA 4NDLA 2XGEA 2NVTJ 4C2MJ 4BBSJ 1A5JA 2D6YA 4Y52J 1MBFA 3IH3A 3RZOJ 2CUEA 3VVYA 2JA5J 5EGOA 1WH5A 2JK3A 1D5YA 3G1OA 3NRGA 2XRLA 4A3IJ 5C4JJ 1H88C 1ETQA 3PM1A 3RZDJ 3BR1A 5BNGA 1PUFB 3ON2A 3DCFA 1AKHA 4MK6A 5FMPA 3BR3A 2YS9A 1W0UA 3E7LA 1CQTA 1UI6A 2RHAA 3VPRA 3PO3J 2W53A 3S15J 4LOCA 4BXXJ 3HOZJ 2LK2A 5C4YA 4QIWN 2LD5A 2E2JJ 3IH4A 3S17J 1ENHA 4M3EA 2QTQA 3A01A 5EZHA 5D1RA 2K40A 2EZHA 4ICHA 5EFYA 5DTDA 1IUFA 1VI0A 4G12A 3GTMJ 2HXOA 5IYBJ 1S7EA 5F0FA 2GFNA 2WUIA 3HDDA 4A3CJ 4JKZA 2K9QA 4DW6A 1JTXA 2M8GX 1SFOJ 2HQ5A 2ME6A 4GCTA 1GV5A 1MNMC 3C2BA 1SGMA 1UI5A 2WB1N 1A6IA 2XB5A 3QKXA 2QOPA 3JSJA 3FK6A 2HDDA 2L7FP 5CW8A 3CDLA 4W1UA 4JL3A 2MW8A 4C3IJ 3ZQCA 3FK7A 4CYCB 1JKOC 5E3NA 1ETWA 3Q0UA 4B4CA 3BTIA 3OSFA 5K58A 4DYRA 5EDNA 2IBDA 2HYTA 2W48A 2M2EA 1H89C 2NS8A 2R5ZB 1OCPA 2ZCXA 3LSGA 3LSPA 4JNNA 1BA5A 1LFBA 4JX6A 1AHDP 2R7ZJ 4UDSA 4FISA 3GTJJ 3S1NJ 1H8AC 1JT6A 2UXOA 5E3LA 2G7LA 1GUUA 4JX4A 3KNWA 2R5ZA 3AQTA 5M3MJ 4AUXA 3MNLA 4I6ZA 2DTZA 1UHSA 3GTKJ 2H1KA 3S2DJ 2DMTA 1JKPC 2DG7A 5E3MA 2EZKA 2DA7A 2O7OA 2RAEA 3G56A 3FKIJ 4C3JJ 1LE8A 2GENA 3SJMA 2LLKA 3CWRA 2NX4A 2AHQA 3B6CA 4V2FA 1ZKGA 2VPRA 3Q0VA 1UG2A 1OJLA 5M5XJ 5F0CA 4GFBA 1IC8A 2OERA 1MH3A 4IHWA 1K83J 3E7QA 3F1BA 3LNQA 1RESA 2X9DA 3HB9A 2Y9YA 5EF6A 1RETA 3WHBA 3BTLA 2O9LA 3VW1A 4S0HB 1ZR2A 3KKCA 3MN2A 2G7GA 2L0KA 3CMYA 2PZ9A 2HKUA 5IOYA 4ABZA 3LSJA 1VF9A 5IYCJ 2YVEA 2FQ4A 2UXPA 2XSDC 3CCYA 1MSEC 1POGA 1RPWA 3QQAA 2Y30A 4M3BA 1BW5A 4HNVA 2NVYJ 5DAJA 2E2HJ 2UXIA 4CGRA 4IHYA 3IV5A 2CJJA 1JTYA 4M6VA 1ZGWA 1JJ6C 1DU6A 2V57A 4D7MA 2XGCA 2DA2A 2YUSA 1TWFJ 5F0HA 3HOXJ 2R92J 5IP7J 2Q24A 1FTZA 2DG8A 1MBGA 5F08A 2TCTA 1YRNB 3G7RA 5H9TA 5IYDJ 3OSGA 4XRSA 3RQIA 1O4XA 1ZK8A 2VI6A 1ETKA 2CU7A 3GTPJ 2ZB9A 2YVHA 3HOVJ 3HOWJ 1G2HA 5HODA 2Y0SN 5C4XJ 1ZQ3P 3NI7A 4FE4A 4W97A 1ETXA 3VUQA 1TWHJ 3BG3A 5EGOB 3KKDA 4A93J 2HXIA 2ID6A 5IOZA 3BTJA 3F0CA 1MBHA 1JT0A 2ZOZA 4UUSA 3RKQA 1F43A 4XRMA 9ANTA 3HKZN 2D5VA 3B6AA 1OFCX 2ECCA 3COLA 2L7MP 1T33A 3DPJA 2LY9A 3FIWA 5EG0A 1B8IA 2GM4A 3GTOJ 1P7IA 2XDNA 5IP9J 2LKXA 4NN1A 2QKOA 1U9OA 5IPAA 3L1PA 3HOUJ 1QVTA 2YU9J 3BRUA 5M5YJ 4IHVA 2HI3A 3HE0A 5M5WJ 2JN6A 2EBIA 2DMPA 1VNDA 4J19A 5HBUA 4HKUA 2DMNA 2DA6A 2KT0A 4JYKA 4PXIA 1HCRA 2I10A 2DA5A 4M3GA 2ZCMA 4YZEA 2CQQA 4QSHA 1ETOA 3RH2A 2JA8J 3VVZA 2X6OA 2QCOA 2Y31A 4AC0A 2HOSA 3CQZJ 2UXHA 5J3LA 5C3EJ 3VOKA 1ETVA 4D5FA 2LR8A 3WHCA 2KDZA 4DYCA 3S14J 1ITYA 3T6NA 3FISA 3ANGA 1TC3C 5E3OA 1RKWA 5EG0B 2VKEA 3MKLA 3SDGA 1B8IB 4GFKA 3OOUA 2XB0X 2QF7A 5JLXA 3JRGA 2HOTA 4L5EA 4A3LJ 5DS9A 3LJLA 2L7ZA 2NVXJ 3S1MJ 1I6HJ 2ELKA 4A3DJ 3HTIA 5CXIA 3QBMA 1PUFA 3LOCA 3JR9A 4A3FJ 5CXGA 3I4MJ 2IEKA 2MG4A 4MIMA 2G0EA 3HBLA 2JA7J 3S2HJ 2NP3A 5K7FA 2HOAA 5J1YA 2REKA 1BJZA 2M9HA 2M34A 4A3GJ 3EGQA 1IDYA 3BJBA 3QPLA 1Y1WJ 3TP0A 4BBRJ 3FRQA 3K2AA 2JJ7A 2E2IJ 3BG9A 3VOXA 5HAWA 1MBKA 2NS7A 1EF4A 4D5CA 2DA4A 4EEFG 4RDUA 4UUTA 4FE7A 2ID3A 3A03A 1WPKA 1HDDC 2RASA 2OF7A 3VVXA 3S16J 2DMUA 3IUVA 1TWGJ 1HDPA 2CQXA 4ACIA 2IAIA 5FKMA 3JRHA 3OIOA 1IRZA 2ZCNA 4A3JJ 1JGGA 2LTPA 1UMQA 3HM5A 5J1RA 5HSZA 3TEDA 1JUSA 1T56A 5EYRA 1MBJA 3GTQJ 3HEFA 1WGXA 2GLOA 2DA1A 1HOMA 2PBXA 2O7TA 4GCLA 2EH3A 4CYCA 3S1RJ 2ME0A 1K61A 2G7SA 3O8HA 1JJ8C 3HIMA 3K7AJ 3P9TA 4BKXA 3AQSA 1WCMJ 3Q0WA 3ZQLA 4A3KJ 1W0TA 2MGQA 5F04A 1IG7A 2L9RA 3CRJA 3H0GJ 3BQYA 2EZLA 5FKNA 4XRSG 4AF5A 2E19A 5EZGA 3O60A 3V6GA 2B63J 2XPVA 5FGLA 4DZPA 2CUFA 2NVQJ 3HTHA 1X58A 2VKVA 1GT0C 5GPCA 2FJ1A 3JRAA 2WGBA 3NNRA 5FKOA 2DJNA 4DYQA 1F36A 2XPUA 4QTRA 1FIPA 4V2GA 3JRFA 4XICA 3TW7A 3GBGA 5K7ZA 3NAUA 3MVPA 1AKHB 2GBYA 3VIBA 3LHQA 3QPSA 3ANPA 1I50J 3TP3A 3ZQGA 1FJLA 4BY1J 1FTTA 2DMQA 3VW0A 3GTLJ 1DU0A 4M3FA 3GZIA 1B72B 2HYJA 1NTCA 3LWJA 5FKKA 3NXCA 1IJWC 1GV2A 3G1LA 2COBA 5J1UA 2QWTA 3I4NJ 3D1NI 3JRBA 5F1JA 5FLMJ 1B72A 2F07A 2VUMJ 4BY7J 4JP0A 2CRGA 2FD5A 3V78A 2PMZN 2G3BA 1Z77A 2MSYA 1ZR4A 2NOGA 4NELA 1MBEA 2P81A 4UUSB 2QIBA 3H3VK 2M0CA 3GTGJ 4MXMA 1TWCJ 4A3MJ 1LE8B 4MFDA 2JMWA 2FBQA 4A3EJ 2EZIA 2WV1A 1BW6A 2Y9ZA 1SANA 2WAQN 3SFIA 1AU7A 1QPIA 3C07A 1TWAJ 3IH2A 3BCGA 2AO9A 4X6AJ 4Y7NJ 2TRTA 4XK4A 4GFLA 1U78A 1YRNA 1XS9A 1Z0XA 3PO2J 1U8BA 4B3AA 3PPBA 3A02A 3JRCA 5D19A 4AYBN 3KZ9A 4IEJA 1Y1VJ 3A01B 3HTAA 3LSRA 2EQRA 3BR2A 2N8GA 2E1OA 1RR7A 2X48A 1X2MA 1HLVA 3M4OJ 2R5YB 5D18A 5AQCA 1ORKA 2ECBA 3HGYA 3HGGA 4MLOA 4DZJA 1E3OC 3VW2A 4XIDA 3BT9A 3NARA 3GEUA 2R5YA 2NP5A 3VP5A 1JKQC 5EEAA 3BR0A 3ZOBA 2LFBA 1QVUA 3BR6A 1FEXA 3RD3A 3S5RA 4AC6A 2OPTA 5JLWA 4FTHA 1LFUP 1IV6A 2JA6J 1NK2P 1I3QJ 2LP0A 2XGDA 3TW6A 4IHXA 1QRYA 1WI3A 3BG5A 3UKGA 2LVSA 1GDTA 1XG1A 2DN0A 3DEWA 3ZQIA 4I76A 1R9TJ 3PASA 4MFEA 1JKRC 5GP9A 3BR5A 4JX5A 2UXUA 2ZOYA 1MSFC 4A3BJ 2OI8A 3O8GA 1ZTRA 5M3FJ 2K9NA 3W6VA 4B1RA 3ZQFA 3BHQA 4A69C 4C3HJ 5IP6A 1HF0A 4M3DA 1JUMA 1U9NA 3ON4A 4FCYA 3CJDA 1BL0A 1X2NA 2R0QC 2JWTA 5C44J 2XPWA 4X1EA 3BQZA 4D7NA 1OCTC 3B81A 4ME9A 5FHPA 2DA3A 2K9SA 4L62A 3HOYJ 5FKLA 3HTJA 1JUPA 1FIAA 5FJ8J 4RBOA 3S1QJ 5GPAA 1IDZA 1GVDA 1MH4A 3Q3SA 4MO7A 2Y2ZA 3BTCA 2H8RA 1WH7A 2GUHA 1IGNA 3G1MA 5FLVA 1Q1VA 4KWAA 4GCKA 3BNIA 3M3YJ 2IU5A 3ZQHA 2R93J 1VFCA 3JREA 1ETYA 2FX0A 3JRIA 3NPIA 5F27A 1APLC 3EUPA 1P7JA 1NK3P 1RKTA 1XC5A 2O8KA 5K7HA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3JRD A;  4NDL A;  2XGE A;  2NVT J;  4C2M J;  4BBS J;  1A5J A;  2D6Y A;  4Y52 J;  1MBF A;  3IH3 A;  3RZO J;  2CUE A;  3VVY A;  2JA5 J;  5EGO A;  1WH5 A;  2JK3 A;  1D5Y A;  3G1O A;  3NRG A;  2XRL A;  4A3I J;  5C4J J;  1H88 C;  1ETQ A;  3PM1 A;  3RZD J;  3BR1 A;  5BNG A;  1PUF B;  3ON2 A;  3DCF A;  1AKH A;  4MK6 A;  5FMP A;  3BR3 A;  2YS9 A;  1W0U A;  3E7L A;  1CQT A;  1UI6 A;  2RHA A;  3VPR A;  3PO3 J;  2W53 A;  3S15 J;  4LOC A;  4BXX J;  3HOZ J;  2LK2 A;  5C4Y A;  4QIW N;  2LD5 A;  2E2J J;  3IH4 A;  3S17 J;  1ENH A;  4M3E A;  2QTQ A;  3A01 A;  5EZH A;  5D1R A;  2K40 A;  2EZH A;  4ICH A;  5EFY A;  5DTD A;  1IUF A;  1VI0 A;  4G12 A;  3GTM J;  2HXO A;  5IYB J;  1S7E A;  5F0F A;  2GFN A;  2WUI A;  3HDD A;  4A3C J;  4JKZ A;  2K9Q A;  4DW6 A;  1JTX A;  2M8G X;  1SFO J;  2HQ5 A;  2ME6 A;  4GCT A;  1GV5 A;  1MNM C;  3C2B A;  1SGM A;  1UI5 A;  2WB1 N;  1A6I A;  2XB5 A;  3QKX A;  2QOP A;  3JSJ A;  3FK6 A;  2HDD A;  2L7F P;  5CW8 A;  3CDL A;  4W1U A;  4JL3 A;  2MW8 A;  4C3I J;  3ZQC A;  3FK7 A;  4CYC B;  1JKO C;  5E3N A;  1ETW A;  3Q0U A;  4B4C A;  3BTI A;  3OSF A;  5K58 A;  4DYR A;  5EDN A;  2IBD A;  2HYT A;  2W48 A;  2M2E A;  1H89 C;  2NS8 A;  2R5Z B;  1OCP A;  2ZCX A;  3LSG A;  3LSP A;  4JNN A;  1BA5 A;  1LFB A;  4JX6 A;  1AHD P;  2R7Z J;  4UDS A;  4FIS A;  3GTJ J;  3S1N J;  1H8A C;  1JT6 A;  2UXO A;  5E3L A;  2G7L A;  1GUU A;  4JX4 A;  3KNW A;  2R5Z A;  3AQT A;  5M3M J;  4AUX A;  3MNL A;  4I6Z A;  2DTZ A;  1UHS A;  3GTK J;  2H1K A;  3S2D J;  2DMT A;  1JKP C;  2DG7 A;  5E3M A;  2EZK A;  2DA7 A;  2O7O A;  2RAE A;  3G56 A;  3FKI J;  4C3J J;  1LE8 A;  2GEN A;  3SJM A;  2LLK A;  3CWR A;  2NX4 A;  2AHQ A;  3B6C A;  4V2F A;  1ZKG A;  2VPR A;  3Q0V A;  1UG2 A;  1OJL A;  5M5X J;  5F0C A;  4GFB A;  1IC8 A;  2OER A;  1MH3 A;  4IHW A;  1K83 J;  3E7Q A;  3F1B A;  3LNQ A;  1RES A;  2X9D A;  3HB9 A;  2Y9Y A;  5EF6 A;  1RET A;  3WHB A;  3BTL A;  2O9L A;  3VW1 A;  4S0H B;  1ZR2 A;  3KKC A;  3MN2 A;  2G7G A;  2L0K A;  3CMY A;  2PZ9 A;  2HKU A;  5IOY A;  4ABZ A;  3LSJ A;  1VF9 A;  5IYC J;  2YVE A;  2FQ4 A;  2UXP A;  2XSD C;  3CCY A;  1MSE C;  1POG A;  1RPW A;  3QQA A;  2Y30 A;  4M3B A;  1BW5 A;  4HNV A;  2NVY J;  5DAJ A;  2E2H J;  2UXI A;  4CGR A;  4IHY A;  3IV5 A;  2CJJ A;  1JTY A;  4M6V A;  1ZGW A;  1JJ6 C;  1DU6 A;  2V57 A;  4D7M A;  2XGC A;  2DA2 A;  2YUS A;  1TWF J;  5F0H A;  3HOX J;  2R92 J;  5IP7 J;  2Q24 A;  1FTZ A;  2DG8 A;  1MBG A;  5F08 A;  2TCT A;  1YRN B;  3G7R A;  5H9T A;  5IYD J;  3OSG A;  4XRS A;  3RQI A;  1O4X A;  1ZK8 A;  2VI6 A;  1ETK A;  2CU7 A;  3GTP J;  2ZB9 A;  2YVH A;  3HOV J;  3HOW J;  1G2H A;  5HOD A;  2Y0S N;  5C4X J;  1ZQ3 P;  3NI7 A;  4FE4 A;  4W97 A;  1ETX A;  3VUQ A;  1TWH J;  3BG3 A;  5EGO B;  3KKD A;  4A93 J;  2HXI A;  2ID6 A;  5IOZ A;  3BTJ A;  3F0C A;  1MBH A;  1JT0 A;  2ZOZ A;  4UUS A;  3RKQ A;  1F43 A;  4XRM A;  9ANT A;  3HKZ N;  2D5V A;  3B6A A;  1OFC X;  2ECC A;  3COL A;  2L7M P;  1T33 A;  3DPJ A;  2LY9 A;  3FIW A;  5EG0 A;  1B8I A;  2GM4 A;  3GTO J;  1P7I A;  2XDN A;  5IP9 J;  2LKX A;  4NN1 A;  2QKO A;  1U9O A;  5IPA A;  3L1P A;  3HOU J;  1QVT A;  2YU9 J;  3BRU A;  5M5Y J;  4IHV A;  2HI3 A;  3HE0 A;  5M5W J;  2JN6 A;  2EBI A;  2DMP A;  1VND A;  4J19 A;  5HBU A;  4HKU A;  2DMN A;  2DA6 A;  2KT0 A;  4JYK A;  4PXI A;  1HCR A;  2I10 A;  2DA5 A;  4M3G A;  2ZCM A;  4YZE A;  2CQQ A;  4QSH A;  1ETO A;  3RH2 A;  2JA8 J;  3VVZ A;  2X6O A;  2QCO A;  2Y31 A;  4AC0 A;  2HOS A;  3CQZ J;  2UXH A;  5J3L A;  5C3E J;  3VOK A;  1ETV A;  4D5F A;  2LR8 A;  3WHC A;  2KDZ A;  4DYC A;  3S14 J;  1ITY A;  3T6N A;  3FIS A;  3ANG A;  1TC3 C;  5E3O A;  1RKW A;  5EG0 B;  2VKE A;  3MKL A;  3SDG A;  1B8I B;  4GFK A;  3OOU A;  2XB0 X;  2QF7 A;  5JLX A;  3JRG A;  2HOT A;  4L5E A;  4A3L J;  5DS9 A;  3LJL A;  2L7Z A;  2NVX J;  3S1M J;  1I6H J;  2ELK A;  4A3D J;  3HTI A;  5CXI A;  3QBM A;  1PUF A;  3LOC A;  3JR9 A;  4A3F J;  5CXG A;  3I4M J;  2IEK A;  2MG4 A;  4MIM A;  2G0E A;  3HBL A;  2JA7 J;  3S2H J;  2NP3 A;  5K7F A;  2HOA A;  5J1Y A;  2REK A;  1BJZ A;  2M9H A;  2M34 A;  4A3G J;  3EGQ A;  1IDY A;  3BJB A;  3QPL A;  1Y1W J;  3TP0 A;  4BBR J;  3FRQ A;  3K2A A;  2JJ7 A;  2E2I J;  3BG9 A;  3VOX A;  5HAW A;  1MBK A;  2NS7 A;  1EF4 A;  4D5C A;  2DA4 A;  4EEF G;  4RDU A;  4UUT A;  4FE7 A;  2ID3 A;  3A03 A;  1WPK A;  1HDD C;  2RAS A;  2OF7 A;  3VVX A;  3S16 J;  2DMU A;  3IUV A;  1TWG J;  1HDP A;  2CQX A;  4ACI A;  2IAI A;  5FKM A;  3JRH A;  3OIO A;  1IRZ A;  2ZCN A;  4A3J J;  1JGG A;  2LTP A;  1UMQ A;  3HM5 A;  5J1R A;  5HSZ A;  3TED A;  1JUS A;  1T56 A;  5EYR A;  1MBJ A;  3GTQ J;  3HEF A;  1WGX A;  2GLO A;  2DA1 A;  1HOM A;  2PBX A;  2O7T A;  4GCL A;  2EH3 A;  4CYC A;  3S1R J;  2ME0 A;  1K61 A;  2G7S A;  3O8H A;  1JJ8 C;  3HIM A;  3K7A J;  3P9T A;  4BKX A;  3AQS A;  1WCM J;  3Q0W A;  3ZQL A;  4A3K J;  1W0T A;  2MGQ A;  5F04 A;  1IG7 A;  2L9R A;  3CRJ A;  3H0G J;  3BQY A;  2EZL A;  5FKN A;  4XRS G;  4AF5 A;  2E19 A;  5EZG A;  3O60 A;  3V6G A;  2B63 J;  2XPV A;  5FGL A;  4DZP A;  2CUF A;  2NVQ J;  3HTH A;  1X58 A;  2VKV A;  1GT0 C;  5GPC A;  2FJ1 A;  3JRA A;  2WGB A;  3NNR A;  5FKO A;  2DJN A;  4DYQ A;  1F36 A;  2XPU A;  4QTR A;  1FIP A;  4V2G A;  3JRF A;  4XIC A;  3TW7 A;  3GBG A;  5K7Z A;  3NAU A;  3MVP A;  1AKH B;  2GBY A;  3VIB A;  3LHQ A;  3QPS A;  3ANP A;  1I50 J;  3TP3 A;  3ZQG A;  1FJL A;  4BY1 J;  1FTT A;  2DMQ A;  3VW0 A;  3GTL J;  1DU0 A;  4M3F A;  3GZI A;  1B72 B;  2HYJ A;  1NTC A;  3LWJ A;  5FKK A;  3NXC A;  1IJW C;  1GV2 A;  3G1L A;  2COB A;  5J1U A;  2QWT A;  3I4N J;  3D1N I;  3JRB A;  5F1J A;  5FLM J;  1B72 A;  2F07 A;  2VUM J;  4BY7 J;  4JP0 A;  2CRG A;  2FD5 A;  3V78 A;  2PMZ N;  2G3B A;  1Z77 A;  2MSY A;  1ZR4 A;  2NOG A;  4NEL A;  1MBE A;  2P81 A;  4UUS B;  2QIB A;  3H3V K;  2M0C A;  3GTG J;  4MXM A;  1TWC J;  4A3M J;  1LE8 B;  4MFD A;  2JMW A;  2FBQ A;  4A3E J;  2EZI A;  2WV1 A;  1BW6 A;  2Y9Z A;  1SAN A;  2WAQ N;  3SFI A;  1AU7 A;  1QPI A;  3C07 A;  1TWA J;  3IH2 A;  3BCG A;  2AO9 A;  4X6A J;  4Y7N J;  2TRT A;  4XK4 A;  4GFL A;  1U78 A;  1YRN A;  1XS9 A;  1Z0X A;  3PO2 J;  1U8B A;  4B3A A;  3PPB A;  3A02 A;  3JRC A;  5D19 A;  4AYB N;  3KZ9 A;  4IEJ A;  1Y1V J;  3A01 B;  3HTA A;  3LSR A;  2EQR A;  3BR2 A;  2N8G A;  2E1O A;  1RR7 A;  2X48 A;  1X2M A;  1HLV A;  3M4O J;  2R5Y B;  5D18 A;  5AQC A;  1ORK A;  2ECB A;  3HGY A;  3HGG A;  4MLO A;  4DZJ A;  1E3O C;  3VW2 A;  4XID A;  3BT9 A;  3NAR A;  3GEU A;  2R5Y A;  2NP5 A;  3VP5 A;  1JKQ C;  5EEA A;  3BR0 A;  3ZOB A;  2LFB A;  1QVU A;  3BR6 A;  1FEX A;  3RD3 A;  3S5R A;  4AC6 A;  2OPT A;  5JLW A;  4FTH A;  1LFU P;  1IV6 A;  2JA6 J;  1NK2 P;  1I3Q J;  2LP0 A;  2XGD A;  3TW6 A;  4IHX A;  1QRY A;  1WI3 A;  3BG5 A;  3UKG A;  2LVS A;  1GDT A;  1XG1 A;  2DN0 A;  3DEW A;  3ZQI A;  4I76 A;  1R9T J;  3PAS A;  4MFE A;  1JKR C;  5GP9 A;  3BR5 A;  4JX5 A;  2UXU A;  2ZOY A;  1MSF C;  4A3B J;  2OI8 A;  3O8G A;  1ZTR A;  5M3F J;  2K9N A;  3W6V A;  4B1R A;  3ZQF A;  3BHQ A;  4A69 C;  4C3H J;  5IP6 A;  1HF0 A;  4M3D A;  1JUM A;  1U9N A;  3ON4 A;  4FCY A;  3CJD A;  1BL0 A;  1X2N A;  2R0Q C;  2JWT A;  5C44 J;  2XPW A;  4X1E A;  3BQZ A;  4D7N A;  1OCT C;  3B81 A;  4ME9 A;  5FHP A;  2DA3 A;  2K9S A;  4L62 A;  3HOY J;  5FKL A;  3HTJ A;  1JUP A;  1FIA A;  5FJ8 J;  4RBO A;  3S1Q J;  5GPA A;  1IDZ A;  1GVD A;  1MH4 A;  3Q3S A;  4MO7 A;  2Y2Z A;  3BTC A;  2H8R A;  1WH7 A;  2GUH A;  1IGN A;  3G1M A;  5FLV A;  1Q1V A;  4KWA A;  4GCK A;  3BNI A;  3M3Y J;  2IU5 A;  3ZQH A;  2R93 J;  1VFC A;  3JRE A;  1ETY A;  2FX0 A;  3JRI A;  3NPI A;  5F27 A;  1APL C;  3EUP A;  1P7J A;  1NK3 P;  1RKT A;  1XC5 A;  2O8K A;  5K7H A; 
#chains in the Genus database with same CATH topology
 3JRD A;  4WXD A;  1GLN A;  2NVT J;  2H09 A;  3RZO J;  2A61 A;  3D5L A;  3DEU A;  5EGO A;  2JA5 J;  1XGS A;  1IN8 A;  1UHM A;  3NRG A;  3RKY A;  4A3I J;  2KJB A;  4IF4 A;  3F9K A;  3PM1 A;  1XCB A;  5LRR A;  2NRA C;  1S6L A;  2LYC A;  4ON0 A;  5BNG A;  1PUF B;  2FMY A;  4FQG A;  2HVQ A;  5FMP A;  4HW0 A;  3PSF A;  2YS9 A;  2P5V A;  2RHA A;  1E17 A;  3H9J A;  3ZN1 A;  2Z16 A;  5J8F A;  3CCR I;  2W84 A;  5IT3 A;  2ICW G;  2VC1 A;  4QIW N;  2L9S A;  3IH4 A;  2LD5 A;  4RAY A;  3S17 J;  3X2Q H;  3ULQ B;  1G3Y A;  4X0G A;  4CSW A;  4DQ2 A;  4N9H A;  3OYG A;  5GTH C;  2ZJQ F;  1FC3 A;  4ICH A;  1KGS A;  3LQQ A;  1ZHF A;  4Q4Z F;  1VI0 A;  4G12 A;  5BQT A;  3GTM J;  3CTA A;  3BCB A;  4KDP A;  3AL0 C;  2DDB A;  6PAX A;  2DYS H;  2FXA A;  4CCO A;  4YEJ A;  4DW6 A;  5L3D A;  2ME6 A;  3U1D A;  2JQ7 A;  2UXN A;  5JFR A;  3DBL B;  2V6E A;  4XQF A;  3C2B A;  3NRV A;  1RR8 C;  2WBM A;  4NQW A;  1D1C A;  2DT6 A;  5LEJ A;  5LHH A;  2HDD A;  2VOO A;  3MKY B;  1D3Y A;  3CDL A;  1OCO H;  1IRX A;  2DPD A;  4JL3 A;  3FK7 A;  1TBX A;  4AM3 A;  3TO7 A;  3Q0U A;  4B4C A;  3FMQ A;  2IT0 A;  2E60 A;  2V79 A;  1J7K A;  5EDN A;  2DJI A;  2IBD A;  3PIO F;  2HTJ A;  2R5Z B;  3LSG A;  3DLL F;  1S8N A;  1LFB A;  4IXA A;  2R7Z J;  3LSK A;  4HX4 A;  4QPQ A;  4UDS A;  3GTJ J;  3S1N J;  1H8A C;  1JT6 A;  5TJJ A;  5E3L A;  3SWH A;  1W5S A;  5B3S H;  3E3V A;  2RDP A;  3W6K B;  2VJJ A;  2R5Z A;  3HUG B;  4I6Z A;  4BAC A;  2B0L A;  1FPQ A;  1IXC A;  3P7N A;  4BDZ A;  2DG7 A;  2EZK A;  2O7O A;  3ZMZ A;  2RAE A;  3CUQ A;  2HVR A;  1T6S A;  5DV5 A;  1T2K A;  4K2E A;  2P5L C;  2PMH A;  5LGU A;  4BGD A;  2NX4 A;  4M9Z A;  3K4L A;  2JT1 A;  5CQG A;  2WTE A;  2KRC A;  3L2R A;  1OJL A;  3EET A;  4HF1 A;  1EH7 A;  4BHC A;  1K4T A;  3PSI A;  3BZ6 A;  1S29 A;  2FA5 A;  1K83 J;  1OIS A;  3LNQ A;  1RES A;  3I59 B;  3E6C C;  1JI8 A;  3BJA A;  4MGR A;  2X9D A;  3SDB A;  1DQU A;  2NS0 A;  4DOZ A;  2JVH A;  3ELK A;  1QNT A;  3WHB A;  4S0H B;  4A0X A;  3JSO A;  4FHT A;  3WTW C;  3MN2 A;  2P0W A;  1VQL I;  1W7P B;  1ZAR A;  4JBA A;  2CQN A;  4NNJ A;  1PJR A;  1N25 A;  2AXL A;  1WRJ A;  2Q1Z B;  1MD0 A;  3CCY A;  5GAH J;  2PMU A;  3S32 A;  1UG0 A;  2XAS A;  3OYD A;  2M5W A;  3DKY A;  3TBI A;  4CGR A;  1I3A A;  4HLX A;  2NXN B;  2RNJ A;  4I0A A;  3S3N A;  2OBP A;  3BLY A;  2A6E F;  4BE0 A;  1U8R A;  1R1T A;  1D0Z A;  3DQV C;  4HDV A;  3IUO A;  3RYP A;  2HVS A;  2AXT C;  2BV6 A;  3FHZ A;  2L4M A;  3I53 A;  3A1Y A;  1RRJ A;  1X1P A;  2Z99 A;  3RDI A;  1YFH A;  3LSH A;  1ZK8 A;  4HLY A;  3BCA A;  3E5X A;  1W7P A;  4EV0 A;  2VQH A;  3DPL C;  3GTP J;  5GAD J;  5TGT A;  1T8I A;  2BW3 B;  3JTH A;  5K5R A;  3MWM A;  3Q9S A;  4II2 A;  1ZQ3 P;  4CUG A;  3ABU A;  2A3S A;  3LSM A;  1BI2 A;  5HNF A;  3F8N A;  3VUQ A;  3TOA A;  4A93 J;  1Z7L A;  4L9J A;  1UZC A;  2QQ9 A;  4PJL A;  3CJT B;  3BDD A;  1JT0 A;  3RKQ A;  2LKS A;  2HOE A;  2QA4 I;  3E0J B;  3HKZ N;  1YJ9 I;  2D5V A;  5HLH A;  2YSR A;  2XAU A;  2W25 A;  2LY9 A;  3CD6 I;  5F6F A;  2UUZ A;  1R4M B;  5E8I A;  2KZV A;  2QKO A;  4U0W A;  1IZ1 A;  1U9O A;  5ICC A;  2OUM A;  4GYG A;  5ILU A;  2EIL H;  3NQO A;  3PUF A;  2AQE A;  1W7P D;  3OYH A;  5D6F A;  2JN6 A;  3IAM 2;  1MMN A;  2GA2 A;  3EPZ A;  1VQ5 I;  2BOL A;  2DPU A;  5D5U B;  1IAW A;  2ZCM A;  3CCV I;  3RH2 A;  1ZN2 A;  3HPG A;  4Q48 A;  3VVZ A;  1VQO I;  1YO5 C;  2QCO A;  3KET A;  5C3E J;  3GVA A;  4AU7 A;  1FT9 A;  1T98 A;  2NYX A;  4BDY A;  5DDG A;  3WHC A;  5HOO A;  2KDZ A;  2PJR B;  1ITY A;  3T6N A;  2ZKZ A;  1RKW A;  2VKE A;  3SDG A;  4J00 A;  2RC4 A;  2A6T A;  3OOU A;  4XMY A;  1U2W A;  2X4H A;  3SZT A;  1JHH A;  5DS9 A;  4I01 A;  1KU2 A;  2ADU A;  1K6O A;  3IKV A;  2MH2 A;  4MEY F;  1MDM B;  4A3F J;  1I1S A;  3I4M J;  1FOK A;  3WG9 A;  2MC4 A;  3S2H J;  4MNU A;  2JA7 J;  1U0J A;  2NP3 A;  2BHZ A;  5K7F A;  5FO5 A;  3OYF A;  3B02 A;  2VIX A;  4AYB A;  2XSJ C;  3EGQ A;  2E35 A;  3C1D A;  1IDY A;  2F5F A;  5K5O A;  4U0V A;  3BJB A;  3O6B B;  3R0A A;  1Z7U A;  4UV9 A;  4GGG A;  1O57 A;  1EJ9 A;  5FLX K;  4ZTJ A;  2EFN A;  2CQK A;  3ZN0 A;  4N4O B;  2Z5U A;  1EF4 A;  4ZYD A;  4XM3 A;  3E97 A;  4RDU A;  4EEF G;  5HNH A;  2VC0 A;  1XMA A;  4UUT A;  1VQK I;  2PQ8 A;  1WPK A;  4JQF A;  3MZY A;  1E3H A;  3K4J A;  2OCE A;  4U7D A;  3CCL I;  1PUE E;  5D5X B;  2GXA A;  1JGG A;  1IO2 A;  2HR3 A;  3HM5 A;  1UMQ A;  4RLF A;  2R7V A;  2XKO A;  3FBI B;  4FX4 A;  1KON A;  2L7K A;  3EDP A;  1TQP A;  1YW9 A;  1YJW I;  5A2Q Z;  1WJ5 A;  3J81 K;  3HRM A;  3GYH X;  2R7S A;  1BN5 A;  4S05 A;  3LMM A;  1TZL A;  2JUC A;  4ASN A;  3CF2 A;  4OIR F;  1O3Q A;  1K61 A;  1MMA A;  2GIZ A;  4EM1 A;  3HIM A;  3FMR A;  1JJ8 C;  2H6B A;  1TQI A;  3Q0W A;  2BY3 A;  3ZQL A;  4RGU A;  4A3K J;  3RCO A;  1W0T A;  4HST A;  1IG7 A;  4DNC A;  1X1B A;  3BQY A;  4HX7 A;  2EZL A;  5FKN A;  2E1M B;  3DPT A;  4YFK F;  3S3M A;  2RQQ A;  3F23 A;  3HTU A;  1I5Z A;  1STZ A;  3IL2 A;  3V6G A;  3NWT A;  1PYV A;  5FGL A;  2F4O B;  3CJQ B;  2IS2 A;  2W00 A;  3K9T A;  4AD9 A;  2VKV A;  1Q1H A;  2WGB A;  2DLL A;  3I4P A;  4DYQ A;  2R7T A;  1VQ8 I;  1FIP A;  2I8D A;  3F8B A;  3QPT A;  4TV7 A;  3SEZ A;  5K7Z A;  1QHH D;  4OMY A;  3WU1 B;  3MVP A;  3KYL A;  1R36 A;  2GBY A;  4XKB A;  2UV1 A;  4FET A;  3QPS A;  3ANP A;  4HF2 A;  1FTT A;  4CXF A;  2W57 A;  3VW0 A;  1BJA A;  3PL8 A;  1T38 A;  5H6Q A;  1BI3 A;  4KYW A;  1FMW A;  3CDH A;  4RM3 A;  3CCQ I;  2HDC A;  5B5E C;  1FSH A;  2COB A;  3V8L A;  5F1J A;  5CVR A;  1TTY A;  1R22 A;  2CRG A;  3I9V 2;  2FD5 A;  2X51 A;  1A36 A;  1Z77 A;  2MSY A;  3J80 Z;  1KU7 A;  2M4K A;  2J5P A;  3DBH B;  5LRS A;  1V5G A;  4WCG A;  1NG7 A;  3SHF A;  1TWC J;  2XKP A;  1OR7 C;  4HSR A;  4OU0 A;  3K4N A;  4I98 B;  4A3E J;  2Y9Z A;  1SAN A;  3QU3 A;  2HQA A;  4C9Y A;  3V7C A;  3HIF A;  1BOA A;  4XK4 A;  1I1G A;  2VBX A;  3ERE D;  4GFL A;  5HDN A;  1Z0X A;  3PO2 J;  2GXB A;  3H9G A;  3A02 A;  3I59 A;  1G8X A;  5AON A;  2VJI A;  4AYB N;  5D19 A;  4I02 A;  2V7F A;  1Z3Y A;  2DDA A;  2F5D A;  3LSR A;  3LL7 A;  2YX4 A;  4L9N A;  5KCM A;  1S7A A;  5K1Y A;  3H35 A;  2ZSI B;  3OOP A;  1CF7 B;  5FRO A;  1ORK A;  3HGY A;  3OL4 A;  2LH9 A;  1N77 A;  2OJE D;  3VW2 A;  4FX0 A;  4YEL A;  4RB2 C;  1W36 C;  2OV7 A;  5EEG A;  2NP5 A;  4CCK A;  3ZOB A;  1B4A A;  1T0F A;  2LFB A;  3HRU A;  3QOD A;  3QOE A;  1FEX A;  3S5R A;  5JLW A;  2H8W A;  2WA0 A;  5GAE J;  2EA2 A;  2ZXH A;  3NWS A;  4HQE A;  2TDX A;  4IHX A;  1QRY A;  2G7H A;  3TOB A;  1QZY A;  1ULY A;  2M3A A;  5FD5 A;  3DEW A;  4E6K G;  2VE8 A;  4G6D A;  4G8X A;  1X1A A;  1YHQ I;  2ACJ A;  4MFE A;  3HL2 A;  1SVM A;  1AA7 A;  2OCC H;  4A3B J;  2OI8 A;  5CJ9 A;  2XIG A;  3AFH A;  3O8G A;  4LG0 A;  3OYJ A;  2K9N A;  2Q0O A;  1J9I A;  3I56 I;  5FGM A;  3S3O A;  4XLH A;  2KP6 A;  3CJR B;  1HF0 A;  2CG4 A;  4DJA A;  2VOP A;  1JUM A;  2VXZ A;  1BL0 A;  3PNY A;  2JWT A;  4HDU A;  3DEE A;  2E1N A;  1Z1D A;  2IXS A;  1WI9 A;  4XLA A;  5C44 J;  3BQZ A;  3B81 A;  4U9N A;  1ON1 A;  2HZD A;  1O3T A;  2DA3 A;  3MCZ A;  2IGO A;  2K9S A;  4L62 A;  4PGG A;  4RGX A;  4RBO A;  3V8J A;  3ZMV A;  3S1Q J;  2VN2 A;  2ZXW H;  1MDM A;  3TO9 A;  2XAG A;  4NC6 A;  1SFK A;  1SC7 A;  4ZJZ A;  2VE9 A;  2L4A A;  1SEU A;  3M3Y J;  3BNI A;  5DCM A;  4RM2 A;  1W5T A;  2K9L A;  4ZYG A;  5B66 C;  3JRI A;  3NPI A;  1SFE A;  1P7J A;  1S5L C;  2HZT A;  3CJN A;  2QM3 A;  5D6E A;  1XC5 A;  2O8K A;  2CMP A;  3SXY A;  2RNG A;  4BBS J;  2D6Y A;  3VVY A;  3IH3 A;  2CUE A;  4KMU X;  2JK3 A;  3VTI A;  4PDK A;  2VBY A;  4KT6 A;  5C4J J;  2PBI A;  1NG6 A;  1LQ1 A;  4BHP A;  4AID A;  3CES A;  3BR1 A;  2QSG X;  5GAG J;  2K3P A;  4GCV A;  2K5C A;  5E8G A;  2CYY A;  3E7L A;  1SMY F;  1SD4 A;  2K9M A;  2ZSH B;  3VPR A;  4LOC A;  4XLP F;  2QKL B;  2E2J J;  2CSO A;  3IP4 B;  1J09 A;  2M7A A;  5E79 C;  3WE2 A;  4G7O F;  2JZY A;  3A01 A;  3REO A;  5D1R A;  4UVA A;  2PI0 A;  3HRS A;  5DTD A;  1IUF A;  1LJ9 A;  4A12 A;  3ECO A;  1D0X A;  4A2U A;  3TL4 X;  4CA0 A;  4ITV A;  1XSV A;  4U87 A;  1EKE A;  2QEN A;  2E5Z A;  2WUI A;  1MIJ A;  4A3C J;  4JKZ A;  4BQA A;  3CUO A;  5JVT A;  2EIK H;  2CW8 A;  2HQ5 A;  2KL4 A;  5FLX Z;  2PFV A;  1SGM A;  3FZV A;  1MJ9 A;  2WB1 N;  2DYR H;  3QKX A;  1HSJ A;  1RZ4 A;  1UAA A;  4BS9 A;  2QOP A;  4LLL A;  1Z6T A;  5J47 A;  3PNV A;  4PJJ A;  4C3I J;  3KP6 A;  1JKO C;  4CYC B;  1ZGJ A;  3GXO A;  2IP2 A;  3GFL A;  5E3N A;  3OSF A;  3C3W A;  4XRF A;  1J75 A;  3FWE A;  1OCP A;  4BXF A;  1MMD A;  4Y3O A;  3LSP A;  2DFI A;  4JNN A;  1AHD P;  3GZN B;  2IS1 A;  3K4C A;  4FIS A;  1BI1 A;  3GF2 A;  2UXO A;  1X4O A;  1UEL B;  1HKQ A;  1GUU A;  3KNW A;  3AQT A;  5M3M J;  3G4S I;  1KQ8 A;  2DTZ A;  3FXL A;  1T08 B;  3J7Z I;  3G73 A;  2H1K A;  1JKP C;  4BU2 A;  5E3M A;  1JHF A;  2DA7 A;  4NC7 A;  5LBQ A;  4D0P A;  2GEN A;  1G4D A;  2LLK A;  3GCM A;  4LB5 A;  2F5V A;  4LLG F;  2PMZ A;  1FWZ A;  4V2F A;  2VPR A;  1GHC A;  2ZFU A;  5D4S A;  3JAM Z;  1FP1 D;  3RKX A;  1XN7 A;  2ISY A;  4A5M A;  5F0C A;  3DP7 A;  5AIP A;  5M5X J;  4E7H A;  4S04 A;  4GFB A;  4Y13 A;  4RAF A;  4LB6 B;  4CCL A;  3E1S A;  3WOD F;  3CCE I;  1DPU A;  1J2X A;  1H9G A;  3WU0 A;  3E7Q A;  2RRE A;  4WIB A;  3KP4 A;  3FXU A;  2VQC A;  4ZDL A;  3CCS I;  2R3S A;  3S2W A;  2STT A;  1XD7 A;  5EF6 A;  4C30 A;  1RET A;  3BTL A;  1ZRE A;  3HUG A;  2P7V B;  4HQM A;  3K1N A;  4PGH A;  1KZH A;  3VW1 A;  3BG6 A;  4QLC U;  1ZR2 A;  3K1P A;  1ZRC A;  4CYD A;  2DOA A;  4RB0 A;  5A2Q K;  3ZP5 A;  2X1D A;  4ZTF A;  4ZYA A;  2EIN H;  4ABZ A;  1HC8 A;  2O0Y A;  2PLY A;  1J59 A;  1VF9 A;  5IYC J;  1TW3 A;  2CWE A;  2FQ4 A;  1UFM A;  4IQ4 A;  1YOV B;  3EUH A;  2Y30 A;  5KAI C;  4M3B A;  1VZ0 A;  3RPQ A;  3BC8 A;  3ZCO A;  2NVY J;  5DAJ A;  2RQP A;  4DBQ A;  1IXR C;  4XN3 A;  2CJJ A;  4YIF A;  2W24 A;  3PUB A;  1ZGW A;  3DKX A;  2R7W A;  2QQB A;  3IRQ A;  3TKY A;  2YUS A;  4B48 A;  5B1B H;  1TWF J;  3ZQ7 A;  3H5A A;  2DG8 A;  1MBG A;  5E1Z B;  3RKW A;  4UXN A;  2QKM B;  1SAU A;  3OSG A;  1O4X A;  5FB2 A;  2VI6 A;  1ETK A;  2CU7 A;  4XLF A;  2F2E A;  2DU9 A;  3K0L A;  5HDK A;  1P4W A;  4BJT A;  3WGG A;  1OPC A;  2KJC A;  3VYT B;  2F6C A;  5C4X J;  4XOT A;  4KA4 A;  1OYW A;  2X6W A;  1XDU A;  1TWH J;  3BG3 A;  5GTI C;  4N9I A;  2P8T A;  1YIJ I;  2O3F A;  5EGO B;  3KKD A;  1J0R A;  1YIO A;  2ID6 A;  2JSC A;  3F0C A;  4EJT A;  5LHI A;  1LVK A;  9ANT A;  3VYU B;  3M9A A;  2XF5 A;  2PJR A;  3ERM A;  2ELH A;  3W3C A;  3W6J B;  1HQC A;  5E18 F;  2PG4 A;  5EG0 A;  5D8K B;  3ABL H;  3FKJ A;  2FEZ A;  3F3X A;  4NN1 A;  3ESW B;  3DXJ F;  1BOB A;  1U3E M;  4KMF A;  1K79 A;  4B47 A;  4EMS A;  2ISZ A;  4IHV A;  2H6C A;  3HE0 A;  1MMS A;  1IW7 F;  3WGH A;  5HBU A;  2EBI A;  2Z2S B;  1HKT A;  1HKS A;  3F8M A;  2LF7 A;  4HKU A;  4EJU A;  4PXI A;  4YG2 F;  4M3G A;  4YZE A;  1C0W A;  1ETO A;  4XN0 A;  4XSZ F;  2JA8 J;  3L2Q A;  4OWR B;  4L18 B;  2YR2 A;  3CC4 I;  4AC0 A;  2LBF A;  4F93 B;  2A05 A;  3WG7 H;  2HKO A;  1EA3 A;  1B59 A;  4AIJ A;  3ANG A;  2XAQ A;  1B8I B;  3FHN A;  4PK4 A;  1Z9C A;  4GFK A;  2XB0 X;  2QF7 A;  2F5C A;  4UV8 A;  5JLX A;  2HOT A;  1ACI A;  5IY5 H;  4L5E A;  4RGS A;  2JSP A;  4A3L J;  2LY1 A;  3LJL A;  2NVX J;  3G2B A;  2ELK A;  4A3D J;  5D8L B;  2IS6 A;  1YQA A;  3GFJ A;  4WF2 A;  4NBQ A;  5CXG A;  5KK1 A;  3D0S A;  2ELJ A;  3H3Z A;  3U21 A;  3ABT A;  4P55 A;  4MIM A;  2M45 A;  3EUK L;  2H94 A;  5J1Y A;  3MEX A;  5FRM A;  2PJP A;  4OIO F;  4O5V A;  5HLG A;  2A2F X;  3F6V A;  2HYF A;  4LK0 F;  1BIB A;  1LEA A;  3QPL A;  1FLI A;  3R0J A;  2JTV A;  3BG9 A;  3VOX A;  1MBK A;  2RV8 A;  3WTT C;  1YYV A;  4PJN A;  4D5C A;  2CO5 A;  2R7F A;  2ID3 A;  3I55 I;  1O3S A;  2DMU A;  3LST A;  3QYE A;  3IUV A;  3ISP A;  1IN7 A;  1TWG J;  2V26 A;  5J8C A;  2IAI A;  1RIO H;  3OIO A;  2ZCN A;  4A3J J;  2AS5 F;  2LTP A;  3DKW A;  4IRI A;  5J1R A;  2IA1 A;  2ZCW A;  3ABK H;  3OV8 A;  4P9U A;  4XBF A;  3LSI A;  1MBJ A;  2K4B A;  1X3Z B;  3FM5 A;  3HEF A;  4BH9 A;  1GXP A;  4CCN A;  2DA1 A;  4LFU A;  1FMV A;  4E7I A;  1BR1 A;  2P6S A;  3T0Y A;  3S1R J;  5BPD A;  3P9T A;  1ZG3 A;  3ZMS A;  4BKX A;  1GVJ A;  4ESJ A;  2L9R A;  2EPF A;  2XUB A;  2K85 A;  2BY1 A;  1QO0 D;  2GZW A;  2IPQ X;  3CO6 C;  4KT5 C;  4QWQ A;  3CMA I;  4Q5S F;  2WAE A;  2ESH A;  3CUQ B;  1V55 H;  4DZP A;  2CUF A;  5KHD A;  2NVQ J;  3HTH A;  1I27 A;  2WC2 A;  1S72 I;  5GPC A;  2AQF A;  3M8E A;  2Q8K A;  3NS4 A;  5FKO A;  2DJN A;  1XMK A;  4G6Q A;  4KIB A;  2XPU A;  5DEQ A;  5LFA A;  2QBY B;  3IAS 2;  3FXK A;  2CW7 A;  2MD0 A;  4XSX F;  5CKT A;  3T1B A;  5AIQ A;  3K70 C;  5LHG A;  4H0E A;  4A0Z A;  3TP3 A;  1FJL A;  2BY0 A;  2DMQ A;  4HG2 A;  1DU0 A;  3GZI A;  2FBI A;  2DBB A;  3F8F A;  5FKK A;  2KIQ A;  1K78 B;  1GV2 A;  4GXO A;  3HOS A;  3W2W A;  1R6R A;  2QWT A;  3D1N I;  2M30 A;  3VSL A;  1B72 A;  2F07 A;  1DPR A;  4HA8 A;  4BY7 J;  3RPU A;  1WHU A;  2BZT A;  3HSE A;  2EIJ H;  1MGT A;  1Z21 A;  2G3B A;  3GZ5 A;  3TDZ C;  2FML A;  1ZR4 A;  2L01 A;  2P81 A;  2WWY A;  2X6Y A;  3KPH A;  2QIB A;  3I58 A;  3H3V K;  5E1W A;  3J7A O;  2VQL A;  3CLO A;  2M0C A;  2VXD A;  4A3M J;  1K6Y A;  1FY7 A;  2CUJ A;  3P9C A;  1HXD A;  5LD2 C;  1NHA A;  2CV1 A;  3D5S C;  5ILV A;  1BW6 A;  1T0F C;  1QZZ A;  2NNN A;  3SFI A;  3KE2 A;  3QU6 A;  1QPI A;  3AG3 H;  3EUH C;  3H36 A;  4R79 A;  3P5J A;  2BYV E;  3F22 A;  1XPX A;  1E0E A;  4MHG A;  1LKX A;  2DTR A;  4X6A J;  3J80 K;  3CP2 A;  2TRT A;  4XNF A;  3A0H C;  3RPU D;  4U88 A;  1XS9 A;  1MJA A;  2PEX A;  1LVA A;  3L00 A;  3JRC A;  3WTS C;  4M71 A;  3CUQ C;  4LJZ F;  1E2X A;  5E20 A;  1YIT I;  4HV5 A;  3F72 A;  3O2P E;  1X3W B;  2EQR A;  2E71 A;  2N8G A;  3WU2 C;  1RR7 A;  2X48 A;  1OKR A;  1U5T B;  1HLV A;  1EV7 A;  5LGT A;  2EV5 A;  3H92 A;  4ETS A;  4DZJ A;  1E3O C;  1EH6 A;  2MLK A;  4YFN F;  3NAR A;  1JKQ C;  5EEA A;  5JVG F;  4KFC A;  3HHG A;  4OOI A;  3L2U A;  4AC6 A;  2V1U A;  3L09 A;  2NVU B;  4M73 A;  1NK2 P;  1I3Q J;  5TRD A;  3L9F A;  3UKG A;  1VQ6 I;  1KQ9 A;  2LVS A;  1XG1 A;  3J7Y J;  3C18 A;  1USS A;  2XF6 A;  2L54 A;  3CZ6 A;  3PAS A;  5HS9 A;  5GP9 A;  1ZRF A;  2UXU A;  2ZOY A;  1F9N A;  1SVO A;  5E1X A;  4ANJ A;  4CZC A;  5D4R A;  3W6V A;  2VB6 A;  4A69 C;  1FOY A;  4N4N B;  2ETH A;  1U9N A;  2Z3Y A;  3GO5 A;  5L3E A;  1SD7 A;  2R0Q C;  1X3U A;  1PVE A;  1XMX A;  3DV8 A;  4OIP F;  2Q2E A;  2XPW A;  4X1E A;  4ME9 A;  5FHP A;  4M9S A;  1FBU A;  4JK1 X;  3CP8 A;  3HC7 A;  1F5T A;  3GZ6 A;  3KP3 A;  5FKL A;  3G6E I;  3HOY J;  1JUP A;  4LK1 F;  3OIQ A;  2RAS A;  3DBR B;  4MO7 A;  4OIQ F;  3BTC A;  3OL3 A;  3R60 A;  2BEO A;  3N97 A;  2VBW A;  2H8R A;  2GUH A;  3WTX C;  2IRF G;  5FLV A;  5DCF A;  4KIT B;  4GCK A;  3DWL E;  3A2K A;  1JE8 A;  1M1E B;  2IU5 A;  3K8P C;  2KRH A;  3LFU A;  2QVO A;  1D5V A;  4F55 A;  3JRE A;  2NOJ B;  4Y17 A;  4E7L A;  3IRR A;  5F27 A;  1Z67 A;  2L5Q A;  3FF5 A;  4KN7 X;  3KCC A;  4KN4 X;  1NK3 P;  5CQE A;  1WJE A;  3HYI A;  5K7H A;  4C2M J;  4U9L A;  1ZH5 A;  1LB2 A;  1BIA A;  4PJ0 C;  1D5Y A;  2IVM A;  3G1O A;  2Y48 A;  1MND A;  4RS8 A;  2XRL A;  5KNL A;  5FFZ A;  3QOP A;  2R7X A;  1P2F A;  1HA8 A;  4D9J A;  3K10 A;  2CUZ A;  3DPU A;  3K4B A;  4HX8 A;  4IQJ A;  2EFO A;  3RZD J;  3T8R A;  3BR3 A;  4CO8 A;  2F4I A;  1UI6 A;  3I5U A;  3K4M A;  2K02 A;  4IHT A;  3PO3 J;  2W53 A;  1EH8 A;  1KA8 A;  3HOZ J;  2CV0 A;  2VT2 A;  3MKZ A;  4Z2Y A;  3KIO A;  2KQR A;  3ROU A;  3FXQ A;  4M3E A;  2EFQ A;  2RN7 A;  3CME I;  5EFY A;  1ZGA A;  2COM A;  2DFE A;  3GLL A;  3LQR A;  3RSN A;  4ZH4 F;  1TL8 A;  1N78 A;  2L9V A;  5H6R A;  1K7A A;  3U2R A;  2MFZ A;  3A4C A;  3BY6 A;  2HXO A;  2MLG A;  2LBF B;  1OCR H;  3PFI A;  5F0F A;  1TW2 A;  1WJC A;  1B9M A;  3K70 D;  4E7Z A;  2L3D A;  1JTX A;  2M8G X;  2QLZ A;  1UCR A;  2WY8 Q;  2DO7 A;  2HYG D;  1SFO J;  1VQ7 I;  2J5O A;  1X1C A;  3CCM I;  4EAT A;  3TQN A;  2JRM A;  4HRI A;  2M1B A;  3OR2 C;  4NUB A;  4XLE A;  2OTL I;  5JHU A;  3K1M A;  1A6I A;  1T39 A;  1T95 A;  2OZ6 A;  1Z6R A;  5H2F C;  3JSJ A;  1ZRD A;  2ZXI A;  5CW8 A;  5KVR A;  2FQ3 A;  2PX9 A;  2BHY A;  1G59 A;  4W1U A;  1VQ9 I;  1ETW A;  2Z33 A;  4EM0 B;  3M8F A;  3BTI A;  5K58 A;  5ICF A;  2HYT A;  4WXH A;  1K78 A;  3PJR A;  2O5R A;  1KQ0 A;  2M2E A;  1H89 C;  2NS8 A;  3FDY A;  2ZCX A;  4YII A;  2M8E A;  3OS1 A;  3ZXS A;  5L3F A;  1E3P A;  4V19 K;  2B9S A;  1V5E A;  2KMU A;  3QRF F;  1WKM A;  1Y8Q B;  4JX4 A;  4IHS A;  4IZZ A;  4AUX A;  1UJ8 A;  1CGP A;  1UHS A;  1ZEL A;  3OYI A;  3S2D J;  4II3 A;  2STW A;  2FJI 1;  2BGC A;  2Z1D A;  2LG4 A;  3FKI J;  1XX5 A;  1LE8 A;  3EYI A;  3QP6 A;  1P9Q C;  4IOA F;  4RGR A;  1R1V A;  2AHQ A;  4UVB A;  2X1C A;  1ZKG A;  4XL9 A;  4AIK A;  1L0O C;  3M8J A;  3Q0V A;  5ICE A;  1V4R A;  3FXM A;  1WZ2 A;  1UG2 A;  3IKT A;  4L0Z B;  1MH3 A;  3KZI C;  2CW0 F;  1R5G A;  2HTS A;  5BMZ A;  5TIS C;  3AAF A;  1DGR M;  4EVI A;  2BVL A;  1VQ4 I;  3KLO A;  4F91 B;  5J6X A;  3OYK A;  3G3Z A;  2Y9Y A;  2F48 A;  2O9L A;  1SVL A;  1LDD A;  3V8K A;  2VQG A;  1ZG5 A;  4J01 A;  4F52 A;  4M72 A;  2ZFW A;  3KKC A;  3VOE A;  2G7G A;  1HST A;  2L0K A;  5L3B A;  2H1L A;  5EJC A;  2NNY A;  2PZ9 A;  2HKU A;  5IOY A;  4ZZD A;  2ZJR F;  2XSD C;  4EJV A;  1POG A;  2ZBK A;  2OQG A;  3QQA A;  4I09 A;  1KU3 A;  4HNV A;  2A69 F;  4B44 A;  4HZF A;  4IJA A;  1K4S A;  2E2H J;  2OAZ A;  1S9H A;  1QZE A;  4M6V A;  3JTG A;  1DU6 A;  2M87 A;  3KX2 A;  3S8P A;  3ZMD A;  2VKD A;  2XGC A;  3EUA A;  3GME A;  2DA2 A;  5DYM A;  5D5V B;  3MKW B;  2VT3 A;  2F4M B;  5IP7 J;  1FTZ A;  3SZG A;  4CIC A;  3D5R C;  2TCT A;  2V4J C;  5H9T A;  2QGU A;  2X6X A;  4XRS A;  3RQI A;  1LPQ A;  3VYR B;  1LFP A;  4IRG A;  2HKX A;  1R58 A;  2VLA A;  1UB9 A;  5HS8 A;  3HOV J;  3HOW J;  5HOD A;  1SD6 A;  2Y0S N;  1KU9 A;  3VSK A;  2CQ7 A;  4RMN A;  3WE3 A;  3NI7 A;  4EGZ A;  3HHH A;  4BHB A;  2MAB A;  2A07 F;  2P6T A;  1YG2 A;  3BTJ A;  2V9K A;  3V4G A;  1MBH A;  2XV4 S;  4M6Y A;  1AOY A;  2ZOZ A;  3QP5 A;  3FXJ A;  1F43 A;  2R7O A;  4XRM A;  2IGK A;  3P9I A;  2WB1 A;  4XOR A;  1OFC X;  3VOD A;  2Y0S A;  2EV6 A;  1T33 A;  1X1D A;  4CDG A;  4UUV A;  1B8I A;  4UHT A;  1OR7 A;  3C2H A;  1P7I A;  4E7K A;  2DK8 A;  5IP9 J;  2LKX A;  4O3M A;  2QQ8 A;  4BJ5 C;  5IPA A;  3HOU J;  2YU9 J;  4B09 A;  3LAJ A;  5BPI A;  1Y0N A;  4MTD A;  1F4K A;  3K6G A;  1VND A;  2DMN A;  2D45 A;  1HCR A;  4ENN A;  1S3J A;  2DA5 A;  3OS0 A;  1B9N A;  1YLF A;  4QSH A;  4MTE A;  2XAF A;  1YX5 A;  3L2C A;  4OMZ A;  2HOS A;  2UXH A;  3VOK A;  4LG0 B;  5J3L A;  2V9V A;  3KZZ A;  4D1Q A;  4D5F A;  2LR8 A;  3S14 J;  1V54 H;  2M4G A;  1YS7 A;  3FIS A;  1ODD A;  5EG0 B;  3MKL A;  2V6C A;  2E1C A;  4Y4R A;  4XKV A;  2D1V A;  1I6H J;  2DW4 A;  1YX3 A;  1PP8 F;  1PUF A;  1VQN I;  3LOC A;  3QBM A;  3JR9 A;  5K5Q A;  2Z9O A;  4OD4 A;  2W4S A;  1MNE A;  3BWG A;  2V1X A;  1V5F A;  3HBL A;  5DCM B;  4DIQ A;  3LWF A;  2EIM H;  3QWL A;  3SYT A;  1BJZ A;  2V1N A;  3L7W A;  2M9H A;  3HXL A;  2M34 A;  2HEO A;  4A3G J;  4XOP A;  1A35 A;  1XGO A;  3ML6 A;  2I5U A;  4BBR J;  3K2A A;  4RB1 A;  4RB3 C;  2PN6 A;  2KLO A;  4HNT A;  1O7F A;  1FSE A;  5HAW A;  4LMY A;  5JI6 A;  3ZQQ A;  2GXG A;  4A0Y A;  3BG7 A;  3VB2 A;  2FU4 A;  3A03 A;  2ZC2 A;  1DDN A;  3PIP F;  2CQX A;  1TNT A;  4NC8 A;  3JCU C;  3WTV C;  5J40 A;  4BE2 A;  3E5Q A;  5HSZ A;  4DBR A;  4P1W A;  4CH7 A;  3TED A;  1JUS A;  1T56 A;  2OC6 A;  5EYR A;  3P9K A;  3GTQ J;  3KYD B;  1WJD A;  2KFD A;  1HOM A;  4F7Z A;  1TP4 A;  2MBF A;  4Y33 A;  5DD4 A;  2DAO A;  3S93 A;  4CYC A;  2G7S A;  3K7A J;  2ZJP F;  3C7J A;  3AQS A;  4PCQ A;  4ESF A;  5DM6 F;  1RUN A;  2GA1 A;  2OQR A;  2Y75 A;  5F64 A;  3CRJ A;  2W85 A;  1IXS B;  4XKW A;  3GX4 X;  1OMI A;  3CCJ I;  4L9T A;  5L3G A;  4F92 B;  4XRS G;  4I0B A;  3OYA A;  2E19 A;  1L3L A;  5EZG A;  2K27 A;  1Y6I A;  3ASN H;  2X0L A;  2FNP A;  1FBQ A;  1X58 A;  1GT0 C;  3JRA A;  2FJ1 A;  3NNR A;  2O03 A;  3I3L A;  2OZU A;  1F36 A;  4QTR A;  3ZMU A;  4V2G A;  5CYV A;  3TW7 A;  3GBG A;  1FYK A;  3F8C A;  4NQW B;  1D8J A;  2DCE A;  3IHU A;  3BP8 A;  2L2O A;  2ZY9 A;  3FXR A;  4A6E A;  1IN4 A;  5F1R A;  1A6Q A;  1I50 J;  2DQL A;  1J5Y A;  4BY1 J;  2L9N A;  4B3X A;  1HBX G;  2DI3 A;  4BYY A;  1MMG A;  3MQ0 A;  4FT8 A;  3RIR A;  1KYZ A;  1B72 B;  1LEB A;  4U7B A;  1X4P A;  1NTC A;  2KIS A;  2WY7 Q;  2NAZ A;  5BOX A;  3NXC A;  4JOM A;  1NH3 A;  3OYB A;  5J1U A;  3Q9V A;  3I4N J;  3ABM H;  1BC8 C;  5FLM J;  2R7U A;  3H5R A;  1TQM A;  2RVC A;  2VUM J;  3A0B C;  4UVC A;  1R23 A;  3V78 A;  3GLX A;  2PMZ N;  3W2A A;  1OYI A;  2E36 A;  2BVM A;  5ED4 A;  2NOG A;  1TT0 A;  1W4M A;  5DUK A;  4LIT A;  2FBK A;  3BJ6 A;  2V1D A;  4UUS B;  1VQM I;  2KIU A;  4I99 C;  1W1W E;  5DUI A;  1R7J A;  2GQQ A;  3MFK A;  1IF1 A;  2JMW A;  2O6G E;  4M6X A;  3COA C;  2EZI A;  1SFX A;  3L2W A;  1AU7 A;  3C07 A;  1TWA J;  1BI0 A;  3BCG A;  1MKM A;  2DT5 A;  2FNA A;  2IA2 A;  4Y7N J;  5JHF A;  1ZLJ A;  4MEX F;  2P7C B;  1U78 A;  4QPO A;  1YRN A;  2IA0 A;  4L5J A;  3I54 A;  3PPB A;  4B3A A;  1U5T A;  2HQR A;  2XDV A;  2IJL A;  3KZ9 A;  3SEQ A;  3QYF A;  3A01 B;  4CGZ A;  4GDF A;  3HTA A;  1IN6 A;  3CDI A;  1TNS A;  3BR2 A;  1X2M A;  2JA2 A;  1Z3X A;  3M4O J;  2QWW A;  4OD5 A;  5L3C A;  3QPH A;  2R5Y B;  5AQC A;  3R4K A;  2ECB A;  3MAJ A;  3RI4 A;  5LLQ A;  4MLO A;  4O6J A;  2DT7 B;  3ZR8 X;  4E4H A;  1DP7 P;  3GEU A;  3JW4 A;  2O61 A;  4BQO A;  4BUP A;  4GYI A;  1QVU A;  1LUJ B;  1LDK B;  4E7S A;  3B73 A;  1D8K A;  1LFU P;  2JA6 J;  3K2Z A;  4ZYH A;  1BR4 A;  3EQL F;  3KP7 A;  4M9X A;  1WI3 A;  3V42 A;  4BEH B;  3LA3 A;  4BXU A;  4GO1 A;  1GDT A;  2DN0 A;  2HU9 A;  1OYY A;  2LF8 A;  4I76 A;  2B3W A;  4ZDP A;  3BR5 A;  3UNG C;  3M07 A;  3NEU A;  4JX5 A;  1MSF C;  4P96 A;  1IV8 A;  1ZTR A;  2HFH A;  2YX7 A;  2YU3 A;  3FX3 A;  3ZQF A;  3BHQ A;  4M3D A;  4E70 A;  4FCY A;  1X2N A;  5KAF C;  3OYN A;  4RAZ A;  3PQJ A;  4D7N A;  1ONV A;  1P92 A;  2HGC A;  2QZ8 A;  4HNU A;  3HTJ A;  1HW5 A;  5FJ8 J;  1IDZ A;  4ZZL A;  1MH4 A;  2Y2Z A;  1WH7 A;  1IGN A;  5CVV A;  1VTN C;  1Q1V A;  3J81 Z;  4WX9 A;  3ZQH A;  4AWX B;  1FNN A;  2R7Q A;  4OAY A;  5HDG A;  2UXX A;  4UNO A;  1ETY A;  1R5H A;  2FX0 A;  2LY2 A;  4BQQ A;  1B6A A;  5IT9 Z;  1I6X A;  3H9Q A;  3C2G A;  1RKT A;  2B1E A;  1QQI A;  4IOC F;  4NDL A;  2XGE A;  1H0M A;  2W82 A;  4Y52 J;  1MBF A;  1QGP A;  1A5J A;  3PNT A;  1WH5 A;  1SD5 A;  1H88 C;  4A6D A;  1ETQ A;  3G71 I;  4UY8 I;  1I39 A;  5HVQ C;  1V3F A;  2W1O A;  3MD2 A;  3ON2 A;  2QBY A;  3DCF A;  1AKH A;  4MK6 A;  1W0U A;  1U6G A;  1CQT A;  1WJF A;  3OWT A;  3E6D A;  3S15 J;  4BXX J;  5CVU A;  2LK2 A;  2XAJ A;  3LA2 A;  3HPH A;  3O3K A;  4YFX F;  3OYL A;  4PUS A;  5C4Y A;  1XTA A;  2E7X A;  3AKZ A;  4EJW A;  1BBY A;  3BJO A;  1ENH A;  1F1Z A;  3L2V A;  3CCU I;  2QTQ A;  2CH0 A;  2ZME C;  2OTJ I;  2QYO A;  5EZH A;  4EM2 A;  1JXS A;  2K40 A;  1PP7 U;  2EZH A;  3M1E A;  2JUG A;  3H3U A;  2FF4 A;  3ZMT A;  4KUM A;  2P5K A;  4ZDO A;  2Q2E B;  1S7O A;  5IYB J;  1HW2 A;  1IN5 A;  1S7E A;  4G94 A;  3BZC A;  2GFN A;  1D1A A;  3TMO A;  4HBL A;  4EQQ A;  3HDD A;  1XSX A;  2K9Q A;  1WFX A;  2R7D A;  4BJ6 C;  4GCT A;  4HAM A;  1GV5 A;  1MNM C;  3TO6 A;  2FE3 A;  3OIP A;  1UI5 A;  2ZXJ A;  2LSO A;  3HKZ A;  2XB5 A;  2X1E A;  1UHW A;  5JR3 A;  4GRI A;  3FK6 A;  3V7R A;  3VYS B;  2L7F P;  2O8X A;  5D5W B;  3LAP A;  3GW2 A;  3HRT A;  2MW8 A;  2ZNZ A;  3ZQC A;  5DM7 F;  1QBJ A;  2X85 A;  3MZ8 A;  3ECH A;  3VEP A;  3Q5F A;  4BAY A;  3SZP A;  2BXZ A;  4ENM A;  2MH9 A;  2Y69 H;  1A31 A;  4DYR A;  1ZAO A;  3KLN A;  2W48 A;  4PSW A;  3ZRG A;  1R00 A;  2KZG A;  1BA5 A;  2E7W A;  4JX6 A;  3TDU C;  3SQN A;  3QAH A;  5FD6 A;  3E6M A;  2VL8 A;  4BL0 B;  2G7L A;  5CPR B;  3MNL A;  4MQV A;  1QA6 A;  2FBH A;  2BE5 F;  3HSF A;  3GTK J;  1ZLK A;  2FUG 2;  2DMT A;  4PSX A;  4UB6 C;  1IRF A;  4L9V A;  1WQ2 A;  3JSP A;  4KIF A;  3G56 A;  4C3J J;  3SJM A;  2GAU A;  5EEH A;  3CWR A;  1WWX A;  2LC2 A;  3B6C A;  5J4V A;  3GEZ A;  4HOB A;  2LDU A;  1IC8 A;  2OER A;  2EWN A;  4I7H A;  1R5I D;  4WK8 F;  4IHW A;  3IC7 A;  5J4Y A;  1WJB A;  3F1B A;  1OQY A;  4XKC A;  2JRT A;  2DOF A;  3DFG A;  3FMS A;  3HB9 A;  3RYR A;  3TGN A;  1TLH B;  1BR2 A;  2FOK A;  2P4W A;  3CMY A;  3J7A Y;  1XSD A;  1FBS A;  1HW1 A;  3LSJ A;  4E7J A;  2DQR A;  3DU5 A;  2M0M A;  3CC7 I;  3T5X A;  1R49 A;  2YVE A;  2UXP A;  1ERD A;  1QU3 A;  1MSE C;  1IRG A;  4ESB A;  4Y15 A;  1LNW A;  1RPW A;  3GFM A;  2KIF A;  3DLA A;  1BW5 A;  2EV0 A;  2HWV A;  2D1H A;  2FRH A;  2YVX A;  2UXI A;  2XRO A;  4IHY A;  3IV5 A;  1JTY A;  4G9Y A;  1JJ6 C;  3E5U A;  2V57 A;  4C2U A;  3IWF A;  4D7M A;  3HSR A;  1RUO A;  5F0H A;  3AL0 B;  3HOX J;  2R92 J;  4WWC A;  2Q24 A;  2RGV A;  4BEH A;  4P9F A;  5F08 A;  1FZP B;  1FX7 A;  1YRN B;  3G7R A;  5IYD J;  4YRV A;  1W36 D;  2ESN A;  3ZPL A;  2GIV A;  2ZB9 A;  2YVH A;  1G2H A;  3KEO A;  3HG9 A;  5CLS A;  1FYM A;  3KEY A;  4CZZ A;  4FE4 A;  4W97 A;  4RLQ A;  4EJO A;  1ETX A;  1G3W A;  1YW7 A;  2DXI A;  4XLN F;  2QSF X;  4LG3 A;  2HXI A;  4NB5 A;  5IOZ A;  3M7G A;  5DD8 A;  5B1A H;  4LLN A;  2MA3 A;  4UUS A;  2BXY A;  2UWM A;  2KRF A;  4BQN A;  3B6A A;  2OA4 A;  2OU2 A;  2DFF A;  3ASO H;  2K3F A;  2ECC A;  3COL A;  4G6T B;  2QUF A;  1Y39 A;  2L7M P;  3DPJ A;  4HPQ A;  3FIW A;  2EA4 A;  2HPI A;  2ZME A;  2GM4 A;  3GTO J;  2XDN A;  4ENJ A;  2KIM A;  3FBN B;  1WVR A;  2WV0 A;  4ZYE A;  3AG4 H;  4LIV A;  3BPV A;  3L1P A;  1QVT A;  2WAQ A;  4ZC3 A;  4HYE A;  3BRU A;  2L02 A;  5M5Y J;  5HLT A;  4LD5 A;  2HI3 A;  2M7B A;  5M5W J;  4J19 A;  2DMP A;  1RC9 A;  4KJZ A;  4OIN F;  2CGP A;  4G7H F;  2DA6 A;  2KT0 A;  4JYK A;  3WGI A;  2I10 A;  3H1C A;  5ICG A;  3V7S A;  4KIS A;  2CQQ A;  4IRH A;  3F21 A;  2LOO A;  1XDS A;  2G7U A;  3HZJ A;  5CVJ A;  5E17 F;  3LFK A;  2X6O A;  2Y31 A;  3CQZ J;  1VQP I;  1MJB A;  1IUY A;  4LIU A;  3DTK A;  1ETV A;  2DOE A;  1YJN I;  4IKF A;  4DYC A;  4Q47 A;  3U9G A;  3GFI A;  1TC3 C;  2EJR A;  3DU6 A;  4IL6 C;  5E3O A;  3GUD A;  1TT5 B;  1G3T A;  2YPR A;  2ZJ2 A;  3GWZ A;  4HF0 A;  2JVG A;  1LDJ A;  2VKH A;  5CVI A;  3JRG A;  5FFX A;  3QYB A;  3JAM K;  2HS5 A;  2HPM A;  3VDX A;  3CLQ A;  3VFZ A;  2L7Z A;  3S1M J;  4PFO A;  1XB4 A;  3HTI A;  3PFY A;  5CXI A;  2EFW A;  2IS4 A;  4PFP A;  3I0T A;  4PZJ A;  4AIH A;  3WTU C;  2IEK A;  4UB8 C;  3HJE A;  3RQ4 A;  2MG4 A;  1OCZ H;  1X19 A;  2LRE A;  2G0E A;  3I64 A;  2MD5 A;  3W2V A;  3HOT A;  4L0Y B;  2XAH A;  2CV2 A;  2ZNY A;  2HOA A;  4KNY A;  1B1B A;  2REK A;  3BOQ A;  5ILS A;  3U1K A;  1O7L A;  2VAS A;  5FRN A;  4H4K C;  4RAG A;  1Y1W J;  3TP0 A;  4ENK A;  3FRQ A;  1AWC A;  2JJ7 A;  2D2W A;  2XHK A;  2E2I J;  3KFW X;  2NS7 A;  2Y0M A;  2QEX I;  2DA4 A;  3FXO A;  2K86 A;  4FE7 A;  3CMM A;  3SFZ A;  1YTY A;  1HDD C;  2R7R A;  4KIC A;  1P6R A;  2KHM A;  2OF7 A;  3S16 J;  3VVX A;  3M1C A;  3R61 A;  1HDP A;  2E34 A;  2HQN A;  4ACI A;  4M74 A;  5FKM A;  3RTR A;  3JRH A;  1IRZ A;  2KDO A;  2A68 F;  1A04 A;  4IVN A;  3CO7 C;  2FOW A;  2LMD A;  2H27 A;  2GLO A;  1WGX A;  4B43 A;  3FM3 A;  2PBX A;  2O7T A;  2ZO4 A;  4GCL A;  1ZG1 A;  2VBZ A;  2EH3 A;  2V9P A;  2QSH X;  2ME0 A;  3O8H A;  2OD5 A;  2WAF A;  5H20 A;  1WCM J;  1Y56 A;  4L5I A;  2HNH A;  2IW5 A;  2MGQ A;  5F04 A;  2W7N A;  2XVC A;  4MQ9 F;  3H0G J;  2MC3 A;  4I2O A;  2XRN A;  4IX7 A;  2DFH A;  2XGX A;  3F6O A;  4AF5 A;  1R1U A;  2IGN A;  2GWR A;  4LGW A;  3O60 A;  2B63 J;  2XPV A;  1WJA A;  4AVZ A;  2XF7 A;  3AG2 H;  4KIG A;  3K4K A;  2BBY A;  3HTS B;  2WAD A;  3UR3 C;  2XC7 A;  2GOX B;  3WTY C;  3JRF A;  4P5O A;  1O3R A;  4XIC A;  2LRD A;  3NAU A;  4CCM A;  2UZK A;  1AKH B;  2GOM A;  3VWB A;  3VIB A;  2VOD A;  3WTZ A;  1G3S A;  2EB7 A;  1WSU A;  3LHQ A;  3ZQG A;  5HS7 A;  3GTL J;  1FP2 A;  4IPA A;  4R1H A;  4DGW B;  4M3F A;  2CFX A;  4G7Z F;  2HYJ A;  3LWJ A;  1YE9 A;  4PJM A;  2IGM A;  3OYM A;  1IJW C;  3G1L A;  3OY9 A;  3JRB A;  2B7E A;  4JP0 A;  1D1B A;  2PFB A;  5LGN A;  2A6H F;  4YIR X;  4CHU A;  1Y8R B;  1MBE A;  4NEL A;  1SMT A;  4B8X A;  4CCJ A;  1YS6 A;  4C2T A;  3GTG J;  4MXM A;  1PDN C;  1KYW A;  2KPM A;  1LE8 B;  1Z91 A;  4MFD A;  2EFP A;  4FAS D;  2FBQ A;  4XLC A;  1REP C;  2WV1 A;  3ONQ A;  3KEQ A;  2WAQ N;  3EYY A;  3IH2 A;  3LA7 A;  2AO9 A;  1RI7 A;  4IO9 F;  1W5C C;  3OR1 C;  1ZYR F;  3DTE A;  1DGW Y;  1UST A;  4N0B A;  1U8B A;  2BW3 A;  2C6Y A;  1CF7 A;  4IEJ A;  1OLT A;  4Z6Y A;  5LEK A;  3K69 A;  4R8H A;  1Y1V J;  1SAX A;  4NHJ A;  2EK5 A;  3OMY A;  3H0D A;  2E1O A;  1U5T C;  5IT9 K;  3IWZ A;  1YW8 A;  4EGY A;  5D18 A;  2VON A;  2LKP A;  5ERI A;  1FYL A;  1H9T A;  4XON A;  4BNC A;  3HGG A;  3KP2 A;  3KZY A;  4XID A;  3BT9 A;  2R5Y A;  3VP5 A;  3BR0 A;  2A5Y B;  2K4J A;  3OS2 A;  3MZH A;  2VPL A;  3BR6 A;  1GXQ A;  2HDW A;  3RD3 A;  3R6S A;  1YI2 I;  2OPT A;  2E1M C;  2E5N A;  4FTH A;  1IV6 A;  1QPM A;  1FOW A;  2CFO A;  2LP0 A;  2XGD A;  3TW6 A;  2FSW A;  3BG5 A;  1RNL A;  2A5W A;  3ZQI A;  1R9T J;  1XGM A;  1JKR C;  1D0Y A;  2K7L A;  2CS3 A;  3KYC B;  2BY2 A;  3N4M A;  3CF5 F;  5M3F J;  4C2M A;  3PQK A;  4B1R A;  1G6N A;  1SFU A;  3T8T A;  1P4A A;  4C3H J;  5IP6 A;  1BM9 A;  3ON4 A;  2LNB A;  4WXC A;  3CJD A;  3CC2 I;  1R71 A;  3KP5 A;  4IRV A;  2JPB A;  4HEA 2;  2DOD A;  1R4N B;  1QHG A;  1DUX C;  1OCT C;  2R4G A;  1FOX A;  3DF8 A;  4OAZ A;  1MW7 A;  3RJP A;  1DP3 A;  2G9W A;  4RA2 A;  1P4X A;  1FIA A;  2DK5 A;  1JGS A;  5GPA A;  1GVD A;  3Q3S A;  3OYE A;  2KKO A;  4U0Y A;  1Z05 A;  2ZME B;  3G1M A;  2MYS A;  4AVP A;  1N75 A;  3BZK A;  2QQA A;  1BC7 C;  4KWA A;  5BS6 A;  2VJ5 A;  1ON2 A;  1VFC A;  2R93 J;  1MZB A;  3OYC A;  3AG1 H;  3MMY B;  2VJ4 A;  2RKH A;  4HV6 A;  4BE1 A;  3H5N A;  3DTI A;  2JPC A;  4XR6 A;  4F3Q A;  1APL C;  1Y0U A;  3EUP A;  3BPX A;  3ZGK A;  3N05 A;  4DVY P;  3E6B A;  1XGN A;  5HLI A;  1XCV A;  3BRO A;  3I71 A;  1OCC H;  4A5N A;  2F5E A; 
#chains in the Genus database with same CATH homology
 3JRD A;  4NDL A;  2XGE A;  2NVT J;  4C2M J;  4BBS J;  1A5J A;  2D6Y A;  4Y52 J;  1MBF A;  3IH3 A;  3RZO J;  2CUE A;  3VVY A;  2JA5 J;  5EGO A;  1WH5 A;  2JK3 A;  1D5Y A;  3G1O A;  3NRG A;  2XRL A;  4A3I J;  5C4J J;  1H88 C;  1ETQ A;  3PM1 A;  3RZD J;  3BR1 A;  5BNG A;  1PUF B;  3ON2 A;  3DCF A;  1AKH A;  4MK6 A;  5FMP A;  3BR3 A;  2YS9 A;  1W0U A;  3E7L A;  1CQT A;  1UI6 A;  2RHA A;  3VPR A;  3PO3 J;  2W53 A;  3S15 J;  4LOC A;  4BXX J;  3HOZ J;  2LK2 A;  5C4Y A;  4QIW N;  2LD5 A;  2E2J J;  3IH4 A;  3S17 J;  1ENH A;  4M3E A;  2QTQ A;  3A01 A;  5EZH A;  5D1R A;  2K40 A;  2EZH A;  4ICH A;  5EFY A;  5DTD A;  1IUF A;  1VI0 A;  4G12 A;  3GTM J;  2HXO A;  5IYB J;  1S7E A;  5F0F A;  2GFN A;  2WUI A;  3HDD A;  4A3C J;  4JKZ A;  2K9Q A;  4DW6 A;  1JTX A;  2M8G X;  1SFO J;  2HQ5 A;  2ME6 A;  4GCT A;  1GV5 A;  1MNM C;  3C2B A;  1SGM A;  1UI5 A;  2WB1 N;  1A6I A;  2XB5 A;  3QKX A;  2QOP A;  3JSJ A;  3FK6 A;  2HDD A;  2L7F P;  5CW8 A;  3CDL A;  4W1U A;  4JL3 A;  2MW8 A;  4C3I J;  3ZQC A;  3FK7 A;  4CYC B;  1JKO C;  5E3N A;  1ETW A;  3Q0U A;  4B4C A;  3BTI A;  3OSF A;  5K58 A;  4DYR A;  5EDN A;  2IBD A;  2HYT A;  2W48 A;  2M2E A;  1H89 C;  2NS8 A;  2R5Z B;  1OCP A;  2ZCX A;  3LSG A;  3LSP A;  4JNN A;  1BA5 A;  1LFB A;  4JX6 A;  1AHD P;  2R7Z J;  4UDS A;  4FIS A;  3GTJ J;  3S1N J;  1H8A C;  1JT6 A;  2UXO A;  5E3L A;  2G7L A;  1GUU A;  4JX4 A;  3KNW A;  2R5Z A;  3AQT A;  5M3M J;  4AUX A;  3MNL A;  4I6Z A;  2DTZ A;  1UHS A;  3GTK J;  2H1K A;  3S2D J;  2DMT A;  1JKP C;  2DG7 A;  5E3M A;  2EZK A;  2DA7 A;  2O7O A;  2RAE A;  3G56 A;  3FKI J;  4C3J J;  1LE8 A;  2GEN A;  3SJM A;  2LLK A;  3CWR A;  2NX4 A;  2AHQ A;  3B6C A;  4V2F A;  1ZKG A;  2VPR A;  3Q0V A;  1UG2 A;  1OJL A;  5M5X J;  5F0C A;  4GFB A;  1IC8 A;  2OER A;  1MH3 A;  4IHW A;  1K83 J;  3E7Q A;  3F1B A;  3LNQ A;  1RES A;  2X9D A;  3HB9 A;  2Y9Y A;  5EF6 A;  1RET A;  3WHB A;  3BTL A;  2O9L A;  3VW1 A;  4S0H B;  1ZR2 A;  3KKC A;  3MN2 A;  2G7G A;  2L0K A;  3CMY A;  2PZ9 A;  2HKU A;  5IOY A;  4ABZ A;  3LSJ A;  1VF9 A;  5IYC J;  2YVE A;  2FQ4 A;  2UXP A;  2XSD C;  3CCY A;  1MSE C;  1POG A;  1RPW A;  3QQA A;  2Y30 A;  4M3B A;  1BW5 A;  4HNV A;  2NVY J;  5DAJ A;  2E2H J;  2UXI A;  4CGR A;  4IHY A;  3IV5 A;  2CJJ A;  1JTY A;  4M6V A;  1ZGW A;  1JJ6 C;  1DU6 A;  2V57 A;  4D7M A;  2XGC A;  2DA2 A;  2YUS A;  1TWF J;  5F0H A;  3HOX J;  2R92 J;  5IP7 J;  2Q24 A;  1FTZ A;  2DG8 A;  1MBG A;  5F08 A;  2TCT A;  1YRN B;  3G7R A;  5H9T A;  5IYD J;  3OSG A;  4XRS A;  3RQI A;  1O4X A;  1ZK8 A;  2VI6 A;  1ETK A;  2CU7 A;  3GTP J;  2ZB9 A;  2YVH A;  3HOV J;  3HOW J;  1G2H A;  5HOD A;  2Y0S N;  5C4X J;  1ZQ3 P;  3NI7 A;  4FE4 A;  4W97 A;  1ETX A;  3VUQ A;  1TWH J;  3BG3 A;  5EGO B;  3KKD A;  4A93 J;  2HXI A;  2ID6 A;  5IOZ A;  3BTJ A;  3F0C A;  1MBH A;  1JT0 A;  2ZOZ A;  4UUS A;  3RKQ A;  1F43 A;  4XRM A;  9ANT A;  3HKZ N;  2D5V A;  3B6A A;  1OFC X;  2ECC A;  3COL A;  2L7M P;  1T33 A;  3DPJ A;  2LY9 A;  3FIW A;  5EG0 A;  1B8I A;  2GM4 A;  3GTO J;  1P7I A;  2XDN A;  5IP9 J;  2LKX A;  4NN1 A;  2QKO A;  1U9O A;  5IPA A;  3L1P A;  3HOU J;  1QVT A;  2YU9 J;  3BRU A;  5M5Y J;  4IHV A;  2HI3 A;  3HE0 A;  5M5W J;  2JN6 A;  2EBI A;  2DMP A;  1VND A;  4J19 A;  5HBU A;  4HKU A;  2DMN A;  2DA6 A;  2KT0 A;  4JYK A;  4PXI A;  1HCR A;  2I10 A;  2DA5 A;  4M3G A;  2ZCM A;  4YZE A;  2CQQ A;  4QSH A;  1ETO A;  3RH2 A;  2JA8 J;  3VVZ A;  2X6O A;  2QCO A;  2Y31 A;  4AC0 A;  2HOS A;  3CQZ J;  2UXH A;  5J3L A;  5C3E J;  3VOK A;  1ETV A;  4D5F A;  2LR8 A;  3WHC A;  2KDZ A;  4DYC A;  3S14 J;  1ITY A;  3T6N A;  3FIS A;  3ANG A;  1TC3 C;  5E3O A;  1RKW A;  5EG0 B;  2VKE A;  3MKL A;  3SDG A;  1B8I B;  4GFK A;  3OOU A;  2XB0 X;  2QF7 A;  5JLX A;  3JRG A;  2HOT A;  4L5E A;  4A3L J;  5DS9 A;  3LJL A;  2L7Z A;  2NVX J;  3S1M J;  1I6H J;  2ELK A;  4A3D J;  3HTI A;  5CXI A;  3QBM A;  1PUF A;  3LOC A;  3JR9 A;  4A3F J;  5CXG A;  3I4M J;  2IEK A;  2MG4 A;  4MIM A;  2G0E A;  3HBL A;  2JA7 J;  3S2H J;  2NP3 A;  5K7F A;  2HOA A;  5J1Y A;  2REK A;  1BJZ A;  2M9H A;  2M34 A;  4A3G J;  3EGQ A;  1IDY A;  3BJB A;  3QPL A;  1Y1W J;  3TP0 A;  4BBR J;  3FRQ A;  3K2A A;  2JJ7 A;  2E2I J;  3BG9 A;  3VOX A;  5HAW A;  1MBK A;  2NS7 A;  1EF4 A;  4D5C A;  2DA4 A;  4EEF G;  4RDU A;  4UUT A;  4FE7 A;  2ID3 A;  3A03 A;  1WPK A;  1HDD C;  2RAS A;  2OF7 A;  3VVX A;  3S16 J;  2DMU A;  3IUV A;  1TWG J;  1HDP A;  2CQX A;  4ACI A;  2IAI A;  5FKM A;  3JRH A;  3OIO A;  1IRZ A;  2ZCN A;  4A3J J;  1JGG A;  2LTP A;  1UMQ A;  3HM5 A;  5J1R A;  5HSZ A;  3TED A;  1JUS A;  1T56 A;  5EYR A;  1MBJ A;  3GTQ J;  3HEF A;  1WGX A;  2GLO A;  2DA1 A;  1HOM A;  2PBX A;  2O7T A;  4GCL A;  2EH3 A;  4CYC A;  3S1R J;  2ME0 A;  1K61 A;  2G7S A;  3O8H A;  1JJ8 C;  3HIM A;  3K7A J;  3P9T A;  4BKX A;  3AQS A;  1WCM J;  3Q0W A;  3ZQL A;  4A3K J;  1W0T A;  2MGQ A;  5F04 A;  1IG7 A;  2L9R A;  3CRJ A;  3H0G J;  3BQY A;  2EZL A;  5FKN A;  4XRS G;  4AF5 A;  2E19 A;  5EZG A;  3O60 A;  3V6G A;  2B63 J;  2XPV A;  5FGL A;  4DZP A;  2CUF A;  2NVQ J;  3HTH A;  1X58 A;  2VKV A;  1GT0 C;  5GPC A;  2FJ1 A;  3JRA A;  2WGB A;  3NNR A;  5FKO A;  2DJN A;  4DYQ A;  1F36 A;  2XPU A;  4QTR A;  1FIP A;  4V2G A;  3JRF A;  4XIC A;  3TW7 A;  3GBG A;  5K7Z A;  3NAU A;  3MVP A;  1AKH B;  2GBY A;  3VIB A;  3LHQ A;  3QPS A;  3ANP A;  1I50 J;  3TP3 A;  3ZQG A;  1FJL A;  4BY1 J;  1FTT A;  2DMQ A;  3VW0 A;  3GTL J;  1DU0 A;  4M3F A;  3GZI A;  1B72 B;  2HYJ A;  1NTC A;  3LWJ A;  5FKK A;  3NXC A;  1IJW C;  1GV2 A;  3G1L A;  2COB A;  5J1U A;  2QWT A;  3I4N J;  3D1N I;  3JRB A;  5F1J A;  5FLM J;  1B72 A;  2F07 A;  2VUM J;  4BY7 J;  4JP0 A;  2CRG A;  2FD5 A;  3V78 A;  2PMZ N;  2G3B A;  1Z77 A;  2MSY A;  1ZR4 A;  2NOG A;  4NEL A;  1MBE A;  2P81 A;  4UUS B;  2QIB A;  3H3V K;  2M0C A;  3GTG J;  4MXM A;  1TWC J;  4A3M J;  1LE8 B;  4MFD A;  2JMW A;  2FBQ A;  4A3E J;  2EZI A;  2WV1 A;  1BW6 A;  2Y9Z A;  1SAN A;  2WAQ N;  3SFI A;  1AU7 A;  1QPI A;  3C07 A;  1TWA J;  3IH2 A;  3BCG A;  2AO9 A;  4X6A J;  4Y7N J;  2TRT A;  4XK4 A;  4GFL A;  1U78 A;  1YRN A;  1XS9 A;  1Z0X A;  3PO2 J;  1U8B A;  4B3A A;  3PPB A;  3A02 A;  3JRC A;  5D19 A;  4AYB N;  3KZ9 A;  4IEJ A;  1Y1V J;  3A01 B;  3HTA A;  3LSR A;  2EQR A;  3BR2 A;  2N8G A;  2E1O A;  1RR7 A;  2X48 A;  1X2M A;  1HLV A;  3M4O J;  2R5Y B;  5D18 A;  5AQC A;  1ORK A;  2ECB A;  3HGY A;  3HGG A;  4MLO A;  4DZJ A;  1E3O C;  3VW2 A;  4XID A;  3BT9 A;  3NAR A;  3GEU A;  2R5Y A;  2NP5 A;  3VP5 A;  1JKQ C;  5EEA A;  3BR0 A;  3ZOB A;  2LFB A;  1QVU A;  3BR6 A;  1FEX A;  3RD3 A;  3S5R A;  4AC6 A;  2OPT A;  5JLW A;  4FTH A;  1LFU P;  1IV6 A;  2JA6 J;  1NK2 P;  1I3Q J;  2LP0 A;  2XGD A;  3TW6 A;  4IHX A;  1QRY A;  1WI3 A;  3BG5 A;  3UKG A;  2LVS A;  1GDT A;  1XG1 A;  2DN0 A;  3DEW A;  3ZQI A;  4I76 A;  1R9T J;  3PAS A;  4MFE A;  1JKR C;  5GP9 A;  3BR5 A;  4JX5 A;  2UXU A;  2ZOY A;  1MSF C;  4A3B J;  2OI8 A;  3O8G A;  1ZTR A;  5M3F J;  2K9N A;  3W6V A;  4B1R A;  3ZQF A;  3BHQ A;  4A69 C;  4C3H J;  5IP6 A;  1HF0 A;  4M3D A;  1JUM A;  1U9N A;  3ON4 A;  4FCY A;  3CJD A;  1BL0 A;  1X2N A;  2R0Q C;  2JWT A;  5C44 J;  2XPW A;  4X1E A;  3BQZ A;  4D7N A;  1OCT C;  3B81 A;  4ME9 A;  5FHP A;  2DA3 A;  2K9S A;  4L62 A;  3HOY J;  5FKL A;  3HTJ A;  1JUP A;  1FIA A;  5FJ8 J;  4RBO A;  3S1Q J;  5GPA A;  1IDZ A;  1GVD A;  1MH4 A;  3Q3S A;  4MO7 A;  2Y2Z A;  3BTC A;  2H8R A;  1WH7 A;  2GUH A;  1IGN A;  3G1M A;  5FLV A;  1Q1V A;  4KWA A;  4GCK A;  3BNI A;  3M3Y J;  2IU5 A;  3ZQH A;  2R93 J;  1VFC A;  3JRE A;  1ETY A;  2FX0 A;  3JRI A;  3NPI A;  5F27 A;  1APL C;  3EUP A;  1P7J A;  1NK3 P;  1RKT A;  1XC5 A;  2O8K A;  5K7H A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...