1JUSA

Crystal structure of the multidrug binding transcriptional repressor qacr bound to rhodamine 6g
Total Genus 76
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
76
sequence length
186
structure length
186
Chain Sequence
NLKDKILGVAKELFIKNGYNATTTGEIVKLSESSKGNLYYHFKTKENLFLEILNIEESKWQEQWKKEQIKAKTNREKFYLYNELSLTTEYYYPLQNAIIEFYTEYYKTNSINEKMNKLENKYIDAYHVIFKEGNLNGEWSINDVNAVSKIAANAVNGIVTFTHEQNINERIKLMNKFSQIFLNGLS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HYPOTHETICAL TRANSCRIPTIONAL REGULATOR IN QACA 5'REGION
publication title Structural mechanisms of QacR induction and multidrug recognition.
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Transcription
total genus 76
structure length 186
sequence length 186
chains with identical sequence B, D, E
ec nomenclature
pdb deposition date 2001-08-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00440 TetR_N Bacterial regulatory proteins, tetR family
A PF08360 TetR_C_5 QacR-like protein, C-terminal region
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 1jusA01
1.10.357.10 Mainly Alpha Orthogonal Bundle Tetracycline Repressor; domain 2 Tetracycline Repressor, domain 2 1jusA02
1WI3A 2FD5A 2ME6A 3LSJA 2HYTA 3IH4A 3GTGJ 5EZGA 3ZQFA 5E3MA 1ZR2A 2JJ7A 5F0HA 1W0TA 1QPIA 4L62A 3FRQA 4ICHA 1F43A 2ZCXA 5HAWA 2CUEA 1IUFA 2JA6J 3M4OJ 2Y2ZA 3LJLA 1ETQA 1IG7A 2DMPA 1ETXA 4HNVA 1H8AC 2FJ1A 3RZOJ 2K9SA 3RKQA 1DU0A 1GDTA 3BR5A 3AQSA 1JT0A 5FMPA 1IDYA 3G1MA 2O7OA 2XGDA 4DZJA 3A02A 4A3IJ 5D19A 2XB0X 4A3BJ 2XGCA 3B81A 4BY1J 1BW5A 5FLMJ 3S1NJ 5EZHA 4AYBN 5IPAA 1DU6A 2W53A 1BL0A 3CJDA 2X48A 4JX6A 1FIPA 3JRHA 1AKHB 3Q3SA 3S2HJ 1OJLA 2K9NA 2E1OA 2R5ZA 2HQ5A 2GENA 3VVYA 5K7ZA 1D5YA 2DA7A 3TP3A 4GFLA 2NVTJ 1RETA 2HDDA 1QVTA 1JKQC 1RKWA 3P9TA 3G1LA 4HKUA 5M5XJ 3RZDJ 2UXPA 2QIBA 4JNNA 9ANTA 1LFBA 2LY9A 2H1KA 4FTHA 1B72A 4M6VA 1G2HA 3NNRA 3SFIA 5E3NA 2AHQA 2TCTA 2OF7A 5F1JA 4QTRA 3E7LA 2LFBA 1ZTRA 2YS9A 5JLXA 3VPRA 1Z77A 2FBQA 2PZ9A 3OSFA 4UUSA 1I6HJ 5EG0A 1H88C 1YRNA 5C4JJ 5J1YA 2DG7A 1P7JA 3JRAA 3TEDA 2JA8J 1O4XA 3BR1A 2HXIA 1JKOC 2B63J 4CYCB 2L0KA 1AHDP 2YUSA 1JUPA 2UXOA 4MLOA 5C44J 2CRGA 3ZQLA 4A3DJ 2LR8A 3HOYJ 1UG2A 3A01A 1U9NA 5BNGA 1ZGWA 2NP5A 3PO3J 1HF0A 4A3LJ 1U8BA 3Q0VA 3CRJA 1B8IB 4YZEA 3JRFA 3GTJJ 1K83J 3VOXA 1GUUA 2G3BA 3TW7A 4C3JJ 1HOMA 4Y7NJ 1FEXA 5DAJA 2ZCMA 3BQYA 2MSYA 3B6AA 3G56A 3MNLA 1VI0A 3IH2A 1T33A 3GTKJ 4L5EA 1AU7A 3M3YJ 3LNQA 3UKGA 2LLKA 3F0CA 3S15J 1GVDA 3BG3A 3EUPA 4A69C 3JRBA 4FCYA 2ECCA 4C3IJ 1RKTA 3WHBA 2K40A 1MNMC 3BRUA 1TC3C 1MBHA 3VP5A 1ZR4A 3LSPA 2G7SA 5FKKA 4NELA 2DJNA 2UXHA 1ETOA 3IH3A 4C2MJ 5F08A 4KWAA 3BNIA 1S7EA 2DMUA 4AUXA 2WUIA 4NDLA 3ON4A 2HKUA 3QQAA 1CQTA 2WV1A 1I3QJ 5FLVA 1OCTC 2JK3A 3JR9A 1IV6A 1MH3A 2R92J 1P7IA 2XPWA 4MFEA 1FTZA 3H0GJ 2QF7A 3S5RA 1U78A 4A3KJ 4X1EA 3L1PA 1ETVA 5C4YA 1SANA 2M9HA 1ZK8A 4ME9A 3JRDA 3BR3A 3AQTA 3ANGA 4MK6A 1POGA 5EGOA 1XC5A 2CQQA 1IDZA 4RBOA 3HOWJ 2IAIA 2LKXA 3PM1A 4C3HJ 1TWCJ 2EH3A 4UUTA 2DMQA 3CCYA 2E2JJ 2NVXJ 3ZQGA 2XRLA 1ETYA 3MKLA 2DA2A 1PUFA 2QOPA 3V78A 4X6AJ 4IHVA 4AC0A 1A6IA 1NK3P 1NK2P 4GCKA 3S2DJ 5DTDA 3RH2A 2DMNA 4LOCA 3VOKA 3GTOJ 1H89C 5E3LA 1APLC 1X58A 2XSDC 1GV5A 2VKVA 2ZCNA 4DYRA 2ECBA 3PASA 3JRCA 3LWJA 2VI6A 3HKZN 1TWFJ 3GTMJ 2ID3A 3GEUA 5F04A 3Q0UA 1FJLA 2ZOYA 5F0CA 2IEKA 4D7MA 4QSHA 2OI8A 4JKZA 3CDLA 3ZQCA 4CGRA 2NX4A 2R5ZB 3MVPA 4IEJA 3DPJA 1JGGA 2GLOA 1Q1VA 4G12A 2EBIA 5JLWA 1ENHA 4XRSA 2FX0A 4D5CA 3BR0A 1MBKA 1MSEC 2EZIA 4D5FA 5GPCA 2RAEA 2H8RA 4DYQA 4MO7A 3D1NI 3I4MJ 1MH4A 5FKNA 1B72B 4UDSA 2DA3A 3HEFA 3QBMA 3CQZJ 5IOZA 4GCLA 1FIAA 3NXCA 5K7FA 2CU7A 2R7ZJ 3BQZA 2LP0A 3JSJA 4XICA 1WH5A 4UUSB 1Y1VJ 1BW6A 5EG0B 1YRNB 1SFOJ 3S17J 3TP0A 3FISA 4MFDA 4BBRJ 3DCFA 3JREA 2DA5A 3HBLA 1X2NA 5IP7J 3RQIA 4JYKA 2G0EA 3ZQHA 4GFBA 3OIOA 4S0HB 2WGBA 2HI3A 1OFCX 2NP3A 3HTIA 4BXXJ 4M3EA 3S1RJ 5HSZA 1ORKA 3S16J 1ETWA 3KKCA 3BTIA 2HOTA 4J19A 1LE8A 3BT9A 4XIDA 2LD5A 1GV2A 2E2HJ 1K61A 3S1QJ 3ANPA 5IP6A 5CXIA 3O8GA 2ZB9A 3S1MJ 2L7FP 3HTHA 1JT6A 3V6GA 2JA5J 2CUFA 3WHCA 4IHXA 3QPLA 2NVQJ 1GT0C 3NRGA 2LTPA 2HYJA 2VKEA 3QPSA 4I76A 5GPAA 2V57A 4A3FJ 4I6ZA 2OERA 2ELKA 3F1BA 4GFKA 1HDDC 2YVHA 1ZKGA 4B3AA 3OSGA 4A3CJ 2LK2A 2CJJA 1RR7A 3BCGA 2O9LA 2WAQN 2R5YA 4XK4A 5F27A 5FKMA 5J1UA 3BR6A 2JA7J 4IHYA 2ID6A 2L7MP 3KKDA 3GTQJ 4V2GA 2Y30A 3HTJA 2QTQA 4AC6A 5HBUA 1JUSA 2ME0A 3G1OA 1TWGJ 2FQ4A 5J1RA 1ZQ3P 1EF4A 2HOSA 2EZLA 4FISA 5D1RA 2M8GX 1QVUA 4M3DA 2M2EA 5EEAA 4RDUA 1LFUP 5C3EJ 1U9OA 3VVXA 3VIBA 3NPIA 1ETKA 5EDNA 3HDDA 3K7AJ 3JRIA 5EGOB 3QKXA 3NI7A 3H3VK 2XPVA 1RESA 2Y9ZA 2F07A 2REKA 2XPUA 2GBYA 2LVSA 4IHWA 3HGYA 3O60A 1XS9A 2VUMJ 2EZKA 4PXIA 2DMTA 3A03A 5H9TA 2L9RA 4V2FA 2DA1A 2O7TA 4M3BA 2QCOA 3NAUA 5M3FJ 1PUFB 1E3OC 1HCRA 5AQCA 2DN0A 5J3LA 2CQXA 3HTAA 2NS8A 3O8HA 1JTXA 3IUVA 1RPWA 5IYBJ 2UXUA 3LSGA 1Y1WJ 1JKRC 3T6NA 2YU9J 5FKOA 3HOXJ 2HXOA 3BHQA 1T56A 5EYRA 2M34A 2IBDA 4A3EJ 5M5WJ 1IJWC 2Q24A 5F0FA 4A93J 4B4CA 3BG9A 1WCMJ 3MN2A 2Y9YA 5FJ8J 4W97A 1MBJA 4NN1A 2Y0SN 3KZ9A 4JX4A 3C2BA 5CW8A 5FHPA 2UXIA 5K58A 5M3MJ 3VW1A 2KDZA 1WGXA 4BKXA 3FK6A 4DW6A 1AKHA 2X9DA 2QWTA 2MW8A 3BG5A 5GP9A 4M3FA 2RHAA 3PO2J 3EGQA 2DA6A 2P81A 5M5YJ 1VFCA 3GZIA 4XRMA 5IP9J 5EF6A 1R9TJ 2YVEA 1WH7A 4QIWN 3SJMA 1IC8A 5IYDJ 2GUHA 2W48A 2KT0A 3NARA 3BTCA 5C4XJ 1JJ8C 2PMZN 3HOVJ 2NS7A 4A3GJ 2R0QC 2XDNA 5K7HA 4Y52J 2NVYJ 4AF5A 2MG4A 3HOZJ 3COLA 2M0CA 2D5VA 4W1UA 3GTLJ 2K9QA 5IOYA 3VW0A 5HODA 1FTTA 4MIMA 2X6OA 3A01B 1JJ6C 2HOAA 2DA4A 2DTZA 4BY7J 4B1RA 2GM4A 2EZHA 1IRZA 3TW6A 1MBFA 2G7LA 1NTCA 1LE8B 1XG1A 1A5JA 2IU5A 1VF9A 2O8KA 4CYCA 3PPBA 2N8GA 2EQRA 1BA5A 3W6VA 1IGNA 2MGQA 2RASA 3HIMA 3HE0A 2D6YA 3BTJA 4EEFG 2R93J 1HDPA 1UMQA 3FKIJ 1W0UA 1MSFC 2WB1N 1SGMA 4JL3A 3BJBA 3SDGA 1B8IA 1F36A 5FGLA 4MXMA 3GBGA 1UI5A 1QRYA 3G7RA 3VUQA 4ACIA 3ON2A 4FE4A 2GFNA 4M3GA 2JMWA 3HM5A 1TWAJ 2XB5A 3OOUA 2Y31A 3K2AA 2AO9A 1TWHJ 2R5YB 3GTPJ 3I4NJ 2QKOA 1JUMA 3S14J 3RD3A 4D7NA 2COBA 3JRGA 1MBGA 1OCPA 3HOUJ 2G7GA 3C07A 2JN6A 1MBEA 4A3JJ 1I50J 4JX5A 3LOCA 1JTYA 3HGGA 2PBXA 1UHSA 2VPRA 5D18A 5CXGA 2XGEA 3KNWA 3VW2A 3IV5A 3VVZA 4BBSJ 1JKPC 4DZPA 3CWRA 1WPKA 4A3MJ 4JP0A 2ZOZA 3Q0WA 5EFYA 1VNDA 3B6CA 4DYCA 1Z0XA 4FE7A 3HB9A 3E7QA 2I10A 3BR2A 3BTLA 3FIWA 3ZQIA 1BJZA 3DEWA 2TRTA 3LSRA 2L7ZA 3CMYA 1X2MA 5FKLA 2E19A 5DS9A 3FK7A 2OPTA 4XRSG 2NOGA 3ZOBA 1ITYA 5E3OA 1UI6A 4GCTA 1HLVA 2JWTA 2DG8A 3LHQA 5IYCJ 2E2IJ 4ABZA
chains in the Genus database with same CATH superfamily
2QYOA 5HS7A 1F1ZA 2FSWA 1PDNC 4OMYA 1MJAA 2HYTA 1WSUA 1DPRA 5EZGA 2DODA 3IHUA 2QUFA 3ZQFA 1F9NA 5GAHJ 2JJ7A 5F0HA 1W0TA 2MD0A 3D0SA 4L62A 2O3FA 3FRQA 2F5EA 3L00A 3SEZA 2JUGA 2VIXA 3DKWA 2JA6J 1FSEA 4EM2A 3M4OJ 3LJLA 2DMPA 3K4MA 2OD5A 1ETXA 4LLGF 3RKQA 2W00A 1ERDA 1GDTA 1TQIA 3KEQA 4E70A 2DDAA 3ECOA 2XGDA 2P8TA 4DZJA 3NEUA 4ZH4F 2Y0SA 3B81A 4BY1J 3DU5A 1BW5A 2WTEA 5EZHA 3LSHA 3HUGA 3JRHA 3WG9A 2RQPA 3QP5A 1W7PB 4RAGA 4ZZLA 2R7RA 3SEQA 5CVIA 1XGMA 3E6BA 2XVCA 4NQWA 1KYZA 4HG2A 3CJQB 3FXUA 4MQVA 4NC7A 3S32A 5J8FA 2HDDA 5TJJA 2FOKA 1JKQC 3CCQI 4XSZF 4KT5C 5E1XA 5IYCJ 4IOAF 4M9XA 2EA4A 2A3SA 2UXPA 4JNNA 2LY9A 4FTHA 4EATA 1TL8A 3NNRA 2BGCA 3JAMK 3H92A 1KONA 3PIOF 5F1JA 4QTRA 5HVQC 3FXMA 1ZTRA 3U9GA 2PZ9A 3HZJA 3QPTA 3S8PA 3OSFA 2KRFA 3KP6A 2FA5A 3EUHC 1YRNA 3F8NA 3R60A 5C4JJ 2FOWA 1P4XA 3RDIA 4LLLA 1FOWA 1P7JA 1R1TA 3RI4A 5AIPA 2EA2A 1EJ9A 4MHGA 1D0XA 1SVOA 2LF8A 2RV8A 3DFGA 3PQJA 1MW7A 1JUPA 1TQMA 1AOYA 4MLOA 1ULYA 2R4GA 3I4PA 3ZR8X 4DOZA 1UG2A 4L9TA 2NP5A 2DW4A 4LGWA 1RNLA 2K4BA 2QENA 5IT9Z 1X4OA 3CRJA 2L3DA 2K27A 1Z3XA 2XSJC 3JRFA 4RB0A 4YIFA 3OV8A 1HOMA 1FEXA 3LSIA 2ZXHA 2W4SA 3V8KA 4WXDA 1WHUA 2F5VA 1W36C 3CCRI 3BQYA 3PJRA 2ZCMA 4WIBA 3KZYA 4HQMA 1I1SA 1L0OC 3V7RA 2GWRA 3AL0B 3MNLA 2KJCA 3VOEA 3M3YJ 3UR3C 3F0CA 5B1AH 2K7LA 4A69C 2ECCA 4C3IJ 3WHBA 4EGYA 2JRMA 4A5MA 1MBHA 4ZYHA 2WAEA 5H6RA 1BI2A 1ZR4A 5GAGJ 1S7AA 3FXQA 5LHHA 5LRRA 3IH3A 1BJAA 4QLCU 3CD6I 4KWAA 2DMUA 2NNNA 3FXRA 4NDLA 2HKUA 3K1PA 3WG7H 1J09A 5FLVA 2JK3A 2P6TA 3KIOA 1MH3A 3ZMZA 4D1QA 2R92J 2ZNYA 3WTZA 2XPWA 4HYEA 1VQLI 1FTZA 2ISZA 4I7HA 1J7KA 1W5CC 5FLXK 3U1DA 3DWLE 4EM0B 2M9HA 3F8FA 3W6JB 2KZVA 2HYFA 3AQTA 3CDIA 5EGOA 1XC5A 4RBOA 1RRJA 4Y13A 2ZSIB 3EQLF 1Z05A 1T0FA 3EPZA 6PAXA 3I0TA 1V5FA 2DI3A 3F72A 3FHNA 5J4YA 4UUTA 3KYDB 4M74A 4OD5A 2GAUA 2E2JJ 3MEXA 5DCFA 5FFZA 4HRIA 3MKWB 3IAM2 4L0ZB 2DA2A 3WTWC 2IJLA 5IT3A 4PFPA 4IHVA 3S93A 4GCKA 1J9IA 1B1BA 2FF4A 2DMNA 3QYBA 4ENJA 4BGDA 3OYLA 2KJBA 3IP4B 4HA8A 2KISA 2ZCNA 4FETA 5LGUA 3VYSB 4AIDA 3JRCA 2W1OA 3LWJA 1S9HA 3GTMJ 2P5KA 1SC7A 4D9JA 2VONA 3ASOH 4D7MA 4Y4RA 3CDLA 2OQRA 4CGRA 4JQFA 3BZKA 1Q1VA 2K02A 2EBIA 4XRSA 2PLYA 1BN5A 4PUSA 2FX0A 2A05A 3BR0A 5DDGA 4O3MA 4OU0A 2OTJI 2RAEA 1HKSA 2CFOA 1XPXA 5CVUA 4P9UA 1BBYA 5KAFC 2YVXA 2DU9A 2KL4A 2DA3A 3K10A 4OAYA 5EJCA 2A6HF 2GZWA 2MA3A 3BQZA 5GTHC 1R49A 4XICA 4UUSB 3CCSI 2R7FA 3G2BA 4MFDA 2I8DA 4P55A 3KE2A 1BI0A 3JREA 1VQPI 2DA5A 1X2NA 2PJRB 3E97A 3GYHX 1P4WA 3HXLA 4YG2F 2CFXA 2WGBA 3OYIA 1Z6TA 4BXXJ 4M3EA 1N75A 1Y0UA 2HPIA 2H1LA 1ETWA 3KKCA 2HOTA 4XIDA 1OCZH 2A2FX 2E2HJ 5TGTA 2XC7A 1Y8QB 1QA6A 5CXIA 5A2QK 2WA0A 5E79C 4IVNA 4XKWA 3I56I 1K7AA 3S1MJ 4RM3A 3DBHB 5D4SA 1RUNA 2E7WA 2LREA 2MC3A 4DNCA 4ZYDA 1FOKA 4PJJA 4I76A 2JPBA 5GPAA 2DOFA 3DBRB 4D0PA 3WTSC 3E6DA 4E7KA 1WZ2A 1KU7A 2P7VB 2HQNA 1EKEA 1HDDC 2YVHA 1ZKGA 4B3AA 1FBUA 5DM7F 4E4HA 1IXSB 3ZQ7A 1MMDA 3BLYA 2IP2A 1SD6A 1D1AA 1LNWA 3BR6A 3D5LA 2R7DA 1JI8A 2ID6A 4A0YA 3GTQJ 3CZ6A 3NWSA 2XIGA 2Y30A 2R7UA 3LFUA 4N9IA 1P6RA 1RIOH 2QTQA 5HBUA 2FE3A 2KRCA 3AG1H 5TRDA 4M9SA 1D5VA 2PMHA 3WTUC 1H9GA 2EZLA 4FISA 1EF4A 4M3DA 2M2EA 3F8CA 5EEAA 1FOXA 5C3EJ 2CH0A 3ABLH 1M1EB 3M8JA 5LGNA 5LEJA 3NPIA 1ETKA 4PZJA 5EDNA 3DTIA 3NI7A 2ICWG 2Y9ZA 2F48A 2F07A 1LVKA 1S29A 4RGRA 1LDJA 4BQQA 5FD6A 4LK0F 1X1PA 3KEYA 3KEOA 3KP4A 2Z2SB 3NAUA 3ZXSA 2LG4A 5M3FJ 2XAHA 1PUFB 1B4AA 2DFHA 3SXYA 3BP8A 3SZGA 3V7CA 5FROA 5L3FA 4UNOA 3JSPA 2NRAC 3IUVA 3WE3A 1WJBA 1RPWA 5IYBJ 4ESFA 5LHIA 2LF7A 3HRMA 3S3NA 5ICFA 1FC3A 1UAAA 4WXHA 1SAXA 3RYPA 1X3UA 5AONA 2UV1A 1KQ9A 3PNVA 1T56A 3BHQA 1KGSA 4BXUA 4ZYEA 5FGMA 5BPDA 3OR2C 4WF2A 3FMSA 3GFIA 4M6YA 2DFIA 5FJ8J 4E7HA 2Y9YA 2L01A 1U5TC 1S6LA 1W1WE 2DT6A 3C2BA 3J80Z 5FHPA 4HNUA 3F3XA 4FASD 1SAUA 4AM3A 4CYDA 4EJVA 2IS2A 3HC7A 3KP5A 2QWTA 3BG5A 1OYYA 5BPIA 2GXBA 3IL2A 1LJ9A 1J5YA 4XM3A 3BG6A 4YIIA 3OS0A 4A0XA 4B44A 4CXFA 2HR3A 3L2WA 4A6EA 4CSWA 2W48A 1T98A 4Y33A 2HOEA 3BTCA 4RLFA 1O3QA 2PMZN 2XGXA 3TQNA 2ESNA 2EK5A 2R0QC 2A6EF 3K4CA 4RM2A 3SYTA 4LG0B 1U0JA 4LIVA 3PQKA 2EB7A 4KYWA 4AF5A 2J5PA 2KHMA 2BZTA 3CF2A 3T8RA 3WTTC 4W1UA 2L02A 1X3WB 3TDZC 3E5QA 5HODA 1FTTA 4MIMA 2DA4A 4BJ5C 1O7FA 2EZHA 2FBHA 1IN5A 1YX5A 4KN4X 2ZXWH 5L3BA 1Q1HA 1VF9A 2O8KA 1TW3A 1X3ZB 3HSEA 4CYCA 1XMAA 3L2CA 1G3TA 2ADUA 1YHQI 3TOAA 4M72A 5J47A 2RASA 2A61A 1U8RA 1NHAA 1U6GA 1W0UA 3RQ4A 4HX4A 2OC6A 5E1ZB 2EFQA 3I58A 4BXFA 1VQOI 3G7RA 2IS1A 3C3WA 3ON2A 1IXCA 2GFNA 4C2MA 2VPLA 2JMWA 3HM5A 3IWFA 3VDXA 4AVPA 1A36A 3VB2A 2XB5A 3L2VA 3NWTA 3OOUA 2KRHA 2HEOA 2QKOA 2EV0A 4C9YA 1UHMA 2NS0A 3OYGA 2Z3YA 2VXDA 1RI7A 3GF2A 4U9LA 3R61A 1OCPA 2G7GA 4KIFA 2RNJA 1STZA 3FX3A 1I50J 4JX5A 1PUEE 1OCOH 1JTYA 4BE2A 2VPRA 5D18A 3LA2A 2P0WA 1J75A 3GCMA 2JPCA 4U88A 3VVZA 4BBSJ 4OAZA 1JKPC 3CWRA 4A3MJ 4JP0A 3HL2A 1YJNI 1VQ6I 2ZOZA 3B6CA 2WADA 4FE7A 4G94A 1CF7B 3HYIA 3DKXA 5DCMB 3CUOA 3BTLA 1OCRH 1QNTA 1YG2A 2V1XA 3OYEA 4HEA2 5BOXA 2P7CB 2BW3A 4RGSA 3IWZA 2ZMEB 1LPQA 2M7BA 5DS9A 3F6VA 4YELA 2OPTA 5B5EC 4CICA 4C30A 1LFPA 1HLVA 2VJ4A 2D2WA 2DG8A 2ELHA 3LHQA 3K4BA 1WVRA 2FD5A 2IPQX 2QQ8A 4BQNA 3IH4A 3GTGJ 2CW0F 3PNYA 1ZR2A 3HPHA 4PSWA 1I27A 3I64A 2JVGA 2H6BA 2EV5A 4ZZDA 2E36A 1IUFA 2DT5A 3DLLF 1B59A 3DTKA 3BPXA 1RZ4A 2MD5A 1DUXC 3ZMDA 2JQ7A 3E6CC 2W25A 3BR5A 1JT0A 1IDYA 2O7OA 2QVOA 2HPMA 3A02A 2XB0X 1T95A 4A3BJ 2H8WA 1V55H 2X85A 3S1NJ 5TISC 1QO0D 3I55I 2BE5F 4AVZA 1DU6A 2CO5A 3V42A 1BL0A 2XAUA 1KA8A 1AKHB 4ENNA 3LSMA 1NG6A 2E1OA 2YPRA 3OYFA 4MGRA 2GENA 4HV6A 2EWNA 3BWGA 3VVYA 1HXDA 2RC4A 1HW2A 2STWA 2NVTJ 2AS5F 3P9TA 1KU3A 3ML6A 4HKUA 5ED4A 5DD4A 2EV6A 3RZDJ 2R7SA 3E1SA 2QIBA 1LFBA 3O6BB 4HNTA 2QQ9A 1FZPB 3ROUA 3SFIA 3CUQC 2VB6A 2IGKA 2VKDA 4B43A 2OF7A 2E5NA 3E7LA 3W2WA 2LFBA 3VWBA 2B1EA 3HG9A 5BMZA 1SVMA 3ZN0A 2O61A 2ETHA 1ZAOA 2F5CA 2X1CA 3K4NA 1VQ7I 2DG7A 4XLAA 3TEDA 1O4XA 2QQBA 3BR1A 5CLSA 3OS2A 2HXIA 1JKOC 2L0KA 2IT0A 2EPFA 3JW4A 3ZQLA 2OZ6A 3BJAA 4WCGA 3HOYJ 1VQNI 2WB1A 2BXYA 3B73A 3A01A 3V8LA 2JUCA 2MFZA 1QGPA 1FYLA 3R4KA 2Y48A 1G3SA 2O0YA 3L9FA 2HVQA 2FMLA 3ONQA 1XGSA 5E1WA 1QHHD 1WJ5A 1R7JA 5DAJA 4YFXF 5EEHA 1Z91A 1VI0A 4E7JA 5CKTA 2IS6A 2E35A 3IH2A 1ZRDA 4BU2A 2W57A 4Q5SF 3GZ5A 3UKGA 1V3FA 2LLKA 3S15J 1GVDA 3BG3A 3O2PE 2R3SA 1V5GA 3JRBA 4FCYA 5HDKA 1TC3C 3VP5A 1IF1A 4OD4A 3LSPA 2G7SA 2PQ8A 3OYKA 1SFKA 2DJNA 1G3WA 2F4IA 3K4JA 3J81K 1ETOA 4C2MJ 2WAFA 3ASNH 5F08A 4DIQA 1S7EA 3BNIA 3ZMUA 1OISA 1YJWI 3QQAA 1CQTA 3OR1C 1I3QJ 3QOEA 3FM3A 1BI1A 4DGWB 1FBQA 4PK4A 4ENMA 3PSFA 1P7IA 3BY6A 4OMZA 1EV7A 4BQOA 2H6CA 3V8JA 1VTNC 4A3KJ 2DPUA 1I39A 3L1PA 1ETVA 2RDPA 1SANA 4JK1X 1IAWA 4ME9A 4E7IA 3QOPA 3IRQA 3QODA 4MK6A 3DV8A 3GFLA 2CQQA 3K4LA 3GO5A 4CZCA 1NH3A 1ZLJA 2D45A 1P4AA 2ZBKA 4C3HJ 2E1MB 2EH3A 2Y69H 3LMMA 3FBNB 4XRFA 4ZDLA 2L9NA 2KIUA 2KZGA 3EUHA 2VQGA 3MKLA 4QPOA 2OJED 3F8BA 4C2UA 4F52A 4X6AJ 1A6IA 5HS9A 2X4HA 3VEPA 1NK3P 5DTDA 3GTOJ 1H89C 3FZVA 2JSCA 5E3LA 4IRIA 2XSDC 2V9VA 1MMGA 1GV5A 2O03A 1YW7A 3PASA 3KX2A 2VI6A 3HKZN 2LKSA 3HUGB 5CVRA 2ZOYA 2DBBA 2Q8KA 2BY2A 2NXNB 4JKZA 2LOOA 3P9CA 3MVPA 4ENKA 1JGGA 4G12A 4NQWB 4ITVA 1ENHA 3LSTA 1IXRC 4BHCA 5D8KB 3CMMA 4CH7A 1Z21A 1MSEC 2EZIA 4D5FA 2BVMA 5GPCA 3WGGA 2H8RA 1T08B 2FRHA 4MO7A 3D1NI 3S2WA 3I4MJ 1SD5A 2V4JC 4OWRB 4UDSA 4HV5A 3HEFA 1H9TA 4HF0A 1FMVA 4UVAA 3NXCA 2HZTA 4PJLA 5K7FA 4IOCF 4IPAA 1BW6A 4OIRF 2OBPA 1YRNB 1JXSA 2FBIA 2LSOA 3CJNA 3TP0A 3ULQB 4H4KC 3FISA 1FP2A 2XAFA 5D5XB 4XMYA 4UUVA 2EINH 3DCFA 1QU3A 5KVRA 4LD5A 3DPLC 4UB6C 3BOQA 4RLQA 4JYKA 3ZQHA 3Q5FA 3NS4A 2WY7Q 1T39A 2DOEA 2XDVA 4IHTA 4B48A 2EIJH 4XKCA 3S3OA 3AG3H 3S16J 1LE8A 2F5FA 3BT9A 4I02A 1GV2A 2LD5A 2K9LA 4N9HA 1BI3A 4IRGA 4I0AA 1X4PA 4XKVA 3O8GA 2ZB9A 3D5RC 1W7PD 3OYDA 3GZNB 4Z6YA 3E5UA 4GRIA 4IHXA 1Z6RA 3QPLA 3HOTA 5D5VB 1EH7A 4F93B 2J5OA 1B9NA 3NRGA 2ISYA 1ZREA 2DXIA 2E5ZA 4HAMA 5LRSA 4LB5A 2V57A 1FNNA 1K4SA 4XL9A 4ZYAA 4DBRA 4A3FJ 1PP8F 2X6WA 4L5JA 4WK8F 4AWXB 3F1BA 3I59A 4GFKA 2LK2A 4EJWA 3BZ6A 2VQHA 4PCQA 3BCGA 2DAOA 4RGUA 2FBKA 2V79A 2GIVA 2M4KA 4XK4A 5F27A 5GAEJ 2DPDA 4HLYA 5FKMA 5F6FA 2CV0A 2XRNA 1IUYA 1TQPA 2L9VA 2IGMA 4N4OB 1XB4A 4AC6A 1I5ZA 2VBWA 3M7GA 3CCLI 2ZJ2A 2ME0A 2EILH 1O57A 2KQRA 1BC7C 1TWGJ 1I1GA 2CGPA 4WXCA 1ZQ3P 5J8CA 2HOSA 4GO1A 3FXOA 1QVUA 5HLGA 3HPGA 2QA4I 2W84A 4UVBA 3ERMA 3VIBA 3AG2H 5JHFA 3H5AA 2WWYA 3K7AJ 4XBFA 3DEEA 5EGOB 3QKXA 3FMRA 3H3VK 1HA8A 3CLQA 2XPVA 1R5HA 4PSXA 4IL6C 1YIOA 3AKZA 4BQAA 4CGZA 3GXOA 5JHUA 4KT6A 4PXIA 3TO9A 2CWEA 5D6EA 2E71A 2EFWA 2L9RA 4LMYA 2QZ8A 4V2FA 3TKYA 4KMUX 3QYEA 3IC7A 2PG4A 4M3BA 2CQ7A 4DJAA 2K4JA 1E3OC 1HCRA 3MFKA 4MTEA 2A5WA 1Z3YA 1X1AA 5IY5H 5ICCA 1MD0A 1AA7A 2ZKZA 3AL0C 1DDNA 4BDYA 1JKRC 3T8TA 2YU9J 4F7ZA 4RMNA 5EYRA 2M34A 1BR2A 4A3EJ 3MZYA 4HX7A 2Q24A 5F0FA 3I71A 4ESJA 1USSA 4A93J 1FOYA 4B4CA 3MN2A 5CVVA 1BOBA 1MBJA 4W97A 3E3VA 2QQAA 3RSNA 4E7SA 1GXPA 4N4NB 2AXTC 2Y0SN 1PYVA 1UELB 2OQGA 3KZ9A 1IN7A 5CW8A 4NBQA 1REPC 2HQAA 1ZHFA 3VW1A 4G8XA 3LSKA 2E7XA 2P5LC 1MJBA 3HOSA 4Y3OA 2X9DA 2RHAA 3CJTB 3PO2J 2P81A 1D8KA 5M5YJ 3GZIA 4M73A 1WH7A 4QIWN 3DXJF 5KCMA 3SJMA 3CC2I 3SWHA 2GUHA 3NARA 4ESBA 5C4XJ 2PMZA 3HHHA 3NQOA 1IW7F 2CQKA 2PMUA 3M9AA 2FU4A 5K7HA 2LYCA 4Y52J 3REOA 3CLOA 2MLGA 2NVYJ 2MG4A 1SFEA 3OMYA 3COLA 4YIRX 3A0BC 2M0CA 5HDNA 3GTLJ 1O3SA 4II3A 4P5OA 2X6OA 1K79A 3B02A 2ZC2A 4BY7J 2G7LA 1NTCA 3FXJA 2PFVA 1XG1A 4ON0A 4QPQA 3C2HA 1IRFA 5LLQA 2CW8A 3HTUA 4LITA 4ANJA 1QQIA 4FX4A 2DT7B 5JR3A 4HBLA 4RAYA 3TO6A 2VT2A 4BAYA 1S8NA 4EEFG 2R93J 1YO5C 2EFNA 3JAMZ 1R36A 3BJBA 1B8IA 3S3MA 3FDYA 3QWLA 3WU2C 3GFMA 1XGOA 1QRYA 2KDOA 3VUQA 2M4GA 3ABKH 3CCEI 2M7AA 4FX0A 3F9KA 4M3GA 4FQGA 1WWXA 5DUKA 2WAQA 1TWAJ 5E20A 1LEBA 3ZCOA 5ILSA 2MBFA 3BJOA 2Y31A 3HRSA 4XNFA 1RUOA 1JUMA 3S14J 2COBA 1MBGA 3KYCB 3F23A 1UG0A 2KKOA 3HOUJ 3MKYB 1FYKA 1TZLA 1MBEA 2IA2A 3ABTA 1ZRCA 1U5TA 3LWFA 5B3SH 5ILVA 5B1BH 3LQRA 3IRRA 4ZDOA 1UHSA 3ZP5A 2JTVA 2ZY9A 4EM1A 2XGEA 3HTSB 4A0ZA 1DGRM 1UZCA 1SFUA 4G7HF 1WPKA 1SD7A 1XDUA 2LC2A 1G3YA 4XOTA 3CC4I 1T6SA 4HF2A 4BACA 3ZQIA 1R5GA 4L9JA 3RJPA 2EJRA 2L4MA 1X2MA 5FD5A 2E19A 4XRSG 4RA2A 2PX9A 3ZOBA 1ITYA 5E3OA 4GCTA 2L2OA 2KIFA 2FNAA 2V1DA 2GQQA 3H9QA 2ME6A 3LSJA 4EMSA 2B7EA 1Y0NA 5CPRB 5E3MA 1YITI 4BNCA 1IRGA 3W2AA 1QPIA 1B9MA 1YQAA 4UXNA 4IJAA 3L7WA 1F43A 5HAWA 1LUJB 4F55A 2Y2ZA 1ETQA 1A04A 3H5NA 4XN0A 3AG4H 4HNVA 3H3ZA 2NNYA 1H8AC 2FJ1A 3RZOJ 5HLIA 1R5ID 2ACJA 1DU0A 1XCVA 3TBIA 3FXLA 2G7UA 5D19A 5DUIA 2XGCA 2KFDA 3SZTA 2E34A 4OOIA 5FLXZ 1ON2A 2HTSA 2DK5A 4CHUA 4AYBN 5IPAA 2CV1A 4CCOA 3SQNA 3QYFA 3SHFA 2Q0OA 3ZGKA 3Q3SA 3S2HJ 2Q2EB 2XAJA 2HQ5A 2MLKA 2R5ZA 5LFAA 5D5UB 5K7ZA 3BZCA 1D5YA 3OIPA 3TL4X 3TP3A 2VOPA 1RETA 2ZNZA 5ERIA 5M5XJ 2XF5A 4I98B 2H1KA 1ODDA 1B72A 2XKOA 1G2HA 2XAQA 2OAZA 3GEZA 2AHQA 2TCTA 1D1BA 3RCOA 3PNTA 1F5TA 2KMUA 2Z9OA 5F64A 1S3JA 5JLXA 3VPRA 1Z77A 4IRVA 3A2KA 3LFKA 4IX7A 1A35A 2V1UA 5EG0A 2QLZA 3COAC 1H88C 2L4AA 2P4WA 3DTEA 3Q9VA 4GYGA 1LEAA 2R7VA 2V9PA 3GLXA 4CYCB 1QHGA 2GIZA 2Q1ZB 4NC6A 2X6XA 5CYVA 1IZ1A 4A3DJ 3H35A 5CQEA 1YFHA 1ZGWA 3PO3J 1HF0A 3I3LA 1IV8A 2FMYA 3Q0VA 2HKOA 2OCCH 2Y75A 1OKRA 1OCCH 3GTJJ 3RIRA 2HNHA 1MDMA 1GUUA 3VOXA 4L5IA 2ZXIA 4Y7NJ 4BEHA 1BR1A 3WU1B 5HLHA 2MSYA 3H9GA 3B6AA 3G56A 2CG4A 1T33A 4Z2YA 1VQ5I 2LY1A 3GTKJ 2VC0A 2RGVA 5FB2A 3SFZA 2RKHA 2HU9A 1C0WA 4DQ2A 2FXAA 1FMWA 3EUPA 1WRJA 4Q48A 1MNMC 3BRUA 2CUJA 1ZN2A 1XSXA 3KLNA 4XLFA 2NOJB 2FEZA 3MMYB 1G6NA 4XN3A 2UXHA 5A2QZ 2XAGA 2FNPA 1ACIA 3D5SC 4UHTA 2WUIA 3WU0A 3ON4A 1YOVB 3H1CA 1OLTA 2M3AA 1PJRA 2GA2A 1Y39A 1OCTC 3U2RA 3I53A 3JR9A 4ZTFA 1IV6A 4C2TA 2VLAA 5K5OA 2QKLB 1EA3A 4Y15A 4S05A 2BW3B 2XHKA 3RTRA 1V54H 4MFEA 2KLOA 3H0GJ 2QF7A 3S5RA 3U1KA 3MQ0A 4X1EA 5C4YA 5ICGA 1ZK8A 1QBJA 3BR3A 4RAFA 2HTJA 2NAZA 4LLNA 2ZJQF 5DEQA 4UV9A 1YS6A 1BIAA 2DLLA 2LRDA 1IDZA 3CJRB 3HOWJ 3CUQA 2IAIA 5B66C 2STTA 2H94A 4O6JA 3K8PC 4YEJA 1GLNA 1TWCJ 1DP3A 4LB6B 3ZQGA 4MEYF 4ZJZA 5DM6F 5D8LB 1ETYA 1Z9CA 3OYJA 4ZDPA 2F4OB 3FXKA 1PP7U 1VQMI 3V78A 1HW1A 1BIBA 5GADJ 3S2DJ 2AQEA 5J6XA 2JA2A 3K9TA 1R22A 1X58A 2QGUA 4G7OF 2ECBA 1N77A 1BM9A 3EDPA 2W85A 3HKZA 1A31A 1R6RA 2ID3A 3Q0UA 2EFOA 4NB5A 2LY2A 5F0CA 1ZARA 2IEKA 2UXXA 2OI8A 3A0HC 4XLCA 3ZQCA 5FRNA 4IEJA 4L9VA 2GLOA 3RPUA 3LQQA 5JLWA 5K5RA 3FMQA 4L9NA 2YR2A 4XQFA 4D5CA 5LGTA 1MBKA 2YX4A 5DV5A 3VYUB 1KU9A 2RQQA 5F1RA 2WC2A 1W4MA 1OR7C 3KFWX 1MH4A 4A12A 5FKNA 1LDDA 3OYAA 5KNLA 3BCAA 3OYBA 1D0ZA 5IT9K 3QBMA 3CQZJ 2JRTA 4GCLA 1FIAA 3HJEA 2XKPA 2ZMEC 3K69A 5D4RA 2R7ZJ 1W5SA 2FQ3A 3JSJA 1WH5A 2L7KA 4R79A 2BHYA 4RS8A 3AAFA 1K78A 1SFOJ 2LDUA 5BQTA 1VQ9I 3QP6A 1XMKA 3OS1A 3PUFA 1XTAA 1R00A 5IP7J 4KIBA 3RQIA 2G0EA 1HKTA 3OIOA 2ZJPF 4S0HB 2HI3A 1TNSA 4HSTA 2RVCA 2HWVA 1J0RA 5ICEA 1XX5A 4OIOF 3FBIB 4CCJA 2OZUA 4J19A 1X1CA 3EETA 3S1QJ 4KIGA 4OINF 5JVTA 3CCUI 4TV7A 1FX7A 1YLFA 2G9WA 2LBFA 1DPUA 3K70D 3HTHA 1JT6A 3V6GA 3OYHA 1R4MB 2VQLA 2CUFA 4I0BA 4L0YB 2GOXB 5JVGF 2OV7A 3ZMTA 3ABUA 3QPHA 4CDGA 1GT0C 5DD8A 3K70C 4E7ZA 3I54A 4I01A 1BOAA 1Y56A 1H0MA 2XUBA 1WKMA 2E1NA 2OERA 3CESA 1J59A 3MZ8A 1P2FA 4O5VA 1YW9A 4A3CJ 2CJJA 3H3UA 2QBYA 3DBLB 4LG3A 4CUGA 1RR7A 4G6QA 2O9LA 2R5YA 2VJJA 1T2KA 1UB9A 2JA7J 1LVAA 2W82A 5GTIC 3EUAA 4PFOA 1ZLKA 4UB8C 2KP6A 1X1BA 4RB1A 2FQ4A 3VODA 3M07A 2V6CA 5J1RA 1J2XA 5CQGA 4G9YA 1LB2A 2M8GX 2CV2A 4AIHA 4RDUA 1LFUP 3P9IA 1ZH5A 4HLXA 3M8FA 5E17F 4UV8A 2ZJRF 1IO2A 1USTA 3HDDA 1RESA 3ZMVA 4F91B 2FJI1 2REKA 1R1VA 2HQRA 2XPUA 1JE8A 2GBYA 2DO7A 2LVSA 3H5RA 3CMEI 3KP3A 5EEGA 1ZG5A 1XS9A 4LJZF 3A03A 4HQEA 2VUMJ 5H9TA 2I5UA 2O7TA 2QCOA 3VTIA 1MZBA 1ZGJA 1FWZA 1S7OA 4P9FA 4PGGA 5AQCA 2NYXA 1A6QA 2DN0A 5J3LA 4NNJA 3HTAA 2BVLA 3O8HA 1JTXA 1ZELA 4HW0A 2DQLA 3J7YJ 2CQNA 2UXUA 4DBQA 4JOMA 4V19K 3I9V2 2AXLA 4EJOA 1T8IA 2Z5UA 2R7OA 3OYMA 1YW8A 2GXGA 4KICA 1KZHA 5FKOA 3R6SA 2X1DA 2YX7A 2IBDA 3L2UA 4B3XA 1IJWC 1YI2I 3FM5A 3ERED 3BG9A 1WCMJ 4NN1A 1LDKB 1WJCA 1XSVA 2A68F 2KIQA 2O8XA 2NVUB 3QU3A 3P7NA 1FYMA 3VSLA 4JX4A 2EIKH 2DK8A 4F92B 1WGXA 5HOOA 2O6GE 3FK6A 5LEKA 4DW6A 2R7QA 2LKPA 1W7PA 5GP9A 4EVIA 4M3FA 2X1EA 3EGQA 2DA6A 4IHSA 4JBAA 3W3CA 1WFXA 1ON1A 4E7LA 1MMAA 4XRMA 3CO6C 1R9TJ 4XR6A 1R71A 2A07F 1SEUA 2YVEA 4HX8A 1IC8A 2R7XA 3LL7A 3DEUA 3VYRB 1JJ8C 3BJ6A 3HOVJ 2NS7A 3KP2A 4BE0A 4OIQF 1WJEA 2RNGA 4U9NA 4IRHA 2Z16A 4U0WA 3HOZJ 2E1MC 5KAIC 4GGGA 4F3QA 5ILUA 2PJPA 2BYVE 1X1DA 2OUMA 2VASA 1WJDA 3MAJA 3HSRA 1IRZA 3ZRGA 2H27A 3IKTA 1LE8B 1XCBA 1A5JA 3KP7A 2IU5A 4LFUA 3PL8A 1HSJA 3PPBA 1HQCA 2EQRA 4HOBA 1JGSA 4CCNA 1UHWA 3W6VA 1ZG1A 3HIMA 3BTJA 4BYYA 2UXNA 1TW2A 3DPTA 1HDPA 3FKIJ 1Z67A 1MSFC 5L3CA 2WB1N 2VT3A 1SGMA 3SDGA 4AIJA 1F36A 2VBXA 5FGLA 2BEOA 1IN6A 1W36D 4KFCA 3F6OA 3I59B 1R4NB 1YS7A 1K6YA 2R7WA 4IQ4A 3K2AA 3RKYA 2AO9A 2GXAA 3I4NJ 3GTPJ 1WJFA 1OPCA 4D7NA 4P96A 1YTYA 4KNYA 3TGNA 1L3LA 1MMNA 3GW2A 1X19A 3DKYA 1HKQA 2M1BA 2JN6A 1ONVA 4KN7X 5K1YA 1TT5B 1NG7A 4A3JJ 5HS8A 4P1WA 3LOCA 3CMAI 2O5RA 2PBXA 2K85A 4G6DA 3G4SI 3GWZA 3KNWA 3VW2A 3IV5A 3M8EA 4DZPA 2DJIA 2MYSA 4BUPA 3Q0WA 3W6KB 5LHGA 5EFYA 1VNDA 4II2A 4DYCA 3OYNA 3TO7A 1Z0XA 4G7ZF 3HB9A 4M9ZA 4YFKF 2I10A 3BR2A 1MMSA 1DQUA 1Z1DA 3K4KA 1MNDA 4Y17A 3X2QH 3DEWA 2QM3A 2TRTA 3PSIA 3LSRA 5CJ9A 5KHDA 4PJNA 2EIMH 4CZZA 5FKLA 3H9JA 3CMYA 1CGPA 1U2WA 3DP7A 3KZZA 1G8XA 1QPMA 3DF8A 3FK7A 1UI6A 4BL0B 3FHZA 2PN6A 3J80K 2JWTA 4HPQA 2CUZA 4KMFA 2E2IJ 3G3ZA 4UVCA 3MWMA 1WI3A 1TLHB 2XV4S 2DYSH 2F4MB 2L54A 4RAZA 3J81Z 2VN2A 3FF5A 4ICHA 3C2GA 2QEXI 2ZCXA 2CUEA 1YYVA 4G6TB 4L18B 2JVHA 1IG7A 2IW5A 1OQYA 4M71A 4J01A 2K9SA 1S5LC 3R0AA 3AQSA 1TT0A 1KQ0A 1R23A 3G1MA 3EYIA 1O3RA 5FMPA 2M5WA 4A3IJ 2ZFUA 2Y0MA 5L3GA 2IVMA 3OY9A 5FLMJ 4AYBA 2W53A 2BHZA 4B8XA 3MKZA 3CJDA 3AFHA 2X48A 4JX6A 1FIPA 3GX4X 3KETA 3JTHA 2VBZA 2HDCA 4ASNA 2F2EA 2JZYA 1OJLA 2K9NA 4CCMA 4GCVA 1FBSA 2DA7A 4GFLA 3GFJA 3Q9SA 4A6DA 1LKXA 3RYRA 4Q47A 3TDUC 1XN7A 1QVTA 3P5JA 1RKWA 3WTXC 3G1LA 3LA7A 1BR4A 2B0LA 9ANTA 4M6VA 2H09A 3M1CA 5E3NA 2KPMA 1T0FC 1YJ9I 2DFEA 3K1MA 2YS9A 2FBQA 3E5XA 2D1HA 3F22A 3V4GA 1FLIA 4UUSA 1I6HJ 3U21A 3CP2A 1SVLA 3OIQA 5J1YA 4DVYP 1HC8A 3JRAA 3KCCA 1Z7UA 1HBXG 2JA8J 2PJRA 2BY0A 4PGHA 5FFXA 2B63J 3DU6A 2YU3A 1AHDP 2RREA 2DCEA 3WTYC 3LAJA 2YUSA 2UXOA 3IAS2 1TNTA 2W24A 5C44J 2CRGA 2LR8A 3MCZA 5BS6A 1U9NA 5BNGA 4A3LJ 1U8BA 4U0YA 2Z33A 1B8IB 4YZEA 1DGWY 3PFYA 3JTGA 3F21A 1D8JA 1K83J 2VQCA 3O3KA 2V7FA 4I09A 3TW7A 4AD9A 4C3JJ 2G3BA 4OIPF 2M0MA 1KYWA 4KJZA 1WI9A 3PIPF 3HRUA 2VE9A 2A6TA 1KU2A 5HLTA 4U0VA 3CC7I 4UY8I 2VJIA 3C7JA 2IGNA 4L5EA 2UUZA 1AU7A 3J7AY 1XD7A 5FO5A 3LNQA 2PEXA 2C6YA 2UWMA 1SMYF 1GHCA 1RKTA 2K40A 2M45A 1FY7A 1U5TB 4KDPA 2BY1A 3P9KA 2UZKA 1Z7LA 2ZCWA 1UCRA 1D3YA 3QU6A 5FKKA 1ZRFA 4NELA 3T5XA 4CCKA 4I99C 2BY3A 2YSRA 2BOLA 3DQVC 3G73A 1E0EA 4AUXA 2WY8Q 1B6AA 2WV1A 2XASA 2MABA 3FWEA 3WGHA 1E2XA 3E0JB 2V26A 2DOAA 1R1UA 1RC9A 5K5QA 2DFFA 1Y8RB 1U78A 2B3WA 4A5NA 2ZO4A 2LNBA 2QWWA 2DYRH 3JRDA 3SDBA 4ZTJA 3WGIA 3ANGA 1POGA 3HHGA 2X51A 3J7AO 1FT9A 3CCVI 3ECHA 4MNUA 3T1BA 2LKXA 3PM1A 4U87A 2MH9A 4EQQA 4EV0A 3RKXA 2DMQA 3CCYA 2NVXJ 4BE1A 2LMDA 2XRLA 1TTYA 1PUFA 1ZGAA 3BPVA 2QOPA 4AC0A 1NK2P 5JI6A 3ISPA 3RH2A 3V7SA 4LOCA 3VOKA 3GMEA 3RPQA 1APLC 2WBMA 5HNFA 2VKVA 4DYRA 1IN4A 1W5TA 1QZZA 5AIQA 4YRVA 1S72I 4AIKA 2HDWA 1TWFJ 4Q4ZF 3GEUA 2JT1A 2X6YA 1MKMA 3BG7A 5F04A 4B09A 4GXOA 1FJLA 4EGZA 3CDHA 4QSHA 4X0GA 4XLEA 3J7ZI 3JSOA 1O3TA 1TP4A 2NX4A 2LH9A 5L3DA 2R5ZB 3DPJA 2VJ5A 3HIFA 1EH6A 2CMPA 3ZMSA 1BC8C 2IXSA 3GUDA 2QSGX 2V1NA 3OOPA 2V9KA 4RGXA 4I2OA 4XLHA 4DYQA 1AWCA 2ZFWA 5D5WB 3KLOA 3CP8A 1B72B 2Q2EA 4EJUA 2IS4A 4WX9A 4HF1A 4CA0A 1O7LA 3ZPLA 2DTRA 2VL8A 5IOZA 2HZDA 1Y6IA 4IO9F 4BDZA 2CU7A 2IGOA 4KA4A 2QSHX 1EH8A 2ZSHB 4U7DA 2LP0A 5E8IA 1Y1VJ 5EG0B 5HNHA 3EUKL 3CCMI 3S17J 1K6OA 4LG0A 2MC4A 3TOBA 4N0BA 4BBRJ 2K9MA 1SD4A 3HBLA 2HS5A 3ZN1A 2IA1A 3BC8A 4GFBA 3G6EI 1OFCX 1SFXA 1PVEA 1VQ8I 5FRMA 2NP3A 3HTIA 4GDFA 3S1RJ 5HSZA 3PFIA 1ORKA 2M30A 3BTIA 4FHTA 3ABMH 3H0DA 2PI0A 1K61A 3ZQQA 3ANPA 5IP6A 3FKJA 3CTAA 1MDMB 3RKWA 2L7FP 3N05A 3H36A 2P5VA 4RB2C 4BEHB 2JA5J 3WHCA 3KPHA 3T0YA 2GOMA 3M1EA 2NVQJ 3WE2A 3I5UA 2LTPA 2HYJA 2VKEA 1TBXA 3QPSA 2TDXA 4KUMA 4BJTA 3GLLA 2GA1A 2OTLI 4I6ZA 3CF5F 2ELKA 3EYYA 3LAPA 4MEXF 1YX3A 3VSKA 3OSGA 2HYGD 2XROA 3IUOA 1XSDA 2WAQN 3A4CA 4ZYGA 1V5EA 1XMXA 5J1UA 2ESHA 4IHYA 2XF7A 2L7MP 4H0EA 3KKDA 4V2GA 3K0LA 3HTJA 2VBYA 3LA3A 4QWQA 4XLNF 2BV6A 1JUSA 1XDSA 2F5DA 2K5CA 2CS3A 1N25A 3G1OA 1DP7P 2K86A 3NRVA 1SMTA 5H20A 5D1RA 4IKFA 1UFMA 1VZ0A 1F4KA 2K3FA 2RN7A 1U9OA 3WODF 1QZYA 3DPUA 2COMA 2BXZA 4BHPA 4E6KG 5L3EA 3VVXA 2A5YB 3K2ZA 1RR8C 1OR7A 2HVSA 2L5QA 3JRIA 1CF7A 5HDGA 5DCMA 3F8MA 3BROA 1T38A 3CUQB 2HKXA 2WV0A 2JSPA 4B47A 2XF6A 3ESWB 2ZMEA 3HGYA 4IHWA 3O60A 2EZKA 4R8HA 2DMTA 2DA1A 3OYCA 1FSHA 1UJ8A 1QZEA 2HGCA 1E3PA 1FPQA 1K4TA 2OCEA 4XKBA 3OWTA 4XONA 2A69F 2CQXA 2NS8A 3K6GA 2E1CA 5E18F 3OL4A 2DQRA 1VQ4I 2G7HA 4ETSA 1IN8A 4NUBA 2VODA 4BS9A 1JHFA 3LSGA 1Y1WJ 3WTVC 1KQ8A 4AU7A 2QSFX 3K1NA 3MD2A 3SZPA 1JHHA 5KK1A 4KISA 3T6NA 3BDDA 2HXOA 4CCLA 3HOXJ 1N78A 2OU2A 5M5WJ 1GXQA 3CCJI 4M6XA 3KYLA 3HSFA 2W7NA 2B9SA 4XSXF 3ELKA 1R58A 4IF4A 5J40A 3A1YA 2Z1DA 2UXIA 5K58A 5M3MJ 2KDZA 4BJ6C 1YE9A 1P9QC 4CO8A 2VC1A 4BKXA 2VOOA 1AKHA 3DLAA 2HVRA 2MW8A 3N4MA 1IRXA 1MGTA 2VKHA 3JCUC 4FT8A 4NC8A 1D0YA 4A2UA 1VFCA 3L2QA 2CYYA 5IP9J 2PFBA 5EF6A 2CSOA 5IYDJ 4IQJA 1ZYRF 3E6MA 2KT0A 4PJ0C 2L9SA 2MH2A 5DYMA 1K78B 4XORA 4U7BA 4A3GJ 5LBQA 2XDNA 1P92A 4LK1F 4YFNF 3QRFF 3OL3A 4HSRA 2Z99A 3VFZA 2VE8A 4R1HA 2D5VA 2K9QA 5IOYA 1E3HA 3VW0A 4BHBA 5E8GA 3C1DA 4GYIA 2EFPA 2IRFG 3A01B 1GVJA 2HOAA 1I6XA 1JJ6C 2DTZA 4B1RA 2GM4A 3TW6A 1G4DA 1MBFA 4HDVA 4ZC3A 3G71I 2PBIA 2D1VA 1I3AA 1V4RA 2N8GA 4K2EA 2LBFB 2K3PA 1U3EM 1BA5A 1IGNA 2MGQA 2E60A 4PDKA 3HE0A 4HZFA 2KIMA 1VQKI 1YIJI 2D6YA 1UMQA 3RPUD 4JL3A 3W2VA 2P6SA 4XLPF 3BCBA 4MXMA 2M8EA 3GBGA 5H6QA 1UI5A 4ACIA 4FE4A 5D6FA 4EJTA 3HRTA 4MQ9F 2OA4A 2QBYB 3CO7C 3L2RA 1E17A 2R5YB 3KZIC 1TWHJ 2FUG2 3GVAA 3PUBA 3VYTB 3RD3A 3JRGA 2DDBA 1OYWA 1MIJA 2HFHA 2ZXJA 3C07A 4BH9A 4J00A 3IKVA 3MZHA 2CW7A 3HGGA 2QKMB 5JFRA 4MTDA 2ELJA 1FP1D 5CXGA 1OMIA 2IA0A 4PJMA 1XGNA 3TMOA 1LQ1A 2M87A 4XOPA 1OYIA 4KITB 5H2FC 1WQ2A 5CVJA 3UNGC 1G59A 2AQFA 4HDUA 3R0JA 3E7QA 3L09A 3FIWA 2F6CA 3N97A 3QAHA 1BJZA 4WWCA 1HSTA 5J4VA 2R7TA 2X0LA 2L7ZA 1HW5A 1MNEA 3C18A 1MJ9A 4LIUA 2VXZA 4RB3C 5LD2C 2NOGA 4IXAA 1D1CA 4IZZA 2V6EA 4NHJA 1ZG3A 3GZ6A 4S04A 1WJAA 4ABZA 2BBYA
chains in the Genus database with same CATH topology
1WI3A 2FD5A 2ME6A 3LSJA 2HYTA 3IH4A 3GTGJ 5EZGA 3ZQFA 5E3MA 1ZR2A 2JJ7A 5F0HA 1W0TA 1QPIA 4L62A 3FRQA 4ICHA 1F43A 2ZCXA 5HAWA 2CUEA 1IUFA 2JA6J 3M4OJ 2Y2ZA 3LJLA 1ETQA 1IG7A 2DMPA 1ETXA 4HNVA 1H8AC 2FJ1A 3RZOJ 2K9SA 3RKQA 1DU0A 1GDTA 3BR5A 3AQSA 1JT0A 5FMPA 1IDYA 3G1MA 2O7OA 2XGDA 4DZJA 3A02A 4A3IJ 5D19A 2XB0X 4A3BJ 2XGCA 3B81A 4BY1J 1BW5A 5FLMJ 3S1NJ 5EZHA 4AYBN 5IPAA 1DU6A 2W53A 1BL0A 3CJDA 2X48A 4JX6A 1FIPA 3JRHA 1AKHB 3Q3SA 3S2HJ 1OJLA 2K9NA 2E1OA 2R5ZA 2HQ5A 2GENA 3VVYA 5K7ZA 1D5YA 2DA7A 3TP3A 4GFLA 2NVTJ 1RETA 2HDDA 1QVTA 1JKQC 1RKWA 3P9TA 3G1LA 4HKUA 5M5XJ 3RZDJ 2UXPA 2QIBA 4JNNA 9ANTA 1LFBA 2LY9A 2H1KA 4FTHA 1B72A 4M6VA 1G2HA 3NNRA 3SFIA 5E3NA 2AHQA 2TCTA 2OF7A 5F1JA 4QTRA 3E7LA 2LFBA 1ZTRA 2YS9A 5JLXA 3VPRA 1Z77A 2FBQA 2PZ9A 3OSFA 4UUSA 1I6HJ 5EG0A 1H88C 1YRNA 5C4JJ 5J1YA 2DG7A 1P7JA 3JRAA 3TEDA 2JA8J 1O4XA 3BR1A 2HXIA 1JKOC 2B63J 4CYCB 2L0KA 1AHDP 2YUSA 1JUPA 2UXOA 4MLOA 5C44J 2CRGA 3ZQLA 4A3DJ 2LR8A 3HOYJ 1UG2A 3A01A 1U9NA 5BNGA 1ZGWA 2NP5A 3PO3J 1HF0A 4A3LJ 1U8BA 3Q0VA 3CRJA 1B8IB 4YZEA 3JRFA 3GTJJ 1K83J 3VOXA 1GUUA 2G3BA 3TW7A 4C3JJ 1HOMA 4Y7NJ 1FEXA 5DAJA 2ZCMA 3BQYA 2MSYA 3B6AA 3G56A 3MNLA 1VI0A 3IH2A 1T33A 3GTKJ 4L5EA 1AU7A 3M3YJ 3LNQA 3UKGA 2LLKA 3F0CA 3S15J 1GVDA 3BG3A 3EUPA 4A69C 3JRBA 4FCYA 2ECCA 4C3IJ 1RKTA 3WHBA 2K40A 1MNMC 3BRUA 1TC3C 1MBHA 3VP5A 1ZR4A 3LSPA 2G7SA 5FKKA 4NELA 2DJNA 2UXHA 1ETOA 3IH3A 4C2MJ 5F08A 4KWAA 3BNIA 1S7EA 2DMUA 4AUXA 2WUIA 4NDLA 3ON4A 2HKUA 3QQAA 1CQTA 2WV1A 1I3QJ 5FLVA 1OCTC 2JK3A 3JR9A 1IV6A 1MH3A 2R92J 1P7IA 2XPWA 4MFEA 1FTZA 3H0GJ 2QF7A 3S5RA 1U78A 4A3KJ 4X1EA 3L1PA 1ETVA 5C4YA 1SANA 2M9HA 1ZK8A 4ME9A 3JRDA 3BR3A 3AQTA 3ANGA 4MK6A 1POGA 5EGOA 1XC5A 2CQQA 1IDZA 4RBOA 3HOWJ 2IAIA 2LKXA 3PM1A 4C3HJ 1TWCJ 2EH3A 4UUTA 2DMQA 3CCYA 2E2JJ 2NVXJ 3ZQGA 2XRLA 1ETYA 3MKLA 2DA2A 1PUFA 2QOPA 3V78A 4X6AJ 4IHVA 4AC0A 1A6IA 1NK3P 1NK2P 4GCKA 3S2DJ 5DTDA 3RH2A 2DMNA 4LOCA 3VOKA 3GTOJ 1H89C 5E3LA 1APLC 1X58A 2XSDC 1GV5A 2VKVA 2ZCNA 4DYRA 2ECBA 3PASA 3JRCA 3LWJA 2VI6A 3HKZN 1TWFJ 3GTMJ 2ID3A 3GEUA 5F04A 3Q0UA 1FJLA 2ZOYA 5F0CA 2IEKA 4D7MA 4QSHA 2OI8A 4JKZA 3CDLA 3ZQCA 4CGRA 2NX4A 2R5ZB 3MVPA 4IEJA 3DPJA 1JGGA 2GLOA 1Q1VA 4G12A 2EBIA 5JLWA 1ENHA 4XRSA 2FX0A 4D5CA 3BR0A 1MBKA 1MSEC 2EZIA 4D5FA 5GPCA 2RAEA 2H8RA 4DYQA 4MO7A 3D1NI 3I4MJ 1MH4A 5FKNA 1B72B 4UDSA 2DA3A 3HEFA 3QBMA 3CQZJ 5IOZA 4GCLA 1FIAA 3NXCA 5K7FA 2CU7A 2R7ZJ 3BQZA 2LP0A 3JSJA 4XICA 1WH5A 4UUSB 1Y1VJ 1BW6A 5EG0B 1YRNB 1SFOJ 3S17J 3TP0A 3FISA 4MFDA 4BBRJ 3DCFA 3JREA 2DA5A 3HBLA 1X2NA 5IP7J 3RQIA 4JYKA 2G0EA 3ZQHA 4GFBA 3OIOA 4S0HB 2WGBA 2HI3A 1OFCX 2NP3A 3HTIA 4BXXJ 4M3EA 3S1RJ 5HSZA 1ORKA 3S16J 1ETWA 3KKCA 3BTIA 2HOTA 4J19A 1LE8A 3BT9A 4XIDA 2LD5A 1GV2A 2E2HJ 1K61A 3S1QJ 3ANPA 5IP6A 5CXIA 3O8GA 2ZB9A 3S1MJ 2L7FP 3HTHA 1JT6A 3V6GA 2JA5J 2CUFA 3WHCA 4IHXA 3QPLA 2NVQJ 1GT0C 3NRGA 2LTPA 2HYJA 2VKEA 3QPSA 4I76A 5GPAA 2V57A 4A3FJ 4I6ZA 2OERA 2ELKA 3F1BA 4GFKA 1HDDC 2YVHA 1ZKGA 4B3AA 3OSGA 4A3CJ 2LK2A 2CJJA 1RR7A 3BCGA 2O9LA 2WAQN 2R5YA 4XK4A 5F27A 5FKMA 5J1UA 3BR6A 2JA7J 4IHYA 2ID6A 2L7MP 3KKDA 3GTQJ 4V2GA 2Y30A 3HTJA 2QTQA 4AC6A 5HBUA 1JUSA 2ME0A 3G1OA 1TWGJ 2FQ4A 5J1RA 1ZQ3P 1EF4A 2HOSA 2EZLA 4FISA 5D1RA 2M8GX 1QVUA 4M3DA 2M2EA 5EEAA 4RDUA 1LFUP 5C3EJ 1U9OA 3VVXA 3VIBA 3NPIA 1ETKA 5EDNA 3HDDA 3K7AJ 3JRIA 5EGOB 3QKXA 3NI7A 3H3VK 2XPVA 1RESA 2Y9ZA 2F07A 2REKA 2XPUA 2GBYA 2LVSA 4IHWA 3HGYA 3O60A 1XS9A 2VUMJ 2EZKA 4PXIA 2DMTA 3A03A 5H9TA 2L9RA 4V2FA 2DA1A 2O7TA 4M3BA 2QCOA 3NAUA 5M3FJ 1PUFB 1E3OC 1HCRA 5AQCA 2DN0A 5J3LA 2CQXA 3HTAA 2NS8A 3O8HA 1JTXA 3IUVA 1RPWA 5IYBJ 2UXUA 3LSGA 1Y1WJ 1JKRC 3T6NA 2YU9J 5FKOA 3HOXJ 2HXOA 3BHQA 1T56A 5EYRA 2M34A 2IBDA 4A3EJ 5M5WJ 1IJWC 2Q24A 5F0FA 4A93J 4B4CA 3BG9A 1WCMJ 3MN2A 2Y9YA 5FJ8J 4W97A 1MBJA 4NN1A 2Y0SN 3KZ9A 4JX4A 3C2BA 5CW8A 5FHPA 2UXIA 5K58A 5M3MJ 3VW1A 2KDZA 1WGXA 4BKXA 3FK6A 4DW6A 1AKHA 2X9DA 2QWTA 2MW8A 3BG5A 5GP9A 4M3FA 2RHAA 3PO2J 3EGQA 2DA6A 2P81A 5M5YJ 1VFCA 3GZIA 4XRMA 5IP9J 5EF6A 1R9TJ 2YVEA 1WH7A 4QIWN 3SJMA 1IC8A 5IYDJ 2GUHA 2W48A 2KT0A 3NARA 3BTCA 5C4XJ 1JJ8C 2PMZN 3HOVJ 2NS7A 4A3GJ 2R0QC 2XDNA 5K7HA 4Y52J 2NVYJ 4AF5A 2MG4A 3HOZJ 3COLA 2M0CA 2D5VA 4W1UA 3GTLJ 2K9QA 5IOYA 3VW0A 5HODA 1FTTA 4MIMA 2X6OA 3A01B 1JJ6C 2HOAA 2DA4A 2DTZA 4BY7J 4B1RA 2GM4A 2EZHA 1IRZA 3TW6A 1MBFA 2G7LA 1NTCA 1LE8B 1XG1A 1A5JA 2IU5A 1VF9A 2O8KA 4CYCA 3PPBA 2N8GA 2EQRA 1BA5A 3W6VA 1IGNA 2MGQA 2RASA 3HIMA 3HE0A 2D6YA 3BTJA 4EEFG 2R93J 1HDPA 1UMQA 3FKIJ 1W0UA 1MSFC 2WB1N 1SGMA 4JL3A 3BJBA 3SDGA 1B8IA 1F36A 5FGLA 4MXMA 3GBGA 1UI5A 1QRYA 3G7RA 3VUQA 4ACIA 3ON2A 4FE4A 2GFNA 4M3GA 2JMWA 3HM5A 1TWAJ 2XB5A 3OOUA 2Y31A 3K2AA 2AO9A 1TWHJ 2R5YB 3GTPJ 3I4NJ 2QKOA 1JUMA 3S14J 3RD3A 4D7NA 2COBA 3JRGA 1MBGA 1OCPA 3HOUJ 2G7GA 3C07A 2JN6A 1MBEA 4A3JJ 1I50J 4JX5A 3LOCA 1JTYA 3HGGA 2PBXA 1UHSA 2VPRA 5D18A 5CXGA 2XGEA 3KNWA 3VW2A 3IV5A 3VVZA 4BBSJ 1JKPC 4DZPA 3CWRA 1WPKA 4A3MJ 4JP0A 2ZOZA 3Q0WA 5EFYA 1VNDA 3B6CA 4DYCA 1Z0XA 4FE7A 3HB9A 3E7QA 2I10A 3BR2A 3BTLA 3FIWA 3ZQIA 1BJZA 3DEWA 2TRTA 3LSRA 2L7ZA 3CMYA 1X2MA 5FKLA 2E19A 5DS9A 3FK7A 2OPTA 4XRSG 2NOGA 3ZOBA 1ITYA 5E3OA 1UI6A 4GCTA 1HLVA 2JWTA 2DG8A 3LHQA 5IYCJ 2E2IJ 4ABZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1WI3 A;  2FD5 A;  2ME6 A;  3LSJ A;  2HYT A;  3IH4 A;  3GTG J;  5EZG A;  3ZQF A;  5E3M A;  1ZR2 A;  2JJ7 A;  5F0H A;  1W0T A;  1QPI A;  4L62 A;  3FRQ A;  4ICH A;  1F43 A;  2ZCX A;  5HAW A;  2CUE A;  1IUF A;  2JA6 J;  3M4O J;  2Y2Z A;  3LJL A;  1ETQ A;  1IG7 A;  2DMP A;  1ETX A;  4HNV A;  1H8A C;  2FJ1 A;  3RZO J;  2K9S A;  3RKQ A;  1DU0 A;  1GDT A;  3BR5 A;  3AQS A;  1JT0 A;  5FMP A;  1IDY A;  3G1M A;  2O7O A;  2XGD A;  4DZJ A;  3A02 A;  4A3I J;  5D19 A;  2XB0 X;  4A3B J;  2XGC A;  3B81 A;  4BY1 J;  1BW5 A;  5FLM J;  3S1N J;  5EZH A;  4AYB N;  5IPA A;  1DU6 A;  2W53 A;  1BL0 A;  3CJD A;  2X48 A;  4JX6 A;  1FIP A;  3JRH A;  1AKH B;  3Q3S A;  3S2H J;  1OJL A;  2K9N A;  2E1O A;  2R5Z A;  2HQ5 A;  2GEN A;  3VVY A;  5K7Z A;  1D5Y A;  2DA7 A;  3TP3 A;  4GFL A;  2NVT J;  1RET A;  2HDD A;  1QVT A;  1JKQ C;  1RKW A;  3P9T A;  3G1L A;  4HKU A;  5M5X J;  3RZD J;  2UXP A;  2QIB A;  4JNN A;  9ANT A;  1LFB A;  2LY9 A;  2H1K A;  4FTH A;  1B72 A;  4M6V A;  1G2H A;  3NNR A;  3SFI A;  5E3N A;  2AHQ A;  2TCT A;  2OF7 A;  5F1J A;  4QTR A;  3E7L A;  2LFB A;  1ZTR A;  2YS9 A;  5JLX A;  3VPR A;  1Z77 A;  2FBQ A;  2PZ9 A;  3OSF A;  4UUS A;  1I6H J;  5EG0 A;  1H88 C;  1YRN A;  5C4J J;  5J1Y A;  2DG7 A;  1P7J A;  3JRA A;  3TED A;  2JA8 J;  1O4X A;  3BR1 A;  2HXI A;  1JKO C;  2B63 J;  4CYC B;  2L0K A;  1AHD P;  2YUS A;  1JUP A;  2UXO A;  4MLO A;  5C44 J;  2CRG A;  3ZQL A;  4A3D J;  2LR8 A;  3HOY J;  1UG2 A;  3A01 A;  1U9N A;  5BNG A;  1ZGW A;  2NP5 A;  3PO3 J;  1HF0 A;  4A3L J;  1U8B A;  3Q0V A;  3CRJ A;  1B8I B;  4YZE A;  3JRF A;  3GTJ J;  1K83 J;  3VOX A;  1GUU A;  2G3B A;  3TW7 A;  4C3J J;  1HOM A;  4Y7N J;  1FEX A;  5DAJ A;  2ZCM A;  3BQY A;  2MSY A;  3B6A A;  3G56 A;  3MNL A;  1VI0 A;  3IH2 A;  1T33 A;  3GTK J;  4L5E A;  1AU7 A;  3M3Y J;  3LNQ A;  3UKG A;  2LLK A;  3F0C A;  3S15 J;  1GVD A;  3BG3 A;  3EUP A;  4A69 C;  3JRB A;  4FCY A;  2ECC A;  4C3I J;  1RKT A;  3WHB A;  2K40 A;  1MNM C;  3BRU A;  1TC3 C;  1MBH A;  3VP5 A;  1ZR4 A;  3LSP A;  2G7S A;  5FKK A;  4NEL A;  2DJN A;  2UXH A;  1ETO A;  3IH3 A;  4C2M J;  5F08 A;  4KWA A;  3BNI A;  1S7E A;  2DMU A;  4AUX A;  2WUI A;  4NDL A;  3ON4 A;  2HKU A;  3QQA A;  1CQT A;  2WV1 A;  1I3Q J;  5FLV A;  1OCT C;  2JK3 A;  3JR9 A;  1IV6 A;  1MH3 A;  2R92 J;  1P7I A;  2XPW A;  4MFE A;  1FTZ A;  3H0G J;  2QF7 A;  3S5R A;  1U78 A;  4A3K J;  4X1E A;  3L1P A;  1ETV A;  5C4Y A;  1SAN A;  2M9H A;  1ZK8 A;  4ME9 A;  3JRD A;  3BR3 A;  3AQT A;  3ANG A;  4MK6 A;  1POG A;  5EGO A;  1XC5 A;  2CQQ A;  1IDZ A;  4RBO A;  3HOW J;  2IAI A;  2LKX A;  3PM1 A;  4C3H J;  1TWC J;  2EH3 A;  4UUT A;  2DMQ A;  3CCY A;  2E2J J;  2NVX J;  3ZQG A;  2XRL A;  1ETY A;  3MKL A;  2DA2 A;  1PUF A;  2QOP A;  3V78 A;  4X6A J;  4IHV A;  4AC0 A;  1A6I A;  1NK3 P;  1NK2 P;  4GCK A;  3S2D J;  5DTD A;  3RH2 A;  2DMN A;  4LOC A;  3VOK A;  3GTO J;  1H89 C;  5E3L A;  1APL C;  1X58 A;  2XSD C;  1GV5 A;  2VKV A;  2ZCN A;  4DYR A;  2ECB A;  3PAS A;  3JRC A;  3LWJ A;  2VI6 A;  3HKZ N;  1TWF J;  3GTM J;  2ID3 A;  3GEU A;  5F04 A;  3Q0U A;  1FJL A;  2ZOY A;  5F0C A;  2IEK A;  4D7M A;  4QSH A;  2OI8 A;  4JKZ A;  3CDL A;  3ZQC A;  4CGR A;  2NX4 A;  2R5Z B;  3MVP A;  4IEJ A;  3DPJ A;  1JGG A;  2GLO A;  1Q1V A;  4G12 A;  2EBI A;  5JLW A;  1ENH A;  4XRS A;  2FX0 A;  4D5C A;  3BR0 A;  1MBK A;  1MSE C;  2EZI A;  4D5F A;  5GPC A;  2RAE A;  2H8R A;  4DYQ A;  4MO7 A;  3D1N I;  3I4M J;  1MH4 A;  5FKN A;  1B72 B;  4UDS A;  2DA3 A;  3HEF A;  3QBM A;  3CQZ J;  5IOZ A;  4GCL A;  1FIA A;  3NXC A;  5K7F A;  2CU7 A;  2R7Z J;  3BQZ A;  2LP0 A;  3JSJ A;  4XIC A;  1WH5 A;  4UUS B;  1Y1V J;  1BW6 A;  5EG0 B;  1YRN B;  1SFO J;  3S17 J;  3TP0 A;  3FIS A;  4MFD A;  4BBR J;  3DCF A;  3JRE A;  2DA5 A;  3HBL A;  1X2N A;  5IP7 J;  3RQI A;  4JYK A;  2G0E A;  3ZQH A;  4GFB A;  3OIO A;  4S0H B;  2WGB A;  2HI3 A;  1OFC X;  2NP3 A;  3HTI A;  4BXX J;  4M3E A;  3S1R J;  5HSZ A;  1ORK A;  3S16 J;  1ETW A;  3KKC A;  3BTI A;  2HOT A;  4J19 A;  1LE8 A;  3BT9 A;  4XID A;  2LD5 A;  1GV2 A;  2E2H J;  1K61 A;  3S1Q J;  3ANP A;  5IP6 A;  5CXI A;  3O8G A;  2ZB9 A;  3S1M J;  2L7F P;  3HTH A;  1JT6 A;  3V6G A;  2JA5 J;  2CUF A;  3WHC A;  4IHX A;  3QPL A;  2NVQ J;  1GT0 C;  3NRG A;  2LTP A;  2HYJ A;  2VKE A;  3QPS A;  4I76 A;  5GPA A;  2V57 A;  4A3F J;  4I6Z A;  2OER A;  2ELK A;  3F1B A;  4GFK A;  1HDD C;  2YVH A;  1ZKG A;  4B3A A;  3OSG A;  4A3C J;  2LK2 A;  2CJJ A;  1RR7 A;  3BCG A;  2O9L A;  2WAQ N;  2R5Y A;  4XK4 A;  5F27 A;  5FKM A;  5J1U A;  3BR6 A;  2JA7 J;  4IHY A;  2ID6 A;  2L7M P;  3KKD A;  3GTQ J;  4V2G A;  2Y30 A;  3HTJ A;  2QTQ A;  4AC6 A;  5HBU A;  1JUS A;  2ME0 A;  3G1O A;  1TWG J;  2FQ4 A;  5J1R A;  1ZQ3 P;  1EF4 A;  2HOS A;  2EZL A;  4FIS A;  5D1R A;  2M8G X;  1QVU A;  4M3D A;  2M2E A;  5EEA A;  4RDU A;  1LFU P;  5C3E J;  1U9O A;  3VVX A;  3VIB A;  3NPI A;  1ETK A;  5EDN A;  3HDD A;  3K7A J;  3JRI A;  5EGO B;  3QKX A;  3NI7 A;  3H3V K;  2XPV A;  1RES A;  2Y9Z A;  2F07 A;  2REK A;  2XPU A;  2GBY A;  2LVS A;  4IHW A;  3HGY A;  3O60 A;  1XS9 A;  2VUM J;  2EZK A;  4PXI A;  2DMT A;  3A03 A;  5H9T A;  2L9R A;  4V2F A;  2DA1 A;  2O7T A;  4M3B A;  2QCO A;  3NAU A;  5M3F J;  1PUF B;  1E3O C;  1HCR A;  5AQC A;  2DN0 A;  5J3L A;  2CQX A;  3HTA A;  2NS8 A;  3O8H A;  1JTX A;  3IUV A;  1RPW A;  5IYB J;  2UXU A;  3LSG A;  1Y1W J;  1JKR C;  3T6N A;  2YU9 J;  5FKO A;  3HOX J;  2HXO A;  3BHQ A;  1T56 A;  5EYR A;  2M34 A;  2IBD A;  4A3E J;  5M5W J;  1IJW C;  2Q24 A;  5F0F A;  4A93 J;  4B4C A;  3BG9 A;  1WCM J;  3MN2 A;  2Y9Y A;  5FJ8 J;  4W97 A;  1MBJ A;  4NN1 A;  2Y0S N;  3KZ9 A;  4JX4 A;  3C2B A;  5CW8 A;  5FHP A;  2UXI A;  5K58 A;  5M3M J;  3VW1 A;  2KDZ A;  1WGX A;  4BKX A;  3FK6 A;  4DW6 A;  1AKH A;  2X9D A;  2QWT A;  2MW8 A;  3BG5 A;  5GP9 A;  4M3F A;  2RHA A;  3PO2 J;  3EGQ A;  2DA6 A;  2P81 A;  5M5Y J;  1VFC A;  3GZI A;  4XRM A;  5IP9 J;  5EF6 A;  1R9T J;  2YVE A;  1WH7 A;  4QIW N;  3SJM A;  1IC8 A;  5IYD J;  2GUH A;  2W48 A;  2KT0 A;  3NAR A;  3BTC A;  5C4X J;  1JJ8 C;  2PMZ N;  3HOV J;  2NS7 A;  4A3G J;  2R0Q C;  2XDN A;  5K7H A;  4Y52 J;  2NVY J;  4AF5 A;  2MG4 A;  3HOZ J;  3COL A;  2M0C A;  2D5V A;  4W1U A;  3GTL J;  2K9Q A;  5IOY A;  3VW0 A;  5HOD A;  1FTT A;  4MIM A;  2X6O A;  3A01 B;  1JJ6 C;  2HOA A;  2DA4 A;  2DTZ A;  4BY7 J;  4B1R A;  2GM4 A;  2EZH A;  1IRZ A;  3TW6 A;  1MBF A;  2G7L A;  1NTC A;  1LE8 B;  1XG1 A;  1A5J A;  2IU5 A;  1VF9 A;  2O8K A;  4CYC A;  3PPB A;  2N8G A;  2EQR A;  1BA5 A;  3W6V A;  1IGN A;  2MGQ A;  2RAS A;  3HIM A;  3HE0 A;  2D6Y A;  3BTJ A;  4EEF G;  2R93 J;  1HDP A;  1UMQ A;  3FKI J;  1W0U A;  1MSF C;  2WB1 N;  1SGM A;  4JL3 A;  3BJB A;  3SDG A;  1B8I A;  1F36 A;  5FGL A;  4MXM A;  3GBG A;  1UI5 A;  1QRY A;  3G7R A;  3VUQ A;  4ACI A;  3ON2 A;  4FE4 A;  2GFN A;  4M3G A;  2JMW A;  3HM5 A;  1TWA J;  2XB5 A;  3OOU A;  2Y31 A;  3K2A A;  2AO9 A;  1TWH J;  2R5Y B;  3GTP J;  3I4N J;  2QKO A;  1JUM A;  3S14 J;  3RD3 A;  4D7N A;  2COB A;  3JRG A;  1MBG A;  1OCP A;  3HOU J;  2G7G A;  3C07 A;  2JN6 A;  1MBE A;  4A3J J;  1I50 J;  4JX5 A;  3LOC A;  1JTY A;  3HGG A;  2PBX A;  1UHS A;  2VPR A;  5D18 A;  5CXG A;  2XGE A;  3KNW A;  3VW2 A;  3IV5 A;  3VVZ A;  4BBS J;  1JKP C;  4DZP A;  3CWR A;  1WPK A;  4A3M J;  4JP0 A;  2ZOZ A;  3Q0W A;  5EFY A;  1VND A;  3B6C A;  4DYC A;  1Z0X A;  4FE7 A;  3HB9 A;  3E7Q A;  2I10 A;  3BR2 A;  3BTL A;  3FIW A;  3ZQI A;  1BJZ A;  3DEW A;  2TRT A;  3LSR A;  2L7Z A;  3CMY A;  1X2M A;  5FKL A;  2E19 A;  5DS9 A;  3FK7 A;  2OPT A;  4XRS G;  2NOG A;  3ZOB A;  1ITY A;  5E3O A;  1UI6 A;  4GCT A;  1HLV A;  2JWT A;  2DG8 A;  3LHQ A;  5IYC J;  2E2I J;  4ABZ A; 
#chains in the Genus database with same CATH topology
 2QYO A;  5HS7 A;  1F1Z A;  2FSW A;  1PDN C;  4OMY A;  1MJA A;  2HYT A;  1WSU A;  1DPR A;  5EZG A;  2DOD A;  3IHU A;  2QUF A;  3ZQF A;  1F9N A;  5GAH J;  2JJ7 A;  5F0H A;  1W0T A;  2MD0 A;  3D0S A;  4L62 A;  2O3F A;  3FRQ A;  2F5E A;  3L00 A;  3SEZ A;  2JUG A;  2VIX A;  3DKW A;  2JA6 J;  1FSE A;  4EM2 A;  3M4O J;  3LJL A;  2DMP A;  3K4M A;  2OD5 A;  1ETX A;  4LLG F;  3RKQ A;  2W00 A;  1ERD A;  1GDT A;  1TQI A;  3KEQ A;  4E70 A;  2DDA A;  3ECO A;  2XGD A;  2P8T A;  4DZJ A;  3NEU A;  4ZH4 F;  2Y0S A;  3B81 A;  4BY1 J;  3DU5 A;  1BW5 A;  2WTE A;  5EZH A;  3LSH A;  3HUG A;  3JRH A;  3WG9 A;  2RQP A;  3QP5 A;  1W7P B;  4RAG A;  4ZZL A;  2R7R A;  3SEQ A;  5CVI A;  1XGM A;  3E6B A;  2XVC A;  4NQW A;  1KYZ A;  4HG2 A;  3CJQ B;  3FXU A;  4MQV A;  4NC7 A;  3S32 A;  5J8F A;  2HDD A;  5TJJ A;  2FOK A;  1JKQ C;  3CCQ I;  4XSZ F;  4KT5 C;  5E1X A;  5IYC J;  4IOA F;  4M9X A;  2EA4 A;  2A3S A;  2UXP A;  4JNN A;  2LY9 A;  4FTH A;  4EAT A;  1TL8 A;  3NNR A;  2BGC A;  3JAM K;  3H92 A;  1KON A;  3PIO F;  5F1J A;  4QTR A;  5HVQ C;  3FXM A;  1ZTR A;  3U9G A;  2PZ9 A;  3HZJ A;  3QPT A;  3S8P A;  3OSF A;  2KRF A;  3KP6 A;  2FA5 A;  3EUH C;  1YRN A;  3F8N A;  3R60 A;  5C4J J;  2FOW A;  1P4X A;  3RDI A;  4LLL A;  1FOW A;  1P7J A;  1R1T A;  3RI4 A;  5AIP A;  2EA2 A;  1EJ9 A;  4MHG A;  1D0X A;  1SVO A;  2LF8 A;  2RV8 A;  3DFG A;  3PQJ A;  1MW7 A;  1JUP A;  1TQM A;  1AOY A;  4MLO A;  1ULY A;  2R4G A;  3I4P A;  3ZR8 X;  4DOZ A;  1UG2 A;  4L9T A;  2NP5 A;  2DW4 A;  4LGW A;  1RNL A;  2K4B A;  2QEN A;  5IT9 Z;  1X4O A;  3CRJ A;  2L3D A;  2K27 A;  1Z3X A;  2XSJ C;  3JRF A;  4RB0 A;  4YIF A;  3OV8 A;  1HOM A;  1FEX A;  3LSI A;  2ZXH A;  2W4S A;  3V8K A;  4WXD A;  1WHU A;  2F5V A;  1W36 C;  3CCR I;  3BQY A;  3PJR A;  2ZCM A;  4WIB A;  3KZY A;  4HQM A;  1I1S A;  1L0O C;  3V7R A;  2GWR A;  3AL0 B;  3MNL A;  2KJC A;  3VOE A;  3M3Y J;  3UR3 C;  3F0C A;  5B1A H;  2K7L A;  4A69 C;  2ECC A;  4C3I J;  3WHB A;  4EGY A;  2JRM A;  4A5M A;  1MBH A;  4ZYH A;  2WAE A;  5H6R A;  1BI2 A;  1ZR4 A;  5GAG J;  1S7A A;  3FXQ A;  5LHH A;  5LRR A;  3IH3 A;  1BJA A;  4QLC U;  3CD6 I;  4KWA A;  2DMU A;  2NNN A;  3FXR A;  4NDL A;  2HKU A;  3K1P A;  3WG7 H;  1J09 A;  5FLV A;  2JK3 A;  2P6T A;  3KIO A;  1MH3 A;  3ZMZ A;  4D1Q A;  2R92 J;  2ZNY A;  3WTZ A;  2XPW A;  4HYE A;  1VQL I;  1FTZ A;  2ISZ A;  4I7H A;  1J7K A;  1W5C C;  5FLX K;  3U1D A;  3DWL E;  4EM0 B;  2M9H A;  3F8F A;  3W6J B;  2KZV A;  2HYF A;  3AQT A;  3CDI A;  5EGO A;  1XC5 A;  4RBO A;  1RRJ A;  4Y13 A;  2ZSI B;  3EQL F;  1Z05 A;  1T0F A;  3EPZ A;  6PAX A;  3I0T A;  1V5F A;  2DI3 A;  3F72 A;  3FHN A;  5J4Y A;  4UUT A;  3KYD B;  4M74 A;  4OD5 A;  2GAU A;  2E2J J;  3MEX A;  5DCF A;  5FFZ A;  4HRI A;  3MKW B;  3IAM 2;  4L0Z B;  2DA2 A;  3WTW C;  2IJL A;  5IT3 A;  4PFP A;  4IHV A;  3S93 A;  4GCK A;  1J9I A;  1B1B A;  2FF4 A;  2DMN A;  3QYB A;  4ENJ A;  4BGD A;  3OYL A;  2KJB A;  3IP4 B;  4HA8 A;  2KIS A;  2ZCN A;  4FET A;  5LGU A;  3VYS B;  4AID A;  3JRC A;  2W1O A;  3LWJ A;  1S9H A;  3GTM J;  2P5K A;  1SC7 A;  4D9J A;  2VON A;  3ASO H;  4D7M A;  4Y4R A;  3CDL A;  2OQR A;  4CGR A;  4JQF A;  3BZK A;  1Q1V A;  2K02 A;  2EBI A;  4XRS A;  2PLY A;  1BN5 A;  4PUS A;  2FX0 A;  2A05 A;  3BR0 A;  5DDG A;  4O3M A;  4OU0 A;  2OTJ I;  2RAE A;  1HKS A;  2CFO A;  1XPX A;  5CVU A;  4P9U A;  1BBY A;  5KAF C;  2YVX A;  2DU9 A;  2KL4 A;  2DA3 A;  3K10 A;  4OAY A;  5EJC A;  2A6H F;  2GZW A;  2MA3 A;  3BQZ A;  5GTH C;  1R49 A;  4XIC A;  4UUS B;  3CCS I;  2R7F A;  3G2B A;  4MFD A;  2I8D A;  4P55 A;  3KE2 A;  1BI0 A;  3JRE A;  1VQP I;  2DA5 A;  1X2N A;  2PJR B;  3E97 A;  3GYH X;  1P4W A;  3HXL A;  4YG2 F;  2CFX A;  2WGB A;  3OYI A;  1Z6T A;  4BXX J;  4M3E A;  1N75 A;  1Y0U A;  2HPI A;  2H1L A;  1ETW A;  3KKC A;  2HOT A;  4XID A;  1OCZ H;  2A2F X;  2E2H J;  5TGT A;  2XC7 A;  1Y8Q B;  1QA6 A;  5CXI A;  5A2Q K;  2WA0 A;  5E79 C;  4IVN A;  4XKW A;  3I56 I;  1K7A A;  3S1M J;  4RM3 A;  3DBH B;  5D4S A;  1RUN A;  2E7W A;  2LRE A;  2MC3 A;  4DNC A;  4ZYD A;  1FOK A;  4PJJ A;  4I76 A;  2JPB A;  5GPA A;  2DOF A;  3DBR B;  4D0P A;  3WTS C;  3E6D A;  4E7K A;  1WZ2 A;  1KU7 A;  2P7V B;  2HQN A;  1EKE A;  1HDD C;  2YVH A;  1ZKG A;  4B3A A;  1FBU A;  5DM7 F;  4E4H A;  1IXS B;  3ZQ7 A;  1MMD A;  3BLY A;  2IP2 A;  1SD6 A;  1D1A A;  1LNW A;  3BR6 A;  3D5L A;  2R7D A;  1JI8 A;  2ID6 A;  4A0Y A;  3GTQ J;  3CZ6 A;  3NWS A;  2XIG A;  2Y30 A;  2R7U A;  3LFU A;  4N9I A;  1P6R A;  1RIO H;  2QTQ A;  5HBU A;  2FE3 A;  2KRC A;  3AG1 H;  5TRD A;  4M9S A;  1D5V A;  2PMH A;  3WTU C;  1H9G A;  2EZL A;  4FIS A;  1EF4 A;  4M3D A;  2M2E A;  3F8C A;  5EEA A;  1FOX A;  5C3E J;  2CH0 A;  3ABL H;  1M1E B;  3M8J A;  5LGN A;  5LEJ A;  3NPI A;  1ETK A;  4PZJ A;  5EDN A;  3DTI A;  3NI7 A;  2ICW G;  2Y9Z A;  2F48 A;  2F07 A;  1LVK A;  1S29 A;  4RGR A;  1LDJ A;  4BQQ A;  5FD6 A;  4LK0 F;  1X1P A;  3KEY A;  3KEO A;  3KP4 A;  2Z2S B;  3NAU A;  3ZXS A;  2LG4 A;  5M3F J;  2XAH A;  1PUF B;  1B4A A;  2DFH A;  3SXY A;  3BP8 A;  3SZG A;  3V7C A;  5FRO A;  5L3F A;  4UNO A;  3JSP A;  2NRA C;  3IUV A;  3WE3 A;  1WJB A;  1RPW A;  5IYB J;  4ESF A;  5LHI A;  2LF7 A;  3HRM A;  3S3N A;  5ICF A;  1FC3 A;  1UAA A;  4WXH A;  1SAX A;  3RYP A;  1X3U A;  5AON A;  2UV1 A;  1KQ9 A;  3PNV A;  1T56 A;  3BHQ A;  1KGS A;  4BXU A;  4ZYE A;  5FGM A;  5BPD A;  3OR2 C;  4WF2 A;  3FMS A;  3GFI A;  4M6Y A;  2DFI A;  5FJ8 J;  4E7H A;  2Y9Y A;  2L01 A;  1U5T C;  1S6L A;  1W1W E;  2DT6 A;  3C2B A;  3J80 Z;  5FHP A;  4HNU A;  3F3X A;  4FAS D;  1SAU A;  4AM3 A;  4CYD A;  4EJV A;  2IS2 A;  3HC7 A;  3KP5 A;  2QWT A;  3BG5 A;  1OYY A;  5BPI A;  2GXB A;  3IL2 A;  1LJ9 A;  1J5Y A;  4XM3 A;  3BG6 A;  4YII A;  3OS0 A;  4A0X A;  4B44 A;  4CXF A;  2HR3 A;  3L2W A;  4A6E A;  4CSW A;  2W48 A;  1T98 A;  4Y33 A;  2HOE A;  3BTC A;  4RLF A;  1O3Q A;  2PMZ N;  2XGX A;  3TQN A;  2ESN A;  2EK5 A;  2R0Q C;  2A6E F;  3K4C A;  4RM2 A;  3SYT A;  4LG0 B;  1U0J A;  4LIV A;  3PQK A;  2EB7 A;  4KYW A;  4AF5 A;  2J5P A;  2KHM A;  2BZT A;  3CF2 A;  3T8R A;  3WTT C;  4W1U A;  2L02 A;  1X3W B;  3TDZ C;  3E5Q A;  5HOD A;  1FTT A;  4MIM A;  2DA4 A;  4BJ5 C;  1O7F A;  2EZH A;  2FBH A;  1IN5 A;  1YX5 A;  4KN4 X;  2ZXW H;  5L3B A;  1Q1H A;  1VF9 A;  2O8K A;  1TW3 A;  1X3Z B;  3HSE A;  4CYC A;  1XMA A;  3L2C A;  1G3T A;  2ADU A;  1YHQ I;  3TOA A;  4M72 A;  5J47 A;  2RAS A;  2A61 A;  1U8R A;  1NHA A;  1U6G A;  1W0U A;  3RQ4 A;  4HX4 A;  2OC6 A;  5E1Z B;  2EFQ A;  3I58 A;  4BXF A;  1VQO I;  3G7R A;  2IS1 A;  3C3W A;  3ON2 A;  1IXC A;  2GFN A;  4C2M A;  2VPL A;  2JMW A;  3HM5 A;  3IWF A;  3VDX A;  4AVP A;  1A36 A;  3VB2 A;  2XB5 A;  3L2V A;  3NWT A;  3OOU A;  2KRH A;  2HEO A;  2QKO A;  2EV0 A;  4C9Y A;  1UHM A;  2NS0 A;  3OYG A;  2Z3Y A;  2VXD A;  1RI7 A;  3GF2 A;  4U9L A;  3R61 A;  1OCP A;  2G7G A;  4KIF A;  2RNJ A;  1STZ A;  3FX3 A;  1I50 J;  4JX5 A;  1PUE E;  1OCO H;  1JTY A;  4BE2 A;  2VPR A;  5D18 A;  3LA2 A;  2P0W A;  1J75 A;  3GCM A;  2JPC A;  4U88 A;  3VVZ A;  4BBS J;  4OAZ A;  1JKP C;  3CWR A;  4A3M J;  4JP0 A;  3HL2 A;  1YJN I;  1VQ6 I;  2ZOZ A;  3B6C A;  2WAD A;  4FE7 A;  4G94 A;  1CF7 B;  3HYI A;  3DKX A;  5DCM B;  3CUO A;  3BTL A;  1OCR H;  1QNT A;  1YG2 A;  2V1X A;  3OYE A;  4HEA 2;  5BOX A;  2P7C B;  2BW3 A;  4RGS A;  3IWZ A;  2ZME B;  1LPQ A;  2M7B A;  5DS9 A;  3F6V A;  4YEL A;  2OPT A;  5B5E C;  4CIC A;  4C30 A;  1LFP A;  1HLV A;  2VJ4 A;  2D2W A;  2DG8 A;  2ELH A;  3LHQ A;  3K4B A;  1WVR A;  2FD5 A;  2IPQ X;  2QQ8 A;  4BQN A;  3IH4 A;  3GTG J;  2CW0 F;  3PNY A;  1ZR2 A;  3HPH A;  4PSW A;  1I27 A;  3I64 A;  2JVG A;  2H6B A;  2EV5 A;  4ZZD A;  2E36 A;  1IUF A;  2DT5 A;  3DLL F;  1B59 A;  3DTK A;  3BPX A;  1RZ4 A;  2MD5 A;  1DUX C;  3ZMD A;  2JQ7 A;  3E6C C;  2W25 A;  3BR5 A;  1JT0 A;  1IDY A;  2O7O A;  2QVO A;  2HPM A;  3A02 A;  2XB0 X;  1T95 A;  4A3B J;  2H8W A;  1V55 H;  2X85 A;  3S1N J;  5TIS C;  1QO0 D;  3I55 I;  2BE5 F;  4AVZ A;  1DU6 A;  2CO5 A;  3V42 A;  1BL0 A;  2XAU A;  1KA8 A;  1AKH B;  4ENN A;  3LSM A;  1NG6 A;  2E1O A;  2YPR A;  3OYF A;  4MGR A;  2GEN A;  4HV6 A;  2EWN A;  3BWG A;  3VVY A;  1HXD A;  2RC4 A;  1HW2 A;  2STW A;  2NVT J;  2AS5 F;  3P9T A;  1KU3 A;  3ML6 A;  4HKU A;  5ED4 A;  5DD4 A;  2EV6 A;  3RZD J;  2R7S A;  3E1S A;  2QIB A;  1LFB A;  3O6B B;  4HNT A;  2QQ9 A;  1FZP B;  3ROU A;  3SFI A;  3CUQ C;  2VB6 A;  2IGK A;  2VKD A;  4B43 A;  2OF7 A;  2E5N A;  3E7L A;  3W2W A;  2LFB A;  3VWB A;  2B1E A;  3HG9 A;  5BMZ A;  1SVM A;  3ZN0 A;  2O61 A;  2ETH A;  1ZAO A;  2F5C A;  2X1C A;  3K4N A;  1VQ7 I;  2DG7 A;  4XLA A;  3TED A;  1O4X A;  2QQB A;  3BR1 A;  5CLS A;  3OS2 A;  2HXI A;  1JKO C;  2L0K A;  2IT0 A;  2EPF A;  3JW4 A;  3ZQL A;  2OZ6 A;  3BJA A;  4WCG A;  3HOY J;  1VQN I;  2WB1 A;  2BXY A;  3B73 A;  3A01 A;  3V8L A;  2JUC A;  2MFZ A;  1QGP A;  1FYL A;  3R4K A;  2Y48 A;  1G3S A;  2O0Y A;  3L9F A;  2HVQ A;  2FML A;  3ONQ A;  1XGS A;  5E1W A;  1QHH D;  1WJ5 A;  1R7J A;  5DAJ A;  4YFX F;  5EEH A;  1Z91 A;  1VI0 A;  4E7J A;  5CKT A;  2IS6 A;  2E35 A;  3IH2 A;  1ZRD A;  4BU2 A;  2W57 A;  4Q5S F;  3GZ5 A;  3UKG A;  1V3F A;  2LLK A;  3S15 J;  1GVD A;  3BG3 A;  3O2P E;  2R3S A;  1V5G A;  3JRB A;  4FCY A;  5HDK A;  1TC3 C;  3VP5 A;  1IF1 A;  4OD4 A;  3LSP A;  2G7S A;  2PQ8 A;  3OYK A;  1SFK A;  2DJN A;  1G3W A;  2F4I A;  3K4J A;  3J81 K;  1ETO A;  4C2M J;  2WAF A;  3ASN H;  5F08 A;  4DIQ A;  1S7E A;  3BNI A;  3ZMU A;  1OIS A;  1YJW I;  3QQA A;  1CQT A;  3OR1 C;  1I3Q J;  3QOE A;  3FM3 A;  1BI1 A;  4DGW B;  1FBQ A;  4PK4 A;  4ENM A;  3PSF A;  1P7I A;  3BY6 A;  4OMZ A;  1EV7 A;  4BQO A;  2H6C A;  3V8J A;  1VTN C;  4A3K J;  2DPU A;  1I39 A;  3L1P A;  1ETV A;  2RDP A;  1SAN A;  4JK1 X;  1IAW A;  4ME9 A;  4E7I A;  3QOP A;  3IRQ A;  3QOD A;  4MK6 A;  3DV8 A;  3GFL A;  2CQQ A;  3K4L A;  3GO5 A;  4CZC A;  1NH3 A;  1ZLJ A;  2D45 A;  1P4A A;  2ZBK A;  4C3H J;  2E1M B;  2EH3 A;  2Y69 H;  3LMM A;  3FBN B;  4XRF A;  4ZDL A;  2L9N A;  2KIU A;  2KZG A;  3EUH A;  2VQG A;  3MKL A;  4QPO A;  2OJE D;  3F8B A;  4C2U A;  4F52 A;  4X6A J;  1A6I A;  5HS9 A;  2X4H A;  3VEP A;  1NK3 P;  5DTD A;  3GTO J;  1H89 C;  3FZV A;  2JSC A;  5E3L A;  4IRI A;  2XSD C;  2V9V A;  1MMG A;  1GV5 A;  2O03 A;  1YW7 A;  3PAS A;  3KX2 A;  2VI6 A;  3HKZ N;  2LKS A;  3HUG B;  5CVR A;  2ZOY A;  2DBB A;  2Q8K A;  2BY2 A;  2NXN B;  4JKZ A;  2LOO A;  3P9C A;  3MVP A;  4ENK A;  1JGG A;  4G12 A;  4NQW B;  4ITV A;  1ENH A;  3LST A;  1IXR C;  4BHC A;  5D8K B;  3CMM A;  4CH7 A;  1Z21 A;  1MSE C;  2EZI A;  4D5F A;  2BVM A;  5GPC A;  3WGG A;  2H8R A;  1T08 B;  2FRH A;  4MO7 A;  3D1N I;  3S2W A;  3I4M J;  1SD5 A;  2V4J C;  4OWR B;  4UDS A;  4HV5 A;  3HEF A;  1H9T A;  4HF0 A;  1FMV A;  4UVA A;  3NXC A;  2HZT A;  4PJL A;  5K7F A;  4IOC F;  4IPA A;  1BW6 A;  4OIR F;  2OBP A;  1YRN B;  1JXS A;  2FBI A;  2LSO A;  3CJN A;  3TP0 A;  3ULQ B;  4H4K C;  3FIS A;  1FP2 A;  2XAF A;  5D5X B;  4XMY A;  4UUV A;  2EIN H;  3DCF A;  1QU3 A;  5KVR A;  4LD5 A;  3DPL C;  4UB6 C;  3BOQ A;  4RLQ A;  4JYK A;  3ZQH A;  3Q5F A;  3NS4 A;  2WY7 Q;  1T39 A;  2DOE A;  2XDV A;  4IHT A;  4B48 A;  2EIJ H;  4XKC A;  3S3O A;  3AG3 H;  3S16 J;  1LE8 A;  2F5F A;  3BT9 A;  4I02 A;  1GV2 A;  2LD5 A;  2K9L A;  4N9H A;  1BI3 A;  4IRG A;  4I0A A;  1X4P A;  4XKV A;  3O8G A;  2ZB9 A;  3D5R C;  1W7P D;  3OYD A;  3GZN B;  4Z6Y A;  3E5U A;  4GRI A;  4IHX A;  1Z6R A;  3QPL A;  3HOT A;  5D5V B;  1EH7 A;  4F93 B;  2J5O A;  1B9N A;  3NRG A;  2ISY A;  1ZRE A;  2DXI A;  2E5Z A;  4HAM A;  5LRS A;  4LB5 A;  2V57 A;  1FNN A;  1K4S A;  4XL9 A;  4ZYA A;  4DBR A;  4A3F J;  1PP8 F;  2X6W A;  4L5J A;  4WK8 F;  4AWX B;  3F1B A;  3I59 A;  4GFK A;  2LK2 A;  4EJW A;  3BZ6 A;  2VQH A;  4PCQ A;  3BCG A;  2DAO A;  4RGU A;  2FBK A;  2V79 A;  2GIV A;  2M4K A;  4XK4 A;  5F27 A;  5GAE J;  2DPD A;  4HLY A;  5FKM A;  5F6F A;  2CV0 A;  2XRN A;  1IUY A;  1TQP A;  2L9V A;  2IGM A;  4N4O B;  1XB4 A;  4AC6 A;  1I5Z A;  2VBW A;  3M7G A;  3CCL I;  2ZJ2 A;  2ME0 A;  2EIL H;  1O57 A;  2KQR A;  1BC7 C;  1TWG J;  1I1G A;  2CGP A;  4WXC A;  1ZQ3 P;  5J8C A;  2HOS A;  4GO1 A;  3FXO A;  1QVU A;  5HLG A;  3HPG A;  2QA4 I;  2W84 A;  4UVB A;  3ERM A;  3VIB A;  3AG2 H;  5JHF A;  3H5A A;  2WWY A;  3K7A J;  4XBF A;  3DEE A;  5EGO B;  3QKX A;  3FMR A;  3H3V K;  1HA8 A;  3CLQ A;  2XPV A;  1R5H A;  4PSX A;  4IL6 C;  1YIO A;  3AKZ A;  4BQA A;  4CGZ A;  3GXO A;  5JHU A;  4KT6 A;  4PXI A;  3TO9 A;  2CWE A;  5D6E A;  2E71 A;  2EFW A;  2L9R A;  4LMY A;  2QZ8 A;  4V2F A;  3TKY A;  4KMU X;  3QYE A;  3IC7 A;  2PG4 A;  4M3B A;  2CQ7 A;  4DJA A;  2K4J A;  1E3O C;  1HCR A;  3MFK A;  4MTE A;  2A5W A;  1Z3Y A;  1X1A A;  5IY5 H;  5ICC A;  1MD0 A;  1AA7 A;  2ZKZ A;  3AL0 C;  1DDN A;  4BDY A;  1JKR C;  3T8T A;  2YU9 J;  4F7Z A;  4RMN A;  5EYR A;  2M34 A;  1BR2 A;  4A3E J;  3MZY A;  4HX7 A;  2Q24 A;  5F0F A;  3I71 A;  4ESJ A;  1USS A;  4A93 J;  1FOY A;  4B4C A;  3MN2 A;  5CVV A;  1BOB A;  1MBJ A;  4W97 A;  3E3V A;  2QQA A;  3RSN A;  4E7S A;  1GXP A;  4N4N B;  2AXT C;  2Y0S N;  1PYV A;  1UEL B;  2OQG A;  3KZ9 A;  1IN7 A;  5CW8 A;  4NBQ A;  1REP C;  2HQA A;  1ZHF A;  3VW1 A;  4G8X A;  3LSK A;  2E7X A;  2P5L C;  1MJB A;  3HOS A;  4Y3O A;  2X9D A;  2RHA A;  3CJT B;  3PO2 J;  2P81 A;  1D8K A;  5M5Y J;  3GZI A;  4M73 A;  1WH7 A;  4QIW N;  3DXJ F;  5KCM A;  3SJM A;  3CC2 I;  3SWH A;  2GUH A;  3NAR A;  4ESB A;  5C4X J;  2PMZ A;  3HHH A;  3NQO A;  1IW7 F;  2CQK A;  2PMU A;  3M9A A;  2FU4 A;  5K7H A;  2LYC A;  4Y52 J;  3REO A;  3CLO A;  2MLG A;  2NVY J;  2MG4 A;  1SFE A;  3OMY A;  3COL A;  4YIR X;  3A0B C;  2M0C A;  5HDN A;  3GTL J;  1O3S A;  4II3 A;  4P5O A;  2X6O A;  1K79 A;  3B02 A;  2ZC2 A;  4BY7 J;  2G7L A;  1NTC A;  3FXJ A;  2PFV A;  1XG1 A;  4ON0 A;  4QPQ A;  3C2H A;  1IRF A;  5LLQ A;  2CW8 A;  3HTU A;  4LIT A;  4ANJ A;  1QQI A;  4FX4 A;  2DT7 B;  5JR3 A;  4HBL A;  4RAY A;  3TO6 A;  2VT2 A;  4BAY A;  1S8N A;  4EEF G;  2R93 J;  1YO5 C;  2EFN A;  3JAM Z;  1R36 A;  3BJB A;  1B8I A;  3S3M A;  3FDY A;  3QWL A;  3WU2 C;  3GFM A;  1XGO A;  1QRY A;  2KDO A;  3VUQ A;  2M4G A;  3ABK H;  3CCE I;  2M7A A;  4FX0 A;  3F9K A;  4M3G A;  4FQG A;  1WWX A;  5DUK A;  2WAQ A;  1TWA J;  5E20 A;  1LEB A;  3ZCO A;  5ILS A;  2MBF A;  3BJO A;  2Y31 A;  3HRS A;  4XNF A;  1RUO A;  1JUM A;  3S14 J;  2COB A;  1MBG A;  3KYC B;  3F23 A;  1UG0 A;  2KKO A;  3HOU J;  3MKY B;  1FYK A;  1TZL A;  1MBE A;  2IA2 A;  3ABT A;  1ZRC A;  1U5T A;  3LWF A;  5B3S H;  5ILV A;  5B1B H;  3LQR A;  3IRR A;  4ZDO A;  1UHS A;  3ZP5 A;  2JTV A;  2ZY9 A;  4EM1 A;  2XGE A;  3HTS B;  4A0Z A;  1DGR M;  1UZC A;  1SFU A;  4G7H F;  1WPK A;  1SD7 A;  1XDU A;  2LC2 A;  1G3Y A;  4XOT A;  3CC4 I;  1T6S A;  4HF2 A;  4BAC A;  3ZQI A;  1R5G A;  4L9J A;  3RJP A;  2EJR A;  2L4M A;  1X2M A;  5FD5 A;  2E19 A;  4XRS G;  4RA2 A;  2PX9 A;  3ZOB A;  1ITY A;  5E3O A;  4GCT A;  2L2O A;  2KIF A;  2FNA A;  2V1D A;  2GQQ A;  3H9Q A;  2ME6 A;  3LSJ A;  4EMS A;  2B7E A;  1Y0N A;  5CPR B;  5E3M A;  1YIT I;  4BNC A;  1IRG A;  3W2A A;  1QPI A;  1B9M A;  1YQA A;  4UXN A;  4IJA A;  3L7W A;  1F43 A;  5HAW A;  1LUJ B;  4F55 A;  2Y2Z A;  1ETQ A;  1A04 A;  3H5N A;  4XN0 A;  3AG4 H;  4HNV A;  3H3Z A;  2NNY A;  1H8A C;  2FJ1 A;  3RZO J;  5HLI A;  1R5I D;  2ACJ A;  1DU0 A;  1XCV A;  3TBI A;  3FXL A;  2G7U A;  5D19 A;  5DUI A;  2XGC A;  2KFD A;  3SZT A;  2E34 A;  4OOI A;  5FLX Z;  1ON2 A;  2HTS A;  2DK5 A;  4CHU A;  4AYB N;  5IPA A;  2CV1 A;  4CCO A;  3SQN A;  3QYF A;  3SHF A;  2Q0O A;  3ZGK A;  3Q3S A;  3S2H J;  2Q2E B;  2XAJ A;  2HQ5 A;  2MLK A;  2R5Z A;  5LFA A;  5D5U B;  5K7Z A;  3BZC A;  1D5Y A;  3OIP A;  3TL4 X;  3TP3 A;  2VOP A;  1RET A;  2ZNZ A;  5ERI A;  5M5X J;  2XF5 A;  4I98 B;  2H1K A;  1ODD A;  1B72 A;  2XKO A;  1G2H A;  2XAQ A;  2OAZ A;  3GEZ A;  2AHQ A;  2TCT A;  1D1B A;  3RCO A;  3PNT A;  1F5T A;  2KMU A;  2Z9O A;  5F64 A;  1S3J A;  5JLX A;  3VPR A;  1Z77 A;  4IRV A;  3A2K A;  3LFK A;  4IX7 A;  1A35 A;  2V1U A;  5EG0 A;  2QLZ A;  3COA C;  1H88 C;  2L4A A;  2P4W A;  3DTE A;  3Q9V A;  4GYG A;  1LEA A;  2R7V A;  2V9P A;  3GLX A;  4CYC B;  1QHG A;  2GIZ A;  2Q1Z B;  4NC6 A;  2X6X A;  5CYV A;  1IZ1 A;  4A3D J;  3H35 A;  5CQE A;  1YFH A;  1ZGW A;  3PO3 J;  1HF0 A;  3I3L A;  1IV8 A;  2FMY A;  3Q0V A;  2HKO A;  2OCC H;  2Y75 A;  1OKR A;  1OCC H;  3GTJ J;  3RIR A;  2HNH A;  1MDM A;  1GUU A;  3VOX A;  4L5I A;  2ZXI A;  4Y7N J;  4BEH A;  1BR1 A;  3WU1 B;  5HLH A;  2MSY A;  3H9G A;  3B6A A;  3G56 A;  2CG4 A;  1T33 A;  4Z2Y A;  1VQ5 I;  2LY1 A;  3GTK J;  2VC0 A;  2RGV A;  5FB2 A;  3SFZ A;  2RKH A;  2HU9 A;  1C0W A;  4DQ2 A;  2FXA A;  1FMW A;  3EUP A;  1WRJ A;  4Q48 A;  1MNM C;  3BRU A;  2CUJ A;  1ZN2 A;  1XSX A;  3KLN A;  4XLF A;  2NOJ B;  2FEZ A;  3MMY B;  1G6N A;  4XN3 A;  2UXH A;  5A2Q Z;  2XAG A;  2FNP A;  1ACI A;  3D5S C;  4UHT A;  2WUI A;  3WU0 A;  3ON4 A;  1YOV B;  3H1C A;  1OLT A;  2M3A A;  1PJR A;  2GA2 A;  1Y39 A;  1OCT C;  3U2R A;  3I53 A;  3JR9 A;  4ZTF A;  1IV6 A;  4C2T A;  2VLA A;  5K5O A;  2QKL B;  1EA3 A;  4Y15 A;  4S05 A;  2BW3 B;  2XHK A;  3RTR A;  1V54 H;  4MFE A;  2KLO A;  3H0G J;  2QF7 A;  3S5R A;  3U1K A;  3MQ0 A;  4X1E A;  5C4Y A;  5ICG A;  1ZK8 A;  1QBJ A;  3BR3 A;  4RAF A;  2HTJ A;  2NAZ A;  4LLN A;  2ZJQ F;  5DEQ A;  4UV9 A;  1YS6 A;  1BIA A;  2DLL A;  2LRD A;  1IDZ A;  3CJR B;  3HOW J;  3CUQ A;  2IAI A;  5B66 C;  2STT A;  2H94 A;  4O6J A;  3K8P C;  4YEJ A;  1GLN A;  1TWC J;  1DP3 A;  4LB6 B;  3ZQG A;  4MEY F;  4ZJZ A;  5DM6 F;  5D8L B;  1ETY A;  1Z9C A;  3OYJ A;  4ZDP A;  2F4O B;  3FXK A;  1PP7 U;  1VQM I;  3V78 A;  1HW1 A;  1BIB A;  5GAD J;  3S2D J;  2AQE A;  5J6X A;  2JA2 A;  3K9T A;  1R22 A;  1X58 A;  2QGU A;  4G7O F;  2ECB A;  1N77 A;  1BM9 A;  3EDP A;  2W85 A;  3HKZ A;  1A31 A;  1R6R A;  2ID3 A;  3Q0U A;  2EFO A;  4NB5 A;  2LY2 A;  5F0C A;  1ZAR A;  2IEK A;  2UXX A;  2OI8 A;  3A0H C;  4XLC A;  3ZQC A;  5FRN A;  4IEJ A;  4L9V A;  2GLO A;  3RPU A;  3LQQ A;  5JLW A;  5K5R A;  3FMQ A;  4L9N A;  2YR2 A;  4XQF A;  4D5C A;  5LGT A;  1MBK A;  2YX4 A;  5DV5 A;  3VYU B;  1KU9 A;  2RQQ A;  5F1R A;  2WC2 A;  1W4M A;  1OR7 C;  3KFW X;  1MH4 A;  4A12 A;  5FKN A;  1LDD A;  3OYA A;  5KNL A;  3BCA A;  3OYB A;  1D0Z A;  5IT9 K;  3QBM A;  3CQZ J;  2JRT A;  4GCL A;  1FIA A;  3HJE A;  2XKP A;  2ZME C;  3K69 A;  5D4R A;  2R7Z J;  1W5S A;  2FQ3 A;  3JSJ A;  1WH5 A;  2L7K A;  4R79 A;  2BHY A;  4RS8 A;  3AAF A;  1K78 A;  1SFO J;  2LDU A;  5BQT A;  1VQ9 I;  3QP6 A;  1XMK A;  3OS1 A;  3PUF A;  1XTA A;  1R00 A;  5IP7 J;  4KIB A;  3RQI A;  2G0E A;  1HKT A;  3OIO A;  2ZJP F;  4S0H B;  2HI3 A;  1TNS A;  4HST A;  2RVC A;  2HWV A;  1J0R A;  5ICE A;  1XX5 A;  4OIO F;  3FBI B;  4CCJ A;  2OZU A;  4J19 A;  1X1C A;  3EET A;  3S1Q J;  4KIG A;  4OIN F;  5JVT A;  3CCU I;  4TV7 A;  1FX7 A;  1YLF A;  2G9W A;  2LBF A;  1DPU A;  3K70 D;  3HTH A;  1JT6 A;  3V6G A;  3OYH A;  1R4M B;  2VQL A;  2CUF A;  4I0B A;  4L0Y B;  2GOX B;  5JVG F;  2OV7 A;  3ZMT A;  3ABU A;  3QPH A;  4CDG A;  1GT0 C;  5DD8 A;  3K70 C;  4E7Z A;  3I54 A;  4I01 A;  1BOA A;  1Y56 A;  1H0M A;  2XUB A;  1WKM A;  2E1N A;  2OER A;  3CES A;  1J59 A;  3MZ8 A;  1P2F A;  4O5V A;  1YW9 A;  4A3C J;  2CJJ A;  3H3U A;  2QBY A;  3DBL B;  4LG3 A;  4CUG A;  1RR7 A;  4G6Q A;  2O9L A;  2R5Y A;  2VJJ A;  1T2K A;  1UB9 A;  2JA7 J;  1LVA A;  2W82 A;  5GTI C;  3EUA A;  4PFO A;  1ZLK A;  4UB8 C;  2KP6 A;  1X1B A;  4RB1 A;  2FQ4 A;  3VOD A;  3M07 A;  2V6C A;  5J1R A;  1J2X A;  5CQG A;  4G9Y A;  1LB2 A;  2M8G X;  2CV2 A;  4AIH A;  4RDU A;  1LFU P;  3P9I A;  1ZH5 A;  4HLX A;  3M8F A;  5E17 F;  4UV8 A;  2ZJR F;  1IO2 A;  1UST A;  3HDD A;  1RES A;  3ZMV A;  4F91 B;  2FJI 1;  2REK A;  1R1V A;  2HQR A;  2XPU A;  1JE8 A;  2GBY A;  2DO7 A;  2LVS A;  3H5R A;  3CME I;  3KP3 A;  5EEG A;  1ZG5 A;  1XS9 A;  4LJZ F;  3A03 A;  4HQE A;  2VUM J;  5H9T A;  2I5U A;  2O7T A;  2QCO A;  3VTI A;  1MZB A;  1ZGJ A;  1FWZ A;  1S7O A;  4P9F A;  4PGG A;  5AQC A;  2NYX A;  1A6Q A;  2DN0 A;  5J3L A;  4NNJ A;  3HTA A;  2BVL A;  3O8H A;  1JTX A;  1ZEL A;  4HW0 A;  2DQL A;  3J7Y J;  2CQN A;  2UXU A;  4DBQ A;  4JOM A;  4V19 K;  3I9V 2;  2AXL A;  4EJO A;  1T8I A;  2Z5U A;  2R7O A;  3OYM A;  1YW8 A;  2GXG A;  4KIC A;  1KZH A;  5FKO A;  3R6S A;  2X1D A;  2YX7 A;  2IBD A;  3L2U A;  4B3X A;  1IJW C;  1YI2 I;  3FM5 A;  3ERE D;  3BG9 A;  1WCM J;  4NN1 A;  1LDK B;  1WJC A;  1XSV A;  2A68 F;  2KIQ A;  2O8X A;  2NVU B;  3QU3 A;  3P7N A;  1FYM A;  3VSL A;  4JX4 A;  2EIK H;  2DK8 A;  4F92 B;  1WGX A;  5HOO A;  2O6G E;  3FK6 A;  5LEK A;  4DW6 A;  2R7Q A;  2LKP A;  1W7P A;  5GP9 A;  4EVI A;  4M3F A;  2X1E A;  3EGQ A;  2DA6 A;  4IHS A;  4JBA A;  3W3C A;  1WFX A;  1ON1 A;  4E7L A;  1MMA A;  4XRM A;  3CO6 C;  1R9T J;  4XR6 A;  1R71 A;  2A07 F;  1SEU A;  2YVE A;  4HX8 A;  1IC8 A;  2R7X A;  3LL7 A;  3DEU A;  3VYR B;  1JJ8 C;  3BJ6 A;  3HOV J;  2NS7 A;  3KP2 A;  4BE0 A;  4OIQ F;  1WJE A;  2RNG A;  4U9N A;  4IRH A;  2Z16 A;  4U0W A;  3HOZ J;  2E1M C;  5KAI C;  4GGG A;  4F3Q A;  5ILU A;  2PJP A;  2BYV E;  1X1D A;  2OUM A;  2VAS A;  1WJD A;  3MAJ A;  3HSR A;  1IRZ A;  3ZRG A;  2H27 A;  3IKT A;  1LE8 B;  1XCB A;  1A5J A;  3KP7 A;  2IU5 A;  4LFU A;  3PL8 A;  1HSJ A;  3PPB A;  1HQC A;  2EQR A;  4HOB A;  1JGS A;  4CCN A;  1UHW A;  3W6V A;  1ZG1 A;  3HIM A;  3BTJ A;  4BYY A;  2UXN A;  1TW2 A;  3DPT A;  1HDP A;  3FKI J;  1Z67 A;  1MSF C;  5L3C A;  2WB1 N;  2VT3 A;  1SGM A;  3SDG A;  4AIJ A;  1F36 A;  2VBX A;  5FGL A;  2BEO A;  1IN6 A;  1W36 D;  4KFC A;  3F6O A;  3I59 B;  1R4N B;  1YS7 A;  1K6Y A;  2R7W A;  4IQ4 A;  3K2A A;  3RKY A;  2AO9 A;  2GXA A;  3I4N J;  3GTP J;  1WJF A;  1OPC A;  4D7N A;  4P96 A;  1YTY A;  4KNY A;  3TGN A;  1L3L A;  1MMN A;  3GW2 A;  1X19 A;  3DKY A;  1HKQ A;  2M1B A;  2JN6 A;  1ONV A;  4KN7 X;  5K1Y A;  1TT5 B;  1NG7 A;  4A3J J;  5HS8 A;  4P1W A;  3LOC A;  3CMA I;  2O5R A;  2PBX A;  2K85 A;  4G6D A;  3G4S I;  3GWZ A;  3KNW A;  3VW2 A;  3IV5 A;  3M8E A;  4DZP A;  2DJI A;  2MYS A;  4BUP A;  3Q0W A;  3W6K B;  5LHG A;  5EFY A;  1VND A;  4II2 A;  4DYC A;  3OYN A;  3TO7 A;  1Z0X A;  4G7Z F;  3HB9 A;  4M9Z A;  4YFK F;  2I10 A;  3BR2 A;  1MMS A;  1DQU A;  1Z1D A;  3K4K A;  1MND A;  4Y17 A;  3X2Q H;  3DEW A;  2QM3 A;  2TRT A;  3PSI A;  3LSR A;  5CJ9 A;  5KHD A;  4PJN A;  2EIM H;  4CZZ A;  5FKL A;  3H9J A;  3CMY A;  1CGP A;  1U2W A;  3DP7 A;  3KZZ A;  1G8X A;  1QPM A;  3DF8 A;  3FK7 A;  1UI6 A;  4BL0 B;  3FHZ A;  2PN6 A;  3J80 K;  2JWT A;  4HPQ A;  2CUZ A;  4KMF A;  2E2I J;  3G3Z A;  4UVC A;  3MWM A;  1WI3 A;  1TLH B;  2XV4 S;  2DYS H;  2F4M B;  2L54 A;  4RAZ A;  3J81 Z;  2VN2 A;  3FF5 A;  4ICH A;  3C2G A;  2QEX I;  2ZCX A;  2CUE A;  1YYV A;  4G6T B;  4L18 B;  2JVH A;  1IG7 A;  2IW5 A;  1OQY A;  4M71 A;  4J01 A;  2K9S A;  1S5L C;  3R0A A;  3AQS A;  1TT0 A;  1KQ0 A;  1R23 A;  3G1M A;  3EYI A;  1O3R A;  5FMP A;  2M5W A;  4A3I J;  2ZFU A;  2Y0M A;  5L3G A;  2IVM A;  3OY9 A;  5FLM J;  4AYB A;  2W53 A;  2BHZ A;  4B8X A;  3MKZ A;  3CJD A;  3AFH A;  2X48 A;  4JX6 A;  1FIP A;  3GX4 X;  3KET A;  3JTH A;  2VBZ A;  2HDC A;  4ASN A;  2F2E A;  2JZY A;  1OJL A;  2K9N A;  4CCM A;  4GCV A;  1FBS A;  2DA7 A;  4GFL A;  3GFJ A;  3Q9S A;  4A6D A;  1LKX A;  3RYR A;  4Q47 A;  3TDU C;  1XN7 A;  1QVT A;  3P5J A;  1RKW A;  3WTX C;  3G1L A;  3LA7 A;  1BR4 A;  2B0L A;  9ANT A;  4M6V A;  2H09 A;  3M1C A;  5E3N A;  2KPM A;  1T0F C;  1YJ9 I;  2DFE A;  3K1M A;  2YS9 A;  2FBQ A;  3E5X A;  2D1H A;  3F22 A;  3V4G A;  1FLI A;  4UUS A;  1I6H J;  3U21 A;  3CP2 A;  1SVL A;  3OIQ A;  5J1Y A;  4DVY P;  1HC8 A;  3JRA A;  3KCC A;  1Z7U A;  1HBX G;  2JA8 J;  2PJR A;  2BY0 A;  4PGH A;  5FFX A;  2B63 J;  3DU6 A;  2YU3 A;  1AHD P;  2RRE A;  2DCE A;  3WTY C;  3LAJ A;  2YUS A;  2UXO A;  3IAS 2;  1TNT A;  2W24 A;  5C44 J;  2CRG A;  2LR8 A;  3MCZ A;  5BS6 A;  1U9N A;  5BNG A;  4A3L J;  1U8B A;  4U0Y A;  2Z33 A;  1B8I B;  4YZE A;  1DGW Y;  3PFY A;  3JTG A;  3F21 A;  1D8J A;  1K83 J;  2VQC A;  3O3K A;  2V7F A;  4I09 A;  3TW7 A;  4AD9 A;  4C3J J;  2G3B A;  4OIP F;  2M0M A;  1KYW A;  4KJZ A;  1WI9 A;  3PIP F;  3HRU A;  2VE9 A;  2A6T A;  1KU2 A;  5HLT A;  4U0V A;  3CC7 I;  4UY8 I;  2VJI A;  3C7J A;  2IGN A;  4L5E A;  2UUZ A;  1AU7 A;  3J7A Y;  1XD7 A;  5FO5 A;  3LNQ A;  2PEX A;  2C6Y A;  2UWM A;  1SMY F;  1GHC A;  1RKT A;  2K40 A;  2M45 A;  1FY7 A;  1U5T B;  4KDP A;  2BY1 A;  3P9K A;  2UZK A;  1Z7L A;  2ZCW A;  1UCR A;  1D3Y A;  3QU6 A;  5FKK A;  1ZRF A;  4NEL A;  3T5X A;  4CCK A;  4I99 C;  2BY3 A;  2YSR A;  2BOL A;  3DQV C;  3G73 A;  1E0E A;  4AUX A;  2WY8 Q;  1B6A A;  2WV1 A;  2XAS A;  2MAB A;  3FWE A;  3WGH A;  1E2X A;  3E0J B;  2V26 A;  2DOA A;  1R1U A;  1RC9 A;  5K5Q A;  2DFF A;  1Y8R B;  1U78 A;  2B3W A;  4A5N A;  2ZO4 A;  2LNB A;  2QWW A;  2DYR H;  3JRD A;  3SDB A;  4ZTJ A;  3WGI A;  3ANG A;  1POG A;  3HHG A;  2X51 A;  3J7A O;  1FT9 A;  3CCV I;  3ECH A;  4MNU A;  3T1B A;  2LKX A;  3PM1 A;  4U87 A;  2MH9 A;  4EQQ A;  4EV0 A;  3RKX A;  2DMQ A;  3CCY A;  2NVX J;  4BE1 A;  2LMD A;  2XRL A;  1TTY A;  1PUF A;  1ZGA A;  3BPV A;  2QOP A;  4AC0 A;  1NK2 P;  5JI6 A;  3ISP A;  3RH2 A;  3V7S A;  4LOC A;  3VOK A;  3GME A;  3RPQ A;  1APL C;  2WBM A;  5HNF A;  2VKV A;  4DYR A;  1IN4 A;  1W5T A;  1QZZ A;  5AIQ A;  4YRV A;  1S72 I;  4AIK A;  2HDW A;  1TWF J;  4Q4Z F;  3GEU A;  2JT1 A;  2X6Y A;  1MKM A;  3BG7 A;  5F04 A;  4B09 A;  4GXO A;  1FJL A;  4EGZ A;  3CDH A;  4QSH A;  4X0G A;  4XLE A;  3J7Z I;  3JSO A;  1O3T A;  1TP4 A;  2NX4 A;  2LH9 A;  5L3D A;  2R5Z B;  3DPJ A;  2VJ5 A;  3HIF A;  1EH6 A;  2CMP A;  3ZMS A;  1BC8 C;  2IXS A;  3GUD A;  2QSG X;  2V1N A;  3OOP A;  2V9K A;  4RGX A;  4I2O A;  4XLH A;  4DYQ A;  1AWC A;  2ZFW A;  5D5W B;  3KLO A;  3CP8 A;  1B72 B;  2Q2E A;  4EJU A;  2IS4 A;  4WX9 A;  4HF1 A;  4CA0 A;  1O7L A;  3ZPL A;  2DTR A;  2VL8 A;  5IOZ A;  2HZD A;  1Y6I A;  4IO9 F;  4BDZ A;  2CU7 A;  2IGO A;  4KA4 A;  2QSH X;  1EH8 A;  2ZSH B;  4U7D A;  2LP0 A;  5E8I A;  1Y1V J;  5EG0 B;  5HNH A;  3EUK L;  3CCM I;  3S17 J;  1K6O A;  4LG0 A;  2MC4 A;  3TOB A;  4N0B A;  4BBR J;  2K9M A;  1SD4 A;  3HBL A;  2HS5 A;  3ZN1 A;  2IA1 A;  3BC8 A;  4GFB A;  3G6E I;  1OFC X;  1SFX A;  1PVE A;  1VQ8 I;  5FRM A;  2NP3 A;  3HTI A;  4GDF A;  3S1R J;  5HSZ A;  3PFI A;  1ORK A;  2M30 A;  3BTI A;  4FHT A;  3ABM H;  3H0D A;  2PI0 A;  1K61 A;  3ZQQ A;  3ANP A;  5IP6 A;  3FKJ A;  3CTA A;  1MDM B;  3RKW A;  2L7F P;  3N05 A;  3H36 A;  2P5V A;  4RB2 C;  4BEH B;  2JA5 J;  3WHC A;  3KPH A;  3T0Y A;  2GOM A;  3M1E A;  2NVQ J;  3WE2 A;  3I5U A;  2LTP A;  2HYJ A;  2VKE A;  1TBX A;  3QPS A;  2TDX A;  4KUM A;  4BJT A;  3GLL A;  2GA1 A;  2OTL I;  4I6Z A;  3CF5 F;  2ELK A;  3EYY A;  3LAP A;  4MEX F;  1YX3 A;  3VSK A;  3OSG A;  2HYG D;  2XRO A;  3IUO A;  1XSD A;  2WAQ N;  3A4C A;  4ZYG A;  1V5E A;  1XMX A;  5J1U A;  2ESH A;  4IHY A;  2XF7 A;  2L7M P;  4H0E A;  3KKD A;  4V2G A;  3K0L A;  3HTJ A;  2VBY A;  3LA3 A;  4QWQ A;  4XLN F;  2BV6 A;  1JUS A;  1XDS A;  2F5D A;  2K5C A;  2CS3 A;  1N25 A;  3G1O A;  1DP7 P;  2K86 A;  3NRV A;  1SMT A;  5H20 A;  5D1R A;  4IKF A;  1UFM A;  1VZ0 A;  1F4K A;  2K3F A;  2RN7 A;  1U9O A;  3WOD F;  1QZY A;  3DPU A;  2COM A;  2BXZ A;  4BHP A;  4E6K G;  5L3E A;  3VVX A;  2A5Y B;  3K2Z A;  1RR8 C;  1OR7 A;  2HVS A;  2L5Q A;  3JRI A;  1CF7 A;  5HDG A;  5DCM A;  3F8M A;  3BRO A;  1T38 A;  3CUQ B;  2HKX A;  2WV0 A;  2JSP A;  4B47 A;  2XF6 A;  3ESW B;  2ZME A;  3HGY A;  4IHW A;  3O60 A;  2EZK A;  4R8H A;  2DMT A;  2DA1 A;  3OYC A;  1FSH A;  1UJ8 A;  1QZE A;  2HGC A;  1E3P A;  1FPQ A;  1K4T A;  2OCE A;  4XKB A;  3OWT A;  4XON A;  2A69 F;  2CQX A;  2NS8 A;  3K6G A;  2E1C A;  5E18 F;  3OL4 A;  2DQR A;  1VQ4 I;  2G7H A;  4ETS A;  1IN8 A;  4NUB A;  2VOD A;  4BS9 A;  1JHF A;  3LSG A;  1Y1W J;  3WTV C;  1KQ8 A;  4AU7 A;  2QSF X;  3K1N A;  3MD2 A;  3SZP A;  1JHH A;  5KK1 A;  4KIS A;  3T6N A;  3BDD A;  2HXO A;  4CCL A;  3HOX J;  1N78 A;  2OU2 A;  5M5W J;  1GXQ A;  3CCJ I;  4M6X A;  3KYL A;  3HSF A;  2W7N A;  2B9S A;  4XSX F;  3ELK A;  1R58 A;  4IF4 A;  5J40 A;  3A1Y A;  2Z1D A;  2UXI A;  5K58 A;  5M3M J;  2KDZ A;  4BJ6 C;  1YE9 A;  1P9Q C;  4CO8 A;  2VC1 A;  4BKX A;  2VOO A;  1AKH A;  3DLA A;  2HVR A;  2MW8 A;  3N4M A;  1IRX A;  1MGT A;  2VKH A;  3JCU C;  4FT8 A;  4NC8 A;  1D0Y A;  4A2U A;  1VFC A;  3L2Q A;  2CYY A;  5IP9 J;  2PFB A;  5EF6 A;  2CSO A;  5IYD J;  4IQJ A;  1ZYR F;  3E6M A;  2KT0 A;  4PJ0 C;  2L9S A;  2MH2 A;  5DYM A;  1K78 B;  4XOR A;  4U7B A;  4A3G J;  5LBQ A;  2XDN A;  1P92 A;  4LK1 F;  4YFN F;  3QRF F;  3OL3 A;  4HSR A;  2Z99 A;  3VFZ A;  2VE8 A;  4R1H A;  2D5V A;  2K9Q A;  5IOY A;  1E3H A;  3VW0 A;  4BHB A;  5E8G A;  3C1D A;  4GYI A;  2EFP A;  2IRF G;  3A01 B;  1GVJ A;  2HOA A;  1I6X A;  1JJ6 C;  2DTZ A;  4B1R A;  2GM4 A;  3TW6 A;  1G4D A;  1MBF A;  4HDV A;  4ZC3 A;  3G71 I;  2PBI A;  2D1V A;  1I3A A;  1V4R A;  2N8G A;  4K2E A;  2LBF B;  2K3P A;  1U3E M;  1BA5 A;  1IGN A;  2MGQ A;  2E60 A;  4PDK A;  3HE0 A;  4HZF A;  2KIM A;  1VQK I;  1YIJ I;  2D6Y A;  1UMQ A;  3RPU D;  4JL3 A;  3W2V A;  2P6S A;  4XLP F;  3BCB A;  4MXM A;  2M8E A;  3GBG A;  5H6Q A;  1UI5 A;  4ACI A;  4FE4 A;  5D6F A;  4EJT A;  3HRT A;  4MQ9 F;  2OA4 A;  2QBY B;  3CO7 C;  3L2R A;  1E17 A;  2R5Y B;  3KZI C;  1TWH J;  2FUG 2;  3GVA A;  3PUB A;  3VYT B;  3RD3 A;  3JRG A;  2DDB A;  1OYW A;  1MIJ A;  2HFH A;  2ZXJ A;  3C07 A;  4BH9 A;  4J00 A;  3IKV A;  3MZH A;  2CW7 A;  3HGG A;  2QKM B;  5JFR A;  4MTD A;  2ELJ A;  1FP1 D;  5CXG A;  1OMI A;  2IA0 A;  4PJM A;  1XGN A;  3TMO A;  1LQ1 A;  2M87 A;  4XOP A;  1OYI A;  4KIT B;  5H2F C;  1WQ2 A;  5CVJ A;  3UNG C;  1G59 A;  2AQF A;  4HDU A;  3R0J A;  3E7Q A;  3L09 A;  3FIW A;  2F6C A;  3N97 A;  3QAH A;  1BJZ A;  4WWC A;  1HST A;  5J4V A;  2R7T A;  2X0L A;  2L7Z A;  1HW5 A;  1MNE A;  3C18 A;  1MJ9 A;  4LIU A;  2VXZ A;  4RB3 C;  5LD2 C;  2NOG A;  4IXA A;  1D1C A;  4IZZ A;  2V6E A;  4NHJ A;  1ZG3 A;  3GZ6 A;  4S04 A;  1WJA A;  4ABZ A;  2BBY A; 
#chains in the Genus database with same CATH homology
 1WI3 A;  2FD5 A;  2ME6 A;  3LSJ A;  2HYT A;  3IH4 A;  3GTG J;  5EZG A;  3ZQF A;  5E3M A;  1ZR2 A;  2JJ7 A;  5F0H A;  1W0T A;  1QPI A;  4L62 A;  3FRQ A;  4ICH A;  1F43 A;  2ZCX A;  5HAW A;  2CUE A;  1IUF A;  2JA6 J;  3M4O J;  2Y2Z A;  3LJL A;  1ETQ A;  1IG7 A;  2DMP A;  1ETX A;  4HNV A;  1H8A C;  2FJ1 A;  3RZO J;  2K9S A;  3RKQ A;  1DU0 A;  1GDT A;  3BR5 A;  3AQS A;  1JT0 A;  5FMP A;  1IDY A;  3G1M A;  2O7O A;  2XGD A;  4DZJ A;  3A02 A;  4A3I J;  5D19 A;  2XB0 X;  4A3B J;  2XGC A;  3B81 A;  4BY1 J;  1BW5 A;  5FLM J;  3S1N J;  5EZH A;  4AYB N;  5IPA A;  1DU6 A;  2W53 A;  1BL0 A;  3CJD A;  2X48 A;  4JX6 A;  1FIP A;  3JRH A;  1AKH B;  3Q3S A;  3S2H J;  1OJL A;  2K9N A;  2E1O A;  2R5Z A;  2HQ5 A;  2GEN A;  3VVY A;  5K7Z A;  1D5Y A;  2DA7 A;  3TP3 A;  4GFL A;  2NVT J;  1RET A;  2HDD A;  1QVT A;  1JKQ C;  1RKW A;  3P9T A;  3G1L A;  4HKU A;  5M5X J;  3RZD J;  2UXP A;  2QIB A;  4JNN A;  9ANT A;  1LFB A;  2LY9 A;  2H1K A;  4FTH A;  1B72 A;  4M6V A;  1G2H A;  3NNR A;  3SFI A;  5E3N A;  2AHQ A;  2TCT A;  2OF7 A;  5F1J A;  4QTR A;  3E7L A;  2LFB A;  1ZTR A;  2YS9 A;  5JLX A;  3VPR A;  1Z77 A;  2FBQ A;  2PZ9 A;  3OSF A;  4UUS A;  1I6H J;  5EG0 A;  1H88 C;  1YRN A;  5C4J J;  5J1Y A;  2DG7 A;  1P7J A;  3JRA A;  3TED A;  2JA8 J;  1O4X A;  3BR1 A;  2HXI A;  1JKO C;  2B63 J;  4CYC B;  2L0K A;  1AHD P;  2YUS A;  1JUP A;  2UXO A;  4MLO A;  5C44 J;  2CRG A;  3ZQL A;  4A3D J;  2LR8 A;  3HOY J;  1UG2 A;  3A01 A;  1U9N A;  5BNG A;  1ZGW A;  2NP5 A;  3PO3 J;  1HF0 A;  4A3L J;  1U8B A;  3Q0V A;  3CRJ A;  1B8I B;  4YZE A;  3JRF A;  3GTJ J;  1K83 J;  3VOX A;  1GUU A;  2G3B A;  3TW7 A;  4C3J J;  1HOM A;  4Y7N J;  1FEX A;  5DAJ A;  2ZCM A;  3BQY A;  2MSY A;  3B6A A;  3G56 A;  3MNL A;  1VI0 A;  3IH2 A;  1T33 A;  3GTK J;  4L5E A;  1AU7 A;  3M3Y J;  3LNQ A;  3UKG A;  2LLK A;  3F0C A;  3S15 J;  1GVD A;  3BG3 A;  3EUP A;  4A69 C;  3JRB A;  4FCY A;  2ECC A;  4C3I J;  1RKT A;  3WHB A;  2K40 A;  1MNM C;  3BRU A;  1TC3 C;  1MBH A;  3VP5 A;  1ZR4 A;  3LSP A;  2G7S A;  5FKK A;  4NEL A;  2DJN A;  2UXH A;  1ETO A;  3IH3 A;  4C2M J;  5F08 A;  4KWA A;  3BNI A;  1S7E A;  2DMU A;  4AUX A;  2WUI A;  4NDL A;  3ON4 A;  2HKU A;  3QQA A;  1CQT A;  2WV1 A;  1I3Q J;  5FLV A;  1OCT C;  2JK3 A;  3JR9 A;  1IV6 A;  1MH3 A;  2R92 J;  1P7I A;  2XPW A;  4MFE A;  1FTZ A;  3H0G J;  2QF7 A;  3S5R A;  1U78 A;  4A3K J;  4X1E A;  3L1P A;  1ETV A;  5C4Y A;  1SAN A;  2M9H A;  1ZK8 A;  4ME9 A;  3JRD A;  3BR3 A;  3AQT A;  3ANG A;  4MK6 A;  1POG A;  5EGO A;  1XC5 A;  2CQQ A;  1IDZ A;  4RBO A;  3HOW J;  2IAI A;  2LKX A;  3PM1 A;  4C3H J;  1TWC J;  2EH3 A;  4UUT A;  2DMQ A;  3CCY A;  2E2J J;  2NVX J;  3ZQG A;  2XRL A;  1ETY A;  3MKL A;  2DA2 A;  1PUF A;  2QOP A;  3V78 A;  4X6A J;  4IHV A;  4AC0 A;  1A6I A;  1NK3 P;  1NK2 P;  4GCK A;  3S2D J;  5DTD A;  3RH2 A;  2DMN A;  4LOC A;  3VOK A;  3GTO J;  1H89 C;  5E3L A;  1APL C;  1X58 A;  2XSD C;  1GV5 A;  2VKV A;  2ZCN A;  4DYR A;  2ECB A;  3PAS A;  3JRC A;  3LWJ A;  2VI6 A;  3HKZ N;  1TWF J;  3GTM J;  2ID3 A;  3GEU A;  5F04 A;  3Q0U A;  1FJL A;  2ZOY A;  5F0C A;  2IEK A;  4D7M A;  4QSH A;  2OI8 A;  4JKZ A;  3CDL A;  3ZQC A;  4CGR A;  2NX4 A;  2R5Z B;  3MVP A;  4IEJ A;  3DPJ A;  1JGG A;  2GLO A;  1Q1V A;  4G12 A;  2EBI A;  5JLW A;  1ENH A;  4XRS A;  2FX0 A;  4D5C A;  3BR0 A;  1MBK A;  1MSE C;  2EZI A;  4D5F A;  5GPC A;  2RAE A;  2H8R A;  4DYQ A;  4MO7 A;  3D1N I;  3I4M J;  1MH4 A;  5FKN A;  1B72 B;  4UDS A;  2DA3 A;  3HEF A;  3QBM A;  3CQZ J;  5IOZ A;  4GCL A;  1FIA A;  3NXC A;  5K7F A;  2CU7 A;  2R7Z J;  3BQZ A;  2LP0 A;  3JSJ A;  4XIC A;  1WH5 A;  4UUS B;  1Y1V J;  1BW6 A;  5EG0 B;  1YRN B;  1SFO J;  3S17 J;  3TP0 A;  3FIS A;  4MFD A;  4BBR J;  3DCF A;  3JRE A;  2DA5 A;  3HBL A;  1X2N A;  5IP7 J;  3RQI A;  4JYK A;  2G0E A;  3ZQH A;  4GFB A;  3OIO A;  4S0H B;  2WGB A;  2HI3 A;  1OFC X;  2NP3 A;  3HTI A;  4BXX J;  4M3E A;  3S1R J;  5HSZ A;  1ORK A;  3S16 J;  1ETW A;  3KKC A;  3BTI A;  2HOT A;  4J19 A;  1LE8 A;  3BT9 A;  4XID A;  2LD5 A;  1GV2 A;  2E2H J;  1K61 A;  3S1Q J;  3ANP A;  5IP6 A;  5CXI A;  3O8G A;  2ZB9 A;  3S1M J;  2L7F P;  3HTH A;  1JT6 A;  3V6G A;  2JA5 J;  2CUF A;  3WHC A;  4IHX A;  3QPL A;  2NVQ J;  1GT0 C;  3NRG A;  2LTP A;  2HYJ A;  2VKE A;  3QPS A;  4I76 A;  5GPA A;  2V57 A;  4A3F J;  4I6Z A;  2OER A;  2ELK A;  3F1B A;  4GFK A;  1HDD C;  2YVH A;  1ZKG A;  4B3A A;  3OSG A;  4A3C J;  2LK2 A;  2CJJ A;  1RR7 A;  3BCG A;  2O9L A;  2WAQ N;  2R5Y A;  4XK4 A;  5F27 A;  5FKM A;  5J1U A;  3BR6 A;  2JA7 J;  4IHY A;  2ID6 A;  2L7M P;  3KKD A;  3GTQ J;  4V2G A;  2Y30 A;  3HTJ A;  2QTQ A;  4AC6 A;  5HBU A;  1JUS A;  2ME0 A;  3G1O A;  1TWG J;  2FQ4 A;  5J1R A;  1ZQ3 P;  1EF4 A;  2HOS A;  2EZL A;  4FIS A;  5D1R A;  2M8G X;  1QVU A;  4M3D A;  2M2E A;  5EEA A;  4RDU A;  1LFU P;  5C3E J;  1U9O A;  3VVX A;  3VIB A;  3NPI A;  1ETK A;  5EDN A;  3HDD A;  3K7A J;  3JRI A;  5EGO B;  3QKX A;  3NI7 A;  3H3V K;  2XPV A;  1RES A;  2Y9Z A;  2F07 A;  2REK A;  2XPU A;  2GBY A;  2LVS A;  4IHW A;  3HGY A;  3O60 A;  1XS9 A;  2VUM J;  2EZK A;  4PXI A;  2DMT A;  3A03 A;  5H9T A;  2L9R A;  4V2F A;  2DA1 A;  2O7T A;  4M3B A;  2QCO A;  3NAU A;  5M3F J;  1PUF B;  1E3O C;  1HCR A;  5AQC A;  2DN0 A;  5J3L A;  2CQX A;  3HTA A;  2NS8 A;  3O8H A;  1JTX A;  3IUV A;  1RPW A;  5IYB J;  2UXU A;  3LSG A;  1Y1W J;  1JKR C;  3T6N A;  2YU9 J;  5FKO A;  3HOX J;  2HXO A;  3BHQ A;  1T56 A;  5EYR A;  2M34 A;  2IBD A;  4A3E J;  5M5W J;  1IJW C;  2Q24 A;  5F0F A;  4A93 J;  4B4C A;  3BG9 A;  1WCM J;  3MN2 A;  2Y9Y A;  5FJ8 J;  4W97 A;  1MBJ A;  4NN1 A;  2Y0S N;  3KZ9 A;  4JX4 A;  3C2B A;  5CW8 A;  5FHP A;  2UXI A;  5K58 A;  5M3M J;  3VW1 A;  2KDZ A;  1WGX A;  4BKX A;  3FK6 A;  4DW6 A;  1AKH A;  2X9D A;  2QWT A;  2MW8 A;  3BG5 A;  5GP9 A;  4M3F A;  2RHA A;  3PO2 J;  3EGQ A;  2DA6 A;  2P81 A;  5M5Y J;  1VFC A;  3GZI A;  4XRM A;  5IP9 J;  5EF6 A;  1R9T J;  2YVE A;  1WH7 A;  4QIW N;  3SJM A;  1IC8 A;  5IYD J;  2GUH A;  2W48 A;  2KT0 A;  3NAR A;  3BTC A;  5C4X J;  1JJ8 C;  2PMZ N;  3HOV J;  2NS7 A;  4A3G J;  2R0Q C;  2XDN A;  5K7H A;  4Y52 J;  2NVY J;  4AF5 A;  2MG4 A;  3HOZ J;  3COL A;  2M0C A;  2D5V A;  4W1U A;  3GTL J;  2K9Q A;  5IOY A;  3VW0 A;  5HOD A;  1FTT A;  4MIM A;  2X6O A;  3A01 B;  1JJ6 C;  2HOA A;  2DA4 A;  2DTZ A;  4BY7 J;  4B1R A;  2GM4 A;  2EZH A;  1IRZ A;  3TW6 A;  1MBF A;  2G7L A;  1NTC A;  1LE8 B;  1XG1 A;  1A5J A;  2IU5 A;  1VF9 A;  2O8K A;  4CYC A;  3PPB A;  2N8G A;  2EQR A;  1BA5 A;  3W6V A;  1IGN A;  2MGQ A;  2RAS A;  3HIM A;  3HE0 A;  2D6Y A;  3BTJ A;  4EEF G;  2R93 J;  1HDP A;  1UMQ A;  3FKI J;  1W0U A;  1MSF C;  2WB1 N;  1SGM A;  4JL3 A;  3BJB A;  3SDG A;  1B8I A;  1F36 A;  5FGL A;  4MXM A;  3GBG A;  1UI5 A;  1QRY A;  3G7R A;  3VUQ A;  4ACI A;  3ON2 A;  4FE4 A;  2GFN A;  4M3G A;  2JMW A;  3HM5 A;  1TWA J;  2XB5 A;  3OOU A;  2Y31 A;  3K2A A;  2AO9 A;  1TWH J;  2R5Y B;  3GTP J;  3I4N J;  2QKO A;  1JUM A;  3S14 J;  3RD3 A;  4D7N A;  2COB A;  3JRG A;  1MBG A;  1OCP A;  3HOU J;  2G7G A;  3C07 A;  2JN6 A;  1MBE A;  4A3J J;  1I50 J;  4JX5 A;  3LOC A;  1JTY A;  3HGG A;  2PBX A;  1UHS A;  2VPR A;  5D18 A;  5CXG A;  2XGE A;  3KNW A;  3VW2 A;  3IV5 A;  3VVZ A;  4BBS J;  1JKP C;  4DZP A;  3CWR A;  1WPK A;  4A3M J;  4JP0 A;  2ZOZ A;  3Q0W A;  5EFY A;  1VND A;  3B6C A;  4DYC A;  1Z0X A;  4FE7 A;  3HB9 A;  3E7Q A;  2I10 A;  3BR2 A;  3BTL A;  3FIW A;  3ZQI A;  1BJZ A;  3DEW A;  2TRT A;  3LSR A;  2L7Z A;  3CMY A;  1X2M A;  5FKL A;  2E19 A;  5DS9 A;  3FK7 A;  2OPT A;  4XRS G;  2NOG A;  3ZOB A;  1ITY A;  5E3O A;  1UI6 A;  4GCT A;  1HLV A;  2JWT A;  2DG8 A;  3LHQ A;  5IYC J;  2E2I J;  4ABZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...