1JUSA

Crystal structure of the multidrug binding transcriptional repressor qacr bound to rhodamine 6g
Total Genus 76
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
76
sequence length
186
structure length
186
Chain Sequence
NLKDKILGVAKELFIKNGYNATTTGEIVKLSESSKGNLYYHFKTKENLFLEILNIEESKWQEQWKKEQIKAKTNREKFYLYNELSLTTEYYYPLQNAIIEFYTEYYKTNSINEKMNKLENKYIDAYHVIFKEGNLNGEWSINDVNAVSKIAANAVNGIVTFTHEQNINERIKLMNKFSQIFLNGLS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural mechanisms of QacR induction and multidrug recognition.
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Transcription
molecule keywords HYPOTHETICAL TRANSCRIPTIONAL REGULATOR IN QACA 5'REGION
total genus 76
structure length 186
sequence length 186
chains with identical sequence B, D, E
ec nomenclature
pdb deposition date 2001-08-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00440 TetR_N Bacterial regulatory proteins, tetR family
A PF08360 TetR_C_5 QacR-like protein, C-terminal region
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 1jusA01
1.10.357.10 Mainly Alpha Orthogonal Bundle Tetracycline Repressor; domain 2 Tetracycline Repressor, domain 2 1jusA02
4ACIA 2XPVA 3CWRA 1LE8B 2HI3A 3BT9A 3CJDA 1FIAA 2MSYA 2R93J 5FLVA 3VW1A 1Y1VJ 1ZQ3P 4I76A 2XDNA 4CGRA 3S1RJ 1ETOA 3TW6A 3PASA 1IUFA 4EEFG 1PUFB 2QCOA 4IEJA 3HOWJ 2QTQA 3JRIA 1LFBA 5M5WJ 4DYRA 3HOYJ 1HF0A 2K40A 1OCTC 3QKXA 2DMQA 1ETXA 2FBQA 5JLWA 4S0HB 3AQTA 3LWJA 2O9LA 1HDDC 1JTXA 2REKA 2UXIA 1ETWA 3SDGA 1T56A 3M3YJ 3IH4A 2LKXA 1CQTA 1A6IA 5M3FJ 3BR1A 4D5FA 5EEAA 1GT0C 3D1NI 3LSGA 4D7MA 2GENA 2HYJA 2ECCA 4M3BA 2JA7J 4BBRJ 4C3IJ 2AHQA 2VI6A 2MW8A 3Q0VA 3JRCA 2E2JJ 5EYRA 2GBYA 4DZJA 1BW5A 3HIMA 3B81A 5GPCA 3S1MJ 1JKOC 5GPAA 1ETVA 1G2HA 1VFCA 3ZQLA 2HOTA 3K7AJ 3HE0A 1SGMA 2R7ZJ 2M0CA 3T6NA 5H9TA 3ZOBA 3HDDA 3S16J 1TC3C 3VVYA 2NVQJ 3LHQA 2X6OA 5E3NA 4NDLA 2NVXJ 1H89C 4GCKA 4A3EJ 2XRLA 2NP5A 4AYBN 4XRSG 2D6YA 3VW0A 3IUVA 5DS9A 1MH3A 3S1NJ 1RESA 1FIPA 4UUSB 3HOUJ 3LSRA 5IYBJ 2KT0A 1JUMA 3CRJA 5HAWA 2Y30A 5EZGA 3JRGA 4M3EA 4IHWA 2WAQN 2G7LA 2E1OA 1S7EA 2OI8A 5BNGA 2IEKA 3JRHA 1RKTA 5HODA 3GTGJ 3DPJA 1P7JA 2GLOA 3VVXA 3ON4A 1HLVA 5J1UA 1GUUA 2DA6A 5DTDA 3GTOJ 5EFYA 2ELKA 2CRGA 3OSFA 5IYDJ 1QVTA 3OSGA 2M9HA 3G7RA 3HKZN 2R0QC 1AKHA 5K58A 1AKHB 2FD5A 2JA8J 2CJJA 5M5XJ 1MNMC 4A3DJ 1JJ6C 3VP5A 1JTYA 1SFOJ 3HGYA 1T33A 4G12A 1NTCA 3BQZA 3ZQCA 4I6ZA 4GFBA 3VIBA 3O60A 4FE4A 5C3EJ 5C4XJ 2CQQA 2NVTJ 3GTQJ 1WI3A 3C07A 3BR2A 3KKDA 4DW6A 1AHDP 4X6AJ 2W48A 4MIMA 4IHXA 1O4XA 3G1OA 3NI7A 1I50J 1UI5A 1U78A 3UKGA 3DEWA 3G1MA 4A3MJ 4JNNA 2UXPA 3B6AA 3HEFA 2ZCMA 2P81A 4L62A 4M3FA 2DMNA 2YVHA 2DG8A 3RQIA 3HGGA 3S15J 3BTJA 5EG0B 2WB1N 4RBOA 3GTKJ 5CXGA 3S2HJ 3RKQA 4YZEA 1JUPA 2G7GA 4B1RA 5FMPA 2FQ4A 4MO7A 2LP0A 1H8AC 4XK4A 4XRMA 5IYCJ 2Y9YA 2EZIA 3Q3SA 2K9QA 1H88C 3S2DJ 1TWHJ 1JT6A 4A3JJ 2G7SA 2DTZA 2K9SA 3F0CA 4M3DA 2OF7A 5D19A 4X1EA 3BG3A 5C4YA 2Y0SN 2XB0X 3E7LA 4A3FJ 5FLMJ 1YRNB 3GTMJ 4L5EA 3MKLA 4GFKA 1F43A 1POGA 2FX0A 4B4CA 1UI6A 2H1KA 1IRZA 2F07A 1MBHA 2EZLA 1IC8A 2VKVA 2ZB9A 5D18A 3BR3A 4V2FA 3GZIA 3GTLJ 2M34A 3VOKA 1WPKA 1JJ8C 3LOCA 5M3MJ 5E3LA 3OIOA 2RHAA 2MGQA 3A03A 4QIWN 1AU7A 3HTIA 3O8HA 2DN0A 4MFEA 2I10A 3GEUA 1GDTA 3HBLA 5GP9A 2RASA 3WHBA 3K2AA 2Y9ZA 4AF5A 1OFCX 1TWCJ 3CQZJ 1B8IB 3EUPA 5F1JA 1UMQA 3ANPA 3MVPA 4AC6A 2GUHA 3FK6A 4AUXA 4RDUA 1IDZA 1IG7A 5E3OA 5C4JJ 2R5ZA 4A93J 2PMZN 5E3MA 1QVUA 4C2MJ 3BRUA 2WUIA 2JN6A 2EBIA 2JA6J 2CUEA 3SFIA 1FTTA 3RD3A 4JP0A 3PO2J 2DMPA 5F04A 4BY7J 3CDLA 3JRBA 2W53A 4A3GJ 5FJ8J 3IV5A 3S5RA 4MXMA 3TEDA 1QPIA 2L9RA 2NX4A 3EGQA 1D5YA 1DU0A 2H8RA 1Z77A 2AO9A 1YRNA 4QTRA 4A3CJ 1X58A 1JKRC 2V57A 2DA7A 5HBUA 3HOXJ 3S14J 5FKMA 2NS8A 2NOGA 3VPRA 2QKOA 4HNVA 2NS7A 1FJLA 1Y1WJ 1LE8A 5K7HA 4MLOA 3A01A 3NRGA 3B6CA 4UUTA 3FRQA 2JMWA 2TRTA 4JL3A 3NPIA 3BCGA 1MSEC 2LVSA 4JX5A 3BG9A 3IH2A 3HTAA 2DA5A 2YU9J 2EZKA 1JT0A 5F0FA 2HYTA 3KKCA 3HOVJ 5J1YA 3GTJJ 2L7MP 3FIWA 2X9DA 3VVZA 2VPRA 5CW8A 5IP9J 2LTPA 1E3OC 5K7FA 1W0TA 3L1PA 2R5ZB 1ORKA 3ON2A 4DYCA 1P7IA 2COBA 2K9NA 2L7FP 4FTHA 2XGCA 1IGNA 3VOXA 1XG1A 2OERA 4A3IJ 2G3BA 1WH7A 3AQSA 2IBDA 1X2NA 3LNQA 2XPUA 4Y7NJ 3G1LA 5EF6A 4ME9A 4AC0A 2CUFA 1UG2A 1APLC 4QSHA 2R5YA 1ETKA 4BXXJ 3JR9A 1B72A 3V78A 1ETYA 1TWGJ 3PM1A 2VKEA 4B3AA 3RZDJ 4JKZA 1A5JA 3TP3A 2M2EA 1ZTRA 2DG7A 3TW7A 2JWTA 3WHCA 3BHQA 1IDYA 1FEXA 1BL0A 2D5VA 2E19A 4BKXA 1JKPC 2EQRA 2L7ZA 2TCTA 1B72B 3QBMA 4A3KJ 1DU6A 1U9OA 2E2HJ 2X48A 3H0GJ 1RR7A 2QF7A 2YVEA 2NVYJ 3NNRA 1GV2A 5J3LA 1JGGA 2ZOZA 5IP7J 3JRAA 3FKIJ 3JSJA 4PXIA 3NAUA 3BR0A 1ZK8A 3V6GA 3CCYA 4DZPA 4CYCB 2ID3A 2HOSA 2QOPA 3KNWA 3HOZJ 1VI0A 1LFUP 3G56A 1XS9A 1QRYA 1MBGA 2XSDC 4JX6A 2CQXA 2IU5A 5FKLA 4D7NA 2WGBA 1GVDA 1XC5A 1MH4A 4FISA 2DA3A 5CXIA 3GTPJ 3BJBA 4IHYA 1K83J 3OOUA 5EGOA 4NN1A 3HB9A 1HDPA 2YUSA 3FISA 1BW6A 2EZHA 2HQ5A 3I4MJ 1MBKA 5FKNA 3I4NJ 3BR5A 2NP3A 3LJLA 4FE7A 2PZ9A 2UXUA 1Q1VA 4FCYA 1ENHA 1JUSA 5HSZA 2Y2ZA 2FJ1A 4XRSA 4CYCA 2EH3A 2HDDA 1I6HJ 2JA5J 2DMTA 4C3HJ 2LD5A 2DJNA 1EF4A 2ECBA 2UXHA 3HTHA 4ICHA 2HXOA 5IPAA 2RAEA 2R92J 1JKQC 4M6VA 4M3GA 2O8KA 2XPWA 2DMUA 2LK2A 2JJ7A 2LFBA 1RPWA 5IP6A 4UUSA 4IHVA 1IV6A 1MBJA 2DA4A 1ZR2A 3E7QA 4A69C 4GCTA 2E2IJ 1WGXA 5JLXA 3RH2A 5EG0A 2IAIA 3VUQA 2ZCNA 3LSPA 3Q0WA 2R5YB 3ANGA 2O7TA 1U8BA 4W1UA 3ZQGA 2CU7A 1W0UA 2N8GA 5M5YJ 1RKWA 4MK6A 3C2BA 5F27A 2L0KA 1ZKGA 3QPLA 4XIDA 3JRDA 3KZ9A 4J19A 1I3QJ 3MN2A 1RETA 2XGDA 1B8IA 3COLA 5F0CA 3F1BA 2B63J 2G0EA 1HCRA 3PO3J 4Y52J 3QQAA 3ZQIA 4JX4A 4DYQA 1ETQA 1FTZA 1OJLA 5FKKA 1NK2P 2HOAA 5FGLA 3HTJA 2QIBA 3A02A 3S17J 5F0HA 5J1RA 1MBEA 1UHSA 3RZOJ 1BA5A 3SJMA 3GBGA 4NELA 2GM4A 1X2MA 1ZR4A 3QPSA 2UXOA 5IOZA 5FKOA 1MSFC 1VF9A 2ZCXA 1VNDA 4BBSJ 5DAJA 3W6VA 4A3BJ 2PBXA 2XGEA 3JRFA 3NARA 3ZQHA 3P9TA 2LY9A 5IOYA 1R9TJ 4A3LJ 4KWAA 5K7ZA 2LR8A 2LLKA 3BR6A 2JK3A 5FHPA 2Q24A 2XB5A 4D5CA 2ID6A 1GV5A 4BY1J 3BNIA 3JREA 3FK7A 3PPBA 2KDZA 3S1QJ 1F36A 1Z0XA 4MFDA 1OCPA 1TWAJ 2WV1A 5AQCA 3O8GA 4W97A 1U9NA 1NK3P 2DA2A 1WCMJ 2YS9A 4ABZA 2ME0A 3A01B 5EZHA 1ITYA 5D1RA 3NXCA 2MG4A 1ZGWA 3H3VK 5C44J 3LSJA 1WH5A 2QWTA 4GFLA 1SANA 3BTCA 9ANTA 3MNLA 2ME6A 2HKUA 3DCFA 3VW2A 1MBFA 3M4OJ 2GFNA 3BTLA 1PUFA 2VUMJ 1BJZA 4JYKA 2OPTA 4C3JJ 2DA1A 1K61A 2ZOYA 4LOCA 2Y31A 3ZQFA 5F08A 1IJWC 3TP0A 4GCLA 3IH3A 4V2GA 3BTIA 3Q0UA 2M8GX 5EDNA 3BQYA 1HOMA 4UDSA 5EGOB 3HM5A 4XICA 3BG5A 2O7OA 3CMYA 1TWFJ 2HXIA 4HKUA
chains in the Genus database with same CATH superfamily
4ACIA 2EFQA 2XPVA 3T1BA 3ZMZA 2HI3A 2R93J 4JBAA 2EWNA 1W5CC 4KMUX 2QUFA 3TOAA 1ETOA 1YQAA 4LITA 1IUFA 3OYLA 2H6CA 2OBPA 5ILUA 1LFBA 5M5WJ 2LG4A 3H3UA 1LJ9A 4XLCA 2W4SA 3CCRI 3GX4X 4KMFA 1OCTC 3AQTA 3LWJA 2HYFA 2LYCA 1HDDC 1IW7F 5CVRA 4DNCA 1X1DA 1U5TA 1QZYA 4LLGF 3SDGA 4V19K 4LIVA 1T56A 5TISC 4XM3A 5B1BH 1XD7A 3BR1A 2WC2A 3ZQ7A 4D5FA 1N77A 1MGTA 4HLYA 1GT0C 4BQOA 3V7RA 4L9JA 4BUPA 1AWCA 3HHGA 3ONQA 2ZFWA 3CCJI 2IP2A 2MW8A 2CO5A 2CYYA 3Q0VA 3IKTA 3OYAA 1R6RA 4DZJA 3HIMA 4L5IA 3QU3A 3B81A 4C2UA 3COAC 4BJTA 3BOQA 5GPAA 1FP1D 2ELJA 1G2HA 4I0BA 2H1LA 1KQ9A 2BEOA 1G3YA 2HOTA 4E7HA 2M0CA 3ZOBA 3CCMI 2A69F 3HDDA 2X1EA 3S16J 3HTUA 2NVQJ 3LHQA 4AD9A 1SVMA 2R7UA 3KIOA 3TO6A 3C3WA 1R23A 1ON2A 2LKSA 4AYBN 1OR7C 3HUGA 3J81K 1VQ7I 3IUVA 5DS9A 3I71A 2PJPA 3LA3A 3FM5A 4I09A 1JUMA 3FBNB 2WB1A 3SZTA 3JRGA 1ULYA 1T39A 2ZXWH 1MKMA 2E1OA 1LVKA 2OI8A 2QENA 2VN2A 5BNGA 3GTGJ 1P7JA 3KP5A 4PFPA 3QYEA 1TNSA 4KIGA 2P0WA 2WA0A 3J81Z 1GUUA 2DA6A 3I3LA 5EFYA 2CRGA 4AM3A 1QVTA 2BY3A 2QWWA 1EH7A 2YU3A 3KFWX 3WTVC 2R0QC 3KEYA 4UHTA 2DYSH 4XKWA 5ILVA 4HAMA 5M5XJ 4RGRA 4JK1X 4A3DJ 2IS6A 1S3JA 1HXDA 3NQOA 1P9QC 2H6BA 4G12A 4A6EA 3BG7A 3ZQCA 3VIBA 3IHUA 3VYTB 3QP5A 1A04A 4ZYGA 2CQQA 3TO9A 3J7AO 1X19A 2MD0A 2ADUA 1MD0A 2KRCA 2Q8KA 3KKDA 1AHDP 4IHXA 4D1QA 4MEYF 2WV0A 2M7AA 2IT0A 2ZNZA 3UKGA 5HLIA 2UXPA 3B6AA 3DBRB 4M3FA 2AQFA 2DMNA 2OAZA 1MNEA 2COMA 3LA2A 4RBOA 3GTKJ 5FRMA 3S15J 1XGOA 3F22A 3GWZA 2FQ4A 2O5RA 1T95A 2LH9A 4MO7A 1LFPA 2LP0A 4YG2F 1H8AC 1I1SA 4KITB 1S9HA 3D5RC 3DU6A 1ONVA 2Y9YA 4GDFA 2LKPA 1SFUA 2UXXA 3Q3SA 2RNGA 1ZRCA 1H88C 3G6EI 4Q47A 2FXAA 2JRMA 2G7SA 2HPMA 2JVGA 3M9AA 1PVEA 1XSXA 3TQNA 1XX5A 2QQ9A 3CP8A 1XDSA 3K4JA 2EFWA 4P5OA 2DLLA 5D19A 4X1EA 3BG3A 2KDOA 3EUHC 1CF7A 4L5EA 3MKLA 3RPQA 4CUGA 3H9JA 2VQCA 1KGSA 2I8DA 1POGA 3FMRA 3GEZA 1H9TA 2EIMH 2HQAA 1IRZA 2EZLA 1IN5A 2X1CA 1Y56A 4V2FA 4ZH4F 3GZIA 4E7SA 4L5JA 4XOPA 5M3MJ 1BC8C 3EQLF 5E3LA 2RHAA 2GWRA 4QIWN 3CCVI 3CCSI 2A68F 3O8HA 2DO7A 2CQKA 4RB0A 3GEUA 4PJLA 4LFUA 3FKJA 3O3KA 1QU3A 2Y9ZA 2FSWA 2HS5A 1OFCX 5ERIA 1B8IB 3EUPA 1BR2A 3RYRA 2CW7A 2PFBA 2PI0A 1JHHA 3MVPA 5E8IA 3FK6A 3FXOA 4RDUA 2XAUA 2OTJI 2R5ZA 4N4OB 4A93J 4ZYDA 1Z21A 1TNTA 4ZDPA 1MJ9A 4IPAA 4XOTA 2FRHA 2FQ3A 3SFIA 3FXKA 3RD3A 2OQGA 4II3A 2DFEA 3I56I 5HS7A 5FJ8J 3J7YJ 2L9RA 5ICGA 2H8RA 3EGQA 1Z77A 2LRDA 4D9JA 2WY7Q 4WK8F 1FYMA 3KZYA 3SHFA 2L9NA 4A3CJ 4BH9A 4A2UA 4IF4A 4XKCA 4KUMA 3HOXJ 4PJ0C 2NOGA 3VPRA 5JFRA 4F92B 4RB3C 2P5VA 1DPUA 1EH8A 2IGKA 2V9VA 4BU2A 3FMQA 1ZLKA 1D0XA 2IS2A 3FX3A 4MGRA 3RKXA 1Y1WJ 2NRAC 1BM9A 1SD5A 2W24A 2EK5A 3G2BA 2YVXA 3FHNA 4JL3A 1WJAA 4LB6B 4CCOA 1MIJA 1V5FA 1DP7P 3NPIA 3HTAA 4ASNA 4L9VA 2DA5A 2GA2A 3M8EA 2EZKA 3ML6A 3MFKA 4OOIA 3AL0B 1Q1HA 3CP2A 2JSCA 3KLNA 5K7FA 3L1PA 4AYBA 2BW3B 2X0LA 1WSUA 3ON2A 2P7VB 2COBA 2L7FP 2PMUA 5HDNA 3S3OA 2C6YA 2OERA 3H35A 4R8HA 4G6DA 4RB2C 2R7VA 1FMWA 3BP8A 1KU7A 3AQSA 1I5ZA 1X2NA 4YIFA 2EV6A 4Y13A 3OS1A 3J80K 1UG2A 4QSHA 1WI9A 3SQNA 4BXXJ 3JR9A 4C2TA 3V78A 1ETYA 2F5VA 3PM1A 1FOYA 3ISPA 4B3AA 4EGZA 4JKZA 4IRGA 1A5JA 3EYIA 5DCFA 5DCMB 1YW9A 5AIQA 1BL0A 2BVLA 2E19A 3F3XA 1O7LA 3CO6C 1JKPC 2V6EA 1T8IA 3GVAA 4A3KJ 1O57A 1DU6A 3H0GJ 3DFGA 1RR7A 2QF7A 1LQ1A 2NVYJ 2YVEA 5LHIA 4HX8A 5GADJ 3L09A 1D1AA 1WJDA 5J3LA 4EM2A 5FO5A 4P9UA 4Z6YA 1M1EB 1R1VA 3H0DA 3C2GA 3V6GA 2DQRA 2HQNA 1Y8RB 2ID3A 2OZ6A 3KNWA 1D0ZA 1EH6A 1X4PA 4PZJA 1XS9A 1LFUP 2BGCA 3G56A 4PFOA 2QSGX 5E8GA 3ZMSA 2LBFA 2D45A 4OINF 1XC5A 4RGUA 3DF8A 3L2QA 2DK8A 5CXIA 3GTPJ 4NN1A 3OOUA 4B43A 1ZREA 1HDPA 2VBWA 3MD2A 3RQ4A 1ERDA 1BW6A 2B0LA 3C18A 4AIJA 5BOXA 2LSOA 3TDUC 3LAPA 3CJRB 5CQGA 1AOYA 5HSZA 2Y2ZA 3LFKA 1K6YA 3JTHA 4XRSA 2EH3A 3PFYA 1I6HJ 2OTLI 1QO0D 4O6JA 4OD5A 4C3HJ 2ECBA 3KP7A 3QPTA 5IPAA 2RAEA 4K2EA 2QSHX 4M6XA 3G4SI 4M3GA 2CSOA 3ZRGA 1T38A 1MNDA 2O8KA 4B3XA 2JJ7A 3LSTA 3SEZA 3DLAA 4OD4A 4E7LA 4HV6A 4IHVA 4IRVA 1IV6A 2B9SA 1ZR2A 3E7QA 4GCTA 1WGXA 5JLXA 1IUYA 2HVRA 3MKZA 4BEHB 3L2VA 3LSPA 3Q0WA 4GYIA 2PN6A 2R5YB 1D1BA 2BV6A 2F5EA 2O7TA 2W1OA 4BDYA 1U8BA 3RKYA 3M1EA 1KU3A 3WG7H 5F27A 2L3DA 4XIDA 4I99C 2M30A 1I3QJ 2L54A 2RGVA 1EKEA 1IXRC 2XGDA 3E5UA 1VZ0A 1XCVA 5F0CA 5B1AH 3COLA 1R5ID 4B48A 1S6LA 1QQIA 3OIPA 3Q9SA 3QQAA 1J09A 1NHAA 2LY2A 2CFOA 1NK2P 1MMSA 2HOAA 1R7JA 4F55A 1FLIA 4CICA 5FGLA 2FEZA 1P4WA 3HTJA 2QEXI 2R4GA 2E1MC 1UHSA 3RZOJ 2FNPA 1K6OA 4NELA 4M9XA 3OS0A 4A0ZA 3H5RA 2ZMEB 4HPQA 3QPSA 4RS8A 3OYHA 2GM4A 2UXOA 1OPCA 2BOLA 2DTRA 1VNDA 4PUSA 4BBSJ 4A3BJ 1R4NB 1S7OA 4HBLA 4ANJA 5IY5H 3WE3A 4NB5A 4KISA 2HKOA 5D6FA 1R9TJ 4CA0A 2RDPA 2YX7A 4JOMA 3OY9A 2LR8A 2VXDA 5HLHA 2HEOA 4OIQF 4PCQA 3HIFA 1TT0A 3TO7A 2ID6A 4KN7X 1FMVA 3FK7A 3A0HC 3OYBA 2CV0A 2ZNYA 1TP4A 2KDZA 1F36A 1Z0XA 5DYMA 1SD4A 3PQKA 1OCPA 2QGUA 2V26A 5E18F 4UV9A 3O8GA 4IHSA 5LBQA 1WJ5A 2LMDA 2DA2A 2YS9A 1RUOA 2ME0A 1XMAA 3VYRB 3PIPF 1YHQI 1ZGWA 5BMZA 3N05A 4OAYA 3SZPA 4YRVA 3H3VK 4NNJA 2QWTA 1YS6A 5F1RA 3FXLA 1ZN2A 3BZ6A 2WTEA 3MKWB 3MNLA 1WJCA 3IAM2 3D0SA 4ITVA 2HPIA 3DCFA 3ASOH 3K1MA 5KAFC 5IT9Z 2HKUA 3M4OJ 3VW2A 3PNVA 2FNAA 2JVHA 4E7IA 3WTUC 2NNNA 3BTLA 3EUHA 3FXUA 2G7HA 4PDKA 2E71A 2OPTA 1K61A 2G9WA 1H9GA 3F8FA 2XC7A 4RAFA 2JPBA 4WIBA 3QPHA 3HC7A 4I01A 3TP0A 4V2GA 4C9YA 2UWMA 4U9LA 3DQVC 2V9KA 2F4OB 2BZTA 3H9QA 1K79A 2JQ7A 2DT7B 2HXIA 4XKVA 1D8JA 2RASA 1SVOA 2VC0A 4HSRA 3CWRA 1LE8B 3BT9A 3S2WA 3CJDA 2MSYA 3SDBA 1W7PA 2MFZA 5FLVA 1Y1VJ 3L2RA 4I76A 4M71A 4CGZA 2XDNA 1YIOA 4CGRA 3PASA 3ZR8X 2NYXA 5CVJA 3HOWJ 4F91B 3JRIA 2DK5A 3MMYB 1G8XA 1SAXA 3RIRA 4CHUA 2HVQA 3F23A 3REOA 2DMQA 1ETXA 3CLQA 5DUKA 4N9HA 4BEHA 1FBSA 2Z1DA 3BROA 1D3YA 3GW2A 5AIPA 2ZSIB 3IWFA 4FX4A 1K78A 2LKXA 1CQTA 1YOVB 3M3YJ 2UUZA 2V1NA 4LGWA 2K9MA 3F21A 2E60A 2RQQA 3D1NI 4KIBA 3LSGA 2HYJA 4M3BA 1ZG5A 2JA7J 4C3IJ 2E2JJ 3BZKA 4RAYA 4UV8A 2E35A 2QQBA 2L4AA 2HTSA 1EV7A 1Z6RA 3CDHA 3K70D 3NRVA 1JKOC 2YPRA 4M9ZA 3ULQB 1YJWI 2V4JC 3KLOA 3VVYA 3UR3C 4NDLA 4ZDOA 1U6GA 4A3EJ 4I7HA 2XRLA 2NP5A 4XRSG 2D6YA 1R22A 2DODA 4Q4ZF 2PBIA 5L3DA 2MA3A 2QQ8A 5ED4A 1RESA 1FIPA 3OIQA 4UUSB 3HOUJ 2KT0A 3OYNA 1X1AA 2IPQX 5HAWA 2Y30A 3ROUA 4HF2A 2WBMA 4ZZDA 4QPQA 5FD6A 1S7EA 2BBYA 3WE2A 2CFXA 3U9GA 3JRHA 3DPJA 4HDVA 1FBQA 2VE8A 2GLOA 3O6BB 3VVXA 2CV2A 3ON4A 2EB7A 2FUG2 5H6RA 1SC7A 3FF5A 3IP4B 1LEAA 5DV5A 2ELKA 5BPDA 5IYDJ 3OSGA 2M9HA 2QSFX 1N25A 1FX7A 3HKZN 1DDNA 2VOOA 5D8KB 3G7RA 1V54H 2ZMEC 3G73A 2XKOA 2FD5A 3D5SC 2CJJA 2E1MB 1MNMC 3HXLA 3RYPA 2F5CA 2IS1A 1SFOJ 3DXJF 2L7KA 1FNNA 4HQMA 1P92A 1MMAA 3PQJA 3K4KA 4EGYA 4FE4A 1KYZA 5C3EJ 2NVTJ 3ECHA 3TKYA 4CXFA 3BPVA 3VOEA 2FOKA 4HA8A 1IRXA 5ICFA 3KE2A 2W48A 4MIMA 5E17F 1IV8A 1O4XA 4BHCA 5E1WA 3G1OA 2F4MB 4EJOA 1I50J 2XUBA 3NI7A 1UI5A 2VBXA 1R58A 1SD6A 3G1MA 3I0TA 4LMYA 1O3TA 3JCUC 4JNNA 4ENJA 3HEFA 1OLTA 1TTYA 4ZYHA 5HLTA 2DG8A 3R6SA 3BTJA 2STTA 2WB1N 2K7LA 5CXGA 3GLXA 4ESBA 3L7WA 4IL6C 2ICWG 1YW8A 4EV0A 4L9TA 4UB8C 1F1ZA 1VQOI 4IRHA 2EZIA 3OYIA 1D8KA 3BG6A 3HOTA 1TWHJ 2OZUA 5HDKA 4OIOF 5CVVA 2DTZA 3HYIA 2K9SA 3F0CA 2FA5A 2VQLA 3TGNA 4H4KC 4X0GA 2OF7A 2O8XA 4J01A 1F5TA 5DD8A 4WF2A 3DTIA 1R4MB 1Z7UA 2XB0X 2NXNB 5LLQA 5FLMJ 4DBRA 4HV5A 1G6NA 3CC2I 5H2FC 4UUVA 1UI6A 2NVUB 5K1YA 1B9NA 2DXIA 4HNTA 4OMYA 4N0BA 1ZRFA 2F5DA 1BR4A 3GTLJ 3VOKA 1JJ8C 5DM7F 4YFNF 3OIOA 4IRIA 4U87A 4EJWA 2VQGA 2P7CB 2CWEA 1L0OC 1RI7A 1TQPA 3JW4A 1F9NA 3VEPA 2A05A 5GP9A 3CUQB 1E2XA 4MHGA 1TWCJ 3CQZJ 4IVNA 1SFKA 1UMQA 3BZCA 4GCVA 3WU2C 1VQ9I 1OCZH 1KQ0A 2YX4A 3HSFA 1IG7A 4NC7A 5C4JJ 2UZKA 3GZ5A 4RLFA 4EATA 4YELA 1SMYF 2WUIA 2FBHA 3LSIA 4HZFA 2CUEA 3AAFA 5KAIC 1TBXA 1O7FA 2CQ7A 5HDGA 4JP0A 4WXCA 5F04A 3GO5A 2PMZA 4HX7A 3K8PC 4XN0A 1PJRA 3IV5A 1D5YA 4QLCU 1BR1A 3DEUA 5L3EA 4QTRA 3HJEA 3M8JA 3DKXA 2VONA 1KYWA 3KYLA 5HBUA 3JSOA 2NS8A 4MQVA 3GFMA 3BLYA 2NS7A 4CO8A 2F4IA 4EMSA 2O61A 4MLOA 3FXRA 3FRQA 2X1DA 2JMWA 5D5XB 4HOBA 2X6XA 4BXUA 1RIOH 2KL4A 1BJAA 1UELB 3BCGA 1MSEC 3BG9A 3OL3A 2YU9J 2HYTA 5J1YA 1ZGAA 2L7MP 3FIWA 2J5OA 2X9DA 2VBZA 1W0TA 2R5ZB 2M1BA 2CQNA 1ORKA 1R5GA 2DW4A 1P7IA 5HLGA 2XGCA 1QBJA 1ACIA 3VOXA 1XG1A 2YSRA 1Z91A 4A3IJ 2IBDA 2ELHA 5KK1A 1WFXA 4EJUA 2XPUA 4Y7NJ 2IXSA 5J4YA 2AXTC 1XSDA 3F9KA 2MH9A 3R0AA 2CUFA 2R5YA 1V5EA 4F52A 2VKEA 1YW7A 2W00A 4UXNA 2E1CA 2HFHA 2DG7A 1IN4A 1ZTRA 1YJ9I 3K6GA 1R00A 3WHCA 3BHQA 5E1XA 1HKSA 1MZBA 2Z3YA 3W3CA 4BE2A 1P4AA 2PLYA 1XPXA 2PFVA 2NOJB 3P9IA 3WG9A 3S17J 4EJTA 2EQRA 1Z05A 2L7ZA 2TCTA 1B72B 2E2HJ 3F6VA 1P4XA 3NNRA 1GV2A 4G9YA 4U0WA 3GFIA 2D1VA 1HSJA 3QAHA 5CVIA 1JGGA 2KRFA 1S29A 4HW0A 4CDGA 2CGPA 3JRAA 2VQHA 3FKIJ 2K3FA 3JSJA 2A6HF 2L5QA 3NAUA 2IVMA 4LIUA 4ZC3A 4DZPA 4UB6C 1ODDA 4P1WA 4BJ6C 2HOSA 3HOZJ 2DFIA 4U0VA 4S05A 1JE8A 2XSDC 2ZO4A 3GF2A 5FKLA 2IU5A 1GVDA 5D6EA 2MC3A 1Y0UA 2EPFA 4KFCA 4FISA 2DA3A 1XMKA 5D5VB 1I27A 2HTJA 1Z3YA 2V1DA 4I0AA 4BJ5C 4B09A 1R49A 3P7NA 1T2KA 3KETA 1MBKA 5FD5A 4D0PA 2NP3A 4FE7A 2P5LC 1QA6A 1PUEE 2UXUA 3G71I 1ENHA 3B73A 4HEA2 2FJ1A 2FBIA 5KVRA 4EVIA 2K4BA 3IRRA 2QKLB 4IXAA 2ZXJA 3SZGA 2K02A 3TOBA 3DKWA 3WU0A 4B8XA 2UXHA 2HXOA 1UG0A 4IQ4A 2STWA 2HZDA 2R92J 1N75A 1JKQC 3CF5F 2K86A 5AONA 3T0YA 1FSEA 5JI6A 4UUSA 1T08B 4AIDA 4B47A 3RH2A 3PIOF 2JTVA 3WTYC 3LQRA 1MW7A 5ICCA 1PP8F 1P6RA 3R0JA 1SFEA 2UXNA 1A35A 3Q5FA 4C2MA 1UHMA 2CU7A 2XF7A 1W0UA 3PSFA 2HVSA 4MK6A 2DDBA 1TT5B 4DVYP 4ON0A 1YTYA 5J47A 5D5UB 2PX9A 1FY7A 2WY8Q 1VQ5I 2DT6A 2ZCWA 2EJRA 4J19A 4BACA 4F93B 3C1DA 1RETA 4MNUA 3W2WA 2IGNA 3OYGA 1B8IA 4G94A 4CCJA 3F8MA 5FRNA 2G0EA 2I5UA 1W7PB 3RTRA 2RVCA 4J00A 4Y52J 3I59B 4JX4A 3HSRA 2KZGA 4MTDA 3CTAA 2VB6A 2QIBA 2OA4A 3A02A 2OV7A 1B6AA 4NUBA 2QVOA 2Z5UA 3L2WA 1OYYA 5J1RA 1MBEA 1OYWA 2W84A 1RZ4A 3SJMA 3ZMTA 2JPCA 4NC6A 3OL4A 1X2MA 4RM3A 3V8LA 5IOZA 1MSFC 2Y69H 2E5NA 3DLLF 2DPUA 5DAJA 1FYKA 4XONA 2PBXA 2A6TA 1Z67A 3KYCB 3I5UA 3NARA 3JRFA 3HRUA 2QQAA 3ABTA 2VJJA 2EIKH 3MWMA 2E5ZA 1J5YA 2VT2A 2EIJH 2E7WA 3E3VA 3FWEA 2Q24A 2XB5A 3LSKA 2K9LA 2NS0A 4CCLA 4TV7A 2MYSA 1TWAJ 3L00A 2LF7A 3PJRA 2FU4A 1XGSA 3FXMA 2XF6A 5BQTA 2Y0SA 2MLKA 1U9NA 4IHTA 2V7FA 4ABZA 3A01B 1J59A 1VQNI 3H92A 3NXCA 1FOWA 4WXDA 1DUXC 3NS4A 2CMPA 1ZRDA 1FC3A 4E7KA 5C44J 1GLNA 2VASA 2X4HA 4CH7A 9ANTA 1XGNA 2RC4A 3DWLE 4AVZA 2ACJA 3CESA 2NAZA 1MJBA 1PUFA 4BE1A 5LRSA 1JI8A 4U88A 2XV4S 4KDPA 2ZOYA 3DEEA 2Y31A 3X2QH 5FLXK 2D1HA 4E4HA 4L0YB 1GHCA 5F08A 1IN6A 3ZCOA 4GCLA 1K4TA 2P8TA 4EJVA 3BTIA 3Q0UA 2M8GX 3DU5A 3GLLA 4G7OF 3G3ZA 5EGOB 3CMYA 1ZG1A 5CPRB 2OU2A 1Y39A 3GZ6A 2Z2SB 5B66C 1FIAA 2CV1A 5IT9K 3Q9VA 1ZQ3P 1UAAA 4DJAA 3S1RJ 1LKXA 3U1DA 3OYMA 1SMTA 3TW6A 5LHGA 2B3WA 1PUFB 3L2UA 2HGCA 2QCOA 4IEJA 1X3ZB 2MBFA 2QTQA 4E6KG 2KLOA 4LG0A 3HRSA 2XGXA 5FLXZ 1LDJA 2K40A 3GUDA 3QKXA 2YR2A 2FBQA 4S0HB 1T0FA 3RI4A 4CYDA 1JTXA 2LNBA 4B44A 2REKA 2UXIA 3HHHA 3E6DA 3V7SA 1ETWA 3IH4A 1FOXA 1A6IA 5M3FJ 2F2EA 2PEXA 4M74A 4YEJA 1V4RA 4E7JA 4PJJA 3BJ6A 5JR3A 1Z3XA 4DBQA 4Y17A 4IOCF 4G7ZF 5EYRA 3P9CA 2DDAA 2ZXIA 1F4KA 2QA4I 2B7EA 2QYOA 4ZZLA 3TBIA 5GPCA 2ZJPF 4H0EA 4HQEA 2M7BA 1OCOH 2VJIA 3AG1H 5CJ9A 2H8WA 1VFCA 4DQ2A 3K7AJ 2X6WA 3HG9A 1TC3C 4OWRB 3ZP5A 2X6OA 4M6YA 4WX9A 4ZTJA 1MMNA 4LB5A 2GXBA 1SAUA 1IO2A 3GCMA 4BXFA 5J4VA 4OIRF 1D0YA 2VE9A 1DQUA 1MH3A 2XKPA 1HKQA 6PAXA 3LSRA 2O3FA 4FT8A 2W82A 5EZGA 4M3EA 3KP6A 2IS4A 2WAQN 2W25A 2G7LA 3ERMA 2WWYA 3DTKA 1V3FA 4ZYEA 1BOAA 1SFXA 2OD5A 5CQEA 4A5NA 1RKTA 4M9SA 2M4KA 3PUFA 4YFKF 3LMMA 2VLAA 1IRGA 4XQFA 3E6BA 3DTEA 1E3PA 3M07A 5J1UA 4G6QA 5DTDA 3GTOJ 3DPUA 3LQQA 1YITI 3OSFA 2IJLA 1AKHA 5K58A 2OJED 3H36A 2QZ8A 2JA8J 2KIQA 3CJNA 5CKTA 3ABMH 1JTYA 2VC1A 3NWSA 3HGYA 1T33A 4HNUA 5L3FA 1NTCA 3AG2H 3IL2A 3IWZA 4I6ZA 4GFBA 1EA3A 4P9FA 4XL9A 5LGTA 3HL2A 4CCKA 1YJNI 3CDIA 1KONA 1WI3A 3R4KA 3BR2A 4X6AJ 3K4LA 4HLXA 4XBFA 4DIQA 1RR8C 4BL0B 3AKZA 2XAHA 5KCMA 3VFZA 3AL0C 4YIRX 3VTIA 1QNTA 1UCRA 5A2QZ 2ZCMA 3ABUA 2P81A 4FASD 4L62A 1FOKA 3CMEI 5K5RA 3DP7A 5EG0B 3S2HJ 5DCMA 2J5PA 1HW1A 4YZEA 4WXHA 1JUPA 2G7GA 3WGGA 4PSWA 3E5QA 2MD5A 3DBHB 1VQ6I 1WWXA 3BCAA 4XK4A 2ETHA 5IYCJ 1WQ2A 4BHBA 2V9PA 3H5AA 3WGIA 3CC7I 4U9NA 3V8JA 4AIHA 3PUBA 5J40A 3KEOA 4WWCA 2ZSHB 4LD5A 1IN8A 2V1UA 4ZYAA 1JXSA 3E7LA 2XVCA 1BI3A 4Y3OA 3RJPA 3V42A 2OCCH 3WU1B 4A3FJ 4GFKA 3VODA 1IXCA 5LFAA 1F43A 2FX0A 3T5XA 2H1KA 2XIGA 2EA2A 1MBHA 1A6QA 1IC8A 2VKVA 2ZB9A 1BN5A 5D18A 4XN3A 2M34A 2O0YA 1HKTA 1WPKA 3LA7A 1JGSA 3LOCA 5DUIA 2H27A 3AG4H 2MGQA 3HTIA 1AU7A 1GVJA 4FETA 3VWBA 3CD6I 2D2WA 3HBLA 1YO5C 2QM3A 3WHBA 3AFHA 3K2AA 1MMGA 2GQQA 4L0ZB 5F1JA 2LC2A 4CCMA 4ZDLA 5LGUA 3EUAA 4BAYA 4AUXA 4M73A 2QBYA 5E3OA 2DOEA 3CJQB 3CC4I 4RLQA 1FZPB 2PMZN 3V4GA 1BI2A 1BI0A 4C2MJ 1DPRA 1LDDA 2F48A 1BIBA 2HDCA 1FTTA 2M0MA 5HNHA 2VJ4A 3PO2J 2DMPA 4BY7J 3I55I 3JRBA 2W53A 1G4DA 3BWGA 3TEDA 1QPIA 1YX3A 2NX4A 1DU0A 5DDGA 1REPC 2AO9A 5TGTA 3ABLH 3UNGC 5B3SH 3MZHA 2HDWA 4BNCA 5FROA 3KCCA 1ZH5A 1N78A 1X58A 2DI3A 2V57A 2DA7A 3KX2A 4GXOA 2JT1A 4HDUA 5HS8A 2DU9A 2CG4A 3U21A 3OYFA 3S14J 3H1CA 5FKMA 2ISZA 2HZTA 4HNVA 1YX5A 1FT9A 2E1NA 2A5YB 1ON1A 4XRFA 1SD7A 1LE8A 1TLHB 3IRQA 3HPHA 1ZG3A 4UUTA 1R36A 4KICA 4PSXA 2B1EA 3IH2A 1LPQA 1MDMB 2HR3A 3LL7A 5L3GA 1JT0A 2A6EF 1BIAA 1ZGJA 3GTJJ 1FWZA 4RMNA 3JAMZ 2VPRA 4Y4RA 4GYGA 2OUMA 1X1CA 1X1BA 1OQYA 5D5WB 3W2VA 4DYCA 2BE5F 2K9NA 4BDZA 4XR6A 1IGNA 4EM0B 2IA0A 2G3BA 1WH7A 2L9SA 2BXZA 2XF5A 5GAGJ 4BQNA 4ME9A 1HW5A 1G3TA 2GIZA 3K9TA 4F3QA 2P4WA 4CZCA 5HVQC 2GAUA 1W5SA 3RZDJ 2M2EA 3MEXA 3KZZA 3TW7A 2JWTA 4Q5SF 1G3WA 2GIVA 3JAMK 4DGWB 1ZYRF 2KQRA 5LEJA 1IDYA 1TW3A 3S8PA 4EQQA 2W7NA 3RKWA 1XGMA 1TZLA 2FOWA 4AVPA 2D5VA 2GA1A 1XTAA 4BKXA 2ESHA 2MC4A 2CH0A 3ZXSA 1NG7A 2KKOA 2M3AA 3QBMA 4KA4A 1CF7B 1QHHD 3WTXC 3MKYB 1I1GA 4OMZA 4HYEA 4XKBA 5LEKA 1Y8QB 1RNLA 2QKMB 3HPGA 4IQJA 3BR0A 1ZK8A 4PGHA 3S3MA 2QOPA 1W5TA 5H6QA 3KYDB 4A5MA 1LEBA 1FP2A 1OMIA 2CQXA 4JX6A 2WADA 3ZN0A 4D7NA 1S8NA 1LDKB 3SWHA 3DPTA 4IHYA 1FPQA 1K83J 2BY0A 2TDXA 2DFFA 1B1BA 1MDMA 4O5VA 4XORA 4XLNF 1IF1A 2YUSA 3FXQA 2L02A 3FISA 4Y15A 3GZNB 5B5EC 1UHWA 3I58A 2EZHA 3LFUA 2HQ5A 3I4NJ 5FKNA 3LJLA 2IRFG 2Q2EA 3A1YA 3ZMVA 1Q1VA 3HOSA 3QOEA 3VDXA 3R60A 3OR2C 4CYCA 2R7FA 4PJNA 2HDDA 1VQMI 3C2HA 2ZBKA 1XN7A 4L9NA 3ZQQA 3ZN1A 3JSPA 2LD5A 2DJNA 2ZJ2A 1EF4A 5FFZA 1QGPA 4F7ZA 4OAZA 2BY2A 4ICHA 1X1PA 3F8NA 2XPWA 3M8FA 4E7ZA 2KPMA 2LFBA 2PG4A 1RPWA 5IP6A 4I02A 3GXOA 2AQEA 1LVAA 3DBLB 1S5LC 3SYTA 4A69C 5F6FA 1BOBA 2E2IJ 1X3UA 5EG0A 2HWVA 3EETA 3HUGB 5JHFA 2FMLA 2ZCNA 3VUQA 4CZZA 3CCLI 2KIMA 2O03A 1WJFA 2DPDA 3ANGA 2M4GA 2Q1ZB 2R7DA 4KIFA 3HSEA 1W4MA 3ZQGA 3E6CC 4LG0B 3C2BA 3K4CA 2L0KA 3FBIB 4KT6A 3QPLA 3P9KA 3T8TA 3QU6A 3IC7A 3JRDA 3KZ9A 1KZHA 3MN2A 1IAWA 3FZVA 3ERED 2RKHA 2RN7A 4Y33A 2B63J 2M8EA 1I39A 3NWTA 2L9VA 3BJOA 3CMMA 3KPHA 1Z9CA 5GAHJ 2DQLA 2P5KA 2Z16A 5DD4A 1RRJA 3QRFF 1V55H 5F0HA 3S3NA 1TQIA 3H9GA 4KJZA 2VIXA 2K27A 3EDPA 3QP6A 2EILH 3E1SA 4NHJA 3K4NA 4S04A 2R7RA 2P6TA 2Y48A 3VB2A 1XCBA 2FMYA 2BVMA 1XDUA 4KN4X 5HS9A 2ZCXA 3W6VA 2ZJQF 3EYYA 3ZGKA 2DAOA 2XGEA 2VBYA 1R5HA 2IA2A 3P9TA 2XRNA 2FBKA 2LY9A 1YFHA 5IOYA 4A3LJ 4PGGA 3EPZA 4KWAA 2L4MA 2ZY9A 1T0FC 2HKXA 2JK3A 3CCEI 5FHPA 1A36A 2VKDA 4BS9A 4D5CA 1W1WE 1GV5A 4BY1J 3BNIA 3JREA 3A0BC 3F8BA 4BGDA 3S1QJ 1IXSB 4G7HF 4MFDA 1KQ8A 5GAEJ 4PK4A 3D5LA 2WV1A 4LK1F 1HA8A 5AQCA 1U0JA 1SEUA 1NK3P 1WCMJ 3VSKA 2XASA 1JHFA 3PL8A 5L3BA 2HOEA 2MG4A 4HF1A 2IGMA 2WAFA 1TL8A 1S7AA 3LSJA 1WH5A 2DOFA 4GFLA 1SANA 1ZHFA 1TW2A 3FM3A 4ZTFA 1FYLA 3K69A 1U8RA 3WTWC 2GFNA 3OYJA 4UVCA 2VUMJ 4BYYA 2P6SA 1BJZA 5TJJA 1ZARA 4JQFA 4C3JJ 4LOCA 3ZQFA 4II2A 1J2XA 1OYIA 3IH3A 3U1KA 3BC8A 5CLSA 3RDIA 5EDNA 4A12A 3BQYA 4UDSA 5CYVA 4U7BA 3HM5A 4ZJZA 3BG5A 1TWFJ 3K70C 3OYKA 3K4MA 4HKUA 1VQLI 4IZZA 3H3ZA 4XNFA 1HSTA 4RM2A 3VW1A 3F6OA 1IN7A 3W6JB 2DFHA 3U2RA 3VSLA 2XAJA 4EEFG 2H94A 3WODF 3S32A 1B59A 4DYRA 4R1HA 1X3WB 3HOYJ 1HF0A 2WAEA 3B02A 5JLWA 1OCCH 2DJIA 3HRTA 2O9LA 4HRIA 3CUOA 2Z9OA 3ELKA 4EM1A 2R7XA 2EV5A 5D8LB 2A3SA 1DGRM 4GO1A 3SFZA 3VYUB 1LB2A 5BS6A 4AU7A 2PMHA 3F72A 4HX4A 1U5TC 2MABA 3OYEA 5E20A 5E1ZB 5EEAA 5K5OA 3MZYA 2BYVE 2UV1A 4D7MA 2GENA 2ECCA 5DM6F 5JVGF 4BBRJ 2AHQA 3S93A 2VI6A 3WTZA 5ICEA 3JRCA 5KNLA 3WTTC 1J0RA 4O3MA 2A61A 2GBYA 4OIPF 3IAS2 1BW5A 2RQPA 4XLEA 3S1MJ 2NNYA 1ETVA 4LLLA 3ZQLA 3LAJA 3E0JB 3HE0A 1SGMA 2R7ZJ 1WZ2A 3T6NA 4HG2A 3CUQA 5H9TA 5D4RA 2VJ5A 4MTEA 3FHZA 2ZMEA 3E97A 5E3NA 2NVXJ 2CW8A 1H89C 4GCKA 3VW0A 2VKHA 3J80Z 1UZCA 2EFPA 2VODA 2EA4A 3S1NJ 4DOZA 2K5CA 2FF4A 5IYBJ 3CRJA 3QYBA 2DOAA 1L3LA 4IHWA 1D1CA 2R3SA 5KHDA 4YIIA 2KZVA 3GYHX 1P2FA 4RAGA 4XSXF 3ZMUA 2IEKA 5HODA 3J7AY 1AA7A 1LUJB 1PYVA 3IKVA 4OU0A 4RGSA 2AS5F 2KMUA 4WCGA 4RAZA 1HBXG 1HLVA 2JRTA 2V79A 3ASNH 2ESNA 3KEQA 1Z1DA 4I98B 5ILSA 2LDUA 2HYGD 4KNYA 4BQAA 3L9FA 1K78B 1AKHB 2IW5A 2EFOA 4ESFA 3L2CA 1FBUA 2DYRH 3PFIA 1JJ6C 3VP5A 5FGMA 1LNWA 4LG3A 4GRIA 5FB2A 3KZIC 3BQZA 4QPOA 3O60A 4UVBA 3GFLA 4ETSA 5C4XJ 3AG3H 4U7DA 2HU9A 3CCUI 2KHMA 3GTQJ 3R61A 1O3SA 2GOMA 3C07A 4DW6A 3CF2A 5J8CA 2BXYA 2RV8A 2Z33A 2QLZA 2LOOA 1U78A 1GXQA 3IUOA 2EINH 3I64A 3DEWA 4RGXA 3CO7C 4A3MJ 4L18B 1VQPI 2BHZA 3QYFA 4NBQA 1UFMA 1O3RA 2YVHA 3SEQA 3RQIA 3HGGA 4N4NB 3CZ6A 2RREA 3LSHA 4LK0F 3RKQA 2MLGA 4G8XA 4B1RA 5FMPA 3V8KA 5D4SA 1VQKI 5J8FA 4XRMA 1G59A 3MCZA 5K5QA 2K9QA 2ZKZA 3S2DJ 3CMAI 1JT6A 4A3JJ 1WJBA 3DV8A 3PNYA 4M3DA 1BI1A 1H0MA 2KP6A 3NEUA 1E17A 3RCOA 3OV8A 5A2QK 5C4YA 2E34A 2Y0SN 1J75A 4LLNA 3HZJA 2XHKA 5J6XA 1QHGA 1YRNB 3GTMJ 4XLPF 4XSZF 1SVLA 1FSHA 2XAFA 1UJ8A 1WHUA 4KT5C 5E79C 4B4CA 2F07A 1OKRA 3BR3A 1CGPA 1KU9A 1MJAA 2OQRA 1TQMA 5EJCA 2Y75A 2M45A 1BC7C 4G6TB 4E70A 4ENMA 3A03A 1NG6A 2DN0A 4MFEA 2I10A 5BPIA 3ECOA 3K1PA 1GDTA 1MMDA 2ISYA 2X85A 2IGOA 3O2PE 3TL4X 3RPUD 4YFXF 1E0EA 4AF5A 4XMYA 1USTA 2L01A 2WAQA 1UB9A 1I6XA 5EEGA 3ANPA 4AC6A 2GUHA 1IDZA 3CUQC 1PDNC 2VT3A 5LGNA 3LSMA 2W57A 2BW3A 3FDYA 2JZYA 5E3MA 1QVUA 2CUZA 1DP3A 3BRUA 2JN6A 2EBIA 1R1TA 2JA6J 3OYCA 5TRDA 3GFJA 3BCBA 2PJRB 1KA8A 2OC6A 3CDLA 4FHTA 3CJTB 4A3GJ 3ESWB 1U5TB 3S5RA 4MXMA 3I9V2 5LHHA 2VOPA 2F6CA 1HW2A 2IA1A 3K0LA 1W36D 1YRNA 1Z6TA 3BJAA 1JKRC 5GTIC 1X4OA 1W7PD 3WGHA 1K4SA 2R7OA 2KRHA 1XSVA 2JA2A 4ENKA 2QKOA 4GGGA 2K3PA 4PJMA 1J7KA 1FJLA 2L2OA 5K7HA 3A4CA 3EUKL 1R1UA 1B4AA 2Q2EB 1WJEA 2VL8A 3B6CA 3A01A 3NRGA 2TRTA 4IKFA 2LVSA 4JX5A 5DEQA 5F0FA 3E5XA 4CCNA 3I59A 3HOVJ 3KKCA 2PJRA 1XMXA 2KIUA 2R7WA 3VVZA 3ZPLA 3OWTA 5CW8A 5IP9J 2LTPA 1E3OC 3GMEA 5EEHA 3HKZA 4Z2YA 1QPMA 1A31A 4FTHA 2KJCA 2ZXHA 1J9IA 4CSWA 2XSJC 2VPLA 1R71A 2LY1A 4MQ9F 3LNQA 4N9IA 3G1LA 3KP3A 5EF6A 3K1NA 4AC0A 1APLC 5CVUA 1ETKA 1WRJA 3MAJA 1B72A 1TWGJ 1D5VA 4LJZF 3M7GA 2BHYA 4IOAF 3TP3A 2K85A 2Q0OA 3BDDA 5F64A 4NQWA 4A0XA 1FEXA 3QODA 3TMOA 2BY1A 2DCEA 4KYWA 1I3AA 1S72I 2K4JA 1U9OA 2X48A 2CUJA 1ZELA 2HQRA 3BY6A 3ZMDA 2G7UA 4HF0A 3K10A 1V5GA 1HQCA 3FMSA 5IP7J 4ENNA 3CLOA 3OMYA 1U3EM 3BPXA 2ZOZA 4PXIA 4QWQA 2A07F 3CCYA 4RB1A 5HOOA 4CYCB 2A2FX 1ZAOA 3K2ZA 1VI0A 1QRYA 1MBGA 1YG2A 3PNTA 3SXYA 2X51A 4I2OA 2WGBA 1DGWY 2V1XA 2JUGA 3T8RA 1MH4A 2VXZA 4RA2A 1K7AA 1T98A 3BJBA 4UY8I 5EGOA 3ABKH 2ZJRF 3VYSB 3HB9A 4ESJA 4BHPA 4IX7A 1KU2A 3RPUA 4UNOA 1YS7A 3I4MJ 2FJI1 3BR5A 3F8CA 5FFXA 5LD2C 1YYVA 2PZ9A 1O3QA 2XAQA 3C7JA 4FCYA 1JUSA 3OOPA 4P96A 2ZFUA 4AIKA 2JA5J 2DMTA 3I54A 2R7QA 3N97A 1YLFA 3TDZC 1NH3A 1U2WA 2GZWA 2HNHA 2R7SA 3HTHA 3KP4A 1STZA 4MEXF 4UVAA 2LREA 2ZC2A 1GXPA 1G3SA 2DT5A 3DKYA 4M6VA 2KISA 2DMUA 2LK2A 1IRFA 2M87A 1MBJA 2DA4A 4NQWB 1OCRH 2CW0F 4Q48A 2IAIA 1W36C 2A5WA 2W85A 4P55A 2CS3A 3OYDA 4BQQA 4W1UA 4HSTA 3QWLA 2KIFA 5GTHC 4AWXB 2N8GA 5M5YJ 1RKWA 3HRMA 2RNJA 1ZKGA 1WKMA 2H09A 4IO9F 4XLFA 2XDVA 4XLHA 3F1BA 1HCRA 2E36A 1ZLJA 3PO3J 1USSA 3ZQIA 4DYQA 1ETQA 1FTZA 3I4PA 1XB4A 1OJLA 5FKKA 2GXGA 1HC8A 2KFDA 3M1CA 1OR7A 1BA5A 2JSPA 3GBGA 1EJ9A 3LWFA 3I53A 2LBFB 3J7ZI 1VTNC 1ZR4A 5FKOA 3WTSC 1VF9A 5LRRA 1YE9A 1QZZA 1E3HA 1T6SA 1Y6IA 2FE3A 2KJBA 1VQ4I 3KP2A 3ZQHA 4M72A 2R7TA 1BBYA 1IZ1A 3PSIA 5K7ZA 1Z7LA 2LF8A 3N4MA 2LLKA 3BR6A 3W6KB 2E7XA 5IT3A 3DPLC 3E6MA 3MZ8A 4FQGA 4U0YA 2OCEA 4R79A 2EV0A 2X6YA 3PPBA 2Z99A 2JUCA 1OISA 2V6CA 3HTSB 2XAGA 4W97A 3K4BA 1Y0NA 4A6DA 2GOXB 2XROA 1QZEA 3OR1C 4BE0A 4NC8A 5EZHA 1ITYA 1C0WA 5D1RA 2M5WA 5L3CA 3H5NA 3JTGA 5H20A 4C30A 3W2AA 2PQ8A 5HNFA 2EFNA 3P5JA 2GXAA 1VQ8I 3BTCA 3OS2A 3A2KA 2DBBA 2ME6A 3MQ0A 3RSNA 2QBYB 1MBFA 1YI2I 1YIJI 2Y0MA 1RC9A 2MH2A 3CCQI 2AXLA 3FXJA 4JYKA 1RUNA 1B9MA 2DA1A 3V7CA 4XLAA 4IJAA 5JHUA 5JVTA 3QOPA 1IJWC 1PP7U 2O6GE 4FX0A 1HOMA 4XICA 2F5FA 1WVRA 2O7OA 4A0YA
chains in the Genus database with same CATH topology
4ACIA 2XPVA 3CWRA 1LE8B 2HI3A 3BT9A 3CJDA 1FIAA 2MSYA 2R93J 5FLVA 3VW1A 1Y1VJ 1ZQ3P 4I76A 2XDNA 4CGRA 3S1RJ 1ETOA 3TW6A 3PASA 1IUFA 4EEFG 1PUFB 2QCOA 4IEJA 3HOWJ 2QTQA 3JRIA 1LFBA 5M5WJ 4DYRA 3HOYJ 1HF0A 2K40A 1OCTC 3QKXA 2DMQA 1ETXA 2FBQA 5JLWA 4S0HB 3AQTA 3LWJA 2O9LA 1HDDC 1JTXA 2REKA 2UXIA 1ETWA 3SDGA 1T56A 3M3YJ 3IH4A 2LKXA 1CQTA 1A6IA 5M3FJ 3BR1A 4D5FA 5EEAA 1GT0C 3D1NI 3LSGA 4D7MA 2GENA 2HYJA 2ECCA 4M3BA 2JA7J 4BBRJ 4C3IJ 2AHQA 2VI6A 2MW8A 3Q0VA 3JRCA 2E2JJ 5EYRA 2GBYA 4DZJA 1BW5A 3HIMA 3B81A 5GPCA 3S1MJ 1JKOC 5GPAA 1ETVA 1G2HA 1VFCA 3ZQLA 2HOTA 3K7AJ 3HE0A 1SGMA 2R7ZJ 2M0CA 3T6NA 5H9TA 3ZOBA 3HDDA 3S16J 1TC3C 3VVYA 2NVQJ 3LHQA 2X6OA 5E3NA 4NDLA 2NVXJ 1H89C 4GCKA 4A3EJ 2XRLA 2NP5A 4AYBN 4XRSG 2D6YA 3VW0A 3IUVA 5DS9A 1MH3A 3S1NJ 1RESA 1FIPA 4UUSB 3HOUJ 3LSRA 5IYBJ 2KT0A 1JUMA 3CRJA 5HAWA 2Y30A 5EZGA 3JRGA 4M3EA 4IHWA 2WAQN 2G7LA 2E1OA 1S7EA 2OI8A 5BNGA 2IEKA 3JRHA 1RKTA 5HODA 3GTGJ 3DPJA 1P7JA 2GLOA 3VVXA 3ON4A 1HLVA 5J1UA 1GUUA 2DA6A 5DTDA 3GTOJ 5EFYA 2ELKA 2CRGA 3OSFA 5IYDJ 1QVTA 3OSGA 2M9HA 3G7RA 3HKZN 2R0QC 1AKHA 5K58A 1AKHB 2FD5A 2JA8J 2CJJA 5M5XJ 1MNMC 4A3DJ 1JJ6C 3VP5A 1JTYA 1SFOJ 3HGYA 1T33A 4G12A 1NTCA 3BQZA 3ZQCA 4I6ZA 4GFBA 3VIBA 3O60A 4FE4A 5C3EJ 5C4XJ 2CQQA 2NVTJ 3GTQJ 1WI3A 3C07A 3BR2A 3KKDA 4DW6A 1AHDP 4X6AJ 2W48A 4MIMA 4IHXA 1O4XA 3G1OA 3NI7A 1I50J 1UI5A 1U78A 3UKGA 3DEWA 3G1MA 4A3MJ 4JNNA 2UXPA 3B6AA 3HEFA 2ZCMA 2P81A 4L62A 4M3FA 2DMNA 2YVHA 2DG8A 3RQIA 3HGGA 3S15J 3BTJA 5EG0B 2WB1N 4RBOA 3GTKJ 5CXGA 3S2HJ 3RKQA 4YZEA 1JUPA 2G7GA 4B1RA 5FMPA 2FQ4A 4MO7A 2LP0A 1H8AC 4XK4A 4XRMA 5IYCJ 2Y9YA 2EZIA 3Q3SA 2K9QA 1H88C 3S2DJ 1TWHJ 1JT6A 4A3JJ 2G7SA 2DTZA 2K9SA 3F0CA 4M3DA 2OF7A 5D19A 4X1EA 3BG3A 5C4YA 2Y0SN 2XB0X 3E7LA 4A3FJ 5FLMJ 1YRNB 3GTMJ 4L5EA 3MKLA 4GFKA 1F43A 1POGA 2FX0A 4B4CA 1UI6A 2H1KA 1IRZA 2F07A 1MBHA 2EZLA 1IC8A 2VKVA 2ZB9A 5D18A 3BR3A 4V2FA 3GZIA 3GTLJ 2M34A 3VOKA 1WPKA 1JJ8C 3LOCA 5M3MJ 5E3LA 3OIOA 2RHAA 2MGQA 3A03A 4QIWN 1AU7A 3HTIA 3O8HA 2DN0A 4MFEA 2I10A 3GEUA 1GDTA 3HBLA 5GP9A 2RASA 3WHBA 3K2AA 2Y9ZA 4AF5A 1OFCX 1TWCJ 3CQZJ 1B8IB 3EUPA 5F1JA 1UMQA 3ANPA 3MVPA 4AC6A 2GUHA 3FK6A 4AUXA 4RDUA 1IDZA 1IG7A 5E3OA 5C4JJ 2R5ZA 4A93J 2PMZN 5E3MA 1QVUA 4C2MJ 3BRUA 2WUIA 2JN6A 2EBIA 2JA6J 2CUEA 3SFIA 1FTTA 3RD3A 4JP0A 3PO2J 2DMPA 5F04A 4BY7J 3CDLA 3JRBA 2W53A 4A3GJ 5FJ8J 3IV5A 3S5RA 4MXMA 3TEDA 1QPIA 2L9RA 2NX4A 3EGQA 1D5YA 1DU0A 2H8RA 1Z77A 2AO9A 1YRNA 4QTRA 4A3CJ 1X58A 1JKRC 2V57A 2DA7A 5HBUA 3HOXJ 3S14J 5FKMA 2NS8A 2NOGA 3VPRA 2QKOA 4HNVA 2NS7A 1FJLA 1Y1WJ 1LE8A 5K7HA 4MLOA 3A01A 3NRGA 3B6CA 4UUTA 3FRQA 2JMWA 2TRTA 4JL3A 3NPIA 3BCGA 1MSEC 2LVSA 4JX5A 3BG9A 3IH2A 3HTAA 2DA5A 2YU9J 2EZKA 1JT0A 5F0FA 2HYTA 3KKCA 3HOVJ 5J1YA 3GTJJ 2L7MP 3FIWA 2X9DA 3VVZA 2VPRA 5CW8A 5IP9J 2LTPA 1E3OC 5K7FA 1W0TA 3L1PA 2R5ZB 1ORKA 3ON2A 4DYCA 1P7IA 2COBA 2K9NA 2L7FP 4FTHA 2XGCA 1IGNA 3VOXA 1XG1A 2OERA 4A3IJ 2G3BA 1WH7A 3AQSA 2IBDA 1X2NA 3LNQA 2XPUA 4Y7NJ 3G1LA 5EF6A 4ME9A 4AC0A 2CUFA 1UG2A 1APLC 4QSHA 2R5YA 1ETKA 4BXXJ 3JR9A 1B72A 3V78A 1ETYA 1TWGJ 3PM1A 2VKEA 4B3AA 3RZDJ 4JKZA 1A5JA 3TP3A 2M2EA 1ZTRA 2DG7A 3TW7A 2JWTA 3WHCA 3BHQA 1IDYA 1FEXA 1BL0A 2D5VA 2E19A 4BKXA 1JKPC 2EQRA 2L7ZA 2TCTA 1B72B 3QBMA 4A3KJ 1DU6A 1U9OA 2E2HJ 2X48A 3H0GJ 1RR7A 2QF7A 2YVEA 2NVYJ 3NNRA 1GV2A 5J3LA 1JGGA 2ZOZA 5IP7J 3JRAA 3FKIJ 3JSJA 4PXIA 3NAUA 3BR0A 1ZK8A 3V6GA 3CCYA 4DZPA 4CYCB 2ID3A 2HOSA 2QOPA 3KNWA 3HOZJ 1VI0A 1LFUP 3G56A 1XS9A 1QRYA 1MBGA 2XSDC 4JX6A 2CQXA 2IU5A 5FKLA 4D7NA 2WGBA 1GVDA 1XC5A 1MH4A 4FISA 2DA3A 5CXIA 3GTPJ 3BJBA 4IHYA 1K83J 3OOUA 5EGOA 4NN1A 3HB9A 1HDPA 2YUSA 3FISA 1BW6A 2EZHA 2HQ5A 3I4MJ 1MBKA 5FKNA 3I4NJ 3BR5A 2NP3A 3LJLA 4FE7A 2PZ9A 2UXUA 1Q1VA 4FCYA 1ENHA 1JUSA 5HSZA 2Y2ZA 2FJ1A 4XRSA 4CYCA 2EH3A 2HDDA 1I6HJ 2JA5J 2DMTA 4C3HJ 2LD5A 2DJNA 1EF4A 2ECBA 2UXHA 3HTHA 4ICHA 2HXOA 5IPAA 2RAEA 2R92J 1JKQC 4M6VA 4M3GA 2O8KA 2XPWA 2DMUA 2LK2A 2JJ7A 2LFBA 1RPWA 5IP6A 4UUSA 4IHVA 1IV6A 1MBJA 2DA4A 1ZR2A 3E7QA 4A69C 4GCTA 2E2IJ 1WGXA 5JLXA 3RH2A 5EG0A 2IAIA 3VUQA 2ZCNA 3LSPA 3Q0WA 2R5YB 3ANGA 2O7TA 1U8BA 4W1UA 3ZQGA 2CU7A 1W0UA 2N8GA 5M5YJ 1RKWA 4MK6A 3C2BA 5F27A 2L0KA 1ZKGA 3QPLA 4XIDA 3JRDA 3KZ9A 4J19A 1I3QJ 3MN2A 1RETA 2XGDA 1B8IA 3COLA 5F0CA 3F1BA 2B63J 2G0EA 1HCRA 3PO3J 4Y52J 3QQAA 3ZQIA 4JX4A 4DYQA 1ETQA 1FTZA 1OJLA 5FKKA 1NK2P 2HOAA 5FGLA 3HTJA 2QIBA 3A02A 3S17J 5F0HA 5J1RA 1MBEA 1UHSA 3RZOJ 1BA5A 3SJMA 3GBGA 4NELA 2GM4A 1X2MA 1ZR4A 3QPSA 2UXOA 5IOZA 5FKOA 1MSFC 1VF9A 2ZCXA 1VNDA 4BBSJ 5DAJA 3W6VA 4A3BJ 2PBXA 2XGEA 3JRFA 3NARA 3ZQHA 3P9TA 2LY9A 5IOYA 1R9TJ 4A3LJ 4KWAA 5K7ZA 2LR8A 2LLKA 3BR6A 2JK3A 5FHPA 2Q24A 2XB5A 4D5CA 2ID6A 1GV5A 4BY1J 3BNIA 3JREA 3FK7A 3PPBA 2KDZA 3S1QJ 1F36A 1Z0XA 4MFDA 1OCPA 1TWAJ 2WV1A 5AQCA 3O8GA 4W97A 1U9NA 1NK3P 2DA2A 1WCMJ 2YS9A 4ABZA 2ME0A 3A01B 5EZHA 1ITYA 5D1RA 3NXCA 2MG4A 1ZGWA 3H3VK 5C44J 3LSJA 1WH5A 2QWTA 4GFLA 1SANA 3BTCA 9ANTA 3MNLA 2ME6A 2HKUA 3DCFA 3VW2A 1MBFA 3M4OJ 2GFNA 3BTLA 1PUFA 2VUMJ 1BJZA 4JYKA 2OPTA 4C3JJ 2DA1A 1K61A 2ZOYA 4LOCA 2Y31A 3ZQFA 5F08A 1IJWC 3TP0A 4GCLA 3IH3A 4V2GA 3BTIA 3Q0UA 2M8GX 5EDNA 3BQYA 1HOMA 4UDSA 5EGOB 3HM5A 4XICA 3BG5A 2O7OA 3CMYA 1TWFJ 2HXIA 4HKUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4ACI A;  2XPV A;  3CWR A;  1LE8 B;  2HI3 A;  3BT9 A;  3CJD A;  1FIA A;  2MSY A;  2R93 J;  5FLV A;  3VW1 A;  1Y1V J;  1ZQ3 P;  4I76 A;  2XDN A;  4CGR A;  3S1R J;  1ETO A;  3TW6 A;  3PAS A;  1IUF A;  4EEF G;  1PUF B;  2QCO A;  4IEJ A;  3HOW J;  2QTQ A;  3JRI A;  1LFB A;  5M5W J;  4DYR A;  3HOY J;  1HF0 A;  2K40 A;  1OCT C;  3QKX A;  2DMQ A;  1ETX A;  2FBQ A;  5JLW A;  4S0H B;  3AQT A;  3LWJ A;  2O9L A;  1HDD C;  1JTX A;  2REK A;  2UXI A;  1ETW A;  3SDG A;  1T56 A;  3M3Y J;  3IH4 A;  2LKX A;  1CQT A;  1A6I A;  5M3F J;  3BR1 A;  4D5F A;  5EEA A;  1GT0 C;  3D1N I;  3LSG A;  4D7M A;  2GEN A;  2HYJ A;  2ECC A;  4M3B A;  2JA7 J;  4BBR J;  4C3I J;  2AHQ A;  2VI6 A;  2MW8 A;  3Q0V A;  3JRC A;  2E2J J;  5EYR A;  2GBY A;  4DZJ A;  1BW5 A;  3HIM A;  3B81 A;  5GPC A;  3S1M J;  1JKO C;  5GPA A;  1ETV A;  1G2H A;  1VFC A;  3ZQL A;  2HOT A;  3K7A J;  3HE0 A;  1SGM A;  2R7Z J;  2M0C A;  3T6N A;  5H9T A;  3ZOB A;  3HDD A;  3S16 J;  1TC3 C;  3VVY A;  2NVQ J;  3LHQ A;  2X6O A;  5E3N A;  4NDL A;  2NVX J;  1H89 C;  4GCK A;  4A3E J;  2XRL A;  2NP5 A;  4AYB N;  4XRS G;  2D6Y A;  3VW0 A;  3IUV A;  5DS9 A;  1MH3 A;  3S1N J;  1RES A;  1FIP A;  4UUS B;  3HOU J;  3LSR A;  5IYB J;  2KT0 A;  1JUM A;  3CRJ A;  5HAW A;  2Y30 A;  5EZG A;  3JRG A;  4M3E A;  4IHW A;  2WAQ N;  2G7L A;  2E1O A;  1S7E A;  2OI8 A;  5BNG A;  2IEK A;  3JRH A;  1RKT A;  5HOD A;  3GTG J;  3DPJ A;  1P7J A;  2GLO A;  3VVX A;  3ON4 A;  1HLV A;  5J1U A;  1GUU A;  2DA6 A;  5DTD A;  3GTO J;  5EFY A;  2ELK A;  2CRG A;  3OSF A;  5IYD J;  1QVT A;  3OSG A;  2M9H A;  3G7R A;  3HKZ N;  2R0Q C;  1AKH A;  5K58 A;  1AKH B;  2FD5 A;  2JA8 J;  2CJJ A;  5M5X J;  1MNM C;  4A3D J;  1JJ6 C;  3VP5 A;  1JTY A;  1SFO J;  3HGY A;  1T33 A;  4G12 A;  1NTC A;  3BQZ A;  3ZQC A;  4I6Z A;  4GFB A;  3VIB A;  3O60 A;  4FE4 A;  5C3E J;  5C4X J;  2CQQ A;  2NVT J;  3GTQ J;  1WI3 A;  3C07 A;  3BR2 A;  3KKD A;  4DW6 A;  1AHD P;  4X6A J;  2W48 A;  4MIM A;  4IHX A;  1O4X A;  3G1O A;  3NI7 A;  1I50 J;  1UI5 A;  1U78 A;  3UKG A;  3DEW A;  3G1M A;  4A3M J;  4JNN A;  2UXP A;  3B6A A;  3HEF A;  2ZCM A;  2P81 A;  4L62 A;  4M3F A;  2DMN A;  2YVH A;  2DG8 A;  3RQI A;  3HGG A;  3S15 J;  3BTJ A;  5EG0 B;  2WB1 N;  4RBO A;  3GTK J;  5CXG A;  3S2H J;  3RKQ A;  4YZE A;  1JUP A;  2G7G A;  4B1R A;  5FMP A;  2FQ4 A;  4MO7 A;  2LP0 A;  1H8A C;  4XK4 A;  4XRM A;  5IYC J;  2Y9Y A;  2EZI A;  3Q3S A;  2K9Q A;  1H88 C;  3S2D J;  1TWH J;  1JT6 A;  4A3J J;  2G7S A;  2DTZ A;  2K9S A;  3F0C A;  4M3D A;  2OF7 A;  5D19 A;  4X1E A;  3BG3 A;  5C4Y A;  2Y0S N;  2XB0 X;  3E7L A;  4A3F J;  5FLM J;  1YRN B;  3GTM J;  4L5E A;  3MKL A;  4GFK A;  1F43 A;  1POG A;  2FX0 A;  4B4C A;  1UI6 A;  2H1K A;  1IRZ A;  2F07 A;  1MBH A;  2EZL A;  1IC8 A;  2VKV A;  2ZB9 A;  5D18 A;  3BR3 A;  4V2F A;  3GZI A;  3GTL J;  2M34 A;  3VOK A;  1WPK A;  1JJ8 C;  3LOC A;  5M3M J;  5E3L A;  3OIO A;  2RHA A;  2MGQ A;  3A03 A;  4QIW N;  1AU7 A;  3HTI A;  3O8H A;  2DN0 A;  4MFE A;  2I10 A;  3GEU A;  1GDT A;  3HBL A;  5GP9 A;  2RAS A;  3WHB A;  3K2A A;  2Y9Z A;  4AF5 A;  1OFC X;  1TWC J;  3CQZ J;  1B8I B;  3EUP A;  5F1J A;  1UMQ A;  3ANP A;  3MVP A;  4AC6 A;  2GUH A;  3FK6 A;  4AUX A;  4RDU A;  1IDZ A;  1IG7 A;  5E3O A;  5C4J J;  2R5Z A;  4A93 J;  2PMZ N;  5E3M A;  1QVU A;  4C2M J;  3BRU A;  2WUI A;  2JN6 A;  2EBI A;  2JA6 J;  2CUE A;  3SFI A;  1FTT A;  3RD3 A;  4JP0 A;  3PO2 J;  2DMP A;  5F04 A;  4BY7 J;  3CDL A;  3JRB A;  2W53 A;  4A3G J;  5FJ8 J;  3IV5 A;  3S5R A;  4MXM A;  3TED A;  1QPI A;  2L9R A;  2NX4 A;  3EGQ A;  1D5Y A;  1DU0 A;  2H8R A;  1Z77 A;  2AO9 A;  1YRN A;  4QTR A;  4A3C J;  1X58 A;  1JKR C;  2V57 A;  2DA7 A;  5HBU A;  3HOX J;  3S14 J;  5FKM A;  2NS8 A;  2NOG A;  3VPR A;  2QKO A;  4HNV A;  2NS7 A;  1FJL A;  1Y1W J;  1LE8 A;  5K7H A;  4MLO A;  3A01 A;  3NRG A;  3B6C A;  4UUT A;  3FRQ A;  2JMW A;  2TRT A;  4JL3 A;  3NPI A;  3BCG A;  1MSE C;  2LVS A;  4JX5 A;  3BG9 A;  3IH2 A;  3HTA A;  2DA5 A;  2YU9 J;  2EZK A;  1JT0 A;  5F0F A;  2HYT A;  3KKC A;  3HOV J;  5J1Y A;  3GTJ J;  2L7M P;  3FIW A;  2X9D A;  3VVZ A;  2VPR A;  5CW8 A;  5IP9 J;  2LTP A;  1E3O C;  5K7F A;  1W0T A;  3L1P A;  2R5Z B;  1ORK A;  3ON2 A;  4DYC A;  1P7I A;  2COB A;  2K9N A;  2L7F P;  4FTH A;  2XGC A;  1IGN A;  3VOX A;  1XG1 A;  2OER A;  4A3I J;  2G3B A;  1WH7 A;  3AQS A;  2IBD A;  1X2N A;  3LNQ A;  2XPU A;  4Y7N J;  3G1L A;  5EF6 A;  4ME9 A;  4AC0 A;  2CUF A;  1UG2 A;  1APL C;  4QSH A;  2R5Y A;  1ETK A;  4BXX J;  3JR9 A;  1B72 A;  3V78 A;  1ETY A;  1TWG J;  3PM1 A;  2VKE A;  4B3A A;  3RZD J;  4JKZ A;  1A5J A;  3TP3 A;  2M2E A;  1ZTR A;  2DG7 A;  3TW7 A;  2JWT A;  3WHC A;  3BHQ A;  1IDY A;  1FEX A;  1BL0 A;  2D5V A;  2E19 A;  4BKX A;  1JKP C;  2EQR A;  2L7Z A;  2TCT A;  1B72 B;  3QBM A;  4A3K J;  1DU6 A;  1U9O A;  2E2H J;  2X48 A;  3H0G J;  1RR7 A;  2QF7 A;  2YVE A;  2NVY J;  3NNR A;  1GV2 A;  5J3L A;  1JGG A;  2ZOZ A;  5IP7 J;  3JRA A;  3FKI J;  3JSJ A;  4PXI A;  3NAU A;  3BR0 A;  1ZK8 A;  3V6G A;  3CCY A;  4DZP A;  4CYC B;  2ID3 A;  2HOS A;  2QOP A;  3KNW A;  3HOZ J;  1VI0 A;  1LFU P;  3G56 A;  1XS9 A;  1QRY A;  1MBG A;  2XSD C;  4JX6 A;  2CQX A;  2IU5 A;  5FKL A;  4D7N A;  2WGB A;  1GVD A;  1XC5 A;  1MH4 A;  4FIS A;  2DA3 A;  5CXI A;  3GTP J;  3BJB A;  4IHY A;  1K83 J;  3OOU A;  5EGO A;  4NN1 A;  3HB9 A;  1HDP A;  2YUS A;  3FIS A;  1BW6 A;  2EZH A;  2HQ5 A;  3I4M J;  1MBK A;  5FKN A;  3I4N J;  3BR5 A;  2NP3 A;  3LJL A;  4FE7 A;  2PZ9 A;  2UXU A;  1Q1V A;  4FCY A;  1ENH A;  1JUS A;  5HSZ A;  2Y2Z A;  2FJ1 A;  4XRS A;  4CYC A;  2EH3 A;  2HDD A;  1I6H J;  2JA5 J;  2DMT A;  4C3H J;  2LD5 A;  2DJN A;  1EF4 A;  2ECB A;  2UXH A;  3HTH A;  4ICH A;  2HXO A;  5IPA A;  2RAE A;  2R92 J;  1JKQ C;  4M6V A;  4M3G A;  2O8K A;  2XPW A;  2DMU A;  2LK2 A;  2JJ7 A;  2LFB A;  1RPW A;  5IP6 A;  4UUS A;  4IHV A;  1IV6 A;  1MBJ A;  2DA4 A;  1ZR2 A;  3E7Q A;  4A69 C;  4GCT A;  2E2I J;  1WGX A;  5JLX A;  3RH2 A;  5EG0 A;  2IAI A;  3VUQ A;  2ZCN A;  3LSP A;  3Q0W A;  2R5Y B;  3ANG A;  2O7T A;  1U8B A;  4W1U A;  3ZQG A;  2CU7 A;  1W0U A;  2N8G A;  5M5Y J;  1RKW A;  4MK6 A;  3C2B A;  5F27 A;  2L0K A;  1ZKG A;  3QPL A;  4XID A;  3JRD A;  3KZ9 A;  4J19 A;  1I3Q J;  3MN2 A;  1RET A;  2XGD A;  1B8I A;  3COL A;  5F0C A;  3F1B A;  2B63 J;  2G0E A;  1HCR A;  3PO3 J;  4Y52 J;  3QQA A;  3ZQI A;  4JX4 A;  4DYQ A;  1ETQ A;  1FTZ A;  1OJL A;  5FKK A;  1NK2 P;  2HOA A;  5FGL A;  3HTJ A;  2QIB A;  3A02 A;  3S17 J;  5F0H A;  5J1R A;  1MBE A;  1UHS A;  3RZO J;  1BA5 A;  3SJM A;  3GBG A;  4NEL A;  2GM4 A;  1X2M A;  1ZR4 A;  3QPS A;  2UXO A;  5IOZ A;  5FKO A;  1MSF C;  1VF9 A;  2ZCX A;  1VND A;  4BBS J;  5DAJ A;  3W6V A;  4A3B J;  2PBX A;  2XGE A;  3JRF A;  3NAR A;  3ZQH A;  3P9T A;  2LY9 A;  5IOY A;  1R9T J;  4A3L J;  4KWA A;  5K7Z A;  2LR8 A;  2LLK A;  3BR6 A;  2JK3 A;  5FHP A;  2Q24 A;  2XB5 A;  4D5C A;  2ID6 A;  1GV5 A;  4BY1 J;  3BNI A;  3JRE A;  3FK7 A;  3PPB A;  2KDZ A;  3S1Q J;  1F36 A;  1Z0X A;  4MFD A;  1OCP A;  1TWA J;  2WV1 A;  5AQC A;  3O8G A;  4W97 A;  1U9N A;  1NK3 P;  2DA2 A;  1WCM J;  2YS9 A;  4ABZ A;  2ME0 A;  3A01 B;  5EZH A;  1ITY A;  5D1R A;  3NXC A;  2MG4 A;  1ZGW A;  3H3V K;  5C44 J;  3LSJ A;  1WH5 A;  2QWT A;  4GFL A;  1SAN A;  3BTC A;  9ANT A;  3MNL A;  2ME6 A;  2HKU A;  3DCF A;  3VW2 A;  1MBF A;  3M4O J;  2GFN A;  3BTL A;  1PUF A;  2VUM J;  1BJZ A;  4JYK A;  2OPT A;  4C3J J;  2DA1 A;  1K61 A;  2ZOY A;  4LOC A;  2Y31 A;  3ZQF A;  5F08 A;  1IJW C;  3TP0 A;  4GCL A;  3IH3 A;  4V2G A;  3BTI A;  3Q0U A;  2M8G X;  5EDN A;  3BQY A;  1HOM A;  4UDS A;  5EGO B;  3HM5 A;  4XIC A;  3BG5 A;  2O7O A;  3CMY A;  1TWF J;  2HXI A;  4HKU A; 
#chains in the Genus database with same CATH topology
 4ACI A;  2EFQ A;  2XPV A;  3T1B A;  3ZMZ A;  2HI3 A;  2R93 J;  4JBA A;  2EWN A;  1W5C C;  4KMU X;  2QUF A;  3TOA A;  1ETO A;  1YQA A;  4LIT A;  1IUF A;  3OYL A;  2H6C A;  2OBP A;  5ILU A;  1LFB A;  5M5W J;  2LG4 A;  3H3U A;  1LJ9 A;  4XLC A;  2W4S A;  3CCR I;  3GX4 X;  4KMF A;  1OCT C;  3AQT A;  3LWJ A;  2HYF A;  2LYC A;  1HDD C;  1IW7 F;  5CVR A;  4DNC A;  1X1D A;  1U5T A;  1QZY A;  4LLG F;  3SDG A;  4V19 K;  4LIV A;  1T56 A;  5TIS C;  4XM3 A;  5B1B H;  1XD7 A;  3BR1 A;  2WC2 A;  3ZQ7 A;  4D5F A;  1N77 A;  1MGT A;  4HLY A;  1GT0 C;  4BQO A;  3V7R A;  4L9J A;  4BUP A;  1AWC A;  3HHG A;  3ONQ A;  2ZFW A;  3CCJ I;  2IP2 A;  2MW8 A;  2CO5 A;  2CYY A;  3Q0V A;  3IKT A;  3OYA A;  1R6R A;  4DZJ A;  3HIM A;  4L5I A;  3QU3 A;  3B81 A;  4C2U A;  3COA C;  4BJT A;  3BOQ A;  5GPA A;  1FP1 D;  2ELJ A;  1G2H A;  4I0B A;  2H1L A;  1KQ9 A;  2BEO A;  1G3Y A;  2HOT A;  4E7H A;  2M0C A;  3ZOB A;  3CCM I;  2A69 F;  3HDD A;  2X1E A;  3S16 J;  3HTU A;  2NVQ J;  3LHQ A;  4AD9 A;  1SVM A;  2R7U A;  3KIO A;  3TO6 A;  3C3W A;  1R23 A;  1ON2 A;  2LKS A;  4AYB N;  1OR7 C;  3HUG A;  3J81 K;  1VQ7 I;  3IUV A;  5DS9 A;  3I71 A;  2PJP A;  3LA3 A;  3FM5 A;  4I09 A;  1JUM A;  3FBN B;  2WB1 A;  3SZT A;  3JRG A;  1ULY A;  1T39 A;  2ZXW H;  1MKM A;  2E1O A;  1LVK A;  2OI8 A;  2QEN A;  2VN2 A;  5BNG A;  3GTG J;  1P7J A;  3KP5 A;  4PFP A;  3QYE A;  1TNS A;  4KIG A;  2P0W A;  2WA0 A;  3J81 Z;  1GUU A;  2DA6 A;  3I3L A;  5EFY A;  2CRG A;  4AM3 A;  1QVT A;  2BY3 A;  2QWW A;  1EH7 A;  2YU3 A;  3KFW X;  3WTV C;  2R0Q C;  3KEY A;  4UHT A;  2DYS H;  4XKW A;  5ILV A;  4HAM A;  5M5X J;  4RGR A;  4JK1 X;  4A3D J;  2IS6 A;  1S3J A;  1HXD A;  3NQO A;  1P9Q C;  2H6B A;  4G12 A;  4A6E A;  3BG7 A;  3ZQC A;  3VIB A;  3IHU A;  3VYT B;  3QP5 A;  1A04 A;  4ZYG A;  2CQQ A;  3TO9 A;  3J7A O;  1X19 A;  2MD0 A;  2ADU A;  1MD0 A;  2KRC A;  2Q8K A;  3KKD A;  1AHD P;  4IHX A;  4D1Q A;  4MEY F;  2WV0 A;  2M7A A;  2IT0 A;  2ZNZ A;  3UKG A;  5HLI A;  2UXP A;  3B6A A;  3DBR B;  4M3F A;  2AQF A;  2DMN A;  2OAZ A;  1MNE A;  2COM A;  3LA2 A;  4RBO A;  3GTK J;  5FRM A;  3S15 J;  1XGO A;  3F22 A;  3GWZ A;  2FQ4 A;  2O5R A;  1T95 A;  2LH9 A;  4MO7 A;  1LFP A;  2LP0 A;  4YG2 F;  1H8A C;  1I1S A;  4KIT B;  1S9H A;  3D5R C;  3DU6 A;  1ONV A;  2Y9Y A;  4GDF A;  2LKP A;  1SFU A;  2UXX A;  3Q3S A;  2RNG A;  1ZRC A;  1H88 C;  3G6E I;  4Q47 A;  2FXA A;  2JRM A;  2G7S A;  2HPM A;  2JVG A;  3M9A A;  1PVE A;  1XSX A;  3TQN A;  1XX5 A;  2QQ9 A;  3CP8 A;  1XDS A;  3K4J A;  2EFW A;  4P5O A;  2DLL A;  5D19 A;  4X1E A;  3BG3 A;  2KDO A;  3EUH C;  1CF7 A;  4L5E A;  3MKL A;  3RPQ A;  4CUG A;  3H9J A;  2VQC A;  1KGS A;  2I8D A;  1POG A;  3FMR A;  3GEZ A;  1H9T A;  2EIM H;  2HQA A;  1IRZ A;  2EZL A;  1IN5 A;  2X1C A;  1Y56 A;  4V2F A;  4ZH4 F;  3GZI A;  4E7S A;  4L5J A;  4XOP A;  5M3M J;  1BC8 C;  3EQL F;  5E3L A;  2RHA A;  2GWR A;  4QIW N;  3CCV I;  3CCS I;  2A68 F;  3O8H A;  2DO7 A;  2CQK A;  4RB0 A;  3GEU A;  4PJL A;  4LFU A;  3FKJ A;  3O3K A;  1QU3 A;  2Y9Z A;  2FSW A;  2HS5 A;  1OFC X;  5ERI A;  1B8I B;  3EUP A;  1BR2 A;  3RYR A;  2CW7 A;  2PFB A;  2PI0 A;  1JHH A;  3MVP A;  5E8I A;  3FK6 A;  3FXO A;  4RDU A;  2XAU A;  2OTJ I;  2R5Z A;  4N4O B;  4A93 J;  4ZYD A;  1Z21 A;  1TNT A;  4ZDP A;  1MJ9 A;  4IPA A;  4XOT A;  2FRH A;  2FQ3 A;  3SFI A;  3FXK A;  3RD3 A;  2OQG A;  4II3 A;  2DFE A;  3I56 I;  5HS7 A;  5FJ8 J;  3J7Y J;  2L9R A;  5ICG A;  2H8R A;  3EGQ A;  1Z77 A;  2LRD A;  4D9J A;  2WY7 Q;  4WK8 F;  1FYM A;  3KZY A;  3SHF A;  2L9N A;  4A3C J;  4BH9 A;  4A2U A;  4IF4 A;  4XKC A;  4KUM A;  3HOX J;  4PJ0 C;  2NOG A;  3VPR A;  5JFR A;  4F92 B;  4RB3 C;  2P5V A;  1DPU A;  1EH8 A;  2IGK A;  2V9V A;  4BU2 A;  3FMQ A;  1ZLK A;  1D0X A;  2IS2 A;  3FX3 A;  4MGR A;  3RKX A;  1Y1W J;  2NRA C;  1BM9 A;  1SD5 A;  2W24 A;  2EK5 A;  3G2B A;  2YVX A;  3FHN A;  4JL3 A;  1WJA A;  4LB6 B;  4CCO A;  1MIJ A;  1V5F A;  1DP7 P;  3NPI A;  3HTA A;  4ASN A;  4L9V A;  2DA5 A;  2GA2 A;  3M8E A;  2EZK A;  3ML6 A;  3MFK A;  4OOI A;  3AL0 B;  1Q1H A;  3CP2 A;  2JSC A;  3KLN A;  5K7F A;  3L1P A;  4AYB A;  2BW3 B;  2X0L A;  1WSU A;  3ON2 A;  2P7V B;  2COB A;  2L7F P;  2PMU A;  5HDN A;  3S3O A;  2C6Y A;  2OER A;  3H35 A;  4R8H A;  4G6D A;  4RB2 C;  2R7V A;  1FMW A;  3BP8 A;  1KU7 A;  3AQS A;  1I5Z A;  1X2N A;  4YIF A;  2EV6 A;  4Y13 A;  3OS1 A;  3J80 K;  1UG2 A;  4QSH A;  1WI9 A;  3SQN A;  4BXX J;  3JR9 A;  4C2T A;  3V78 A;  1ETY A;  2F5V A;  3PM1 A;  1FOY A;  3ISP A;  4B3A A;  4EGZ A;  4JKZ A;  4IRG A;  1A5J A;  3EYI A;  5DCF A;  5DCM B;  1YW9 A;  5AIQ A;  1BL0 A;  2BVL A;  2E19 A;  3F3X A;  1O7L A;  3CO6 C;  1JKP C;  2V6E A;  1T8I A;  3GVA A;  4A3K J;  1O57 A;  1DU6 A;  3H0G J;  3DFG A;  1RR7 A;  2QF7 A;  1LQ1 A;  2NVY J;  2YVE A;  5LHI A;  4HX8 A;  5GAD J;  3L09 A;  1D1A A;  1WJD A;  5J3L A;  4EM2 A;  5FO5 A;  4P9U A;  4Z6Y A;  1M1E B;  1R1V A;  3H0D A;  3C2G A;  3V6G A;  2DQR A;  2HQN A;  1Y8R B;  2ID3 A;  2OZ6 A;  3KNW A;  1D0Z A;  1EH6 A;  1X4P A;  4PZJ A;  1XS9 A;  1LFU P;  2BGC A;  3G56 A;  4PFO A;  2QSG X;  5E8G A;  3ZMS A;  2LBF A;  2D45 A;  4OIN F;  1XC5 A;  4RGU A;  3DF8 A;  3L2Q A;  2DK8 A;  5CXI A;  3GTP J;  4NN1 A;  3OOU A;  4B43 A;  1ZRE A;  1HDP A;  2VBW A;  3MD2 A;  3RQ4 A;  1ERD A;  1BW6 A;  2B0L A;  3C18 A;  4AIJ A;  5BOX A;  2LSO A;  3TDU C;  3LAP A;  3CJR B;  5CQG A;  1AOY A;  5HSZ A;  2Y2Z A;  3LFK A;  1K6Y A;  3JTH A;  4XRS A;  2EH3 A;  3PFY A;  1I6H J;  2OTL I;  1QO0 D;  4O6J A;  4OD5 A;  4C3H J;  2ECB A;  3KP7 A;  3QPT A;  5IPA A;  2RAE A;  4K2E A;  2QSH X;  4M6X A;  3G4S I;  4M3G A;  2CSO A;  3ZRG A;  1T38 A;  1MND A;  2O8K A;  4B3X A;  2JJ7 A;  3LST A;  3SEZ A;  3DLA A;  4OD4 A;  4E7L A;  4HV6 A;  4IHV A;  4IRV A;  1IV6 A;  2B9S A;  1ZR2 A;  3E7Q A;  4GCT A;  1WGX A;  5JLX A;  1IUY A;  2HVR A;  3MKZ A;  4BEH B;  3L2V A;  3LSP A;  3Q0W A;  4GYI A;  2PN6 A;  2R5Y B;  1D1B A;  2BV6 A;  2F5E A;  2O7T A;  2W1O A;  4BDY A;  1U8B A;  3RKY A;  3M1E A;  1KU3 A;  3WG7 H;  5F27 A;  2L3D A;  4XID A;  4I99 C;  2M30 A;  1I3Q J;  2L54 A;  2RGV A;  1EKE A;  1IXR C;  2XGD A;  3E5U A;  1VZ0 A;  1XCV A;  5F0C A;  5B1A H;  3COL A;  1R5I D;  4B48 A;  1S6L A;  1QQI A;  3OIP A;  3Q9S A;  3QQA A;  1J09 A;  1NHA A;  2LY2 A;  2CFO A;  1NK2 P;  1MMS A;  2HOA A;  1R7J A;  4F55 A;  1FLI A;  4CIC A;  5FGL A;  2FEZ A;  1P4W A;  3HTJ A;  2QEX I;  2R4G A;  2E1M C;  1UHS A;  3RZO J;  2FNP A;  1K6O A;  4NEL A;  4M9X A;  3OS0 A;  4A0Z A;  3H5R A;  2ZME B;  4HPQ A;  3QPS A;  4RS8 A;  3OYH A;  2GM4 A;  2UXO A;  1OPC A;  2BOL A;  2DTR A;  1VND A;  4PUS A;  4BBS J;  4A3B J;  1R4N B;  1S7O A;  4HBL A;  4ANJ A;  5IY5 H;  3WE3 A;  4NB5 A;  4KIS A;  2HKO A;  5D6F A;  1R9T J;  4CA0 A;  2RDP A;  2YX7 A;  4JOM A;  3OY9 A;  2LR8 A;  2VXD A;  5HLH A;  2HEO A;  4OIQ F;  4PCQ A;  3HIF A;  1TT0 A;  3TO7 A;  2ID6 A;  4KN7 X;  1FMV A;  3FK7 A;  3A0H C;  3OYB A;  2CV0 A;  2ZNY A;  1TP4 A;  2KDZ A;  1F36 A;  1Z0X A;  5DYM A;  1SD4 A;  3PQK A;  1OCP A;  2QGU A;  2V26 A;  5E18 F;  4UV9 A;  3O8G A;  4IHS A;  5LBQ A;  1WJ5 A;  2LMD A;  2DA2 A;  2YS9 A;  1RUO A;  2ME0 A;  1XMA A;  3VYR B;  3PIP F;  1YHQ I;  1ZGW A;  5BMZ A;  3N05 A;  4OAY A;  3SZP A;  4YRV A;  3H3V K;  4NNJ A;  2QWT A;  1YS6 A;  5F1R A;  3FXL A;  1ZN2 A;  3BZ6 A;  2WTE A;  3MKW B;  3MNL A;  1WJC A;  3IAM 2;  3D0S A;  4ITV A;  2HPI A;  3DCF A;  3ASO H;  3K1M A;  5KAF C;  5IT9 Z;  2HKU A;  3M4O J;  3VW2 A;  3PNV A;  2FNA A;  2JVH A;  4E7I A;  3WTU C;  2NNN A;  3BTL A;  3EUH A;  3FXU A;  2G7H A;  4PDK A;  2E71 A;  2OPT A;  1K61 A;  2G9W A;  1H9G A;  3F8F A;  2XC7 A;  4RAF A;  2JPB A;  4WIB A;  3QPH A;  3HC7 A;  4I01 A;  3TP0 A;  4V2G A;  4C9Y A;  2UWM A;  4U9L A;  3DQV C;  2V9K A;  2F4O B;  2BZT A;  3H9Q A;  1K79 A;  2JQ7 A;  2DT7 B;  2HXI A;  4XKV A;  1D8J A;  2RAS A;  1SVO A;  2VC0 A;  4HSR A;  3CWR A;  1LE8 B;  3BT9 A;  3S2W A;  3CJD A;  2MSY A;  3SDB A;  1W7P A;  2MFZ A;  5FLV A;  1Y1V J;  3L2R A;  4I76 A;  4M71 A;  4CGZ A;  2XDN A;  1YIO A;  4CGR A;  3PAS A;  3ZR8 X;  2NYX A;  5CVJ A;  3HOW J;  4F91 B;  3JRI A;  2DK5 A;  3MMY B;  1G8X A;  1SAX A;  3RIR A;  4CHU A;  2HVQ A;  3F23 A;  3REO A;  2DMQ A;  1ETX A;  3CLQ A;  5DUK A;  4N9H A;  4BEH A;  1FBS A;  2Z1D A;  3BRO A;  1D3Y A;  3GW2 A;  5AIP A;  2ZSI B;  3IWF A;  4FX4 A;  1K78 A;  2LKX A;  1CQT A;  1YOV B;  3M3Y J;  2UUZ A;  2V1N A;  4LGW A;  2K9M A;  3F21 A;  2E60 A;  2RQQ A;  3D1N I;  4KIB A;  3LSG A;  2HYJ A;  4M3B A;  1ZG5 A;  2JA7 J;  4C3I J;  2E2J J;  3BZK A;  4RAY A;  4UV8 A;  2E35 A;  2QQB A;  2L4A A;  2HTS A;  1EV7 A;  1Z6R A;  3CDH A;  3K70 D;  3NRV A;  1JKO C;  2YPR A;  4M9Z A;  3ULQ B;  1YJW I;  2V4J C;  3KLO A;  3VVY A;  3UR3 C;  4NDL A;  4ZDO A;  1U6G A;  4A3E J;  4I7H A;  2XRL A;  2NP5 A;  4XRS G;  2D6Y A;  1R22 A;  2DOD A;  4Q4Z F;  2PBI A;  5L3D A;  2MA3 A;  2QQ8 A;  5ED4 A;  1RES A;  1FIP A;  3OIQ A;  4UUS B;  3HOU J;  2KT0 A;  3OYN A;  1X1A A;  2IPQ X;  5HAW A;  2Y30 A;  3ROU A;  4HF2 A;  2WBM A;  4ZZD A;  4QPQ A;  5FD6 A;  1S7E A;  2BBY A;  3WE2 A;  2CFX A;  3U9G A;  3JRH A;  3DPJ A;  4HDV A;  1FBQ A;  2VE8 A;  2GLO A;  3O6B B;  3VVX A;  2CV2 A;  3ON4 A;  2EB7 A;  2FUG 2;  5H6R A;  1SC7 A;  3FF5 A;  3IP4 B;  1LEA A;  5DV5 A;  2ELK A;  5BPD A;  5IYD J;  3OSG A;  2M9H A;  2QSF X;  1N25 A;  1FX7 A;  3HKZ N;  1DDN A;  2VOO A;  5D8K B;  3G7R A;  1V54 H;  2ZME C;  3G73 A;  2XKO A;  2FD5 A;  3D5S C;  2CJJ A;  2E1M B;  1MNM C;  3HXL A;  3RYP A;  2F5C A;  2IS1 A;  1SFO J;  3DXJ F;  2L7K A;  1FNN A;  4HQM A;  1P92 A;  1MMA A;  3PQJ A;  3K4K A;  4EGY A;  4FE4 A;  1KYZ A;  5C3E J;  2NVT J;  3ECH A;  3TKY A;  4CXF A;  3BPV A;  3VOE A;  2FOK A;  4HA8 A;  1IRX A;  5ICF A;  3KE2 A;  2W48 A;  4MIM A;  5E17 F;  1IV8 A;  1O4X A;  4BHC A;  5E1W A;  3G1O A;  2F4M B;  4EJO A;  1I50 J;  2XUB A;  3NI7 A;  1UI5 A;  2VBX A;  1R58 A;  1SD6 A;  3G1M A;  3I0T A;  4LMY A;  1O3T A;  3JCU C;  4JNN A;  4ENJ A;  3HEF A;  1OLT A;  1TTY A;  4ZYH A;  5HLT A;  2DG8 A;  3R6S A;  3BTJ A;  2STT A;  2WB1 N;  2K7L A;  5CXG A;  3GLX A;  4ESB A;  3L7W A;  4IL6 C;  2ICW G;  1YW8 A;  4EV0 A;  4L9T A;  4UB8 C;  1F1Z A;  1VQO I;  4IRH A;  2EZI A;  3OYI A;  1D8K A;  3BG6 A;  3HOT A;  1TWH J;  2OZU A;  5HDK A;  4OIO F;  5CVV A;  2DTZ A;  3HYI A;  2K9S A;  3F0C A;  2FA5 A;  2VQL A;  3TGN A;  4H4K C;  4X0G A;  2OF7 A;  2O8X A;  4J01 A;  1F5T A;  5DD8 A;  4WF2 A;  3DTI A;  1R4M B;  1Z7U A;  2XB0 X;  2NXN B;  5LLQ A;  5FLM J;  4DBR A;  4HV5 A;  1G6N A;  3CC2 I;  5H2F C;  4UUV A;  1UI6 A;  2NVU B;  5K1Y A;  1B9N A;  2DXI A;  4HNT A;  4OMY A;  4N0B A;  1ZRF A;  2F5D A;  1BR4 A;  3GTL J;  3VOK A;  1JJ8 C;  5DM7 F;  4YFN F;  3OIO A;  4IRI A;  4U87 A;  4EJW A;  2VQG A;  2P7C B;  2CWE A;  1L0O C;  1RI7 A;  1TQP A;  3JW4 A;  1F9N A;  3VEP A;  2A05 A;  5GP9 A;  3CUQ B;  1E2X A;  4MHG A;  1TWC J;  3CQZ J;  4IVN A;  1SFK A;  1UMQ A;  3BZC A;  4GCV A;  3WU2 C;  1VQ9 I;  1OCZ H;  1KQ0 A;  2YX4 A;  3HSF A;  1IG7 A;  4NC7 A;  5C4J J;  2UZK A;  3GZ5 A;  4RLF A;  4EAT A;  4YEL A;  1SMY F;  2WUI A;  2FBH A;  3LSI A;  4HZF A;  2CUE A;  3AAF A;  5KAI C;  1TBX A;  1O7F A;  2CQ7 A;  5HDG A;  4JP0 A;  4WXC A;  5F04 A;  3GO5 A;  2PMZ A;  4HX7 A;  3K8P C;  4XN0 A;  1PJR A;  3IV5 A;  1D5Y A;  4QLC U;  1BR1 A;  3DEU A;  5L3E A;  4QTR A;  3HJE A;  3M8J A;  3DKX A;  2VON A;  1KYW A;  3KYL A;  5HBU A;  3JSO A;  2NS8 A;  4MQV A;  3GFM A;  3BLY A;  2NS7 A;  4CO8 A;  2F4I A;  4EMS A;  2O61 A;  4MLO A;  3FXR A;  3FRQ A;  2X1D A;  2JMW A;  5D5X B;  4HOB A;  2X6X A;  4BXU A;  1RIO H;  2KL4 A;  1BJA A;  1UEL B;  3BCG A;  1MSE C;  3BG9 A;  3OL3 A;  2YU9 J;  2HYT A;  5J1Y A;  1ZGA A;  2L7M P;  3FIW A;  2J5O A;  2X9D A;  2VBZ A;  1W0T A;  2R5Z B;  2M1B A;  2CQN A;  1ORK A;  1R5G A;  2DW4 A;  1P7I A;  5HLG A;  2XGC A;  1QBJ A;  1ACI A;  3VOX A;  1XG1 A;  2YSR A;  1Z91 A;  4A3I J;  2IBD A;  2ELH A;  5KK1 A;  1WFX A;  4EJU A;  2XPU A;  4Y7N J;  2IXS A;  5J4Y A;  2AXT C;  1XSD A;  3F9K A;  2MH9 A;  3R0A A;  2CUF A;  2R5Y A;  1V5E A;  4F52 A;  2VKE A;  1YW7 A;  2W00 A;  4UXN A;  2E1C A;  2HFH A;  2DG7 A;  1IN4 A;  1ZTR A;  1YJ9 I;  3K6G A;  1R00 A;  3WHC A;  3BHQ A;  5E1X A;  1HKS A;  1MZB A;  2Z3Y A;  3W3C A;  4BE2 A;  1P4A A;  2PLY A;  1XPX A;  2PFV A;  2NOJ B;  3P9I A;  3WG9 A;  3S17 J;  4EJT A;  2EQR A;  1Z05 A;  2L7Z A;  2TCT A;  1B72 B;  2E2H J;  3F6V A;  1P4X A;  3NNR A;  1GV2 A;  4G9Y A;  4U0W A;  3GFI A;  2D1V A;  1HSJ A;  3QAH A;  5CVI A;  1JGG A;  2KRF A;  1S29 A;  4HW0 A;  4CDG A;  2CGP A;  3JRA A;  2VQH A;  3FKI J;  2K3F A;  3JSJ A;  2A6H F;  2L5Q A;  3NAU A;  2IVM A;  4LIU A;  4ZC3 A;  4DZP A;  4UB6 C;  1ODD A;  4P1W A;  4BJ6 C;  2HOS A;  3HOZ J;  2DFI A;  4U0V A;  4S05 A;  1JE8 A;  2XSD C;  2ZO4 A;  3GF2 A;  5FKL A;  2IU5 A;  1GVD A;  5D6E A;  2MC3 A;  1Y0U A;  2EPF A;  4KFC A;  4FIS A;  2DA3 A;  1XMK A;  5D5V B;  1I27 A;  2HTJ A;  1Z3Y A;  2V1D A;  4I0A A;  4BJ5 C;  4B09 A;  1R49 A;  3P7N A;  1T2K A;  3KET A;  1MBK A;  5FD5 A;  4D0P A;  2NP3 A;  4FE7 A;  2P5L C;  1QA6 A;  1PUE E;  2UXU A;  3G71 I;  1ENH A;  3B73 A;  4HEA 2;  2FJ1 A;  2FBI A;  5KVR A;  4EVI A;  2K4B A;  3IRR A;  2QKL B;  4IXA A;  2ZXJ A;  3SZG A;  2K02 A;  3TOB A;  3DKW A;  3WU0 A;  4B8X A;  2UXH A;  2HXO A;  1UG0 A;  4IQ4 A;  2STW A;  2HZD A;  2R92 J;  1N75 A;  1JKQ C;  3CF5 F;  2K86 A;  5AON A;  3T0Y A;  1FSE A;  5JI6 A;  4UUS A;  1T08 B;  4AID A;  4B47 A;  3RH2 A;  3PIO F;  2JTV A;  3WTY C;  3LQR A;  1MW7 A;  5ICC A;  1PP8 F;  1P6R A;  3R0J A;  1SFE A;  2UXN A;  1A35 A;  3Q5F A;  4C2M A;  1UHM A;  2CU7 A;  2XF7 A;  1W0U A;  3PSF A;  2HVS A;  4MK6 A;  2DDB A;  1TT5 B;  4DVY P;  4ON0 A;  1YTY A;  5J47 A;  5D5U B;  2PX9 A;  1FY7 A;  2WY8 Q;  1VQ5 I;  2DT6 A;  2ZCW A;  2EJR A;  4J19 A;  4BAC A;  4F93 B;  3C1D A;  1RET A;  4MNU A;  3W2W A;  2IGN A;  3OYG A;  1B8I A;  4G94 A;  4CCJ A;  3F8M A;  5FRN A;  2G0E A;  2I5U A;  1W7P B;  3RTR A;  2RVC A;  4J00 A;  4Y52 J;  3I59 B;  4JX4 A;  3HSR A;  2KZG A;  4MTD A;  3CTA A;  2VB6 A;  2QIB A;  2OA4 A;  3A02 A;  2OV7 A;  1B6A A;  4NUB A;  2QVO A;  2Z5U A;  3L2W A;  1OYY A;  5J1R A;  1MBE A;  1OYW A;  2W84 A;  1RZ4 A;  3SJM A;  3ZMT A;  2JPC A;  4NC6 A;  3OL4 A;  1X2M A;  4RM3 A;  3V8L A;  5IOZ A;  1MSF C;  2Y69 H;  2E5N A;  3DLL F;  2DPU A;  5DAJ A;  1FYK A;  4XON A;  2PBX A;  2A6T A;  1Z67 A;  3KYC B;  3I5U A;  3NAR A;  3JRF A;  3HRU A;  2QQA A;  3ABT A;  2VJJ A;  2EIK H;  3MWM A;  2E5Z A;  1J5Y A;  2VT2 A;  2EIJ H;  2E7W A;  3E3V A;  3FWE A;  2Q24 A;  2XB5 A;  3LSK A;  2K9L A;  2NS0 A;  4CCL A;  4TV7 A;  2MYS A;  1TWA J;  3L00 A;  2LF7 A;  3PJR A;  2FU4 A;  1XGS A;  3FXM A;  2XF6 A;  5BQT A;  2Y0S A;  2MLK A;  1U9N A;  4IHT A;  2V7F A;  4ABZ A;  3A01 B;  1J59 A;  1VQN I;  3H92 A;  3NXC A;  1FOW A;  4WXD A;  1DUX C;  3NS4 A;  2CMP A;  1ZRD A;  1FC3 A;  4E7K A;  5C44 J;  1GLN A;  2VAS A;  2X4H A;  4CH7 A;  9ANT A;  1XGN A;  2RC4 A;  3DWL E;  4AVZ A;  2ACJ A;  3CES A;  2NAZ A;  1MJB A;  1PUF A;  4BE1 A;  5LRS A;  1JI8 A;  4U88 A;  2XV4 S;  4KDP A;  2ZOY A;  3DEE A;  2Y31 A;  3X2Q H;  5FLX K;  2D1H A;  4E4H A;  4L0Y B;  1GHC A;  5F08 A;  1IN6 A;  3ZCO A;  4GCL A;  1K4T A;  2P8T A;  4EJV A;  3BTI A;  3Q0U A;  2M8G X;  3DU5 A;  3GLL A;  4G7O F;  3G3Z A;  5EGO B;  3CMY A;  1ZG1 A;  5CPR B;  2OU2 A;  1Y39 A;  3GZ6 A;  2Z2S B;  5B66 C;  1FIA A;  2CV1 A;  5IT9 K;  3Q9V A;  1ZQ3 P;  1UAA A;  4DJA A;  3S1R J;  1LKX A;  3U1D A;  3OYM A;  1SMT A;  3TW6 A;  5LHG A;  2B3W A;  1PUF B;  3L2U A;  2HGC A;  2QCO A;  4IEJ A;  1X3Z B;  2MBF A;  2QTQ A;  4E6K G;  2KLO A;  4LG0 A;  3HRS A;  2XGX A;  5FLX Z;  1LDJ A;  2K40 A;  3GUD A;  3QKX A;  2YR2 A;  2FBQ A;  4S0H B;  1T0F A;  3RI4 A;  4CYD A;  1JTX A;  2LNB A;  4B44 A;  2REK A;  2UXI A;  3HHH A;  3E6D A;  3V7S A;  1ETW A;  3IH4 A;  1FOX A;  1A6I A;  5M3F J;  2F2E A;  2PEX A;  4M74 A;  4YEJ A;  1V4R A;  4E7J A;  4PJJ A;  3BJ6 A;  5JR3 A;  1Z3X A;  4DBQ A;  4Y17 A;  4IOC F;  4G7Z F;  5EYR A;  3P9C A;  2DDA A;  2ZXI A;  1F4K A;  2QA4 I;  2B7E A;  2QYO A;  4ZZL A;  3TBI A;  5GPC A;  2ZJP F;  4H0E A;  4HQE A;  2M7B A;  1OCO H;  2VJI A;  3AG1 H;  5CJ9 A;  2H8W A;  1VFC A;  4DQ2 A;  3K7A J;  2X6W A;  3HG9 A;  1TC3 C;  4OWR B;  3ZP5 A;  2X6O A;  4M6Y A;  4WX9 A;  4ZTJ A;  1MMN A;  4LB5 A;  2GXB A;  1SAU A;  1IO2 A;  3GCM A;  4BXF A;  5J4V A;  4OIR F;  1D0Y A;  2VE9 A;  1DQU A;  1MH3 A;  2XKP A;  1HKQ A;  6PAX A;  3LSR A;  2O3F A;  4FT8 A;  2W82 A;  5EZG A;  4M3E A;  3KP6 A;  2IS4 A;  2WAQ N;  2W25 A;  2G7L A;  3ERM A;  2WWY A;  3DTK A;  1V3F A;  4ZYE A;  1BOA A;  1SFX A;  2OD5 A;  5CQE A;  4A5N A;  1RKT A;  4M9S A;  2M4K A;  3PUF A;  4YFK F;  3LMM A;  2VLA A;  1IRG A;  4XQF A;  3E6B A;  3DTE A;  1E3P A;  3M07 A;  5J1U A;  4G6Q A;  5DTD A;  3GTO J;  3DPU A;  3LQQ A;  1YIT I;  3OSF A;  2IJL A;  1AKH A;  5K58 A;  2OJE D;  3H36 A;  2QZ8 A;  2JA8 J;  2KIQ A;  3CJN A;  5CKT A;  3ABM H;  1JTY A;  2VC1 A;  3NWS A;  3HGY A;  1T33 A;  4HNU A;  5L3F A;  1NTC A;  3AG2 H;  3IL2 A;  3IWZ A;  4I6Z A;  4GFB A;  1EA3 A;  4P9F A;  4XL9 A;  5LGT A;  3HL2 A;  4CCK A;  1YJN I;  3CDI A;  1KON A;  1WI3 A;  3R4K A;  3BR2 A;  4X6A J;  3K4L A;  4HLX A;  4XBF A;  4DIQ A;  1RR8 C;  4BL0 B;  3AKZ A;  2XAH A;  5KCM A;  3VFZ A;  3AL0 C;  4YIR X;  3VTI A;  1QNT A;  1UCR A;  5A2Q Z;  2ZCM A;  3ABU A;  2P81 A;  4FAS D;  4L62 A;  1FOK A;  3CME I;  5K5R A;  3DP7 A;  5EG0 B;  3S2H J;  5DCM A;  2J5P A;  1HW1 A;  4YZE A;  4WXH A;  1JUP A;  2G7G A;  3WGG A;  4PSW A;  3E5Q A;  2MD5 A;  3DBH B;  1VQ6 I;  1WWX A;  3BCA A;  4XK4 A;  2ETH A;  5IYC J;  1WQ2 A;  4BHB A;  2V9P A;  3H5A A;  3WGI A;  3CC7 I;  4U9N A;  3V8J A;  4AIH A;  3PUB A;  5J40 A;  3KEO A;  4WWC A;  2ZSH B;  4LD5 A;  1IN8 A;  2V1U A;  4ZYA A;  1JXS A;  3E7L A;  2XVC A;  1BI3 A;  4Y3O A;  3RJP A;  3V42 A;  2OCC H;  3WU1 B;  4A3F J;  4GFK A;  3VOD A;  1IXC A;  5LFA A;  1F43 A;  2FX0 A;  3T5X A;  2H1K A;  2XIG A;  2EA2 A;  1MBH A;  1A6Q A;  1IC8 A;  2VKV A;  2ZB9 A;  1BN5 A;  5D18 A;  4XN3 A;  2M34 A;  2O0Y A;  1HKT A;  1WPK A;  3LA7 A;  1JGS A;  3LOC A;  5DUI A;  2H27 A;  3AG4 H;  2MGQ A;  3HTI A;  1AU7 A;  1GVJ A;  4FET A;  3VWB A;  3CD6 I;  2D2W A;  3HBL A;  1YO5 C;  2QM3 A;  3WHB A;  3AFH A;  3K2A A;  1MMG A;  2GQQ A;  4L0Z B;  5F1J A;  2LC2 A;  4CCM A;  4ZDL A;  5LGU A;  3EUA A;  4BAY A;  4AUX A;  4M73 A;  2QBY A;  5E3O A;  2DOE A;  3CJQ B;  3CC4 I;  4RLQ A;  1FZP B;  2PMZ N;  3V4G A;  1BI2 A;  1BI0 A;  4C2M J;  1DPR A;  1LDD A;  2F48 A;  1BIB A;  2HDC A;  1FTT A;  2M0M A;  5HNH A;  2VJ4 A;  3PO2 J;  2DMP A;  4BY7 J;  3I55 I;  3JRB A;  2W53 A;  1G4D A;  3BWG A;  3TED A;  1QPI A;  1YX3 A;  2NX4 A;  1DU0 A;  5DDG A;  1REP C;  2AO9 A;  5TGT A;  3ABL H;  3UNG C;  5B3S H;  3MZH A;  2HDW A;  4BNC A;  5FRO A;  3KCC A;  1ZH5 A;  1N78 A;  1X58 A;  2DI3 A;  2V57 A;  2DA7 A;  3KX2 A;  4GXO A;  2JT1 A;  4HDU A;  5HS8 A;  2DU9 A;  2CG4 A;  3U21 A;  3OYF A;  3S14 J;  3H1C A;  5FKM A;  2ISZ A;  2HZT A;  4HNV A;  1YX5 A;  1FT9 A;  2E1N A;  2A5Y B;  1ON1 A;  4XRF A;  1SD7 A;  1LE8 A;  1TLH B;  3IRQ A;  3HPH A;  1ZG3 A;  4UUT A;  1R36 A;  4KIC A;  4PSX A;  2B1E A;  3IH2 A;  1LPQ A;  1MDM B;  2HR3 A;  3LL7 A;  5L3G A;  1JT0 A;  2A6E F;  1BIA A;  1ZGJ A;  3GTJ J;  1FWZ A;  4RMN A;  3JAM Z;  2VPR A;  4Y4R A;  4GYG A;  2OUM A;  1X1C A;  1X1B A;  1OQY A;  5D5W B;  3W2V A;  4DYC A;  2BE5 F;  2K9N A;  4BDZ A;  4XR6 A;  1IGN A;  4EM0 B;  2IA0 A;  2G3B A;  1WH7 A;  2L9S A;  2BXZ A;  2XF5 A;  5GAG J;  4BQN A;  4ME9 A;  1HW5 A;  1G3T A;  2GIZ A;  3K9T A;  4F3Q A;  2P4W A;  4CZC A;  5HVQ C;  2GAU A;  1W5S A;  3RZD J;  2M2E A;  3MEX A;  3KZZ A;  3TW7 A;  2JWT A;  4Q5S F;  1G3W A;  2GIV A;  3JAM K;  4DGW B;  1ZYR F;  2KQR A;  5LEJ A;  1IDY A;  1TW3 A;  3S8P A;  4EQQ A;  2W7N A;  3RKW A;  1XGM A;  1TZL A;  2FOW A;  4AVP A;  2D5V A;  2GA1 A;  1XTA A;  4BKX A;  2ESH A;  2MC4 A;  2CH0 A;  3ZXS A;  1NG7 A;  2KKO A;  2M3A A;  3QBM A;  4KA4 A;  1CF7 B;  1QHH D;  3WTX C;  3MKY B;  1I1G A;  4OMZ A;  4HYE A;  4XKB A;  5LEK A;  1Y8Q B;  1RNL A;  2QKM B;  3HPG A;  4IQJ A;  3BR0 A;  1ZK8 A;  4PGH A;  3S3M A;  2QOP A;  1W5T A;  5H6Q A;  3KYD B;  4A5M A;  1LEB A;  1FP2 A;  1OMI A;  2CQX A;  4JX6 A;  2WAD A;  3ZN0 A;  4D7N A;  1S8N A;  1LDK B;  3SWH A;  3DPT A;  4IHY A;  1FPQ A;  1K83 J;  2BY0 A;  2TDX A;  2DFF A;  1B1B A;  1MDM A;  4O5V A;  4XOR A;  4XLN F;  1IF1 A;  2YUS A;  3FXQ A;  2L02 A;  3FIS A;  4Y15 A;  3GZN B;  5B5E C;  1UHW A;  3I58 A;  2EZH A;  3LFU A;  2HQ5 A;  3I4N J;  5FKN A;  3LJL A;  2IRF G;  2Q2E A;  3A1Y A;  3ZMV A;  1Q1V A;  3HOS A;  3QOE A;  3VDX A;  3R60 A;  3OR2 C;  4CYC A;  2R7F A;  4PJN A;  2HDD A;  1VQM I;  3C2H A;  2ZBK A;  1XN7 A;  4L9N A;  3ZQQ A;  3ZN1 A;  3JSP A;  2LD5 A;  2DJN A;  2ZJ2 A;  1EF4 A;  5FFZ A;  1QGP A;  4F7Z A;  4OAZ A;  2BY2 A;  4ICH A;  1X1P A;  3F8N A;  2XPW A;  3M8F A;  4E7Z A;  2KPM A;  2LFB A;  2PG4 A;  1RPW A;  5IP6 A;  4I02 A;  3GXO A;  2AQE A;  1LVA A;  3DBL B;  1S5L C;  3SYT A;  4A69 C;  5F6F A;  1BOB A;  2E2I J;  1X3U A;  5EG0 A;  2HWV A;  3EET A;  3HUG B;  5JHF A;  2FML A;  2ZCN A;  3VUQ A;  4CZZ A;  3CCL I;  2KIM A;  2O03 A;  1WJF A;  2DPD A;  3ANG A;  2M4G A;  2Q1Z B;  2R7D A;  4KIF A;  3HSE A;  1W4M A;  3ZQG A;  3E6C C;  4LG0 B;  3C2B A;  3K4C A;  2L0K A;  3FBI B;  4KT6 A;  3QPL A;  3P9K A;  3T8T A;  3QU6 A;  3IC7 A;  3JRD A;  3KZ9 A;  1KZH A;  3MN2 A;  1IAW A;  3FZV A;  3ERE D;  2RKH A;  2RN7 A;  4Y33 A;  2B63 J;  2M8E A;  1I39 A;  3NWT A;  2L9V A;  3BJO A;  3CMM A;  3KPH A;  1Z9C A;  5GAH J;  2DQL A;  2P5K A;  2Z16 A;  5DD4 A;  1RRJ A;  3QRF F;  1V55 H;  5F0H A;  3S3N A;  1TQI A;  3H9G A;  4KJZ A;  2VIX A;  2K27 A;  3EDP A;  3QP6 A;  2EIL H;  3E1S A;  4NHJ A;  3K4N A;  4S04 A;  2R7R A;  2P6T A;  2Y48 A;  3VB2 A;  1XCB A;  2FMY A;  2BVM A;  1XDU A;  4KN4 X;  5HS9 A;  2ZCX A;  3W6V A;  2ZJQ F;  3EYY A;  3ZGK A;  2DAO A;  2XGE A;  2VBY A;  1R5H A;  2IA2 A;  3P9T A;  2XRN A;  2FBK A;  2LY9 A;  1YFH A;  5IOY A;  4A3L J;  4PGG A;  3EPZ A;  4KWA A;  2L4M A;  2ZY9 A;  1T0F C;  2HKX A;  2JK3 A;  3CCE I;  5FHP A;  1A36 A;  2VKD A;  4BS9 A;  4D5C A;  1W1W E;  1GV5 A;  4BY1 J;  3BNI A;  3JRE A;  3A0B C;  3F8B A;  4BGD A;  3S1Q J;  1IXS B;  4G7H F;  4MFD A;  1KQ8 A;  5GAE J;  4PK4 A;  3D5L A;  2WV1 A;  4LK1 F;  1HA8 A;  5AQC A;  1U0J A;  1SEU A;  1NK3 P;  1WCM J;  3VSK A;  2XAS A;  1JHF A;  3PL8 A;  5L3B A;  2HOE A;  2MG4 A;  4HF1 A;  2IGM A;  2WAF A;  1TL8 A;  1S7A A;  3LSJ A;  1WH5 A;  2DOF A;  4GFL A;  1SAN A;  1ZHF A;  1TW2 A;  3FM3 A;  4ZTF A;  1FYL A;  3K69 A;  1U8R A;  3WTW C;  2GFN A;  3OYJ A;  4UVC A;  2VUM J;  4BYY A;  2P6S A;  1BJZ A;  5TJJ A;  1ZAR A;  4JQF A;  4C3J J;  4LOC A;  3ZQF A;  4II2 A;  1J2X A;  1OYI A;  3IH3 A;  3U1K A;  3BC8 A;  5CLS A;  3RDI A;  5EDN A;  4A12 A;  3BQY A;  4UDS A;  5CYV A;  4U7B A;  3HM5 A;  4ZJZ A;  3BG5 A;  1TWF J;  3K70 C;  3OYK A;  3K4M A;  4HKU A;  1VQL I;  4IZZ A;  3H3Z A;  4XNF A;  1HST A;  4RM2 A;  3VW1 A;  3F6O A;  1IN7 A;  3W6J B;  2DFH A;  3U2R A;  3VSL A;  2XAJ A;  4EEF G;  2H94 A;  3WOD F;  3S32 A;  1B59 A;  4DYR A;  4R1H A;  1X3W B;  3HOY J;  1HF0 A;  2WAE A;  3B02 A;  5JLW A;  1OCC H;  2DJI A;  3HRT A;  2O9L A;  4HRI A;  3CUO A;  2Z9O A;  3ELK A;  4EM1 A;  2R7X A;  2EV5 A;  5D8L B;  2A3S A;  1DGR M;  4GO1 A;  3SFZ A;  3VYU B;  1LB2 A;  5BS6 A;  4AU7 A;  2PMH A;  3F72 A;  4HX4 A;  1U5T C;  2MAB A;  3OYE A;  5E20 A;  5E1Z B;  5EEA A;  5K5O A;  3MZY A;  2BYV E;  2UV1 A;  4D7M A;  2GEN A;  2ECC A;  5DM6 F;  5JVG F;  4BBR J;  2AHQ A;  3S93 A;  2VI6 A;  3WTZ A;  5ICE A;  3JRC A;  5KNL A;  3WTT C;  1J0R A;  4O3M A;  2A61 A;  2GBY A;  4OIP F;  3IAS 2;  1BW5 A;  2RQP A;  4XLE A;  3S1M J;  2NNY A;  1ETV A;  4LLL A;  3ZQL A;  3LAJ A;  3E0J B;  3HE0 A;  1SGM A;  2R7Z J;  1WZ2 A;  3T6N A;  4HG2 A;  3CUQ A;  5H9T A;  5D4R A;  2VJ5 A;  4MTE A;  3FHZ A;  2ZME A;  3E97 A;  5E3N A;  2NVX J;  2CW8 A;  1H89 C;  4GCK A;  3VW0 A;  2VKH A;  3J80 Z;  1UZC A;  2EFP A;  2VOD A;  2EA4 A;  3S1N J;  4DOZ A;  2K5C A;  2FF4 A;  5IYB J;  3CRJ A;  3QYB A;  2DOA A;  1L3L A;  4IHW A;  1D1C A;  2R3S A;  5KHD A;  4YII A;  2KZV A;  3GYH X;  1P2F A;  4RAG A;  4XSX F;  3ZMU A;  2IEK A;  5HOD A;  3J7A Y;  1AA7 A;  1LUJ B;  1PYV A;  3IKV A;  4OU0 A;  4RGS A;  2AS5 F;  2KMU A;  4WCG A;  4RAZ A;  1HBX G;  1HLV A;  2JRT A;  2V79 A;  3ASN H;  2ESN A;  3KEQ A;  1Z1D A;  4I98 B;  5ILS A;  2LDU A;  2HYG D;  4KNY A;  4BQA A;  3L9F A;  1K78 B;  1AKH B;  2IW5 A;  2EFO A;  4ESF A;  3L2C A;  1FBU A;  2DYR H;  3PFI A;  1JJ6 C;  3VP5 A;  5FGM A;  1LNW A;  4LG3 A;  4GRI A;  5FB2 A;  3KZI C;  3BQZ A;  4QPO A;  3O60 A;  4UVB A;  3GFL A;  4ETS A;  5C4X J;  3AG3 H;  4U7D A;  2HU9 A;  3CCU I;  2KHM A;  3GTQ J;  3R61 A;  1O3S A;  2GOM A;  3C07 A;  4DW6 A;  3CF2 A;  5J8C A;  2BXY A;  2RV8 A;  2Z33 A;  2QLZ A;  2LOO A;  1U78 A;  1GXQ A;  3IUO A;  2EIN H;  3I64 A;  3DEW A;  4RGX A;  3CO7 C;  4A3M J;  4L18 B;  1VQP I;  2BHZ A;  3QYF A;  4NBQ A;  1UFM A;  1O3R A;  2YVH A;  3SEQ A;  3RQI A;  3HGG A;  4N4N B;  3CZ6 A;  2RRE A;  3LSH A;  4LK0 F;  3RKQ A;  2MLG A;  4G8X A;  4B1R A;  5FMP A;  3V8K A;  5D4S A;  1VQK I;  5J8F A;  4XRM A;  1G59 A;  3MCZ A;  5K5Q A;  2K9Q A;  2ZKZ A;  3S2D J;  3CMA I;  1JT6 A;  4A3J J;  1WJB A;  3DV8 A;  3PNY A;  4M3D A;  1BI1 A;  1H0M A;  2KP6 A;  3NEU A;  1E17 A;  3RCO A;  3OV8 A;  5A2Q K;  5C4Y A;  2E34 A;  2Y0S N;  1J75 A;  4LLN A;  3HZJ A;  2XHK A;  5J6X A;  1QHG A;  1YRN B;  3GTM J;  4XLP F;  4XSZ F;  1SVL A;  1FSH A;  2XAF A;  1UJ8 A;  1WHU A;  4KT5 C;  5E79 C;  4B4C A;  2F07 A;  1OKR A;  3BR3 A;  1CGP A;  1KU9 A;  1MJA A;  2OQR A;  1TQM A;  5EJC A;  2Y75 A;  2M45 A;  1BC7 C;  4G6T B;  4E70 A;  4ENM A;  3A03 A;  1NG6 A;  2DN0 A;  4MFE A;  2I10 A;  5BPI A;  3ECO A;  3K1P A;  1GDT A;  1MMD A;  2ISY A;  2X85 A;  2IGO A;  3O2P E;  3TL4 X;  3RPU D;  4YFX F;  1E0E A;  4AF5 A;  4XMY A;  1UST A;  2L01 A;  2WAQ A;  1UB9 A;  1I6X A;  5EEG A;  3ANP A;  4AC6 A;  2GUH A;  1IDZ A;  3CUQ C;  1PDN C;  2VT3 A;  5LGN A;  3LSM A;  2W57 A;  2BW3 A;  3FDY A;  2JZY A;  5E3M A;  1QVU A;  2CUZ A;  1DP3 A;  3BRU A;  2JN6 A;  2EBI A;  1R1T A;  2JA6 J;  3OYC A;  5TRD A;  3GFJ A;  3BCB A;  2PJR B;  1KA8 A;  2OC6 A;  3CDL A;  4FHT A;  3CJT B;  4A3G J;  3ESW B;  1U5T B;  3S5R A;  4MXM A;  3I9V 2;  5LHH A;  2VOP A;  2F6C A;  1HW2 A;  2IA1 A;  3K0L A;  1W36 D;  1YRN A;  1Z6T A;  3BJA A;  1JKR C;  5GTI C;  1X4O A;  1W7P D;  3WGH A;  1K4S A;  2R7O A;  2KRH A;  1XSV A;  2JA2 A;  4ENK A;  2QKO A;  4GGG A;  2K3P A;  4PJM A;  1J7K A;  1FJL A;  2L2O A;  5K7H A;  3A4C A;  3EUK L;  1R1U A;  1B4A A;  2Q2E B;  1WJE A;  2VL8 A;  3B6C A;  3A01 A;  3NRG A;  2TRT A;  4IKF A;  2LVS A;  4JX5 A;  5DEQ A;  5F0F A;  3E5X A;  4CCN A;  3I59 A;  3HOV J;  3KKC A;  2PJR A;  1XMX A;  2KIU A;  2R7W A;  3VVZ A;  3ZPL A;  3OWT A;  5CW8 A;  5IP9 J;  2LTP A;  1E3O C;  3GME A;  5EEH A;  3HKZ A;  4Z2Y A;  1QPM A;  1A31 A;  4FTH A;  2KJC A;  2ZXH A;  1J9I A;  4CSW A;  2XSJ C;  2VPL A;  1R71 A;  2LY1 A;  4MQ9 F;  3LNQ A;  4N9I A;  3G1L A;  3KP3 A;  5EF6 A;  3K1N A;  4AC0 A;  1APL C;  5CVU A;  1ETK A;  1WRJ A;  3MAJ A;  1B72 A;  1TWG J;  1D5V A;  4LJZ F;  3M7G A;  2BHY A;  4IOA F;  3TP3 A;  2K85 A;  2Q0O A;  3BDD A;  5F64 A;  4NQW A;  4A0X A;  1FEX A;  3QOD A;  3TMO A;  2BY1 A;  2DCE A;  4KYW A;  1I3A A;  1S72 I;  2K4J A;  1U9O A;  2X48 A;  2CUJ A;  1ZEL A;  2HQR A;  3BY6 A;  3ZMD A;  2G7U A;  4HF0 A;  3K10 A;  1V5G A;  1HQC A;  3FMS A;  5IP7 J;  4ENN A;  3CLO A;  3OMY A;  1U3E M;  3BPX A;  2ZOZ A;  4PXI A;  4QWQ A;  2A07 F;  3CCY A;  4RB1 A;  5HOO A;  4CYC B;  2A2F X;  1ZAO A;  3K2Z A;  1VI0 A;  1QRY A;  1MBG A;  1YG2 A;  3PNT A;  3SXY A;  2X51 A;  4I2O A;  2WGB A;  1DGW Y;  2V1X A;  2JUG A;  3T8R A;  1MH4 A;  2VXZ A;  4RA2 A;  1K7A A;  1T98 A;  3BJB A;  4UY8 I;  5EGO A;  3ABK H;  2ZJR F;  3VYS B;  3HB9 A;  4ESJ A;  4BHP A;  4IX7 A;  1KU2 A;  3RPU A;  4UNO A;  1YS7 A;  3I4M J;  2FJI 1;  3BR5 A;  3F8C A;  5FFX A;  5LD2 C;  1YYV A;  2PZ9 A;  1O3Q A;  2XAQ A;  3C7J A;  4FCY A;  1JUS A;  3OOP A;  4P96 A;  2ZFU A;  4AIK A;  2JA5 J;  2DMT A;  3I54 A;  2R7Q A;  3N97 A;  1YLF A;  3TDZ C;  1NH3 A;  1U2W A;  2GZW A;  2HNH A;  2R7S A;  3HTH A;  3KP4 A;  1STZ A;  4MEX F;  4UVA A;  2LRE A;  2ZC2 A;  1GXP A;  1G3S A;  2DT5 A;  3DKY A;  4M6V A;  2KIS A;  2DMU A;  2LK2 A;  1IRF A;  2M87 A;  1MBJ A;  2DA4 A;  4NQW B;  1OCR H;  2CW0 F;  4Q48 A;  2IAI A;  1W36 C;  2A5W A;  2W85 A;  4P55 A;  2CS3 A;  3OYD A;  4BQQ A;  4W1U A;  4HST A;  3QWL A;  2KIF A;  5GTH C;  4AWX B;  2N8G A;  5M5Y J;  1RKW A;  3HRM A;  2RNJ A;  1ZKG A;  1WKM A;  2H09 A;  4IO9 F;  4XLF A;  2XDV A;  4XLH A;  3F1B A;  1HCR A;  2E36 A;  1ZLJ A;  3PO3 J;  1USS A;  3ZQI A;  4DYQ A;  1ETQ A;  1FTZ A;  3I4P A;  1XB4 A;  1OJL A;  5FKK A;  2GXG A;  1HC8 A;  2KFD A;  3M1C A;  1OR7 A;  1BA5 A;  2JSP A;  3GBG A;  1EJ9 A;  3LWF A;  3I53 A;  2LBF B;  3J7Z I;  1VTN C;  1ZR4 A;  5FKO A;  3WTS C;  1VF9 A;  5LRR A;  1YE9 A;  1QZZ A;  1E3H A;  1T6S A;  1Y6I A;  2FE3 A;  2KJB A;  1VQ4 I;  3KP2 A;  3ZQH A;  4M72 A;  2R7T A;  1BBY A;  1IZ1 A;  3PSI A;  5K7Z A;  1Z7L A;  2LF8 A;  3N4M A;  2LLK A;  3BR6 A;  3W6K B;  2E7X A;  5IT3 A;  3DPL C;  3E6M A;  3MZ8 A;  4FQG A;  4U0Y A;  2OCE A;  4R79 A;  2EV0 A;  2X6Y A;  3PPB A;  2Z99 A;  2JUC A;  1OIS A;  2V6C A;  3HTS B;  2XAG A;  4W97 A;  3K4B A;  1Y0N A;  4A6D A;  2GOX B;  2XRO A;  1QZE A;  3OR1 C;  4BE0 A;  4NC8 A;  5EZH A;  1ITY A;  1C0W A;  5D1R A;  2M5W A;  5L3C A;  3H5N A;  3JTG A;  5H20 A;  4C30 A;  3W2A A;  2PQ8 A;  5HNF A;  2EFN A;  3P5J A;  2GXA A;  1VQ8 I;  3BTC A;  3OS2 A;  3A2K A;  2DBB A;  2ME6 A;  3MQ0 A;  3RSN A;  2QBY B;  1MBF A;  1YI2 I;  1YIJ I;  2Y0M A;  1RC9 A;  2MH2 A;  3CCQ I;  2AXL A;  3FXJ A;  4JYK A;  1RUN A;  1B9M A;  2DA1 A;  3V7C A;  4XLA A;  4IJA A;  5JHU A;  5JVT A;  3QOP A;  1IJW C;  1PP7 U;  2O6G E;  4FX0 A;  1HOM A;  4XIC A;  2F5F A;  1WVR A;  2O7O A;  4A0Y A; 
#chains in the Genus database with same CATH homology
 4ACI A;  2XPV A;  3CWR A;  1LE8 B;  2HI3 A;  3BT9 A;  3CJD A;  1FIA A;  2MSY A;  2R93 J;  5FLV A;  3VW1 A;  1Y1V J;  1ZQ3 P;  4I76 A;  2XDN A;  4CGR A;  3S1R J;  1ETO A;  3TW6 A;  3PAS A;  1IUF A;  4EEF G;  1PUF B;  2QCO A;  4IEJ A;  3HOW J;  2QTQ A;  3JRI A;  1LFB A;  5M5W J;  4DYR A;  3HOY J;  1HF0 A;  2K40 A;  1OCT C;  3QKX A;  2DMQ A;  1ETX A;  2FBQ A;  5JLW A;  4S0H B;  3AQT A;  3LWJ A;  2O9L A;  1HDD C;  1JTX A;  2REK A;  2UXI A;  1ETW A;  3SDG A;  1T56 A;  3M3Y J;  3IH4 A;  2LKX A;  1CQT A;  1A6I A;  5M3F J;  3BR1 A;  4D5F A;  5EEA A;  1GT0 C;  3D1N I;  3LSG A;  4D7M A;  2GEN A;  2HYJ A;  2ECC A;  4M3B A;  2JA7 J;  4BBR J;  4C3I J;  2AHQ A;  2VI6 A;  2MW8 A;  3Q0V A;  3JRC A;  2E2J J;  5EYR A;  2GBY A;  4DZJ A;  1BW5 A;  3HIM A;  3B81 A;  5GPC A;  3S1M J;  1JKO C;  5GPA A;  1ETV A;  1G2H A;  1VFC A;  3ZQL A;  2HOT A;  3K7A J;  3HE0 A;  1SGM A;  2R7Z J;  2M0C A;  3T6N A;  5H9T A;  3ZOB A;  3HDD A;  3S16 J;  1TC3 C;  3VVY A;  2NVQ J;  3LHQ A;  2X6O A;  5E3N A;  4NDL A;  2NVX J;  1H89 C;  4GCK A;  4A3E J;  2XRL A;  2NP5 A;  4AYB N;  4XRS G;  2D6Y A;  3VW0 A;  3IUV A;  5DS9 A;  1MH3 A;  3S1N J;  1RES A;  1FIP A;  4UUS B;  3HOU J;  3LSR A;  5IYB J;  2KT0 A;  1JUM A;  3CRJ A;  5HAW A;  2Y30 A;  5EZG A;  3JRG A;  4M3E A;  4IHW A;  2WAQ N;  2G7L A;  2E1O A;  1S7E A;  2OI8 A;  5BNG A;  2IEK A;  3JRH A;  1RKT A;  5HOD A;  3GTG J;  3DPJ A;  1P7J A;  2GLO A;  3VVX A;  3ON4 A;  1HLV A;  5J1U A;  1GUU A;  2DA6 A;  5DTD A;  3GTO J;  5EFY A;  2ELK A;  2CRG A;  3OSF A;  5IYD J;  1QVT A;  3OSG A;  2M9H A;  3G7R A;  3HKZ N;  2R0Q C;  1AKH A;  5K58 A;  1AKH B;  2FD5 A;  2JA8 J;  2CJJ A;  5M5X J;  1MNM C;  4A3D J;  1JJ6 C;  3VP5 A;  1JTY A;  1SFO J;  3HGY A;  1T33 A;  4G12 A;  1NTC A;  3BQZ A;  3ZQC A;  4I6Z A;  4GFB A;  3VIB A;  3O60 A;  4FE4 A;  5C3E J;  5C4X J;  2CQQ A;  2NVT J;  3GTQ J;  1WI3 A;  3C07 A;  3BR2 A;  3KKD A;  4DW6 A;  1AHD P;  4X6A J;  2W48 A;  4MIM A;  4IHX A;  1O4X A;  3G1O A;  3NI7 A;  1I50 J;  1UI5 A;  1U78 A;  3UKG A;  3DEW A;  3G1M A;  4A3M J;  4JNN A;  2UXP A;  3B6A A;  3HEF A;  2ZCM A;  2P81 A;  4L62 A;  4M3F A;  2DMN A;  2YVH A;  2DG8 A;  3RQI A;  3HGG A;  3S15 J;  3BTJ A;  5EG0 B;  2WB1 N;  4RBO A;  3GTK J;  5CXG A;  3S2H J;  3RKQ A;  4YZE A;  1JUP A;  2G7G A;  4B1R A;  5FMP A;  2FQ4 A;  4MO7 A;  2LP0 A;  1H8A C;  4XK4 A;  4XRM A;  5IYC J;  2Y9Y A;  2EZI A;  3Q3S A;  2K9Q A;  1H88 C;  3S2D J;  1TWH J;  1JT6 A;  4A3J J;  2G7S A;  2DTZ A;  2K9S A;  3F0C A;  4M3D A;  2OF7 A;  5D19 A;  4X1E A;  3BG3 A;  5C4Y A;  2Y0S N;  2XB0 X;  3E7L A;  4A3F J;  5FLM J;  1YRN B;  3GTM J;  4L5E A;  3MKL A;  4GFK A;  1F43 A;  1POG A;  2FX0 A;  4B4C A;  1UI6 A;  2H1K A;  1IRZ A;  2F07 A;  1MBH A;  2EZL A;  1IC8 A;  2VKV A;  2ZB9 A;  5D18 A;  3BR3 A;  4V2F A;  3GZI A;  3GTL J;  2M34 A;  3VOK A;  1WPK A;  1JJ8 C;  3LOC A;  5M3M J;  5E3L A;  3OIO A;  2RHA A;  2MGQ A;  3A03 A;  4QIW N;  1AU7 A;  3HTI A;  3O8H A;  2DN0 A;  4MFE A;  2I10 A;  3GEU A;  1GDT A;  3HBL A;  5GP9 A;  2RAS A;  3WHB A;  3K2A A;  2Y9Z A;  4AF5 A;  1OFC X;  1TWC J;  3CQZ J;  1B8I B;  3EUP A;  5F1J A;  1UMQ A;  3ANP A;  3MVP A;  4AC6 A;  2GUH A;  3FK6 A;  4AUX A;  4RDU A;  1IDZ A;  1IG7 A;  5E3O A;  5C4J J;  2R5Z A;  4A93 J;  2PMZ N;  5E3M A;  1QVU A;  4C2M J;  3BRU A;  2WUI A;  2JN6 A;  2EBI A;  2JA6 J;  2CUE A;  3SFI A;  1FTT A;  3RD3 A;  4JP0 A;  3PO2 J;  2DMP A;  5F04 A;  4BY7 J;  3CDL A;  3JRB A;  2W53 A;  4A3G J;  5FJ8 J;  3IV5 A;  3S5R A;  4MXM A;  3TED A;  1QPI A;  2L9R A;  2NX4 A;  3EGQ A;  1D5Y A;  1DU0 A;  2H8R A;  1Z77 A;  2AO9 A;  1YRN A;  4QTR A;  4A3C J;  1X58 A;  1JKR C;  2V57 A;  2DA7 A;  5HBU A;  3HOX J;  3S14 J;  5FKM A;  2NS8 A;  2NOG A;  3VPR A;  2QKO A;  4HNV A;  2NS7 A;  1FJL A;  1Y1W J;  1LE8 A;  5K7H A;  4MLO A;  3A01 A;  3NRG A;  3B6C A;  4UUT A;  3FRQ A;  2JMW A;  2TRT A;  4JL3 A;  3NPI A;  3BCG A;  1MSE C;  2LVS A;  4JX5 A;  3BG9 A;  3IH2 A;  3HTA A;  2DA5 A;  2YU9 J;  2EZK A;  1JT0 A;  5F0F A;  2HYT A;  3KKC A;  3HOV J;  5J1Y A;  3GTJ J;  2L7M P;  3FIW A;  2X9D A;  3VVZ A;  2VPR A;  5CW8 A;  5IP9 J;  2LTP A;  1E3O C;  5K7F A;  1W0T A;  3L1P A;  2R5Z B;  1ORK A;  3ON2 A;  4DYC A;  1P7I A;  2COB A;  2K9N A;  2L7F P;  4FTH A;  2XGC A;  1IGN A;  3VOX A;  1XG1 A;  2OER A;  4A3I J;  2G3B A;  1WH7 A;  3AQS A;  2IBD A;  1X2N A;  3LNQ A;  2XPU A;  4Y7N J;  3G1L A;  5EF6 A;  4ME9 A;  4AC0 A;  2CUF A;  1UG2 A;  1APL C;  4QSH A;  2R5Y A;  1ETK A;  4BXX J;  3JR9 A;  1B72 A;  3V78 A;  1ETY A;  1TWG J;  3PM1 A;  2VKE A;  4B3A A;  3RZD J;  4JKZ A;  1A5J A;  3TP3 A;  2M2E A;  1ZTR A;  2DG7 A;  3TW7 A;  2JWT A;  3WHC A;  3BHQ A;  1IDY A;  1FEX A;  1BL0 A;  2D5V A;  2E19 A;  4BKX A;  1JKP C;  2EQR A;  2L7Z A;  2TCT A;  1B72 B;  3QBM A;  4A3K J;  1DU6 A;  1U9O A;  2E2H J;  2X48 A;  3H0G J;  1RR7 A;  2QF7 A;  2YVE A;  2NVY J;  3NNR A;  1GV2 A;  5J3L A;  1JGG A;  2ZOZ A;  5IP7 J;  3JRA A;  3FKI J;  3JSJ A;  4PXI A;  3NAU A;  3BR0 A;  1ZK8 A;  3V6G A;  3CCY A;  4DZP A;  4CYC B;  2ID3 A;  2HOS A;  2QOP A;  3KNW A;  3HOZ J;  1VI0 A;  1LFU P;  3G56 A;  1XS9 A;  1QRY A;  1MBG A;  2XSD C;  4JX6 A;  2CQX A;  2IU5 A;  5FKL A;  4D7N A;  2WGB A;  1GVD A;  1XC5 A;  1MH4 A;  4FIS A;  2DA3 A;  5CXI A;  3GTP J;  3BJB A;  4IHY A;  1K83 J;  3OOU A;  5EGO A;  4NN1 A;  3HB9 A;  1HDP A;  2YUS A;  3FIS A;  1BW6 A;  2EZH A;  2HQ5 A;  3I4M J;  1MBK A;  5FKN A;  3I4N J;  3BR5 A;  2NP3 A;  3LJL A;  4FE7 A;  2PZ9 A;  2UXU A;  1Q1V A;  4FCY A;  1ENH A;  1JUS A;  5HSZ A;  2Y2Z A;  2FJ1 A;  4XRS A;  4CYC A;  2EH3 A;  2HDD A;  1I6H J;  2JA5 J;  2DMT A;  4C3H J;  2LD5 A;  2DJN A;  1EF4 A;  2ECB A;  2UXH A;  3HTH A;  4ICH A;  2HXO A;  5IPA A;  2RAE A;  2R92 J;  1JKQ C;  4M6V A;  4M3G A;  2O8K A;  2XPW A;  2DMU A;  2LK2 A;  2JJ7 A;  2LFB A;  1RPW A;  5IP6 A;  4UUS A;  4IHV A;  1IV6 A;  1MBJ A;  2DA4 A;  1ZR2 A;  3E7Q A;  4A69 C;  4GCT A;  2E2I J;  1WGX A;  5JLX A;  3RH2 A;  5EG0 A;  2IAI A;  3VUQ A;  2ZCN A;  3LSP A;  3Q0W A;  2R5Y B;  3ANG A;  2O7T A;  1U8B A;  4W1U A;  3ZQG A;  2CU7 A;  1W0U A;  2N8G A;  5M5Y J;  1RKW A;  4MK6 A;  3C2B A;  5F27 A;  2L0K A;  1ZKG A;  3QPL A;  4XID A;  3JRD A;  3KZ9 A;  4J19 A;  1I3Q J;  3MN2 A;  1RET A;  2XGD A;  1B8I A;  3COL A;  5F0C A;  3F1B A;  2B63 J;  2G0E A;  1HCR A;  3PO3 J;  4Y52 J;  3QQA A;  3ZQI A;  4JX4 A;  4DYQ A;  1ETQ A;  1FTZ A;  1OJL A;  5FKK A;  1NK2 P;  2HOA A;  5FGL A;  3HTJ A;  2QIB A;  3A02 A;  3S17 J;  5F0H A;  5J1R A;  1MBE A;  1UHS A;  3RZO J;  1BA5 A;  3SJM A;  3GBG A;  4NEL A;  2GM4 A;  1X2M A;  1ZR4 A;  3QPS A;  2UXO A;  5IOZ A;  5FKO A;  1MSF C;  1VF9 A;  2ZCX A;  1VND A;  4BBS J;  5DAJ A;  3W6V A;  4A3B J;  2PBX A;  2XGE A;  3JRF A;  3NAR A;  3ZQH A;  3P9T A;  2LY9 A;  5IOY A;  1R9T J;  4A3L J;  4KWA A;  5K7Z A;  2LR8 A;  2LLK A;  3BR6 A;  2JK3 A;  5FHP A;  2Q24 A;  2XB5 A;  4D5C A;  2ID6 A;  1GV5 A;  4BY1 J;  3BNI A;  3JRE A;  3FK7 A;  3PPB A;  2KDZ A;  3S1Q J;  1F36 A;  1Z0X A;  4MFD A;  1OCP A;  1TWA J;  2WV1 A;  5AQC A;  3O8G A;  4W97 A;  1U9N A;  1NK3 P;  2DA2 A;  1WCM J;  2YS9 A;  4ABZ A;  2ME0 A;  3A01 B;  5EZH A;  1ITY A;  5D1R A;  3NXC A;  2MG4 A;  1ZGW A;  3H3V K;  5C44 J;  3LSJ A;  1WH5 A;  2QWT A;  4GFL A;  1SAN A;  3BTC A;  9ANT A;  3MNL A;  2ME6 A;  2HKU A;  3DCF A;  3VW2 A;  1MBF A;  3M4O J;  2GFN A;  3BTL A;  1PUF A;  2VUM J;  1BJZ A;  4JYK A;  2OPT A;  4C3J J;  2DA1 A;  1K61 A;  2ZOY A;  4LOC A;  2Y31 A;  3ZQF A;  5F08 A;  1IJW C;  3TP0 A;  4GCL A;  3IH3 A;  4V2G A;  3BTI A;  3Q0U A;  2M8G X;  5EDN A;  3BQY A;  1HOM A;  4UDS A;  5EGO B;  3HM5 A;  4XIC A;  3BG5 A;  2O7O A;  3CMY A;  1TWF J;  2HXI A;  4HKU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...