1JVIA

The 2.2 angstrom resolution structure of bacillus subtilis luxs/ribosilhomocysteine complex
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
154
structure length
153
Chain Sequence
VESFELDHNAVVAPYVRHCGVHKVGTDGVVNKFDIRFCQPNKQAMKPDTIHTLEHLLAFTIRSHAEKYDHFDIIDISPMGQTGYYLVVSGETTSAEIVDLLEDTMKEAVEITEIPAANEKQCGQAKLHDLEGAKRLMRFWLSQDKEELLKVFG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Autoinducer-2 production protein luxS
publication title The 1.2 A structure of a novel quorum-sensing protein, Bacillus subtilis LuxS
pubmed doi rcsb
source organism Bacillus subtilis
molecule tags Signaling protein
total genus 43
structure length 153
sequence length 154
ec nomenclature ec 4.4.1.21: S-ribosylhomocysteine lyase.
pdb deposition date 2001-08-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02664 LuxS S-Ribosylhomocysteinase (LuxS)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1360.80 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 S-ribosylhomocysteinase (LuxS) 1jviA00
1JVIA 1JOEA 1JQWA 2FQOA 1INNA 1J6VA 1J6WA 1VGXA 5E68A 1J6XA 1VH2A 1YCLA 2FQTA 4XCHA 1J98A 1IE0A 1VJEA
chains in the Genus database with same CATH superfamily
2R93C 3S1NC 5L46A 2XCOA 3HOWK 4A3LC 4KASA 4C3JC 3N3YA 5C3EC 4A3DK 1F93A 5C4XC 1ZQ1C 2A68A 2JA5C 1I6HK 5M5WK 4BBRC 4A3EK 4MQ9A 2YU9C 2V6SA 1F9NA 1O28A 1XPPA 3S1RC 4A3IK 2R7ZK 1O24A 1WQGA 5IYBK 1O2BA 3IPJA 2VUMC 3I4MC 3S17K 2R7ZA 1JQWA 1VRQC 3S1QK 2NVXA 5IORA 1VGXA 1TWGK 4XCHA 3TTGA 3GTQC 1HQMA 4PABA 2GSUA 5FLMC 3I4NC 1I50C 2JA6K 1YNJA 2JA6A 1L0WA 3HOZK 1GE9A 2E2JK 1J6WA 1B4BA 1BGWA 3S14K 5C4XK 3GTGK 3PO2C 2FQOA 2V6UA 3GTGA 4JK1A 4FM9A 2PHCB 4A3KC 4Y52C 2BE5A 3CQZC 4A3GC 5C44C 1I3QC 1DCPA 3S15C 4KARA 4X6AC 4GTAA 4A3CC 4YFNA 3G4AA 1XXBA 5TJ3A 4Y7NC 4J3NA 1TWFK 4A93C 4KB2A 3TFIA 1TWFA 3GIRA 5M3MK 2R92C 4BY7K 4C3IC 3FHZA 3GTKK 3HOUK 4KM8A 1BS2A 1K83C 3HOYK 2PPBA 4LJZA 5IYDC 5CHPA 1XZPA 4C2MC 2NVTC 1XZQB 1AB4A 3ADAC 3GTMC 1Y1VK 4BLAA 5IOQA 3FKIA 2NVQC 3S15K 3GTOK 1IW7A 3GTOA 1J6XA 1USOA 4KM9A 3S1MC 1JVIA 2PA8D 3S2DK 1DCHA 4LOWA 3T01A 3WODA 4YFKA 5D4DA 1WOPA 4KDDA 3HOWC 3BUEA 4KMUA 1TWAK 1TWAA 4BBSK 4XSZA 4A3DC 3AH5A 3BP8C 5JVOA 1I6HC 4G7HA 1JOEA 3LPXA 4O2DA 2JA7K 3GTLA 2JA7A 2PMZL 4AYBD 2NVYA 4A3IC 4GFQA 2R7ZC 5IYBC 3G4CA 3S17C 5IYCK 3A8KA 3S1QC 1TWHK 4GTLA 4A3FK 1TWHA 3HKZL 3AD8C 4LLGA 3L4KA 2JA6C 3HOZC 1XZQA 2E2JC 1EI6A 1O25A 1XXCA 5M5XK 3S14C 3T00A 3GTGC 3SZYA 1R9TK 1PJ5A 2PMZD 1R9TA 4GTCA 3AQOA 2D6FC 3TFHA 3M4OK 1XXAA 4OIPA 4AH6A 2P5MA 1YNNA 3RZDK 4BY1K 1TWCK 1Y1WK 1ZVUA 2NVXK 5IP9K 1XZPB 1TWCA 2JH3A 4GTEA 1EFWA 1Y1WA 3QX3A 3K7AK 1TWFC 3CAGA 4BY7C 3GTKC 3HOUC 5JFEA 1EQRA 2A69A 3HOYC 4BLBA 2GSNA 3N0CA 3LAJA 5IP7K 1WCMK 2E2HK 1WCMA 4FZBA 1DCOA 2E2HA 1VJEA 3S2HK 3TFJA 1WOOA 1Y1VC 2GAHC 3GTOC 4KC6A 1ZXOA 2R93A 5IOSA 4KMHA 3S2DC 1EK8A 2P8TA 4Q4ZA 3RZOK 1ISEA 1TWAC 5HL8A 4MEXA 2Y0SL 4BBSC 4P5AA 1DD5A 2E2IK 2XCRB 2E2IA 4XLNA 2YU9A 2B63K 4KMAA 2B63A 4XLPA 2JA7C 4GTBA 2JA8K 3HOVK 4GT9A 1ZBSA 5IYCC 3FKIK 4G7OA 5TMCA 3AD9C 1TWHC 2RGRA 3GTPK 4A3FC 3PO3K 3GTPA 2ZUFA 4KAWX 1I50A 1KQ4A 4BXXK 4MEYA 2EBBA 4DDQA 3M3YK 3ERED 4G0VA 1UV7A 1PJ6A 1VH2A 1O26A 1R9TC 4P9SA 3M4OC 2A6HA 3GTLK 3GSIA 2W7VA 1BJTA 2GAGC 2NVYK 3RZDC 1O29A 1SFOK 2KWAA 3GTJK 4BY1C 1TWCC 1Y1WC 1SFOA 3EQLA 5IP9C 2NVXC 3GTJA 2GSOA 3A8IA 3AD7C 4C3HK 1C0AA 3NUHA 3K7AC 2O5JA 1IS1A 3HXAA 3VA7A 3N0BA 5EGEA 5TMFA 4YFXA 4A3MK 1O2FB 2V6TA 3H3VL 1IBAA 1INNA 5IOTA 2CFAB 5IP7C 3FOEA 1WCMC 2E2HC 3S2HC 3OPFA 3HKZD 3HOXK 4RMFA 4G0UA 1YCLA 4XSXA 4OIQA 2RH6A 4KB4A 1SMYA 1WIHA 3L4JA 3H3VD 3FOFA 1RU0A 3RZOC 4LQYA 4C45A 3S16K 4A3BK 2O5IA 4OINA 4LK0A 3GEEA 3H0GK 4QJVB 4BKWA 2E2IC 3H0GA 2CW0A 3Q3QA 2B63C 3S0XA 2ZFZA 3AQPA 1WQHA 5C4JK 1V5VA 2JA8C 3HOVC 4OIRA 1TWGA 2FQTA 2WAQL 3FKIC 3BP3A 1WSRA 3GTPC 4WILA 2R93K 3PO3C 1IL2A 3S1NK 4A3LK 4ZH4A 1YX2A 1B4AA 4C3JK 4BXXC 1F7UA 5C3EK 3MMLB 2Y3PA 2CFAA 3M3YC 2JA5K 2JA5A 1O2AA 4ILDA 4BBRK 4KMDA 1WORA 2YU9K 3OREA 4GZYA 4WJ4A 4OIOA 3S1RK 2WAQD 2VUMK 3GTLC 3I4MK 2VUMA 2NVYC 3T02A 1SFOC 3GTJC 4PAAA 1J98A 4G7ZA 3GTQK 3OEPA 1I6VA 3GTQA 4C3HC 4P5BA 4YG2A 5FLMK 3I4NK 4KN4A 1I50K 3GTKA 1ZYRA 2PA8L 1VLOA 2WB1L 4QJVA 4QIWL 2Y0SD 1F7VA 1WSVA 1WOSA 3GEIA 4A3JC 3PO2K 4A3MC 4Q5SA 1USMA 1HI9A 4LK1A 5CJ9A 4A3KK 4Y52K 3GDZA 3CQZK 1O27A 4A3GK 3CQZA 5C44K 3A8JA 5E68A 1Y1VA 1I3QK 4GTDA 4NOIA 1I3QA 5M5YK 4AYBL 4X6AK 3LAPA 4A3CK 4G0WA 2WB1D 3HOXC 4QIWD 3DXJA 4Y7NK 4A93K 5FJ8K 4KN7A 2R92K 1EH1A 1BDFA 4C3IK 2R92A 1WQFA 3GEHA 1K83K 3SZZA 3S16C 1IE0A 4M1XA 1K83A 4A3BC 3JSTA 5IYDK 5M3FK 4A3EC 4KATA 4A3JK 4C2MK 2NVTK 3H0GC 5EGHA 2ZUEA 3V4GA 1IQ0A 1G51A 3GTMK 4GTFA 5C4JC 3GTMA 2NVQK 1J6VA 2XCQA 1TWGC 1PJ7A 4WJ3M 4LR2A 3S1MK 1X31C 2A6EA
chains in the Genus database with same CATH topology
1JVIA 1JOEA 1JQWA 2FQOA 1INNA 1J6VA 1J6WA 1VGXA 5E68A 1J6XA 1VH2A 1YCLA 2FQTA 4XCHA 1J98A 1IE0A 1VJEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1JVI A;  1JOE A;  1JQW A;  2FQO A;  1INN A;  1J6V A;  1J6W A;  1VGX A;  5E68 A;  1J6X A;  1VH2 A;  1YCL A;  2FQT A;  4XCH A;  1J98 A;  1IE0 A;  1VJE A; 
#chains in the Genus database with same CATH topology
 2R93 C;  3S1N C;  5L46 A;  2XCO A;  3HOW K;  4A3L C;  4KAS A;  4C3J C;  3N3Y A;  5C3E C;  4A3D K;  1F93 A;  5C4X C;  1ZQ1 C;  2A68 A;  2JA5 C;  1I6H K;  5M5W K;  4BBR C;  4A3E K;  4MQ9 A;  2YU9 C;  2V6S A;  1F9N A;  1O28 A;  1XPP A;  3S1R C;  4A3I K;  2R7Z K;  1O24 A;  1WQG A;  5IYB K;  1O2B A;  3IPJ A;  2VUM C;  3I4M C;  3S17 K;  2R7Z A;  1JQW A;  1VRQ C;  3S1Q K;  2NVX A;  5IOR A;  1VGX A;  1TWG K;  4XCH A;  3TTG A;  3GTQ C;  1HQM A;  4PAB A;  2GSU A;  5FLM C;  3I4N C;  1I50 C;  2JA6 K;  1YNJ A;  2JA6 A;  1L0W A;  3HOZ K;  1GE9 A;  2E2J K;  1J6W A;  1B4B A;  1BGW A;  3S14 K;  5C4X K;  3GTG K;  3PO2 C;  2FQO A;  2V6U A;  3GTG A;  4JK1 A;  4FM9 A;  2PHC B;  4A3K C;  4Y52 C;  2BE5 A;  3CQZ C;  4A3G C;  5C44 C;  1I3Q C;  1DCP A;  3S15 C;  4KAR A;  4X6A C;  4GTA A;  4A3C C;  4YFN A;  3G4A A;  1XXB A;  5TJ3 A;  4Y7N C;  4J3N A;  1TWF K;  4A93 C;  4KB2 A;  3TFI A;  1TWF A;  3GIR A;  5M3M K;  2R92 C;  4BY7 K;  4C3I C;  3FHZ A;  3GTK K;  3HOU K;  4KM8 A;  1BS2 A;  1K83 C;  3HOY K;  2PPB A;  4LJZ A;  5IYD C;  5CHP A;  1XZP A;  4C2M C;  2NVT C;  1XZQ B;  1AB4 A;  3ADA C;  3GTM C;  1Y1V K;  4BLA A;  5IOQ A;  3FKI A;  2NVQ C;  3S15 K;  3GTO K;  1IW7 A;  3GTO A;  1J6X A;  1USO A;  4KM9 A;  3S1M C;  1JVI A;  2PA8 D;  3S2D K;  1DCH A;  4LOW A;  3T01 A;  3WOD A;  4YFK A;  5D4D A;  1WOP A;  4KDD A;  3HOW C;  3BUE A;  4KMU A;  1TWA K;  1TWA A;  4BBS K;  4XSZ A;  4A3D C;  3AH5 A;  3BP8 C;  5JVO A;  1I6H C;  4G7H A;  1JOE A;  3LPX A;  4O2D A;  2JA7 K;  3GTL A;  2JA7 A;  2PMZ L;  4AYB D;  2NVY A;  4A3I C;  4GFQ A;  2R7Z C;  5IYB C;  3G4C A;  3S17 C;  5IYC K;  3A8K A;  3S1Q C;  1TWH K;  4GTL A;  4A3F K;  1TWH A;  3HKZ L;  3AD8 C;  4LLG A;  3L4K A;  2JA6 C;  3HOZ C;  1XZQ A;  2E2J C;  1EI6 A;  1O25 A;  1XXC A;  5M5X K;  3S14 C;  3T00 A;  3GTG C;  3SZY A;  1R9T K;  1PJ5 A;  2PMZ D;  1R9T A;  4GTC A;  3AQO A;  2D6F C;  3TFH A;  3M4O K;  1XXA A;  4OIP A;  4AH6 A;  2P5M A;  1YNN A;  3RZD K;  4BY1 K;  1TWC K;  1Y1W K;  1ZVU A;  2NVX K;  5IP9 K;  1XZP B;  1TWC A;  2JH3 A;  4GTE A;  1EFW A;  1Y1W A;  3QX3 A;  3K7A K;  1TWF C;  3CAG A;  4BY7 C;  3GTK C;  3HOU C;  5JFE A;  1EQR A;  2A69 A;  3HOY C;  4BLB A;  2GSN A;  3N0C A;  3LAJ A;  5IP7 K;  1WCM K;  2E2H K;  1WCM A;  4FZB A;  1DCO A;  2E2H A;  1VJE A;  3S2H K;  3TFJ A;  1WOO A;  1Y1V C;  2GAH C;  3GTO C;  4KC6 A;  1ZXO A;  2R93 A;  5IOS A;  4KMH A;  3S2D C;  1EK8 A;  2P8T A;  4Q4Z A;  3RZO K;  1ISE A;  1TWA C;  5HL8 A;  4MEX A;  2Y0S L;  4BBS C;  4P5A A;  1DD5 A;  2E2I K;  2XCR B;  2E2I A;  4XLN A;  2YU9 A;  2B63 K;  4KMA A;  2B63 A;  4XLP A;  2JA7 C;  4GTB A;  2JA8 K;  3HOV K;  4GT9 A;  1ZBS A;  5IYC C;  3FKI K;  4G7O A;  5TMC A;  3AD9 C;  1TWH C;  2RGR A;  3GTP K;  4A3F C;  3PO3 K;  3GTP A;  2ZUF A;  4KAW X;  1I50 A;  1KQ4 A;  4BXX K;  4MEY A;  2EBB A;  4DDQ A;  3M3Y K;  3ERE D;  4G0V A;  1UV7 A;  1PJ6 A;  1VH2 A;  1O26 A;  1R9T C;  4P9S A;  3M4O C;  2A6H A;  3GTL K;  3GSI A;  2W7V A;  1BJT A;  2GAG C;  2NVY K;  3RZD C;  1O29 A;  1SFO K;  2KWA A;  3GTJ K;  4BY1 C;  1TWC C;  1Y1W C;  1SFO A;  3EQL A;  5IP9 C;  2NVX C;  3GTJ A;  2GSO A;  3A8I A;  3AD7 C;  4C3H K;  1C0A A;  3NUH A;  3K7A C;  2O5J A;  1IS1 A;  3HXA A;  3VA7 A;  3N0B A;  5EGE A;  5TMF A;  4YFX A;  4A3M K;  1O2F B;  2V6T A;  3H3V L;  1IBA A;  1INN A;  5IOT A;  2CFA B;  5IP7 C;  3FOE A;  1WCM C;  2E2H C;  3S2H C;  3OPF A;  3HKZ D;  3HOX K;  4RMF A;  4G0U A;  1YCL A;  4XSX A;  4OIQ A;  2RH6 A;  4KB4 A;  1SMY A;  1WIH A;  3L4J A;  3H3V D;  3FOF A;  1RU0 A;  3RZO C;  4LQY A;  4C45 A;  3S16 K;  4A3B K;  2O5I A;  4OIN A;  4LK0 A;  3GEE A;  3H0G K;  4QJV B;  4BKW A;  2E2I C;  3H0G A;  2CW0 A;  3Q3Q A;  2B63 C;  3S0X A;  2ZFZ A;  3AQP A;  1WQH A;  5C4J K;  1V5V A;  2JA8 C;  3HOV C;  4OIR A;  1TWG A;  2FQT A;  2WAQ L;  3FKI C;  3BP3 A;  1WSR A;  3GTP C;  4WIL A;  2R93 K;  3PO3 C;  1IL2 A;  3S1N K;  4A3L K;  4ZH4 A;  1YX2 A;  1B4A A;  4C3J K;  4BXX C;  1F7U A;  5C3E K;  3MML B;  2Y3P A;  2CFA A;  3M3Y C;  2JA5 K;  2JA5 A;  1O2A A;  4ILD A;  4BBR K;  4KMD A;  1WOR A;  2YU9 K;  3ORE A;  4GZY A;  4WJ4 A;  4OIO A;  3S1R K;  2WAQ D;  2VUM K;  3GTL C;  3I4M K;  2VUM A;  2NVY C;  3T02 A;  1SFO C;  3GTJ C;  4PAA A;  1J98 A;  4G7Z A;  3GTQ K;  3OEP A;  1I6V A;  3GTQ A;  4C3H C;  4P5B A;  4YG2 A;  5FLM K;  3I4N K;  4KN4 A;  1I50 K;  3GTK A;  1ZYR A;  2PA8 L;  1VLO A;  2WB1 L;  4QJV A;  4QIW L;  2Y0S D;  1F7V A;  1WSV A;  1WOS A;  3GEI A;  4A3J C;  3PO2 K;  4A3M C;  4Q5S A;  1USM A;  1HI9 A;  4LK1 A;  5CJ9 A;  4A3K K;  4Y52 K;  3GDZ A;  3CQZ K;  1O27 A;  4A3G K;  3CQZ A;  5C44 K;  3A8J A;  5E68 A;  1Y1V A;  1I3Q K;  4GTD A;  4NOI A;  1I3Q A;  5M5Y K;  4AYB L;  4X6A K;  3LAP A;  4A3C K;  4G0W A;  2WB1 D;  3HOX C;  4QIW D;  3DXJ A;  4Y7N K;  4A93 K;  5FJ8 K;  4KN7 A;  2R92 K;  1EH1 A;  1BDF A;  4C3I K;  2R92 A;  1WQF A;  3GEH A;  1K83 K;  3SZZ A;  3S16 C;  1IE0 A;  4M1X A;  1K83 A;  4A3B C;  3JST A;  5IYD K;  5M3F K;  4A3E C;  4KAT A;  4A3J K;  4C2M K;  2NVT K;  3H0G C;  5EGH A;  2ZUE A;  3V4G A;  1IQ0 A;  1G51 A;  3GTM K;  4GTF A;  5C4J C;  3GTM A;  2NVQ K;  1J6V A;  2XCQ A;  1TWG C;  1PJ7 A;  4WJ3 M;  4LR2 A;  3S1M K;  1X31 C;  2A6E A; 
#chains in the Genus database with same CATH homology
 1JVI A;  1JOE A;  1JQW A;  2FQO A;  1INN A;  1J6V A;  1J6W A;  1VGX A;  5E68 A;  1J6X A;  1VH2 A;  1YCL A;  2FQT A;  4XCH A;  1J98 A;  1IE0 A;  1VJE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...