1JVIA

The 2.2 angstrom resolution structure of bacillus subtilis luxs/ribosilhomocysteine complex
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
154
structure length
153
Chain Sequence
b'VESFELDHNAVVAPYVRHCGVHKVGTDGVVNKFDIRFCQPNKQAMKPDTIHTLEHLLAFTIRSHAEKYDHFDIIDISPMGQTGYYLVVSGETTSAEIVDLLEDTMKEAVEITEIPAANEKQCGQAKLHDLEGAKRLMRFWLSQDKEELLKVFG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Autoinducer-2 production protein luxS
molecule tags Signaling protein
source organism Bacillus subtilis
publication title The 1.2 A structure of a novel quorum-sensing protein, Bacillus subtilis LuxS
pubmed doi rcsb
total genus 43
structure length 153
sequence length 154
ec nomenclature ec 4.4.1.21: S-ribosylhomocysteine lyase.
pdb deposition date 2001-08-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02664 LuxS S-Ribosylhomocysteinase (LuxS)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1360.80 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 S-ribosylhomocysteinase (LuxS) 1jviA00
1JOEA 1J6XA 1VGXA 2FQTA 5E68A 1YCLA 1JQWA 1VH2A 1JVIA 1VJEA 2FQOA 1J6VA 4XCHA 1J98A 1IE0A 1INNA 1J6WA
chains in the Genus database with same CATH superfamily
4LOWA 3G4AA 1JQWA 5EGEA 3I4NC 3S1NK 2XCQA 2B63K 3HOVK 4A3MC 4GTDA 1G51A 2CFAB 4GTBA 4A3EK 3GTJA 4WILA 3GTPK 3S17C 5IP9C 3H0GC 4GT9A 4C3IC 1IL2A 4BY7K 1JVIA 1UV7A 5C4XK 1J98A 2B63C 2E2IC 5E68A 1O2FB 1TWCA 3GTLA 2A69A 4BY1C 3S14C 3HOUC 4A3EC 3S17K 3HOXC 5IYBC 4KM9A 2D6FC 5M5WK 1XZPB 2NVQK 1WOSA 2V6TA 4KATA 5EGHA 1Y1VA 1ISEA 2A68A 1I6HK 3V4GA 4GZYA 3K7AK 3S1RC 3S2HC 4Y7NC 3TFIA 1XXBA 4A3BC 1IW7A 3PO2C 4BXXC 4AYBD 4A3DC 3GSIA 2PMZL 4QJVB 2NVYA 3HOZC 5IP7K 4BBSK 3EQLA 1VGXA 1SFOA 3HXAA 2P5MA 4XSXA 3GTQC 2O5JA 1PJ6A 4Y7NK 1O26A 2NVYC 4A3BK 5C4XC 4C3JC 4Q4ZA 3TFJA 2JA7A 1K83K 2JH3A 4C3HK 3T00A 3GTOA 2V6UA 1L0WA 1TWAK 2JA6K 2JA8K 3SZYA 4X6AC 2P8TA 3CAGA 2VUMK 4KASA 2YU9A 4XLPA 5L46A 4C3JK 4KDDA 4KMHA 1B4BA 4NOIA 3BUEA 5TMCA 3N0BA 5IYDK 4OIRA 1WQGA 3GTLC 2E2HK 4FM9A 3GTOC 3VA7A 4LK0A 4BBRC 2R93K 4AH6A 2JA6C 4A3GC 3GDZA 1Y1VK 1F7UA 1WQHA 4KN4A 3L4KA 4A3JC 1XZQB 5IOQA 3M3YC 3OREA 4YFXA 4QIWL 1XZQA 3Q3QA 4LK1A 4KB4A 3GTLK 2NVTK 4A93C 2CW0A 3LAPA 3S16C 3S1MK 2WB1L 3M4OK 4C45A 3GTKA 4A3JK 1O27A 1BS2A 1TWFK 3HOVC 2ZFZA 3HKZL 2GSNA 3N0CA 3L4JA 4KMDA 2NVTC 2PPBA 1TWHC 2E2IA 1XZPA 3M4OC 2JA7C 3AD8C 1BGWA 4P5AA 1R9TK 1JOEA 1DCHA 1USMA 4A93K 2KWAA 1TWGK 1VJEA 4KC6A 2Y0SD 2NVXK 2R7ZC 5C3EK 1IBAA 5JVOA 3JSTA 3T02A 2FQTA 5IYBK 5IYCC 2Y3PA 1I3QC 2FQOA 4Q5SA 1F9NA 4XLNA 3FKIC 1EFWA 4Y52K 1IS1A 3A8KA 2O5IA 3I4NK 4XSZA 4C2MC 2R92A 3ADAC 1I6HC 2JA6A 4G0WA 5IYCK 1VH2A 4FZBA 4KMAA 3GTGA 4GTEA 4KARA 3S1MC 3GIRA 2WAQD 3S15K 2GAHC 4A3DK 5M5YK 4OIOA 2E2IK 1VRQC 5C4JC 3TFHA 4G7HA 1SFOK 1DCPA 4G0UA 4KB2A 1O2BA 1C0AA 1O28A 3T01A 1XPPA 5FJ8K 5C4JK 1K83C 1F7VA 3GTGK 3GTQA 2JA5K 1AB4A 4WJ3M 1GE9A 3K7AC 1VLOA 2PA8L 5IP9K 1J6XA 2R7ZA 1HI9A 1WQFA 1IE0A 1WOPA 3CQZC 2YU9K 1TWCK 2R93C 4A3KC 3GTOK 1IQ0A 3HOUK 3IPJA 3HOXK 4G7ZA 4LQYA 3GTKC 3I4MC 2NVXA 4GTLA 2Y0SL 5FLMC 3N3YA 1R9TA 1TWAC 2JA8C 4MEYA 1XXAA 4A3KK 3PO2K 4BLBA 4DDQA 3FOFA 3S16K 4X6AK 4J3NA 1I6VA 1EK8A 4XCHA 2ZUEA 3NUHA 3GTKK 3H0GA 3DXJA 4RMFA 4A3CK 4A3LC 4OIQA 3H3VL 2GSOA 4BLAA 1EI6A 1O24A 1J6WA 4A3GK 1WSRA 2NVYK 4MEXA 2V6SA 1KQ4A 4YFNA 4GTAA 3CQZK 2YU9C 3TTGA 2JA5A 4A3IC 5IORA 3HOYC 3LPXA 4ZH4A 3OEPA 2R93A 3M3YK 4KAWX 2EBBA 1BJTA 1O2AA 2GSUA 3CQZA 2E2JK 4Y52C 1I50A 2VUMC 1WCMK 1ZQ1C 3H0GK 4C3IK 1EQRA 4BY7C 3G4CA 4OINA 4G7OA 4A3IK 1V5VA 1XXCA 2VUMA 2E2HC 1TWAA 4JK1A 4BBRK 5C44K 3GEEA 4KMUA 1TWGC 5CHPA 2B63A 2JA7K 3AQPA 1DD5A 4GFQA 4AYBL 3S15C 3GTPA 2PA8D 3FKIA 2PMZD 4ILDA 2BE5A 4P5BA 1PJ5A 1B4AA 1WOOA 4A3MK 1USOA 1WSVA 3A8IA 3RZOC 3S2HK 1WORA 4C2MK 5HL8A 1YNJA 3GEHA 3HOYK 3S1QK 1TWHA 1YNNA 1PJ7A 3GTQK 3RZOK 3RZDK 3S14K 3GTMK 2NVQC 2NVXC 2R7ZK 5C3EC 2GAGC 3AH5A 3S1QC 3WODA 1I3QA 4GTFA 3S1NC 1WIHA 3HOWC 3PO3C 1ZXOA 3I4MK 1BDFA 1INNA 3AD9C 3S0XA 1HQMA 2WAQL 3GTMC 3GTPC 3HOZK 3FOEA 3BP3A 1O29A 4LR2A 3GTJK 4QIWD 1ZBSA 2JA5C 2XCOA 3HOWK 3PO3K 1Y1WK 4A3FC 1YCLA 2CFAA 2R92K 3GTMA 1I50C 4GTCA 5M3FK 4KN7A 5D4DA 5IOTA 1EH1A 4C3HC 1TWCC 4YFKA 5M3MK 5TJ3A 1RU0A 4OIPA 3S2DK 2R92C 2PHCB 3S1RK 4PABA 1X31C 1Y1WC 4A3FK 1J6VA 1TWGA 4WJ4A 3GEIA 5IOSA 3SZZA 3GTGC 5IP7C 4BBSC 2ZUFA 1K83A 1ZVUA 2RGRA 2A6EA 1Y1VC 3QX3A 4PAAA 2W7VA 1WCMC 3HKZD 1Y1WA 4O2DA 4A3LK 2XCRB 4A3CC 5C44C 2WB1D 3GTJC 1TWFA 1I3QK 4BKWA 4KM8A 1DCOA 5CJ9A 3OPFA 1WCMA 3BP8C 1I50K 5IYDC 5FLMK 1TWFC 4YG2A 2A6HA 4M1XA 4LLGA 3AD7C 3H3VD 1R9TC 1O25A 4BY1K 3AQOA 5JFEA 2E2HA 1TWHK 3S2DC 5M5XK 1YX2A 2E2JC 1F93A 3A8JA 4MQ9A 5TMFA 4QJVA 3MMLB 4P9SA 3ERED 1SFOC 3LAJA 3FHZA 1ZYRA 4G0VA 1SMYA 3RZDC 4BXXK 4LJZA 3FKIK 2RH6A
chains in the Genus database with same CATH topology
1JOEA 1J6XA 1VGXA 2FQTA 5E68A 1YCLA 1JQWA 1VH2A 1JVIA 1VJEA 2FQOA 1J6VA 4XCHA 1J98A 1IE0A 1INNA 1J6WA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1JOE A;  1J6X A;  1VGX A;  2FQT A;  5E68 A;  1YCL A;  1JQW A;  1VH2 A;  1JVI A;  1VJE A;  2FQO A;  1J6V A;  4XCH A;  1J98 A;  1IE0 A;  1INN A;  1J6W A; 
#chains in the Genus database with same CATH topology
 4LOW A;  3G4A A;  1JQW A;  5EGE A;  3I4N C;  3S1N K;  2XCQ A;  2B63 K;  3HOV K;  4A3M C;  4GTD A;  1G51 A;  2CFA B;  4GTB A;  4A3E K;  3GTJ A;  4WIL A;  3GTP K;  3S17 C;  5IP9 C;  3H0G C;  4GT9 A;  4C3I C;  1IL2 A;  4BY7 K;  1JVI A;  1UV7 A;  5C4X K;  1J98 A;  2B63 C;  2E2I C;  5E68 A;  1O2F B;  1TWC A;  3GTL A;  2A69 A;  4BY1 C;  3S14 C;  3HOU C;  4A3E C;  3S17 K;  3HOX C;  5IYB C;  4KM9 A;  2D6F C;  5M5W K;  1XZP B;  2NVQ K;  1WOS A;  2V6T A;  4KAT A;  5EGH A;  1Y1V A;  1ISE A;  2A68 A;  1I6H K;  3V4G A;  4GZY A;  3K7A K;  3S1R C;  3S2H C;  4Y7N C;  3TFI A;  1XXB A;  4A3B C;  1IW7 A;  3PO2 C;  4BXX C;  4AYB D;  4A3D C;  3GSI A;  2PMZ L;  4QJV B;  2NVY A;  3HOZ C;  5IP7 K;  4BBS K;  3EQL A;  1VGX A;  1SFO A;  3HXA A;  2P5M A;  4XSX A;  3GTQ C;  2O5J A;  1PJ6 A;  4Y7N K;  1O26 A;  2NVY C;  4A3B K;  5C4X C;  4C3J C;  4Q4Z A;  3TFJ A;  2JA7 A;  1K83 K;  2JH3 A;  4C3H K;  3T00 A;  3GTO A;  2V6U A;  1L0W A;  1TWA K;  2JA6 K;  2JA8 K;  3SZY A;  4X6A C;  2P8T A;  3CAG A;  2VUM K;  4KAS A;  2YU9 A;  4XLP A;  5L46 A;  4C3J K;  4KDD A;  4KMH A;  1B4B A;  4NOI A;  3BUE A;  5TMC A;  3N0B A;  5IYD K;  4OIR A;  1WQG A;  3GTL C;  2E2H K;  4FM9 A;  3GTO C;  3VA7 A;  4LK0 A;  4BBR C;  2R93 K;  4AH6 A;  2JA6 C;  4A3G C;  3GDZ A;  1Y1V K;  1F7U A;  1WQH A;  4KN4 A;  3L4K A;  4A3J C;  1XZQ B;  5IOQ A;  3M3Y C;  3ORE A;  4YFX A;  4QIW L;  1XZQ A;  3Q3Q A;  4LK1 A;  4KB4 A;  3GTL K;  2NVT K;  4A93 C;  2CW0 A;  3LAP A;  3S16 C;  3S1M K;  2WB1 L;  3M4O K;  4C45 A;  3GTK A;  4A3J K;  1O27 A;  1BS2 A;  1TWF K;  3HOV C;  2ZFZ A;  3HKZ L;  2GSN A;  3N0C A;  3L4J A;  4KMD A;  2NVT C;  2PPB A;  1TWH C;  2E2I A;  1XZP A;  3M4O C;  2JA7 C;  3AD8 C;  1BGW A;  4P5A A;  1R9T K;  1JOE A;  1DCH A;  1USM A;  4A93 K;  2KWA A;  1TWG K;  1VJE A;  4KC6 A;  2Y0S D;  2NVX K;  2R7Z C;  5C3E K;  1IBA A;  5JVO A;  3JST A;  3T02 A;  2FQT A;  5IYB K;  5IYC C;  2Y3P A;  1I3Q C;  2FQO A;  4Q5S A;  1F9N A;  4XLN A;  3FKI C;  1EFW A;  4Y52 K;  1IS1 A;  3A8K A;  2O5I A;  3I4N K;  4XSZ A;  4C2M C;  2R92 A;  3ADA C;  1I6H C;  2JA6 A;  4G0W A;  5IYC K;  1VH2 A;  4FZB A;  4KMA A;  3GTG A;  4GTE A;  4KAR A;  3S1M C;  3GIR A;  2WAQ D;  3S15 K;  2GAH C;  4A3D K;  5M5Y K;  4OIO A;  2E2I K;  1VRQ C;  5C4J C;  3TFH A;  4G7H A;  1SFO K;  1DCP A;  4G0U A;  4KB2 A;  1O2B A;  1C0A A;  1O28 A;  3T01 A;  1XPP A;  5FJ8 K;  5C4J K;  1K83 C;  1F7V A;  3GTG K;  3GTQ A;  2JA5 K;  1AB4 A;  4WJ3 M;  1GE9 A;  3K7A C;  1VLO A;  2PA8 L;  5IP9 K;  1J6X A;  2R7Z A;  1HI9 A;  1WQF A;  1IE0 A;  1WOP A;  3CQZ C;  2YU9 K;  1TWC K;  2R93 C;  4A3K C;  3GTO K;  1IQ0 A;  3HOU K;  3IPJ A;  3HOX K;  4G7Z A;  4LQY A;  3GTK C;  3I4M C;  2NVX A;  4GTL A;  2Y0S L;  5FLM C;  3N3Y A;  1R9T A;  1TWA C;  2JA8 C;  4MEY A;  1XXA A;  4A3K K;  3PO2 K;  4BLB A;  4DDQ A;  3FOF A;  3S16 K;  4X6A K;  4J3N A;  1I6V A;  1EK8 A;  4XCH A;  2ZUE A;  3NUH A;  3GTK K;  3H0G A;  3DXJ A;  4RMF A;  4A3C K;  4A3L C;  4OIQ A;  3H3V L;  2GSO A;  4BLA A;  1EI6 A;  1O24 A;  1J6W A;  4A3G K;  1WSR A;  2NVY K;  4MEX A;  2V6S A;  1KQ4 A;  4YFN A;  4GTA A;  3CQZ K;  2YU9 C;  3TTG A;  2JA5 A;  4A3I C;  5IOR A;  3HOY C;  3LPX A;  4ZH4 A;  3OEP A;  2R93 A;  3M3Y K;  4KAW X;  2EBB A;  1BJT A;  1O2A A;  2GSU A;  3CQZ A;  2E2J K;  4Y52 C;  1I50 A;  2VUM C;  1WCM K;  1ZQ1 C;  3H0G K;  4C3I K;  1EQR A;  4BY7 C;  3G4C A;  4OIN A;  4G7O A;  4A3I K;  1V5V A;  1XXC A;  2VUM A;  2E2H C;  1TWA A;  4JK1 A;  4BBR K;  5C44 K;  3GEE A;  4KMU A;  1TWG C;  5CHP A;  2B63 A;  2JA7 K;  3AQP A;  1DD5 A;  4GFQ A;  4AYB L;  3S15 C;  3GTP A;  2PA8 D;  3FKI A;  2PMZ D;  4ILD A;  2BE5 A;  4P5B A;  1PJ5 A;  1B4A A;  1WOO A;  4A3M K;  1USO A;  1WSV A;  3A8I A;  3RZO C;  3S2H K;  1WOR A;  4C2M K;  5HL8 A;  1YNJ A;  3GEH A;  3HOY K;  3S1Q K;  1TWH A;  1YNN A;  1PJ7 A;  3GTQ K;  3RZO K;  3RZD K;  3S14 K;  3GTM K;  2NVQ C;  2NVX C;  2R7Z K;  5C3E C;  2GAG C;  3AH5 A;  3S1Q C;  3WOD A;  1I3Q A;  4GTF A;  3S1N C;  1WIH A;  3HOW C;  3PO3 C;  1ZXO A;  3I4M K;  1BDF A;  1INN A;  3AD9 C;  3S0X A;  1HQM A;  2WAQ L;  3GTM C;  3GTP C;  3HOZ K;  3FOE A;  3BP3 A;  1O29 A;  4LR2 A;  3GTJ K;  4QIW D;  1ZBS A;  2JA5 C;  2XCO A;  3HOW K;  3PO3 K;  1Y1W K;  4A3F C;  1YCL A;  2CFA A;  2R92 K;  3GTM A;  1I50 C;  4GTC A;  5M3F K;  4KN7 A;  5D4D A;  5IOT A;  1EH1 A;  4C3H C;  1TWC C;  4YFK A;  5M3M K;  5TJ3 A;  1RU0 A;  4OIP A;  3S2D K;  2R92 C;  2PHC B;  3S1R K;  4PAB A;  1X31 C;  1Y1W C;  4A3F K;  1J6V A;  1TWG A;  4WJ4 A;  3GEI A;  5IOS A;  3SZZ A;  3GTG C;  5IP7 C;  4BBS C;  2ZUF A;  1K83 A;  1ZVU A;  2RGR A;  2A6E A;  1Y1V C;  3QX3 A;  4PAA A;  2W7V A;  1WCM C;  3HKZ D;  1Y1W A;  4O2D A;  4A3L K;  2XCR B;  4A3C C;  5C44 C;  2WB1 D;  3GTJ C;  1TWF A;  1I3Q K;  4BKW A;  4KM8 A;  1DCO A;  5CJ9 A;  3OPF A;  1WCM A;  3BP8 C;  1I50 K;  5IYD C;  5FLM K;  1TWF C;  4YG2 A;  2A6H A;  4M1X A;  4LLG A;  3AD7 C;  3H3V D;  1R9T C;  1O25 A;  4BY1 K;  3AQO A;  5JFE A;  2E2H A;  1TWH K;  3S2D C;  5M5X K;  1YX2 A;  2E2J C;  1F93 A;  3A8J A;  4MQ9 A;  5TMF A;  4QJV A;  3MML B;  4P9S A;  3ERE D;  1SFO C;  3LAJ A;  3FHZ A;  1ZYR A;  4G0V A;  1SMY A;  3RZD C;  4BXX K;  4LJZ A;  3FKI K;  2RH6 A; 
#chains in the Genus database with same CATH homology
 1JOE A;  1J6X A;  1VGX A;  2FQT A;  5E68 A;  1YCL A;  1JQW A;  1VH2 A;  1JVI A;  1VJE A;  2FQO A;  1J6V A;  4XCH A;  1J98 A;  1IE0 A;  1INN A;  1J6W A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...