1JVOA

Azurin dimer, crosslinked via disulfide bridge
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
128
structure length
128
Chain Sequence
AECSVDIQGNDQMQFNTNAITVDKSCKQFTVNLSHPGNLPKCVMGHNWVLSTAADMQGVVTDGMASGLDKDYLKPDDSRVIAHTKLIGSGEKDSVTFDVSKLKEGEQYMFFCTFPGHSALMKGTLTLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Azurin
publication title Dramatic modulation of electron transfer in protein complexes by crosslinking
pubmed doi rcsb
source organism Pseudomonas aeruginosa
molecule tags Electron transport
total genus 32
structure length 128
sequence length 128
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L
ec nomenclature
pdb deposition date 2001-08-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00127 Copper-bind Copper binding proteins, plastocyanin/azurin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 1jvoA00
1ASOA 3NJMA 1JZHA 1DYZA 4G7SB 4A2EA 3NJGA 3H4FA 5IY5B 1CYXA 2YAQA 3PLYA 1GS7A 2WO3B 5F7BA 2XX1A 3WNJA 2IDSA 1L9OA 2DV6A 5D4JA 4E9XA 3WG7B 2HX8A 3BQVA 1VLXA 2H3XC 4HALA 1KGYE 1GY2A 1PNDA 1A4CA 2BW5A 2XXGA 1JXDA 1NTDA 1JZFA 4KOCA 1KCWA 3FSAA 1WAEA 5AZUA 1SNRA 3ABLB 3WI9A 3H56A 3OM3B 1UATA 2HLEB 4KO9A 1ZDQA 3UAEA 2GIMA 2RACA 2W88A 3FU7B 1V10A 1WA0X 2GHZA 2DYRB 5TK4A 2VW4A 2J55A 4E9QA 1ZIBA 2HX9A 3NSFA 4KNUA 3QJSB 5B3SB 1AZUA 1KDIA 1XB3A 2HRGA 3RYMA 4AI7A 3GXUB 3T71A 1PZAA 2PP8A 4N8UA 1AANA 1JXFA 1TKWA 3DIVA 3WKQA 2VSMB 1AS8A 5PCYA 2FQDA 4TXVB 1AZCA 1J9TA 2XX0A 4A2HA 3FYEB 3FU8A 2PP9A 4PCYA 1ZDSA 2Y1AA 3N55A 3TASA 2FNWA 5B7FA 4A66A 1L9TA 2FQFA 1F56A 4DP5X 3OMAB 1ASPA 3SBPA 1W6LA 1IBZA 4EF3A 3AG2B 3MX0B 3EH3B 3X1EA 2PPFA 4E9YA 1PZCA 3FQ1A 3KW8A 4JHVA 2AANA 3S8GB 1E5ZA 1ILSA 3OQRA 4DPAX 3TA4D 1HAUA 3OD3A 2PP7A 1IBYA 4BWUA 3FSWA 3FPYA 8PAZA 3IBOA 2XVBA 4HCGA 4KO7A 4KNTA 1PZBA 3CVDA 4JHUA 1OE1A 5LDUA 3T6ZA 2P80A 2B3IA 1V54B 4M3HA 3SBQA 1HFUA 3CDZA 1SJMA 2BP8A 2BW4A 1A3ZA 1X9RA 1BQKA 3NSYA 3ABKB 2GBAA 1NPNA 2CBPA 3X1NA 5I6LA 2XU9A 4YSEA 1AAJA 3FQYA 3NJKA 2AZAA 3NJIA 1NWPA 4HCFA 3T6VA 3OMNB 4DPCX 2QDWA 1NIBA 4E9WA 4HIPA 5ANHA 2H47C 4G7RB 2YAFA 1NIFA 3AG3B 2AFNA 2VM3A 1OOWA 1N68A 2BWIA 4YSAA 2EIMB 1NZRA 5F7AA 1JVLA 4BDVB 4HCIA 2X87A 4L0PB 1TEGA 2VMJA 1M9WA 1SDDB 4BWTA 3ZIYA 2YAEA 1EHKB 2PPCA 1CC3A 5B1AB 2BO0A 1KDJA 3ABGA 2CJ3A 5A7EA 4JKNA 3BVDB 6PCYA 2IWFA 3S8FB 2IH8A 3HEIB 4A2FA 3UACA 1QLEB 4F7KA 1PMYA 2GSMB 1GYCA 1BYOA 4G72B 3QJUB 1W6WA 2Q9OA 1A4AA 3T6WA 3S3CB 1QNIA 3TBBA 1PF3A 1E30A 2FQEA 3H4HA 4KO6A 3QPKA 2XLLA 2DWTA 2HRHA 3PCYA 1SHWA 3ABMB 4QKTA 5I5MA 1JZIA 1T5KA 1RKRA 1NWOA 2UX6A 4GYBA 3FT0A 3QQXA 4KNSA 4MFHA 3X1GA 4W9ZA 2HX7A 7PCYA 1AZBA 1L9RA 2OV0A 4YSSA 1AACA 2UXVA 1OF0A 5AFAA 1NDTA 2R7EB 2YAOA 4UF7C 3FSZA 3T6XA 1GS6X 1KBWA 1KYAA 4YSRA 3IN0A 2JXMA 3S3DB 1E67A 1TU2A 1M57B 2Q5BA 3PXLA 5AKRA 1AR1B 4DP9X 2CAKA 3IN2A 4NERA 3AG1B 2VSKB 1ADWA 2X88A 2XV2A 4KOBA 3UABA 2EIJB 4W1TA 1PNCA 1J9SA 2IH9A 4BDVA 5I5IA 1WA2X 2Y69B 2J5WA 1IC0A 1E5YA 3FS9A 4DP2X 1SDDA 3NSCA 1JERA 3NJJA 2TSBA 2IWKA 3NP4A 1KV7A 2FT6A 1L9SA 1I53A 2XV3A 3TU6A 1JOIA 1NICA 2IDUA 5I28A 2NRDA 4NAJA 2ZOOA 2CUAA 1PLCA 4HAKA 3V9CA 3AG4B 3FPXA 5B1JA 2J57A 1NIEA 2BP0B 1CUOA 3JT2A 4X4KA 2ZXWB 2MTAA 1OCOB 2B08A 1JZJA 2H5UA 1NIAA 2YXVA 2P80D 1RCYA 1FWXA 2LLNA 3EHBB 4AKQA 1PY0A 4QLWA 1HAWA 1SF5A 2QPDB 4N4YB 3SQRA 1OV8A 4FA7B 2AVFA 4DP4X 2IWEA 4E9RA 2J56A 1PCSA 1BYPA 1MG3C 4GY4A 3FU7A 2PCYA 1FFTB 1KCBA 3EF4A 5I6NA 4RH4A 1OE2A 1AZRA 2UXFA 1PLBA 3V9EA 3SBRA 2YAHA 1ETJA 2EILB 3FYIB 2OCCB 1WS8A 1AG6A 9PCYA 1A65A 3C75A 5D4IA 1ET8A 5I6MA 1DZ0A 3CVCA 1XB8A 2WSDA 3QJVB 4GXFA 2UXTA 3L45A 2QPEB 1AOZA 2YXWA 1BAWA 1NIDA 1KBVA 4FAAB 3NSDA 5B1JC 2W8CA 3GDCA 4HHWA 2CALA 5I26A 2ZONA 3NJHA 3G5WA 1OE3A 1SHXA 1JZGA 1GY1A 1XMEB 4BXVA 2XV0A 2IDQA 1GR7A 1BQRA 4K9JA 3NJFA 1WA1X 2YQBA 2MRYA 2JKWA 2CCWA 2VW7A 2EIKB 3PAZA 3WKPA 2TSAA 4AX3A 5D4HA 5I6KA 3FQ2A 4P5SA 3EH5B 3AZUA 4YL4A 2VN3A 3ZX1A 4F2FA 1PLAA 4KO5A 4YVNA 3T9WA 2DWSA 5E9NA 5B1KA 4DP7X 2FT8A 1ET7A 1JXGA 3CVBA 1N70A 3ERXA 4YSTA 2PLTA 2XYBA 3KW7A 1JZEA 1CURA 3ZDWA 2QT6A 4CSPA 1V55B 2QDVA 3PAVA 1CYWA 5I6OA 4A67A 1EZLA 4NB7A 1A4BA 4Q8BA 1OCZB 1MDAA 1W8EA 1M56B 2EINB 4E9SA 4G70B 2UX7A 3UGEA 5B1BB 3EH4B 4DP8X 3GYRA 1IKOP 4BWWA 1BXAA 1TEFA 4ZK8A 1MZZA 3ZBMA 4M4RB 1BXVA 1AS6A 1GW0A 3FSVA 3NP3A 4HZ1A 1AIZA 1OCCB 2N0MA 4DP1X 5I6PA 5I5JA 1RZQA 2WO2B 3UAAA 3X1BA 3AY2A 3IEAA 1X9UA 2JFCA 1ZIAA 3NYKA 1E65A 4WTQA 3CDZB 4YSUA 2BP8B 1SFHA 3DTUB 4F2EA 1ZV2A 3WNIA 3NT0A 4PAZA 3NJNA 2I7SA 2E86A 4WKXA 2FQGA 1XB6A 2BZ7A 3TBCA 4DP0X 4ENZA 2PCFA 2YARA 1SF3A 2IAAC 1AG0A 3AW5A 1JVOA 3D12B 5B7EA 4AZUA 6PAZA 1NINA 3DKHA 2HXAA 4A68A 3QJRB 2R7EA 4A2GA 4BXSV 2OJ1A 3QJTB 1URIA 2GC7C 4YSCA 1J5CA 3PAUA 2A3TA 4AKPA 1MZYA 3UADA 2GB2A 2VW6A 2XWZA 1L9PA 4G71B 1BXUA 1R1CA 4Q89A 3HB3B 3ASNB 3CZUB 2BWDA 1ASQA 1GSKA 5PAZA 2GI0A 5TK2A 2VM4A 2IDFA 3QJQB 1ID2A 2UXGA 4BK5C 4GP4B 4YSQA 2FWLB 4GP5B 1B3IA 2YAPA 3U25A 1A8ZA 2YAMA 2I85A 4YSOA 4DP6X 1J5DA 2IDTA 2FJSA 1WS7A 3JTBA 1SFDA 3N2JA 2AZUA 4G7QB 3X2QB 2GC4C 4CSZA 1IUZA 1QHQA 3IE9A 2XXFA 4YSPA 2DY2A 3OMIB 3ASOB 2BP0A 3S3BB 1FA4A 1ET5A 4E9VA 2I7OA 1L9QA 1OCRB 1ZPUA 3WIAA 4HHGA 4E9TA 2BHFA 1AZNA 3NJLA 1GS8A 3FU9A 4GP8B 4AKOA 1MG2C 1RZPA 4P5RA 2PPEA 2PPAA 2XUWA 2FTAA 5B7MA 4YSDA 1BEXA 7PAZA 1AQ8A 3CG8A 3PPSA 4YVUA 3X1FA 5EHFA 1ILUA 3MBWB 1J9RA 1BQ5A 2ZWNA 4UAHA 1PAZA 1NPJA 2BZCA 4DPBX 2DYSB 1AS7A 2FT7A 2PPDA 4UANA 1J9QA 5FC9A 4A2DA 2HZHA 1YLBB
chains in the Genus database with same CATH superfamily
4FE9A 3CDGA 4X6FB 5DU7A 2W0LA 4OAWB 2CWRA 2RJMA 4JM4L 4RFOL 3D4ZA 1A1MA 2XRAL 5IY5B 2MOQA 3C6LA 5F7BA 2XX1A 3V5KA 3BGFC 1YC7A 2HRPL 1P4LA 1AD0A 4PJHB 3BP7A 1OGSA 3AM8C 3KCWA 1ACCA 1E0OB 1VLXA 2CGYA 4H1LB 4OCXH 5IQ9B 3B1UA 1H3PH 4B9ZA 4PH8A 1RZJL 2JJTC 5FYKH 3VFMB 2XIDA 3UYRL 4XBGA 2QVIA 1I1FB 5HY9A 5I0XA 2ZOLA 2CR0A 1T1ZA 2JIXA 1Y0LA 2MCAA 2VDOL 4RZCA 2MHAA 3HNTL 4I0CC 4WGWB 2R59A 3WHE0 2X4SB 4JPKL 1XGYH 2IF7A 3C5ZD 3S4SB 3UJIL 3ZMEA 4LL4A 4RGMB 5F93C 1JYNA 2BMKB 3EHBC 4NC1C 1ZJAA 3ZZLA 3GWJA 4L5FE 4P23C 4XCFH 1CICB 4TVUA 4J1UB 5FHBH 3ZVVA 3X3GH 3KWTA 4P5TB 1WLHA 2B20A 5C1MB 1MOEA 1FVCA 2WY3B 1AANA 4JJHA 1NLBH 4LPXA 4LRNH 1JWMA 3PQYB 4M9OA 3ZDXB 1LO2L 4TXVB 1AZCA 4WV1B 3RWIB 5LO7A 4OD1H 4P57A 2Y6TE 3BJ91 3JV4A 4JJ5B 4YDVB 3OR7B 5ACMA 5E94A 1SHMA 2G2NA 1IAIL 4A66A 1FAKT 3DX8B 2N7AA 2OR9H 1LXMA 1CBVL 5H8DA 4XWOC 1NMBH 2LTQB 4XNZB 1DUZA 1FNHA 4FQIL 2OMYB 4LCYA 1EJOL 3SDCC 3L3KB 4QTHB 3S8GB 4K7PX 2A4EA 2A9ML 1D5RA 2MQGA 4NRXB 3QUZB 4L1BA 1LEIB 3KYKH 4MCNA 3BPOB 2J6EL 3I02B 3M1BA 5G2NA 1KJMA 1ZS8A 4W9EC 1UA6H 3FQTB 5TPWH 2DLEA 4FXGC 3SN6N 1RP8A 2DICA 4M5YL 1DBBH 1VFMA 4X8XA 4TYUA 1WIOA 3FB8B 1K72A 3QDGE 5K69A 1KFGA 2X44D 3EDDA 3HPJB 2HT2D 2O6CA 2ZKYA 1X9RA 1NBQA 3BZ4A 5TE6H 1M6UA 5KJ7E 1HINL 3NJKA 3KBEA 3QI9D 3O2WL 4L9LA 5DD5L 3TC9A 1YNTF 4IU2B 5EZIH 1HS6A 5EC2B 4Y9GA 4RAHA 3ZO0A 3AS0A 1ZLEA 4PS7A 2VMCA 2VDPL 3V4PA 2I27N 2ZUUA 3TJHC 2WINA 4WI3A 2XVKA 4LVOB 5EZOH 2OI9C 4WY7H 3CSYA 4UQ2B 5FO7A 1E28A 1NFDB 4H1LH 4V1DD 5ESAB 2AJXH 4N2CA 3CZGA 2ETWA 4G8GA 1HDMA 4YS4A 5D7SH 1MCQA 1DN0A 1JSYA 1U8CB 4WLCA 5F1KC 1SDDB 1CD8A 2DLFH 4XOAA 1FGVL 2NQCA 1R3IL 1BVNT 1P7KA 4NGHH 3RP1A 1CIDA 3H3PL 3DYPA 4NN5B 3FF8A 2OXHA 3CSGA 4YZWA 5JW3L 3B5TA 1WD9A 1ZA3B 3HEIB 3C6LD 4C83B 3ECUA 2Z7YA 3ESOA 4F7KA 1DDHA 3EJTA 2GSMB 2OK0L 3C5ZB 5DRXA 5E1GA 1UD2A 3QJUB 1M1XB 4Z9KB 2W0FB 1A4AA 4PRAA 4CMMB 3DVGB 3FULA 4YMPA 1AC0A 2YKLL 3AROA 1EJFA 2XKNA 4XE5B 5HHNA 3WD5L 2IGFL 1BQHG 5GRXG 4FG6D 4PGBA 4HGWB 3N1PC 3DI2B 5MEOA 4I18C 2JIXD 3H9HA 3LKSA 3OHXB 5AW3B 1RK7A 4BV1A 2HFEB 2R2EB 4X4ME 1W91A 3RGVC 3WEAA 5AFAA 2OYMA 5EOQL 3C2AL 2C26A 5CSZB 1H0DB 4G42B 4W9CC 5KSBE 5JYLA 3DUSA 3BLBA 3GSNL 2C9PA 4XMXA 3B2UD 1EERB 4NQDA 5IW1B 4KOBA 3UABA 3F3HA 1SN2A 2BIOA 5DC9B 4Q9RL 4P04A 5I5IA 2V17L 2ZNXA 4Z6AT 1A7NL 3WMPA 3CJJA 2X1PA 4FFYL 5KYXA 3GS7A 1DR9A 1VGKB 3E8UL 2DDQH 3QHFL 1XCTA 2C7UB 3IRPX 1I53A 2B1HL 4PJHE 5GGVH 5J3HD 5LAXA 4NZTH 4PB0H 4Z7IA 1CD9B 4PRBA 4XP4H 5JW4M 3B5HA 4MSWB 1KV3A 2XY2A 3P2BA 2WB7A 4DUVA 4JHWL 5ABAA 1EXHA 3L3OB 4RIRB 5ID1A 1TTAA 1N59A 1I1YA 2MTAA 1U91B 3QI9B 1OCOB 1OT2A 2JTYA 4H26A 2EYRA 2H5UA 2WMPB 2YUVA 3D9AH 3ZY7A 5CBEB 3DURB 2NY7L 2VN4A 1NIAA 2HTKC 2RQEA 4ODTH 3O3BB 4EUPA 4JFFA 4KKCC 3GXNA 2VGLM 1HAWA 1DZBA 2MFNA 3HJEA 4N4YB 3FU6A 4P2YA 4OH2A 2OL3H 5F7KC 4I2XA 5L9DH 2Y07L 4YDIH 1GCFA 3CFJA 2PXYA 4J28A 3TYFA 4PR5B 5H2BB 2ESVA 3PQYE 3ZDXE 5T3XD 4UM9B 3BMWA 1KCBA 3U7YH 3C8KA 5C2BH 1Q0EA 3CDGB 4YXHH 5JW5A 2YAHA 3FMGL 4A6YA 3ML8A 1XGPA 3ZHLA 4GXVH 4DO5A 3K6NA 4XH2B 4LQFL 3V5KB 2FBJL 4FDWA 5EU6B 3BP7B 2FO4A 4G8GD 4H5SA 1JV2A 4HJUA 3V4LA 1F00I 4HWZA 4KXDA 3U6RA 4HPYL 1UGNA 4OCYL 1T83C 1E5CA 3V7AG 4R0LB 4ADGA 1HQ4A 2OTWA 2JIXB 3E2HC 5EF2A 2R39A 4RZCB 4H88L 4JM2C 1G7HB 1F90L 3DJTA 1KELH 3FO1B 1PIGA 4TRPH 5ES4B 2O30A 2AJ3A 3KHQA 5E00B 4PGEB 4J3SA 4N2MA 2WAQA 5EORL 3Q43A 4UOZA 1I8MA 4FNPA 4PG2C 4HF5L 1KN4L 3T9WA 3GBML 4HJJH 3BUPA 4W9HC 5DK2A 1OLZA 5EA0H 3RURA 4R7VA 4PGCB 2WTRA 3VQ1C 2ZIDA 3V0JA 5IMMB 3KS0J 1BG9A 2J8UA 3RHWK 4KVNL 2R4SL 3C08H 4CSPA 1R19A 4P57B 2WSPA 3CAFA 4LVNC 1PG7H 1NFDE 3D4CA 1MCFA 5DJYA 4GKZA 3F85A 4W9FC 4ADJA 3JZYA 3F6JA 1CXEA 4NQDD 5AOJA 4X0NA 3J07A 2CBQA 1BXAA 1DUZB 3KPRB 3RFRA 4LCYB 5F1OB 1MRDH 3P4LA 4D0BA 3F2LA 1QX1A 2HT3D 3M1BB 1KJMB 3MLRH 1ZS8B 1M3IA 3IRCA 4OM0H 3RNQB 4LP4A 5KW9L 1GZHA 2BWQA 4QMEA 5LCVH 5TDPB 3TBYA 2FATL 3VFGL 4ZMAT 4F7MB 4G82A 3C6EA 5ICUA 1OZTG 1YY9C 3HHSB 3KH3A 4M03A 1NAMH 4Y5YC 1G7IB 2UWEF 2VABA 4MRBA 1HNFA 1MIML 3BZ4B 2V3EA 4IBLT 2X1WL 2CUMA 3WAJA 3L08A 2B4CH 1QFWL 4L4TA 4OZHA 1TNNA 1BAFH 4NUGH 1JHLL 4CDGC 1CJYA 4WEMB 2ICEC 1TVHB 4PBXA 5B3JE 1PQZB 2NR6A 4JFFD 3AW5A 5D2LB 4ZDHA 3V4PB 5JXAL 2IOOA 3GZOA 1E28B 3KL3A 4HBCH 4X6DF 1AFVL 1HDMB 3MXWH 2E47A 3CVHL 2PXYD 1F2XK 4P9HH 3QAZC 5AW1B 2ESVD 5F9JA 1DN0B 3K71A 1RZ8A 5D5MA 1UB5A 1XH3A 1PEWA 4HG4J 2H1LM 1R6VA 3VSQA 1S7XB 1CLCA 4FF9A 4XNYL 1A5FL 1FH5L 2OMZB 1H5BA 5B22A 1T5WA 2C4FT 2VQ1A 3MNWA 4LVHC 3I50H 1KJVB 2O5NA 2FX8L 5DRXB 1UZ8A 4UTCA 4FQHA 1CI5A 1OAKH 4ALAC 2ROXA 2VTFA 2WQRA 2EO1A 3KDMA 4GAAA 1RAMA 3U25A 1F1DA 2WXFA 2XKNB 1OW0C 4OTXL 1CT8A 3QYNA 2HH0H 2YMXL 3GBNH 3Q8CA 1U8OA 4BUGA 5AWNH 2V2TA 4YDMA 4UTBH 1VPOL 2H0EA 4LU5L 3B9EA 2EZ0D 5IEKA 3QNFA 3M46A 3IE9A 5K39B 4OCRL 1RMFH 1ET5A 1L9QA 2XA8H 2EICA 1YDPA 5DJ8A 3WDIA 3DUSB 4KDTA 2DN7A 2EC8A 2YGNA 4M43L 3WYRA 5FO8B 3K4ZA 4XN7A 1FNEB 5E9AA 2ZOTA 4WDIA 1EGJA 2AHIA 1NSNH 3CH1A 3P3UA 2B9AA 2D7TL 1YEDA 1IIIA 3BVVA 1CLOH 4XPGL 1KPRB 1S7VA 1G7QA 1KN2H 3BFOA 3VYPA 3O6LH 1ZGLA 4PBWD 4MB1A 5EU6E 2FT7A 4LSSH 1F1AA 2I32A 3HMWH 1OAZH 4EI0A 5IMOB 4AEEA 5KBKA 1MREL 1HYSC 1CI3M 3O6KL 4WNSA 1OM3H 3UEZA 1E4WL 4F93B 1Y1DA 2ARJA 4FP8H 2CKBL 1IL1B 3AAZA 3O11A 4RBPH 1AI1L 5D70L 3RL2B 3TP4A 1FP5A 1IGIL 3FQUA 5ID1B 2M8XA 5ALCL 1N59B 3VI4F 3RVTC 4B9FA 3FDWA 2ZF8A 1ORSA 5F7UA 4L3CB 4E9XA 2HKFL 4KK6C 4NBZB 4L8DA 5FLUA 3TO2A 3Q3GA 2EYRB 2A9NH 5JDSA 2EABA 3VTAA 5LQBH 1D7BA 2D7PA 4YR6A 1JXDA 1NTDA 3PG2A 4JFFB 5I2IA 1A4JB 5I1AB 4JFYB 3WJLC 3OQ3B 4XMKL 5E99L 3PHOA 3IWVA 4I2XB 4I8DA 3UBXI 3PJNA 3QH3B 5C0CA 1MCBA 4ZUUA 3GJFH 3TWYA 1M71A 4YZFE 3TYFB 3BKYH 3CQQA 2QVKA 4FXTA 3UO1L 4GAFB 4P99A 3NIGB 2GHZA 1G43A 3FTSA 1EAQA 2FGWH 3VXTA 3CFCL 4L4TD 3US1A 2LU3A 4KDWA 4LASL 4A6YB 3MLYH 5EC1B 1XGPB 2NR6D 3D4YA 1QFHA 3HRZA 3U48A 2OTUA 5ID0A 5D93B 4YDNA 5JXEC 1PZAA 1A47A 4XMTA 3L7EA 2ZOUA 2FO4B 1XO8A 3QUXD 4H5SB 4IIQB 4HWZB 2DPKA 4DGWC 5KYYB 3BPNB 1KOAA 3KPRE 2UUDH 2BC4A 1TUPA 3CC1A 1CFNB 5FLVA 3AT9A 5FF6A 1GYWA 5IEHA 2OTWB 3HZYA 4EO5A 3NABH 4U6YB 1XX9C 5L8JB 5IBTL 4IBVA 4AG4H 4LDOB 1B4TA 3IDJB 5EDSA 1O6SB 5AW9B 3QFDA 4XNUH 1JPSL 1UVQA 4I3SL 4L8BA 4DPAX 4OZIF 3C8DA 1KSRA 1UHVA 4GUPB 2Z93B 4RRPM 2BOBA 2EDHA 3IFOA 4ANXA 1I3UA 1CDHA 3FO2A 1IAIM 4QAWA 5ILTH 2ZD0A 5I1IL 3A6CL 4H8WL 5T3XE 3L54A 4BSVA 1U9KA 4IMKC 1IM9A 1HFUA 1LP9B 1J0JA 1SOQA 5HHQA 3KH4A 4FQPA 3F05A 3N1QC 1IFHL 1A3ZA 3QQ9D 5D2LE 3M07A 4QO1B 4MD5A 1WDAA 2YEVB 5E51A 2YOAA 4R4NC 4XHJD 4XNXH 1J1PH 3OAYH 5DJYB 2XPYA 3FQYA 2Q76A 4HBQA 2DJUA 1SXBA 4LE8A 3U6XA 1MCPL 5DHEA 4OCLC 1QOKA 2R56L 2ZWYA 5CN2A 4G7RB 1NUGA 4NZFA 1J9CT 1W0VA 4OIIH 3S37L 3KPLA 1LO4L 3WBDA 1G94A 4TSCH 5KYUB 4FFZH 4LXFA 3WHXA 1FAIL 1NGPH 1NOFA 3LSOA 3SGEH 2OP4L 2C9VA 2FSDA 4WEBL 5T33L 2KT6A 2W9LA 2HJKA 3FZUC 4YHNB 5ITBL 4TVPD 4URTB 2CXKA 5AOKA 3N85H 4XX5A 3V8OA 1ZK9A 2J43A 2KDYA 4CSSA 2CKNA 1QVOA 3WKYA 4N8CH 2OMWB 5BNXD 2YPKB 4AE0A 1FZOB 5J6HA 3NZSA 5FV2A 5A6IA 3MTRA 5DEGA 5F9AC 3V9FA 1UACH 2Y24A 1JGVL 1E30A 5AKTA 1Q9OA 1XZWA 4BK4A 5I5MA 4TLTA 1Q9KA 2PO6A 3IB4A 4IRJB 1QP1A 2XG4A 4X8JA 3JVGA 2LFGA 3M6DA 2CO1A 1D5ZA 1Z2KA 4WUKL 3OZ9L 4N8VG 1XH0A 2QZQA 3MJ9L 3L6FA 4NRYA 2HUEA 2WNGA 3KPSA 5F70A 5AZEL 5C0CD 2EE3A 2Z64C 3QUXB 4NO2A 3BSZL 4XMWA 1GS6X 2AEQH 4O5LH 2Z91B 2H41A 4LOFA 5F9JB 2B3RA 5KVFE 5D5MB 2NZIA 3HKZA 4ZX4A 1TTFA 4LNRA 1TU2A 1TJHH 3BDYL 5D7IF 2ORBH 4Y16B 4V11A 3OJMB 4HKJB 3UEQA 4MNHA 3ZGIA 4BCXA 5J13B 3GHBL 3NRQA 3IDIA 1H5BB 2X88A 2BY1A 4HJ0D 4WVRA 1I31A 5E9DB 3RY6C 3MNWB 3QJHB 4GLRH 2OJEA 5BXFB 2ERJB 2DQJH 2NNCA 1HIMH 5IVXF 2X2YA 1L5GA 2FB4H 3WKMH 2DLTA 1UZ8B 5J89A 2Y69B 3F7VB 4FQHB 1F4HA 3APMA 1E5YA 2M1KA 3MV7A 3L3GA 1YNTB 1NGXB 4LSRL 4YWGL 2FT6A 3SDAB 5IFJA 2WANA 1U8OB 4XXCC 1RSYA 1YJDH 4AYFA 5TFSL 4FFWD 5JIPA 1LK2A 1NL0H 5IEKB 3VX0A 1PJ9A 1JGLH 1GC1C 3FT3B 2DIEA 4I1RA 3CFBA 4KROB 4JFFE 1RUMH 3GDBA 1YDPB 3W56A 5LUMA 4I2XE 4JPQA 2PYEB 5C0ND 1J0IA 2NZ9C 2Y1YA 3DSFL 2YR3A 3WUWG 3WXVL 1R5IA 4WDIB 3NIGE 4QWWD 1IM9D 1EAPA 2H9GA 3CH1B 4BE6A 1RPKA 2N7BA 3CLFH 2R1XB 1D5IL 3BUQA 1OV8A 1R3KA 4OLWL 4WO0A 1KIUA 1MAJA 2AK1H 2AVFA 2NY5H 1G7QB 4OF8A 4RNRA 3B34A 4NCC2 3QO1A 4YDZA 3UTPD 1VHPA 1ZMYA 1TEYA 2ICCA 3FTGA 5I8EA 3ZKXB 3PABB 1HSBA 3FU7A 2F53B 3BHBA 2ZX7A 1PL3A 4OCXL 4TLKA 1MFUA 4F91B 2EDBA 1TZHA 5FYKL 3RB5A 4Q2ZA 3GM0A 4MB4A 3ZYIA 5CSBA 1TVBB 3QQNA 4HHAB 4HWEH 1A65A 4ONHA 1BBDH 1WZ1H 3PWUA 4IBYA 1OARH 1ORSB 3ZZSA 5DZNA 2A83A 3JV0A 2XWEA 1XGYL 3Q3GB 1AOZA 3ZU8A 5JDSB 2X2HA 3UBFA 5EZPA 1BP3B 3IU4H 3LEXB 3VM7A 3PGDA 5FKAA 2KLSA 2A73A 3HS0A 4YR6B 1WISA 5I2IB 4XCFL 1SQMA 3PAYA 4PP1D 7CGTA 5FHBL 2FE0A 4PJIB 5BV7L 1THAA 1SHXA 1M42A 3P4MB 5I82A 1GY1A 4YEFA 1KXTA 1HNYA 5C0CB 5K9JL 2Q7NA 4FD0A 4ZUUB 4WO4A 4MMYA 1NLBL 2IQ9H 5I0VA 3LH8A 1RI8A 5KOVC 3P1VA 4WI6A 1QR1B 1LP9E 1NCCH 2XACC 3PAZA 1S78D 5AYUL 4U7KA 3MZGB 3KLAA 5GRYA 1DUYA 4ODWA 1INEH 2PO6D 4HIJA 3HRZB 2Y7QA 1DANT 3DX2A 4PWIA 5FUCC 3WTSA 1U3HA 4FGMA 5GHWL 2EDNA 2BP5M 3C60A 3ARYA 1HX0A 3KPSD 2EVHA 3VWJA 2CGZA 3ZDWA 2WP3T 1B0GB 4B3EA 3V6OA 4JKWA 4KDVA 1HH6B 2ZXGA 5IEHB 4LL1A 3KYKL 1EDQA 3QJZA 4L2YA 4HH9B 1WAPA 3LYRA 4NI3A 4R7DA 3N9GH 2ZCKH 2GK0B 1UA6L 5TPWL 4NJAH 3ZTNH 4AGNA 4A2LA 1DJWA 2CIKA 1JPEA 4JMXA 4OF6A 4JUTA 4OB5H 4BQ8A 3EG9B 4ODXB 1DBBL 4GSDH 3TS8A 1BD2B 1YG9A 2E59A 4IDJH 4IU3A 5A2JH 5ERWB 5FR3A 4HS3A 2WLNA 4PJDF 4I85A 3MV7D 5C2UB 3UAAA 5D1XA 3IFOB 3MRCA 2WTPA 5TE6L 1UJ3B 3AY2A 1MLBB 4M48H 3ZYJA 4XB8A 4NWTL 2X70B 3HC4L 1V27A 4RLDA 2BVYA 5EZIL 2ZAHA 4BSVB 2V5YA 4Z3TA 4PRNB 4JB9H 1Z3GH 2VIRB 4JCMA 2WUCH 5IW3A 2DMHA 2CO3A 4QR7A 4OJFH 5EZOL 4GAYB 3VJ6B 3GUFA 1WBZA 1X4ZA 4P0DA 3GMNA 4HG4K 4X4YA 2AJXL 1LDPH 1K4DB 3ARPA 2BIHA 3TV8A 5D7SL 4H0HB 4IKIA 4ZOCA 3EGXA 3M17A 3II2A 2AXGA 3TBCA 2DLFL 5B39G 5D5ME 4NGHL 2P44B 4H0LC 1N7ML 3HN3A 3KPLB 5E7FA 1OB0A 4BELD 1OSZA 1AD9A 1V7NH 5E9DE 2C9QA 2YBRA 4G5AA 4A2GA 1V3KA 4ZTOL 5D4QA 1O6TA 2JB5H 2R69A 1WFOA 2FX7H 2CBOA 5EBMA 3NA4A 4OLVH 1ECYA 1JK8B 2PTTA 4GAGH 1AYRA 2G60H 4MBOA 1IRAY 1QHPA 3NEEA 1O9VA 3O8XC 2Y5EA 4G71B 2E6QA 4N6QA 3RDTB 5BUGA 2VDQB 3DJ9A 1TTGA 3DX6A 5I71B 2V0AA 3DDGA 1QVOB 2GJRA 3SPJA 2CO6B 5J6HB 1ZV5A 1ECZA 4N26A 3FRUA 5HJ3B 1ID2A 1F3JA 1T5XA 4ZS7L 4UI2A 5BQDA 4HX1A 3GD1C 2DIJA 4Y2DA 5FDYA 2OR8A 1Q9OB 3VRJA 1RHFA 1CF1A 2VLJB 3D08A 1Q9KB 2X3BA 3MRGB 3A67L 1UH4A 2XG4B 4PUBL 4X8JB 5EMYA 2H7WA 3SQBA 5E7BA 1ADQA 2FECL 1D5ZB 2PYEE 1LO5A 5FM5O 3L6FB 3T4AA 3KPSB 1ONQB 2Q7YB 5EUOF 1HOCA 1JTPA 1SBBA 4K0OA 4WO4D 4B95C 2OZNA 4A04A 5E8PA 2ADIA 2HFFB 4MAYB 1S9YA 2WNXA 3WFEL 3WN5A 4J27A 1ZPUA 4LNRB 1TU2B 3MU3A 3T8VA 3VWKB 4I77H 4R4BB 1RURH 3MYZA 2WKOF 4MNHB 4F3FA 4GW5A 3K81A 4LBAA 3IDIB 4XC1L 4PV9B 5KSAC 2AJZA 2VDKB 2F53E 1U3HD 4TVPE 2FJUB 3D06A 2CJUH 4PB0L 3C60D 4M5ZL 3OVUB 2UWEB 3F7RA 2L8AA 4K8RH 1VESA 3VWJD 3WCYA 1QWNA 2DJ4A 4YVUA 1KB5A 1CE6B 2X4QA 4Y1AB 3MV7B 4B9JA 3L3IA 4YN3A 4XAKD 4TTGA 3JUZA 4ZTPH 4JAMB 3NCMA 5IFJB 4KZDL 1T0PB 2VDNB 3BFWA 5E4IA 4A2DA 4LPVA 2AQ3A 3KPQA 2AS5M 3QUYC 4ODTL 1QHOA 4Z5RA 4NFDA 3MGOB 3B2PA 3H7BA 4W6XB 3LHPH 5K9OB 3K1KC 4PJIE 3T08A 2OL3L 4OF0A 2XTJD 4YDIL 1QLRA 5D1XD 5C0CE 4Y2LA 3A24A 1RULL 5C70A 3ALXA 1R5IB 4N2GA 1A4CA 2IH1B 4KRNA 3BRFA 2XXGA 4S11A 1SM3H 3CDYA 2H9GB 2XN9B 3MRIB 3UYOD 3E3QE 1KIUB 3ZTDC 3CXFA 2H32A 1KBGH 4NC2B 3BYTA 3GO1H 3MLTB 1FNGB 1N4XL 4Z7UB 1HSBB 1G0DA 1WICA 1X5GA 4P5KB 2W88A 1ZSDA 3FBQA 1CPUA 3FU7B 2VDQH 4BBWA 3EO0A 2J55A 4E9QA 3UJJH 5JOEA 4R97B 3PRZA 5MEQB 1ROCA 1VZGA 2EVGA 3RYMA 4XB7A 3SE9H 4ONHB 5GQBA 3RX9A 4MQXC 1LWJA 1ITBB 4RFEA 5T1DH 2XQYA 1JGUH 3HB3C 3F5WB 5FA3B 5KG9B 1BD2E 3IJ7A 4F9LA 3SKUD 3ZKQD 2F61A 3P02A 1AE6H 3WUWA 1SEBA 3HS0B 3ROLB 2M26A 1L0PA 3GHEH 4HS6B 5E8NA 1KCUL 4M8RA 3TFKC 3TNMA 1PGRB 3MX0B 3WUZA 3OR6A 4DERA 1U6AH 4G1EA 4MMYB 2MTPA 2FEDC 5JNYA 4K5MA 4QJ5B 4IHBA 3C08L 1QQDA 4JX0A 5JYMA 1HHIB 4HIEB 4Y2DD 6FABH 2EVFA 5C0FB 1ED3A 3GEWB 3SEPA 1DUYB 1F4WL 1PG7L 3D2UA 3QULA 3APNA 3EJSA 3CVDA 5K1VA 1NCBH 2O4EA 2XZAL 4W6WB 1U3HB 4KITB 5D6DA 2R2HB 2EUWA 2R0KH 3IS0X 3B9KA 3T4YB 2X6CA 2XETA 4KK9C 3DX7A 2P9RA 2DQGL 3QZWA 5FAAA 4N0UB 2VDNH 2QHLA 3ABKB 1N0LB 4Q14A 1MRDL 4YSEA 5I19H 1MCWW 1SN5A 3TEWA 3D2TA 1J8RA 3MLRL 4HUXB 5F0JB 3GRWL 4ZNEA 2GBUA 2CIKB 2P5EA 2AK4D 1HZHL 2Z7WA 3MGTB 5I0ZA 3UTQB 2J4WH 3G04B 3SO3B 1S7TA 4IU3B 1W15A 4KY2A 4NUMA 4NQVB 4YSAA 1NAML 3PE9A 1H6FA 4GG6F 5DD0H 5KANG 32C2B 3RVXC 5SWQA 4QXTA 3TV3H 5D1XB 2G2PA 1IAMA 4WK0B 1A7PH 3ZIYA 4M61B 2E7MA 2PTVA 1OY3B 2ZUYA 4ZX6A 1KDJA 2WO4A 1BAFL 3LAFA 4NUGL 3WN6A 3CSFA 6PCYA 4MNGA 2YD3A 1CFBA 2EYTA 2VLJE 2DYPB 3N5AA 2GQHA 2PNDA 2HPTA 3KNBB 5DRNB 1WBZB 4WHYG 5CM1A 4IJ3C 3GIZH 4HMCA 2A1WH 3KPSE 4P9HL 3OLGA 1QNIA 3IDGA 3F65A 4Z7QF 3M17B 4DN3H 3LXBA 4HMDA 2AXGB 3NRPA 5SX5K 5I17B 3ABMB 4XB3A 3OGCA 5AKVA 3RAJL 1BFTA 4RGMC 1T3FA 4UYPA 5L6YL 3CHQA 2X4UA 4G2AA 2JJVA 2C3WA 5CLYA 4H8QA 1CICC 3FTUA 4OFDA 1U8LB 1AD9B 2H0PA 2YBRB 2PW2A 3I50L 4P5TC 4MLSA 3GI9L 4XP9H 3VYOA 4GINA 4OQTA 3LPWA 2UWEE 1YUHB 3Q06A 4HXBL 1CBJA 2PTTB 3TOPA 5FECB 4WV1C 2BFGA 3Q0HA 3DRTA 4JPIB 3MV7E 4Y1AE 3SYAA 1P7QA 4J4PA 4BFKA 1C5DA 2VSKB 3DX6B 3MV8A 1I7UA 4QRPA 4KHXL 3LQMA 1C5CH 3V0VA 4UTBL 3HN5A 4OFYD 3SB3A 4Z7WA 4BDVA 2IPKB 4KVCH 5D6CA 3QO0A 1QZ1A 1XSIA 4WI8A 4E9LA 2Y06L 2DIBA 4HX1B 3GMPA 1RMFL 1HWGB 1INQB 2LTQC 4Y2DB 4DP2X 3KG5A 4F7TA 2QQNL 2XA8L 5FM4A 5GGRY 1KV7A 5C0IB 1AGBB 4XC3H 1NJ9B 5KSVA 5DYFA 4GXUN 3QUZC 2CLRA 1K3IA 4PG9A 2ZOOA 4PREA 3BPOC 3R8QA 2BHZA 4PJ5A 3DOIA 4U1MA 1CLYL 1JD7A 5A43C 4KMLB 1GHFH 5I8KH 2HFTA 2WXGA 5IFAH 1CLOL 2HVKA 2XN9E 1KN2L 1MJ8H 1Z9NA 2E7DA 4AW4A 4P07A 3VAEA 3BWUF 1FHNA 4B5EA 4F3FB 3D2UD 1PY9A 4Z7UE 3BP6B 4LSSL 4KH2A 5DVPA 1FWXA 2AK4B 3HMWL 3SGDI 2XZZA 1X7QB 2WLMA 2W59A 1OM3L 3WIHH 4QLWA 1SF5A 3B9KD 4EI5B 4KKQA 4MA3A 5DMGD 3FONA 5CHNA 1OPOA 1G7LA 3TCLA 3P3SA 4GSQA 4JHBA 3L3IB 1L6XA 2VB5A 4LVOC 1ZE3H 1AGDA 3IFPA 3KPMA 3GGWA 5F6HJ 1KGUA 3WJJC 2PCYA 1MJJA 3T2PA 4EBQH 5FOBA 4HYTB 3G08A 1NGZA 2A9NL 4ZSOA 5LQBL 2P5ED 1AZRA 4Z5RB 3GSWA 1MCDA 1MW2A 5SWZB 3T3PF 2OCCB 4MBRA 1TPXB 4E9SA 3EKCA 1ET8A 4CKQA 2MKWA 2WSDA 3GKWH 4NN5C 1NUDA 2FJHB 4U6HB 4F7EA 3BKYL 1NIDA 4NAMA 1EIBA 4QDGA 3E6FB 1FIEA 3ESPA 2VZ3A 1I1AC 2FGWL 2W8CA 1CFSB 3Q6FB 1MNUH 1WYJA 4LZKA 4OU3A 4AUUA 4BH8B 2ATKB 1JPST 1SYVA 1QPXA 3PY9A 5DUPH 1ZGLP 3HMXH 3EZ8A 1XMEB 4OT1H 2APFA 4XMLH 1G7PA 1V3MA 2AEPH 2I9TA 1QPPA 1KNOB 3OHXC 4L23A 3BIKB 3FQNA 1RZGB 4RZKA 2JKWA 4PI0A 2Z1KA 4LLQB 1OTSD 2D9CA 4XBMA 4GG8A 3TCTA 1UXLA 4M1GL 1M7UA 5TE7L 4N0UE 3QDAA 1IZJA 3EJZD 4XO8A 3UO8B 3II1A 3QISA 4ZMYA 4F2FA 1IE5A 2NY0D 4J6RH 5C9KA 4A1RA 4AM0Q 1R47A 2QJDA 3GFUA 3VFUA 2WVSA 4FYRA 3NABL 2C8NA 4R96A 4KHTH 1G87A 2XYBA 2F8VA 1JZEA 3Q8FA 4Z78A 5IREA 1S7WB 3CK0H 3ENEA 4XNUL 4ZTEA 1CS6A 3T8MA 4N6RA 5IF0A 4KI1A 2VISA 2WXOA 1XZ0A 3ECBB 3U9WA 2CUIA 2W9EH 1SEBB 4L1DA 2VLLB 4MB5A 1MNNA 1KLUA 4TULH 1P7QD 4J4PD 4XTRC 5D1XE 3BEVA 5DRZA 3HN8A 5IB1B 3MV8D 4QRPD 3DIFA 3HC0B 5ILTL 4H20H 4MJIA 2EVIA 4LP5A 3A4AA 3BAJA 5D2NA 3ZBMA 5IP4A 1A9BA 1U8MB 1FO0L 2O61A 1QACA 3KLQA 5FKPB 1KXVA 2YLKA 1I8KB 2WZ6A 3MQIA 2DL2A 2QMKA 3OB0K 2YGQA 5DYOB 3QULB 4XNXL 3D0LB 4YH6A 5HYFA 4W9JC 1X9UA 4MHHG 2ZWZA 4HLJA 2GUOB 2Z92A 5I1CL 1S7SB 4LAJH 4UMGA 43C9A 4PJ5D 2WLIA 3SDXA 3WFHA 4ABWA 2XHNA 3DX7B 2WD0A 3QZWB 1NBVL 4OIIL 3STBA 4AVIA 1BYNA 3BUYA 5D1QA 2H0FA 3Q7JA 5T5FL 1KGWA 3BE1H 4TSCL 4KVPA 4OZHF 4FFZL 1DVUA 5AUMB 1BQLL 1CWVA 2E75C 1N64L 4OQ1A 3HHMA 1PW3A 4L8SB 1MFDH 1E8WA 5DF0A 1X5XA 5FO2A 3WEOA 5JW4R 3QWQB 5FWQA 3HFMH 3RWCA 1S7TB 5CFAA 1AZZC 4LGRB 1DLFH 1FZMA 4PGDB 3IKKA 2FHBA 3WS6A 3D25A 2X10A 4N8CL 1YY8B 5EZJA 4BXSV 1TZOA 2B4CC 1MCEA 2CLVB 3CSBA 4UU9A 3LZRA 2LE9A 4FTVB 5CLXA 3GSOA 5GGSA 3RFZA 5FA4B 5EEUA 1UACL 1JPTH 1MZYA 3K4DA 4N9GA 4R84A 2AJSL 3VYNA 3V0DA 5IUCA 2HUHA 4Q89A 4XCNA 4X9HA 2EYTB 2AJYH 3BSGA 4R0LC 5AVSB 1EANA 1TZAA 4P9HC 5GISH 4FYQA 4NM8H 1A8JH 4XVSL 5DD6A 5IJVA 3VXPA 2X40A 3TNNA 5AW4B 5FYJH 2AEQL 4GP5B 2YRPA 4AQOA 2YK1H 2NYYC 4TUJA 3VVVA 15C8H 1KLGA 1QNZH 2NY0B 2ORBL 1P6WA 1AP2A 3ZLQC 5BCAA 1HEZA 4APXB 3S35X 4JQIA 1O7SA 1YN6A 1P1ZB 5IB3A 5IHHA 4KJWC 3ZPDA 5IQOA 3ZHFA 5JMRA 1ZLUH 1JHKH 1IZKA 1F11A 2AK4E 1SOKA 3H8NA 5EOCH 4PJDB 2OZ4H 3SKOA 2FB4L 4NFCA 4W70A 5E95B 3WKML 3WO4C 4MX7B 5GGVY 2I7OA 4JZOA 5LXGH 1L3NA 3FKUS 3G5YB 4MA1C 5K9QG 4MZIA 2CDEA 3AWEA 1JDDA 4G43A 3IDXH 3VD7A 1P7QB 1RZPA 3ZRCC 3MV8B 4QRPB 1I7UB 2H2SD 2PPEA 3K7UA 1MWAA 1Z9LA 5CZVL 4M6NH 3GT6A 1ZLSL 3TX4A 1UXWA 1NL0L 4HS8H 4XCEA 3DA0A 1EFXA 3PPSA 2EDEA 4O02H 3VD5A 5HYJA 1CU4H 4Y4HA 5SWZE 1J9RA 1IBGH 1RUML 1TKWB 3S37X 4F7TB 3SYPA 4JO1H 5JOFB 3WTTA 1NPJA 2BZCA 4K7FA 1E2ZA 4PV8B 5KSUB 2HN7A 1LJMA 4Y4KA 4CADB 1F58H 4XO4A 3BD4A 1TZGH 3RL1B 4KGLA 2CLRB 1IJNA 3OSKA 3PF2A 1KZYA 1Z5LA 4PREB 3FRPG 3QJFA 3THMH 3VU2A 5LVEA 1AXTL 3UMNA 4MJID 2ZJSH 4N68A 4YDKH 5HHOB 5EBWA 1WC7A 4XN9A 5JHDA 4M29A 2C3XA 2O6DA 3MLWH 5HDQH 3FUFA 4Q0XH 4Z0BL 4YC2B 5GS3A 4AGMA 2AK1L 3LN4A 3QPQC 4P2OB 1YRKA 5DFAA 1QEWA 3TYGH 4WI4A 1MAKA 3QWOA 3QZMA 4RESB 1MJ7L 1PNDA 3ULUE 3BRDA 4MRCA 5SX4H 2B77A 1U8NB 4P4KC 2H26A 4OFVA 2N4IA 1JFHA 4MXWL 5GS2D 1FF5A 1U58A 4HWEL 4G6KH 5CHNB 1G7LB 5DQJB 5FYJE 2GTQA 1KIRA 1BBDL 3BKCH 3VGFA 5DZLA 1WZ1L 4ONOA 3WDHA 4B7LA 4YGAB 3IFPB 4CVXB 1OARL 3EFOB 3GGWB 1TETH 2XZQH 3R0MA 3UBHA 4GIPD 3EYVA 3S88L 2E9JA 1LEKA 4CBZA 1F41A 4QHUA 4HWNA 2FHFA 3SGKC 5B21A 5I1KL 5AG9A 1S7UA 1IAKA 3IU4L 4Z8FH 3GSWB 3GXPA 4NQEA 4MS8D 4BFEA 3OZKA 1ZVHA 4MGXA 3V0AC 5DJZA 1YYCA 2HRGA 1RUAH 3RVVD 3SGEI 3GBLA 4XVTH 4OZ4A 5C07A 5IVZB 5IJKC 1AS8A 5PCYA 2IQ9L 2IEPA 3IGKA 4KJPC 2GIYA 4PBDA 5I1DB 1AH1A 2VJXA 3MLZL 3QPXH 1G4MA 3GB7B 3I75A 3V7MA 3UDWC 2P5WB 4KQ4L 5IW6A 3ZTEA 3AGVA 4ESKA 4ENEC 2GT9A 1INEL 1BLIA 3MFFA 3RI5K 1DSFH 1HXMB 4MAUL 4F5CA 1G7PB 4E9YA 3DBXB 2I9TB 1T89A 1YNLH 2AGJH 3FQNB 3RJDA 3SYQA 2I60H 2E3VA 5HI3C 1TFHA 4WSGA 2PP7A 1IBYA 4G80A 8PAZA 2XQYK 4FEIA 4JDVA 5D7KD 2P80A 1ZTXH 1G4RA 1NKRA 5HI4D 2ZCKL 4NJAL 4R96B 4ZUSA 4ZNEE 3QNYA 4RWYH 1U2HA 4N5UA 1RZKH 4FZEL 3KBFA 2WYTA 4MNQB 3MCG1 5CKAA 2AXFA 1NAKH 1B3JA 1AKJA 1HH9B 1CLZL 2AZAA 3O3DB 4TUKH 1KLUB 2QKIA 3BEVB 4HAFA 1IKNC 1ZS2A 4YUEH 3HI6H 1NIBA 1I3RA 2HT3C 4MJIB 4RGOH 4FTVE 3QIWD 1MHEA 2BRQA 1U95A 3VDCA 1A9BB 1D9KB 2Q20A 3N50A 3IJYA 3HE7A 2HJFB 1OOWA 5JR1H 2O61B 1JV5B 1RIUL 3HE6B 1EFXD 4ELMA 4OJFL 4Y4HD 4XMUA 4ZAKA 1XGQB 4K73A 3KM2A 1SOXA 3FHEA 1M7IB 4QHPA 1LDPL 3PXHA 1M9WA 2NPLX 4GPVA 4Y4KD 4HUVA 5AVUB 3CPUA 3QHTC 2QVMA 1HOEA 2F7IA 2X4TA 1J18A 2WLIB 3E1F1 3SDXB 3WFHB 1WPCA 4WRLA 1OP4A 4F2MA 4OFKA 5JHDD 4YHPB 4MJ6A 1EA9C 2WXPA 3S96B 2DH2A 1GYCA 5FWRA 5IKCA 1LWHA 1V7NL 4KUZL 1HL8A 2GIXA 4FKHA 2C9AA 4QOKB 3BN9C 4PVNA 3S3CB 3SZ6A 2LLLA 3FTVA 2JB5L 2FX7L 4U1IB 4HZAA 4PJDE 3AU0A 5BVPH 4S1RL 4HK3J 1DE4A 4OLVL 2G0LA 4GAGL 2G60L 3OAZK 4L1TA 4PN6A 3QQXA 4KNSA 1QR4A 3DTXB 4ERSH 2VLRA 4LRIA 3D25B 3QXDA 4MJ2A 1K4CA 3MV8E 3MGAA 4QRPE 5IR1A 2W92A 1FYHB 3PP4H 5DWUH 5D93C 4ZFFB 1VACB 4WU7A 1ORQB 2OQJB 3V5DA 5T3ZD 2FEEL 3KL5A 1NOLA 1VGEH 3GSOB 4U3HA 3QUMB 4N0RA 4Y7MA 1YCSA 3CE1A 4XHQA 3RWEA 1UWEL 4IIQC 3JYCA 4ZMLA 5F7HA 1U42A 1VEMA 3IN2A 3BPNC 4N2OA 4AENA 1H3VA 2JH2A 25C8H 5INCA 3TL5A 3DVNA 2FK9A 3N3EA 1BBJA 4MCZA 4X7SH 5C07D 3VW3H 1TQCC 5C0EA 2AJUH 3FXIC 5HHOE 5DFTA 3KLKA 2XJKA 4WFFD 1A64A 1YO4A 1T20A 3ZE0B 4X2UA 4Q74A 2YSSB 4TUJB 3UZEC 5AVXB 3QR0A 5EEYA 4PEEA 1DVFC 4I77L 3ULVD 3G9AB 2QFPA 5CEXA 1AP2B 3O3AA 1CD1B 1HEZB 3O2DA 5ICZA 3UZVA 5C0RH 4I3RH 2R23B 3W1ZA 1S8DA 3RWHA 2UY6A 4GG6B 3CX5K 3MBEA 4WNQB 1J0ZA 2VZUA 1CFQB 3FAXA 3F12A 3VFOA 5J6GA 2X89A 2VRKA 4OZFB 4O00A 4G43B 1YJDC 1T0MA 4LGPB 3B9DA 5GRVL 1LE9A 5HDRA 2B8OT 4HKXB 5A2CA 8CGTA 2P80D 4F58L 5DJ6A 3QIWB 4BRJA 3L3JA 2A0LD 3MCLH 1UXWB 4OR1A 4XCEB 2LVEA 3L4UA 3SQRA 1NDGA 3LHPL 4JGMA 2VUYA 4ONGH 1THCA 4RX4A 2ENYA 2QELA 1PCSA 1MG3C 1HHJA 1AKJD 2DD8H 5CIPH 3WAKA 5SWSA 2HN7B 3JT0A 3I9IA 3IDMB 1FFTB 3DIDA 5FYLL 3U9UB 2P7TB 2LVCA 3GIVB 3QJFB 1OE2A 2XFXB 1U8JB 2FUTA 4ZMWA 1SM3L 2OSWA 2NY5C 1WC7B 1WS8A 4AZ8A 2P5WE 5JHDB 1UG9A 3HE7D 3QEUA 4YFDB 3O6MH 4ZAKD 4CDHA 1KBGL 3M1OA 2DKMA 3QWOB 4Z1PA 4OGAD 5LBVA 2NY6D 4U0RB 1BLNB 3RIAK 5AB1A 2EUVA 3FQXA 2H26B 2VMFA 3VTTA 2I69A 5E4AA 3M8OH 3SE9L 4IRJC 3QUMH 5CU5A 1C7TA 2OYKA 3SE4C 5JHLH 4Q7DA 5T1DL 1JGUL 1E3XA 2N01B 2ZPKH 2BY3A 4KU1A 5C6PB 3H1ZA 3PPEA 3QUXC 4YLBA 1S9WB 1S7UB 3GF8A 1OM9A 1AE6L 2DWYA 1PLAA 4MNQE 3ARFA 2DQTL 1GXEA 1IILE 2VLRD 4NUQA 4Y16C 5C07B 3WEXA 5J13C 1VB9A 1CURA 1H5BC 2QT6A 4MJIE 5I75B 1U2YA 4PTUA 5TQ0H 1CYWA 2EO7A 2R9HD 2Z0UA 3Q6GH 2HB0A 5TF1H 4BZ1H 4PJGF 5ABZA 4M1CD 6FABL 5IW6B 1BM3H 1FLRL 2QTVA 4FMFA 1W8EA 4RMTA 2D9QB 3B56A 4AIZA 3P4OA 3D0VB 1NCBL 4EQ2A 2GJ6A 3DPDA 4QTIL 5K93A 3SDAC 2BNUB 5CUSH 3MUZ1 3VD1A 3ZRFC 4OZFH 3OXRA 4FLRA 3SDXE 3PYCA 1BOGA 12E8H 2PYFB 3JV6A 1K85A 2QSQA 1EZVY 3SE6A 5A3ID 3QQ9C 4KROC 1EEZA 3SD5A 5I19L 3A4EA 2WQSA 3L4WA 1CYGA 5F8QC 3AY4A 3RX7A 3OXSA 1CK0H 1JXJA 1ND0A 3P69A 4XHJC 4QOKE 4ZW5A 3T3PB 3BO8A 4NNXA 5AAMC 1KIQA 3JTSA 1L9MA 4X6CA 2OS7A 2J4WL 4JG0L 3GRGA 1P7BA 1FJ1A 3ARVA 4YO0A 2VKXA 1MAMH 3MBED 3PGCA 1NCAH 3FCSA 1J0HA 2X89D 3OKMB 1YSOA 5DD0L 5IB2B 1WTLA 1T7XA 2COVD 4GBXA 1KIPB 1HI6A 1NMCB 3ZKXC 1A7PL 1I3RB 1EEUA 2YARA 3A6OA 4Z77B 2VITA 4F92B 1OP9A 4KRMB 1NCWH 3TT1H 1VFUA 2VQUA 4WHTA 4ZAKB 2JCCA 2MCG1 1BG1A 2D2OA 4RX4D 3V4VL 4GT7A 3GIZL 2A1WL 4CN6A 2ZCLH 5SWSD 1PDKB 4OFPA 2AERT 4YSCA 4U2YA 1IGYA 2XPGB 4POYA 5EEXA 2UVEA 2E9GA 4F9PA 4DN3L 2QSCH 4ZS6D 5T1LB 3ZT6A 4ZMTA 5CF3A 1MY5A 3ZE0E 5DS8A 3TJEH 3ZMRA 1GSKA 1LGVA 4MJ6B 2WWKO 2WB1A 2QR0B 3LNEA 3LPFA 5I18H 3Q2CA 4ZUTA 2Q0ZX 2TRYA 4YHIB 4WKZB 3KR3L 3GSXA 2J20A 2Y36H 5HJGA 4XP9L 3NCBB 1YEKH 1WIPA 1XXFC 1DJSA 2YAPA 5GSRA 4RRPG 4GG6E 3TN0A 3FFDA 3B8SA 3SKJL 1NCNA 2UY7A 3EO1A 1BHGA 1B4JH 1KCSH 2EDLA 4IW4C 1VFBA 2WW8A 5CBAA 3AM8A 3VQLA 1BX2A 5E6UB 2H45A 1PG7X 2ZKWA 2WXHA 2VLRB 5ITFB 1C5CL 3EJYD 3EFFA 3VMPA 1KPVB 5I73B 1X5ZA 1WZLA 3GXDA 3OMIB 4KVCL 4E5XB 4BQBA 4DT2A 1RK0B 3KS0H 2C5DC 3GPEA 3QCUH 3RWEB 1DLHB 3EDEA 2Z31B 1GS8A 3FU9A 3NBNA 2G9KA 2ITCA 5HYEA 4M3KB 2OMXA 3PXJA 3ARFD 1MRCH 4J3XA 3VNZA 2F8IA 1J48A 4RETB 4YSDA 1BEXA 4P23A 3BCFA 7PAZA 3MC0A 4RISL 2VLME 4YQXH 4L3FA 1AXSB 2GW5A 4LP8A 2BIMA 3HZKB 1DQDH 5JHDE 2AXHA 4FYSA 2R2CA 3CGTA 4B50A 3U0PB 4U1GB 5F71A 3T8XA 1MJ8L 4DK5A 4UANA 1JF5A 4S1DC 2GJJA 4ZQTA 1JZHA 2D4DA 5C0NC 1BZ9A 1UJ3C 4K8RC 3DOSA 2GJ6D 1EO7A 1E4KC 1VADA 2BNQA 4K4KA 3FO9A 4W6YB 2UY6B 3WIHL 5EPMA 3MBEB 2NNAA 5J9PA 4JRFA 1OKEA 4OCNC 4AV5A 4CU8A 1GAFH 5D4JA 2L4OA 3WG7B 4F7PA 4UQIM 4YK4B 4D8PA 5HYQA 3KGTA 4YNYB 3PV6A 1TQBB 3SDCA 5CP3H 5HPOA 2VRQA 4EBQL 4XN1A 1FNSH 3IAQA 3ESUF 4M6MH 4P3CH 4YGVA 4ABUA 4RAUA 5T3ZE 3L9YA 5EN2A 2B14A 1WAEA 1SUHA 2J44A 3BD5A 3JV5A 1UKQA 3TGXA 4AC4A 4GMSL 4APQA 2YN3A 4FXGA 4HIQA 4XX1E 2P43B 1KGIA 5EBGA 3GKWL 3Q05A 3B37A 1HHJB 1V3JA 3WTYA 4ORGA 5C07E 4BIKA 3MLUH 1U8QB 4GBXD 3KWUA 3EYUH 3RPIA 2HX9A 1BREA 1AZUA 4X6BA 3T2QA 5D8JH 4MVBD 2EXWD 4JN1H 4R2GD 3GXUB 3U4EA 3QEUB 5DUPL 1JNJA 3HMXL 3EIFA 4XMLL 3RDTC 5DJXB 2DQEL 2AEPL 5I71C 3CFIC 2YPVH 1KEMH 2LLGA 1WUZA 3KPOB 4IYKA 4FQLH 3RY5A 3B43A 2FNWA 2YC1A 4HT1H 2W5PA 4B96A 3MNMA 4KX8A 4WGKA 4Y8DC 5CWSA 2JI1A 4JFXB 2PWGA 4TNGA 1XSOA 3QDMA 2FIRT 2FDBP 2X7LA 1FORL 2DM4A 3QS2A 1ACYH 2H6PA 2XNAA 4NX0A 5AQ0A 2J2ZA 4KHTL 1UADC 1YQVL 3D6GA 3NTCL 3T3PE 5DR5H 1KGJA 3NG5A 3OQRA 2LR4A 2JTDA 4M8VA 1ZLWH 2R0WH 5DC2A 3CK0L 1U93B 1Q94A 2ED7A 3FCGA 3POHA 5I1EH 1EHLL 3T5WA 3ME0B 3TN0D 1I9IL 2F2HA 3EOAA 4UTAA 2G4EA 4MAYC 2CJTA 5DI8B 3PFUA 1P5UB 4G5ZH 3VWKC 1XCXA 3HBPA 1MFBH 4H20L 4OFQA 1PEZA 1MCNA 2A6IA 3D4GA 4G9DB 1DVQA 3IXTA 4JG1H 4PJEF 4CVZA 5DDHA 1LMIA 2FEJA 1H15A 4QHLA 4I18A 1T7YA 1UEMA 4EN2A 1XF5A 1OP3K 3X1NA 1TYEB 4AE1A 3QC5X 5HGAB 3N44B 4R7NA 3RGVA 2PN5A 3ILPA 4NO0A 5GGTH 4AIZB 3P4OB 1FL3A 5F3BB 2N1KA 4E9WA 4XVUC 1H3UA 3EHBD 2F0CA 4OW6A 4P23D 2AFNA 3VSVA 3OL2A 3T1FA 3GXIA 3LQAC 3DV6B 4DKEH 3EOYG 3FBKA 3L5WB 4L37B 1QEXA 3EBIA 3QXWA 3EDJA 4PY8I 2BINA 1JZ5A 1BV8A 3K72B 4RMUA 5L0QB 3C6SB 4E68A 4UQAA 5AD0A 4HSAC 4JKLA 3CFDA 1ND0B 3EFDH 4LPTA 1Z7JA 2CJ3A 1JUFA 4I13B 3AT0A 1I8AA 4JG5A 4J8QA 1KIQB 1NFKA 4X6CB 3QHZH 4TKWA 5F88B 3SJVB 1T2QH 2HLAA 2WIMA 4KV5F 1DLFL 4K5LA 5AW8B 5AYQA 2OPCA 3PGCB 3D30A 1SXCA 1JFQL 3JXAA 4XWOD 2VLRE 4JRYA 1ZXKA 1RUKH 1W6WA 2CIIA 2YGVA 5CJQH 2ARJQ 4LHUA 1M7DB 1MVUA 3SDCD 3PUCA 3ET9F 1DBJH 2DWTA 2HYMA 1ZLVK 4GRMA 1JIBA 1G9MH 3G6AA 5FGRA 1NH6A 1JPTL 2NCEA 3CHSA 1VFAB 2B1AH 4GYBA 4X6EA 4JHAH 4R2GB 2K4AA 4W9ZA 1JF1A 1KENH 3FOMA 4PGZA 4JLRB 3MJGX 4APQD 1NBCA 2JCCB 1HXYB 1MFAL 2E9WA 1QLEL 3QEQB 4GKOA 5GISL 1S7RA 4DF9A 2FBOJ 4NM8L 1JYWA 3QZPA 4EKJA 4ZMQA 1F4AA 2KLTA 1XGZA 1I3GH 2FUQA 1FFRA 3IN0A 4IEFA 2N3JA 2Q5BA 5FFGA 4JPVL 5K1NA 2YK1L 3QARA 4P5MA 5EF0A 15C8L 1KGCE 1BQUA 1TIUA 1QNZL 3QEGH 4FI7A 3K8LA 3L1OH 2P28B 4EPSA 2IH9A 2KQMA 3L1EA 1CDUA 2A99A 4ZQKA 1I82A 2OZ4L 3MBWA 3TJHD 1FYTA 2VKWA 1JERA 3DO3A 5GSRB 3TN0B 1TVDA 1X7SA 3EO1B 4HUMB 3TZVB 2E0PA 3MA9H 3MCKB 3VSUA 1YPZA 4ZO9A 2VR7A 3IDXL 1XR8A 4AH2A 1HJBC 2R29A 3QDMD 3SYCA 3TEYA 4OCSH 2IAMB 1FRGH 1Q9LA 1T83A 2VE6A 4ZPVA 5CZRA 3EFFB 3EH2A 4M6NL 4NI6A 1EZVX 2OMVA 4AQEA 3BAEH 3UP6A 3EJJX 1HTYA 4O02L 5FFOA 1CU4L 1IBGL 4JM2A 1L7TH 4EDWL 5FFLA 1PLGL 2B08A 2YD0A 1AIFA 5K59F 3BUIA 3ZK0A 3GSRA 3UBXG 3AADB 1F58L 4OKVA 1TZGL 1BVKB 1NCJA 3EHBB 5H37A 3LCYA 3LRKA 4Y19B 4MJHA 1SY6H 2ZJSL 4YDKL 2D7OA 2BH0A 3PL6B 4PG2A 1AJ7H 3AITA 4N2LA 1CXKA 1B0WA 3CZEA 3MLWL 3KDPB 3CN0A 3B7YA 5CEYA 1E6OL 1ITCA 2J56A 5AOLA 4XOBA 3T8XB 4RRPA 3ATDA 1ZVNA 1YAIA 3RGVD 1I7TA 4KZ0A 4UQDA 1UA7A 4NO0D 4WAFA 1QLFB 3JWOH 3V52H 4XPBH 1ANUA 4AXWB 4TF4A 2R2BB 4EKXA 4GSXA 4M5SA 3FO9B 4U1HA 5E2UH 4B9CA 5KEZA 5EPMB 4AUJA 1DHKA 4N9OB 2NNAB 1ZE3C 5J9PB 1JK9B 1MN4A 4ODSH 4U33A 4G6KL 2BIPA 3BH8A 3HBZA 3BKCL 3TBSB 3P0VH 1OVZA 2YXWA 4WTXA 1Z6JT 1VJSA 3CU7A 3PV6B 1TETL 2J6EA 4IRZH 4KY1H 4TNVK 2VNCA 1E9QA 5EN2B 1YYMH 5FM8A 4UINH 4Q9QL 4WEUD 5JIMA 4QRTB 1NCOA 3IF1B 3VXSB 1UGKA 2DS4A 3H6JA 2K3TA 1WCBA 4APQB 1RUAL 4FXGB 2XV0A 3L4CA 4XVTL 1A1OB 4PRIA 4JRYD 1G6RL 5J1AA 3ZW3A 3I6KB 4LHUD 4WFHD 2A6KA 4JY4A 4U1LA 1NC2A 4Y5YA 3OJDA 3HVNA 3RWFB 4ZFOL 4PJAA 3RPIB 4C59B 2R0LH 4D9RE 2WLLB 3VE0A 1MDTA 1XXDC 2DWSA 4LAQH 3HZMA 1E4HA 5LBSL 3SOTA 2Z7ZA 2X3AA 3K6IA 4CJ0A 3U4EB 3KYOA 3MNVB 5C3LD 3FFCB 4JPWH 3ERXA 5IHZB 1FV1A 1NGQH 3GSVA 1UKSA 1DSFL 2HTKD 5C92A 2ICEA 4B27A 3K6OA 4KKCD 1FIGH 1WGVA 2OI9B 3PAVA 4MMZC 2I60L 4A67A 2YC1B 2ZCHL 3NACL 3UL4A 1DVZA 1MFCH 1S9VA 4QHKI 1E4JA 1EQWA 5GSVB 3L3HA 4AQAA 4Y2DC 4O9HL 1F3RB 4AYDC 3RG1C 4PJBB 1ZTXL 4QT5A 4XOCA 2J2ZB 3B2DC 4B0MM 1T2XA 1PZ5A 3MUGB 4BFGA 2PCPB 4JZNA 4RWYL 1WEJH 1WT5C 3RUGA 1GPOH 4O58H 4X6CE 1FYTD 1S5IH 3SJVE 4GUCA 3AVEA 4EAEA 2P24B 2ATPA 4BFNA 4BRVA 5K9KA 3B2MA 1B2YA 2OX5A 3HAEB 4TUKL 2VN5A 4ZFGH 5C9JA 4JY6B 4YUEL 3N43B 4J6IA 2OJZH 3HI6L 5FO9A 3WJMA 5DS1A 1OW0A 2A6IB 3QEHB 4NQTA 4RGOL 3DHUA 4AYSA 2OLDA 4L4VA 4YIQA 5I5RA 3MODH 3DX9A 3IAPA 4LK4A 4QHLB 4I18B 5JR1L 2HLFC 2X0UA 4HUWA 1LILA 4ODUA 1H6EA 2AQPA 4ZT1A 3TLRA 1EV2E 1ZV2A 4JM2D 3VM5A 1M53A 5F2FA 4EI5C 4R7NB 5J1TC 3VRIB 4DUWA 2JCCE 3JSSA 1Z9MA 3QEQE 2CR3A 1S5HA 4NO0B 1EO8H 3QXAA 2ZG3A 3ZN6A 4JKKA 4AMXA 1FL3B 1HILA 3KHOA 4OD3H 2J1XA 1TQWA 1GW6A 1AG0A 3UJTL 2JSFA 5DUBA 5D7LD 2J1WA 3QA3A 4LNVA 3U46A 1FVEA 2KZKA 2XKUA 1EUTA 3PNWA 2WIIB 3QJRB 4ENED 1OWRM 1MWOA 1TPXC 5CLZA 5L8KB 2GC7C 1SVZA 4FNRA 3TTSA 5AD0B 1PZDA 5DD3H 3CFDB 3IKCA 4AKPA 1A3QA 5BVPL 4XXWC 3V10A 4PGJA 4ANUA 3AXLA 3DK0A 4GRWB 5E6YA 2IQAA 1Z32X 3BT0A 4NDMA 4ZZFA 4PJ9C 2HKHH 2VM4A 3CN4A 4Y88A 1WAAF 1IC4H 1Z5YD 2BXZA 2J6WA 3SY0B 4UNTA 2CIIB 3IU3A 5DWUL 1RL1A 4LHUB 4PJGB 2AQRA 3UFIA 4DN4L 4Z7AA 1E3FA 4LF3B 1SZNA 4JFVA 1VGEL 4GRMB 4YL9A 1AQHA 3Q5OA 3ULUC 1BVNP 3AMLA 2BS8A 5BZZA 2IDTA 4OLYH 4KJYA 4M7ZB 3PWJA 3L5XH 4PRDA 1WS7A 5IZ7A 1G7MA 1S7RB 5E23A 1KJ2B 3O3EB 4R90L 1QHQA 2ZKHL 2XXFA 4PRID 2NQ3A 4Y19E 3LEYH 2AJUL 2DWDA 4XN2A 1YY9D 3WJLA 2YD2A 1UXMA 1A0QH 3BVTA 3ULSB 1NC2D 1E27A 1AZNA 1UB6A 3BLPX 4ZUVB 3QCVL 2CO2A 1MG2C 4P5RA 2WGNB 1CTMA 2AKRB 4F9LC 3LRGA 2R0ZH 1MH5A 3HLKA 4XI5D 5C09A 4E41A 4GQQA 3DRQB 4I3RL 1TR7A 4YDLB 5E6RB 5MENA 1B9ZA 2V2XA 1J1XH 4TNWF 2A9BA 3R0NA 4ZQKB 3OB8A 3HAEH 3MBWB 5JXEA 5ANMA 3OKOA 4HZLA 4ZNCD 3AXIA 3LB6C 1HU8A 1GVIA 2ZWNA 3FUHA 2B5IB 3M1CA 4HLZG 4DPBX 2KBGA 1YPZB 4XCYB 3LKOA 3TXAA 3E6HA 3VI3A 1Q9LB 4ZPVB 3D85A 4U3SB 1R5WA 2VDOB 3ZSTA 1G1KA 2OMVB 3A0OA 1HK6A 4HJGA 2O72A 3GXFA 1OQOA 1XH1A 4LKXA 5FXCH 2VXQH 3KYMA 3VXSE 4JM2B 1JGEA 5EU3B 4KUCF 2ADYA 5D7EA 3ZJAA 2DD8L 2EO9A 4V2CB 1CD0A 3TBTA 3GSRB 1GY2A 1BJ8A 2A4ZA 2LU7A 2X4OA 4OKVB 2EH8L 4C54A 2Q86B 3WL9B 4LB8A 5D7LB 1W16A 4K71B 3QRGH 4L8SC 4L4VD 2ZWSA 3BW9B 3IMBA 3WI9A 1RD6A 1FHGA 1X5KA 1JXFA 3KPPB 4J3OD 3A4DA 1UATA 4IMKA 1N9PA 3FFCE 1IGFH 4FMVA 1NCIA 2OMTB 1O75A 1I7TB 1A3RL 5H35B 1WWWX 4P4RB 4GW4B 3QAQA 1KXHA 3RJOA 1BZEA 4BKTC 2ZF9A 1CG9A 4LVNB 4WTWA 4X9IA 4AYEC 1FPTH 4JS7A 4U1HB 4JN2B 3CZNA 4XN4A 3M8OL 1AO7A 4R5XA 5EU7E 3SYOA 3Q48A 1CL7I 4G3YH 4PJBE 4A2HA 5JQHC 1CFMA 5EDXA 4UNIA 3ULVF 5DEZA 3ZE2B 3N55A 2ZPKL 1VRSA 3Q2VA 5CS7A 1E9QB 1LK3L 2P8MA 1AQKH 1V7MH 1HL5A 1OTSC 2QV4A 1KJ2H 3BN3B 3EW3B 5C7XL 2NW3A 1OSPL 4EF3A 1WCBB 2Z3FA 5DFVC 4WI2A 3QUGA 1T4KB 1DTUA 3OKDB 2WLJA 4JHVA 2CHDA 1PX8A 1HYSD 1PIFA 1M2VA 4XP1H 4KTDL 5J1AB 2GITB 4H0GA 1OCWH 1JCKA 3I9GH 4W4OC 1O0VA 4NPYA 4IS6B 2ED6A 2ODHA 4OZGA 2IXQA 5TQ0L 1G1OA 3T2NL 4BUHA 5IOPB 5TF1L 4A37A 2XRAH 4QYOA 4AMWA 2GSGA 4I0PB 4HCGA 4RMSA 4KNTA 2H1XA 1BM3L 4KKLC 1ES0A 2ENQA 1FNAA 2C1PA 2HRPH 3JBG7 4HK0A 4PD4J 5E2WL 2VDPB 1FV1B 5JTWA 4YXLH 1M6OB 4I87A 4UV7L 5JUEL 3CDZA 2ICEB 1WE5A 2YLHA 2ZKMX 4ZRGA 3K80A 3NSYA 4I9WD 3UYRH 3CVHA 3U36A 12E8L 1QI4A 2ZSWB 1R3LB 1I8LC 4LQ1A 1GIGH 1Q72H 4DPCX 5I15H 5IM7B 4HETA 5FUOH 4ELMF 4JPKH 4DPRA 3FUMA 5ANHA 1RZKC 2MJWA 3D52A 3TIDA 5B4MC 5FB8B 4E41D 3GKZA 4JZNB 2VM3A 1FFNB 5I8CA 1N68A 4GRWE 1RJZA 2YEZB 1A6TB 5ENWB 5JXED 3RY6A 4HOZA 3UC2A 1SDAB 1JVLA 1FNFA 1NCAL 2ENPA 4UQCA 4LVHB 2EKSA 5K9KB 5FM5M 4LLWB 4J3BA 2OX5B 1FC2D 5C0GA 4P2OC 1CO1A 4WI7A 4PJGE 3K5RA 1LO2H 3J27A 3ZTJH 1HKLH 3D85D 4JKNA 4JRXA 1ADQH 4YIQB 5BZWA 3DX9B 4ZXBC 5J6SA 2IH8A 4A2FA 4FG4A 2JNZA 4XXCA 1YEFH 2BS9A 4JFOA 4BH7B 3IDUA 2VSCA 1SRDA 3QK0A 3FO0H 3PV7A 5BS0A 4I48A 1S5HB 2V3DA 1RLBA 3NAAH 1F5WA 2ZCLL 3GSNB 4TQIA 4FQIH 1EJOH 1TMQA 3G5XA 2QSCL 4HK3N 3TF7C 2A6JA 2A9MH 3UP1A 3FNKA 1OEZW 4P05A 1L9RA 2EC9T 1IBFA 5AW6B 4QRBA 3FT2A 2YAOA 2R1YB 2WAHA 4UF7C 4H4NA 4XODA 1M9SA 1TYRA 4M5YH 4O51A 2JXMA 3IKCB 4AJ0A 2APBA 3U1PA 1S46A 3LKRA 4RA3A 3GHPA 1AHWB 3LN5B 2EDQA 3P30L 5C0BA 4R4ND 1KCSL 3DO7A 1ID5I 2Y5TB 4PJEB 3WY2A 1YPZE 1OT1A 3NZ8B 1J9SA 1HINH 4FQXB 2CM6A 4AJWA 4GNKB 1AO7D 5DD5H 2YD7A 3EYFA 2J5WA 2EDKA 4M8QB 3DROA 2C7FA 5TF0A 1NCGA 1NFIA 3EOBA 5F7EH 3ZDZB 3QCUL 4MCYB 3WMQA 1SJVA 3R06A 3TU6A 3VGDA 2IDUA 4KJYB 3ESMA 1MLCA 2BERA 2JK5B 3PWJB 1R34A 1QI5A 2JKRM 1MRCL 3FZUD 4XMZA 2WC7A 1G7MB 1YN7A 4N87A 2W95A 4NUJA 1EHXA 1JBJA 1IBHA 5FUZH 1YEEL 3C5JA 4NKOB 1FGVH 5D7LE 1R3IH 1NGYA 3VH8G 2BY2A 4NBYB 3H42L 3NCCB 1MI5A 1IGJB 3H3PH 1E27B 1KT2A 1F02I 2D4FA 2H3NA 2ZYSA 3AQYA 5DJDA 2MMXA 3K8KA 4WSJA 5G4NA 2YXVA 1CR9H 3J2PA 4L1LA 4PTTA 4A55A 1R0AH 1MH5B 5AVZB 3NCYS 4LLDA 3UPAA 2V7NA 3MYJB 4Q4EA 2X6MA 5DVLA 4A63A 1N18A 5D7JC 2EDJA 5IG7A 2L7EA 2YKLH 3NGBC 4I5BB 4IBQA 4LCIH 5DTFB 4M6AA 4H1LG 1D9KC 2X4RA 5KANI 2CNYA 1GAFL 3HNSH 3HE6C 2K1MA 3O3UN 4PJXA 5E1QA 5JIHA 5FDWB 1G1CA 4M6ML 3ZE2E 5IQMA 1MQKL 1R5WB 4RMVA 3GUTA 1RFDH 4YHOH 3VFWB 1S7QA 1XL6A 1J0KA 1RERA 2GEQA 1TLKA 2JKJA 3S4SG 5DHYA 3CVCA 4LLAA 3GSNH 1JGEB 1K8IA 2UXTA 1B2WL 4BCYA 2BSDA 2QPEB 3M45A 5JORB 3QFJB 1Q9WA 2P47B 3X13A 1SXAA 3MLUL 1AR2A 3TH3T 2GFBA 2ZX9A 1Z9SA 1K2DA 1L0XA 2X6BA 3MBXH 4XVJH 4L18A 1JNHB 4JRXD 1BDYA 4G6AD 5L88H 5DRWB 2WKGA 4JN1L 3CQPA 2XICA 3E8UH 1BIIA 3NESA 3OJVC 2IDQA 1PZUB 4QXVA 3TBWA 1J1OH 1BQRA 2B1HH 4UIMA 2G2RB 1SYSA 2C3HA 2CCWA 5BS0D 4OF3A 2EIKB 3MROA 3O41A 2Q6WB 1DJGA 1KEML 3RZCD 3SHSA 4GMTL 1P2CA 3ARXA 3ZZ1A 4HT1L 4YE0A 1BPVA 2JKXA 4J39A 4ZOAA 3UAFA 2MQ0A 4MA8L 1P4IL 1P53A 2NZ9D 5AOZA 5CD3A 1GJUA 1ACYL 5I74B 4AV0A 4MTMA 2QDVA 3U0TA 1KTJA 5DR5L 5EO1A 4MB3A 2VCOA 3UGUA 2YRLA 1IARB 3HKFA 4FMKA 1NEPA 2EDOA 5I1EL 4RCAA 1N6VA 2YXFA 2CNZA 2YHGA 5C0BD 4EN3D 4NPJA 5B8CB 3R19A 1H3GA 5JLZA 4DTGH 1DN2A 5B1BB 1MFNA 2X38A 1MFBL 4F20A 3O8XA 4OSUH 1KB9J 3VFNA 4PV1C 4NPYB 5HXMA 4OZGB 3X3FL 5F7NC 3FMGH 1KEGH 4JFEB 4QYOB 2GSGB 5IK3A 5KBMA 4X42A 2FBJH 4DO6A 1A9EB 2C1PB 5E8OA 2XTSA 1EZUA 3BCDA 5BOJA 2L04A 3H6AA 4N1HB 3HS9A 3CDZB 4HPYH 4FFTA 2OTPA 4JE0A 4WI9A 3ARGB 2GKIA 3QIWC 4DKEL 2I24N 3BSZA 3CVHB 1I85C 1NDMA 1MI5D 1A6AB 3UPRA 3QDHA 3MRBA 4OQTH 1UWXH 4FADA 3DHMA 1D5BB 1URZA 1Z1WA 1H8NA 2COQA 2V5SA 1I4FB 3DJRA 3F7YA 3PWPB 1UENA 3TIDB 1A1NA 4XRCA 2GTZA 4Y2OB 4QNPE 3A6BH 1PS3A 5I8CB 3QHZL 5E8EB 5FGSA 3BVUA 5EORH 1XTLA 1NINA 2X6AA 5KSAA 5BJTA 4PJEE 3SD2A 3P4NA 4HF5H 1F6AA 2WQVA 3DV4A 5HDBF 1DBJL 3ZKSD 2DF3A 3L17A 1G9ML 4EVNB 1ZVSA 4U0RC 2MPAL 5EH1A 1HCVA 2B1AL 3WS3A 3ZDZE 5GGRA 1XGUA 1IGTA 4JHAL 4OF5A 3RWDB 3W9DA 4DFHA 3QJQB 3RNKB 4OM1H 3QUYA 4JFOB 2CK2A 5BS0B 1ZEAH 3DLQR 4BFRA 2G9HB 3H9ZA 3RZCB 4JKMA 1CTOA 5D96B 4LDLB 1I3GL 4DJMA 4OLXL 4X9FA 5TD4A 4WENB 3FB7A 4YHZL 5E6ZA 5AB2A 4OLZH 3CLEH 4OGXH 3QEGL 5GS0H 1BFVH 1UCBH 3P73A 1SJEB 3FT2B 3L1OL 1UURA 3X2QB 5J7CC 5KW9H 1FDLL 1ZJBA 4O51B 2L0DA 1FA4A 2EIDA 1X3DA 1T2JA 3P77A 5I1LB 2JJSC 1NBZB 3MREB 4GP8B 3LXUX 4NT6A 2OA9A 3LKRB 5I75C 4Q9CA 1F97A 2F1EA 5C0BB 1QBAA 3ZL2A 4EN3B 3DO7B 2BM3A 3MA9L 1SHSA 3BWUC 1DSYA 3M88A 4J12A 4MQTB 2FTAA 4OCSL 1FRGL 2CKBB 3GQFA 4F33A 5KN5A 2GCYA 3WNNA 5IV2A 1Q90A 4L29A 1KLFB 4HMEA 4FNSA 4NZ8A 5B3NA 1IGCH 1ZT4A 3EOBB 3NSJA 2LU4A 1G5GA 2W0PA 1PAZA 3O9WC 4HA1A 2YA2A 4GEIA 4EIZC 5JXAH 1A7OL 3D34A 2DYSB 1AGFA 3WV0A 4MD4A 1E9PA 1YLBB 1MLCB 3QFJE 3OPUA 3PS6A 2JLLA 2HA1A 4G6JH 3Q13A 4A2EA 1YN7B 2EC9U 5ACZB 4X7CC 3O8XD 4HQQL 2NUTB 1NGYB 3I6LE 4YPGA 1MI5B 4XNYH 1CGSH 2V8LA 1KT2B 2G5BA 4OIAA 4QPEA 3VD0A 1H19A 2HX8A 4UDTA 1UWGL 1OP5K 3BVNB 1K8DA 2YKKA 4PCSA 2BW5A 2BCKB 3EXLA 3M86A 2V7NB 3D3VB 3E1ZA 1E90A 3VQ2C 1A3LH 4GQ9L 4DETA 1NMCC 3ABLB 3NCFB 3NSXA 4ZO6A 4KKAC 4OTXH 4DUXA 1U4EA 3CFKA 3UAEA 1D6EA 2X4RB 1FN4B 1MVYA 3BWZA 2BOCA 3HBQA 1DJZA 1WA0X 3P0VL 2B2XH 3ARRA 2VW4A 1VPOH 2Y5QA 4IK7A 4LU5H 2VUOA 3N0PB 4NSKB 4IRZL 2UYLB 3I84A 4JM0A 4KY1L 1UH3A 5B3SB 3GUTB 1B88A 1P69B 4UINL 1S7QB 5J1SC 3T71A 5KSBA 4N8UA 5KZCD 5DHYB 2VSMB 4P59H 3QIUB 5IB5B 5KSAD 5GZND 3HNVL 4ZOEA 3QIBB 3VH8A 3D18A 1BCIA 2PP9A 1EEYA 5G55A 3DX3A 3VFRA 4PD4K 2DMGA 4FG2A 4OAWA 4G6FD 3DUHA 4DP5X 4OZGE 4XPGH 2OW7A 4YHKH 2DMBA 2RIKA 3QQ3B 4JFEE 1E9OB 4FERA 4P2RB 1TO5A 5DT1H 4NKMB 1BIIB 4PJHA 4JPWL 2Y2YA 1L4IA 4D3CH 4NLHA 1NGQL 4NUPA 5TDNB 3QUYD 4H1LA 4LRIC 1SYSB 4R26H 3KJ4B 5IQ9A 4NOBA 3GTTA 1I1RA 4XWGH 2A38A 4BFFA 3O6KH 4XN5A 1J87A 1FIGL 3VFMA 2VXTH 1P2CB 1QBBA 2HG5B 2CKBH 3FPYA 2NXYC 3IBOA 3L48A 2X1QA 2GVYA 2R9HC 5FGBA 3TO4B 5FPIA 1CFVH 1FFPB 4M1CC 2Z31C 5CD3B 1WFTA 3IFNH 3ZT5A 2HKFH 2X4SA 1J8HA 4AOFA 1T6VN 1KFAH 5JO5B 3S4SA 2E5EA 1UA3A 1XSJA 4AL8H 2BMKA 3NQIA 4E42A 2OMUB 3PWPE 4LEOA 1WEJL 2CBPA 2AAVA 5EO1B 1GPOL 4J1UA 1NEZB 2FWUA 1LL1A 2YSTA 4NO5B 1XF4B 1FZJA 1MJUH 3JWDL 4P5TA 5E99H 1CCZA 4LBEB 2QDWA 1GGUA 3NCEB 3AS2A 5C7ZA 5A3IC 4J2XA 5ETUA 1F8TL 4CRPA 3U0WL 2XWJB 1MW3A 4HJSA 3UO1H 3AG3B 3RWIA 2HFGH 4GXUM 2BWIA 3NK4A 3CFCH 1JRHI 4JJ5A 3FQRA 2QADC 4MQXD 3DX8A 3HB3D 1HKFA 2PPCA 1CC3A 1TJXA 5BS0E 1EO8L 5KVDH 5C0DA 2XBZA 5L2JB 4YK4C 2QTEA 2HMIC 2QFRA 1ZA6B 2JWYA 2N59A 3KVDD 4QTHA 2AQQA 4OLUH 3HUJA 3UTZB 3QUZA 3TFKD 4JQIH 3MPCA 4FNQA 1LEIA 2V2WA 1MFEL 3I02A 4BD4A 1PVHA 3UPRB 3FQTA 4NRZA 4LLMA 3POCA 4QRAA 2IOMA 2FEDD 5IBTH 4KO6A 4ES9A 5HPMB 4QKTA 4N2EA 4HWBA 3CMOL 3LH9A 5CNHA 1U92B 4FNLH 3F7YB 4I0KA 3DGCR 3T0DA 2GTZB 3HPJA 3QS3A 2E56A 3K6FA 4R7XA 5KZCB 2KDGA 2PMZA 2Y7LA