1JVOA

Azurin dimer, crosslinked via disulfide bridge
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
128
structure length
128
Chain Sequence
AECSVDIQGNDQMQFNTNAITVDKSCKQFTVNLSHPGNLPKCVMGHNWVLSTAADMQGVVTDGMASGLDKDYLKPDDSRVIAHTKLIGSGEKDSVTFDVSKLKEGEQYMFFCTFPGHSALMKGTLTLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Azurin
publication title Dramatic modulation of electron transfer in protein complexes by crosslinking
pubmed doi rcsb
source organism Pseudomonas aeruginosa
molecule tags Electron transport
total genus 32
structure length 128
sequence length 128
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L
ec nomenclature
pdb deposition date 2001-08-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00127 Copper-bind Copper binding proteins, plastocyanin/azurin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 1jvoA00
4YSDA 3FU9A 4AKOA 2GC4C 1A4AA 4HCIA 2GIMA 1NIAA 1GS6X 4UAHA 2UX6A 3CVDA 4X4KA 3FPYA 1SFHA 4DP8X 3OD3A 4YSPA 1BXAA 2AZUA 1HAUA 5I5JA 2FT6A 3QJRB 2BZCA 2YARA 3NJHA 3FYEB 3QJUB 2PP8A 4BDVA 2PCYA 3BQVA 3ABMB 2UX7A 4ZK8A 1JVOA 1QLEB 4G72B 1ZV2A 2BP0A 3OQRA 1OCRB 4KO5A 1I53A 3FYIB 2WO2B 2PPEA 2VM4A 1NTDA 2VW7A 4F2EA 3UABA 5I6MA 4G71B 2FNWA 1NIFA 2XUWA 4KO9A 1XMEB 5B7EA 2BWDA 5I28A 7PCYA 2B08A 4UF7C 3ABGA 2FT8A 7PAZA 2HLEB 3QPKA 1AIZA 3SBRA 1J9RA 1QHQA 6PCYA 3FQ2A 3NJJA 4A68A 1KDJA 2P80A 2AANA 1OCCB 5B7MA 2BO0A 4G70B 2XYBA 2N0MA 2IDFA 1L9RA 3IBOA 2GHZA 2MTAA 3RYMA 3AW5A 2AVFA 2QPEB 1BEXA 3OMAB 2EIMB 3T9WA 2H3XC 3X1GA 1OF0A 1ADWA 1JZJA 1W8EA 4HZ1A 3CG8A 2IWFA 2GSMB 3MX0B 3GDCA 9PCYA 1OE2A 3WG7B 3NJIA 2J57A 1NIBA 2BW5A 4AX3A 3IN0A 2IH9A 2EINB 4JHUA 3CDZA 4HALA 1F56A 5B3SB 2I85A 1GYCA 5B1BB 1EHKB 2BZ7A 4YSRA 2DYRB 1JZIA 2DYSB 3PAZA 5D4JA 2BP8B 1OE1A 1AANA 3HB3B 4Q89A 1NPJA 4YSOA 2HX8A 2YXWA 1SHXA 2HRHA 3BVDB 5F7BA 1L9QA 1JZFA 1RCYA 2Q9OA 1AZUA 1KCWA 2W88A 1BXUA 4KNTA 2VW4A 2YAEA 2NRDA 1MZYA 4HIPA 1KYAA 1WA0X 5B1KA 2ZXWB 2OV0A 3N55A 2ZWNA 2I7OA 4K9JA 1GY2A 1V54B 1PMYA 1CYXA 4KNSA 4W9ZA 2J5WA 3FS9A 2OCCB 4A2EA 1SF5A 2YAMA 4YSAA 5B7FA 1PLAA 1OCOB 2R7EB 2VSMB 4YSSA 1L9SA 3AG1B 4NERA 3FU8A 1GS8A 1DZ0A 3AY2A 3CVBA 1KCBA 2UXFA 1HAWA 3UACA 1KBVA 4E9WA 1YLBB 4F7KA 2MRYA 4G7QB 2CJ3A 2QDWA 2GBAA 1AOZA 2PPAA 1AZBA 2I7SA 1MZZA 2XVBA 4G7SB 2PP9A 1ILUA 1FWXA 1GR7A 1NZRA 1JOIA 1FA4A 2E86A 5B1JA 4PCYA 1QNIA 1AACA 4YSEA 4PAZA 6PAZA 2P80D 1OOWA 4DP9X 2LLNA 2QT6A 4DP1X 4CSZA 3FU7A 4MFHA 1B3IA 3FSVA 4G7RB 5EHFA 4GP8B 1PCSA 1ET5A 1MG2C 1PF3A 3T71A 3T6VA 1TKWA 4E9YA 3PAUA 2YAQA 2PP7A 2EILB 5I6LA 4N8UA 3ZBMA 1GW0A 3ZIYA 2OJ1A 1A4CA 3FQYA 3FPXA 2HZHA 2Q5BA 3CVCA 1W6WA 3PCYA 4GYBA 2TSBA 5I6NA 2FQDA 1BYOA 1ZDQA 2DY2A 2FQEA 2FTAA 4N4YB 1J5CA 3EH4B 1SFDA 1AZRA 3DKHA 1JZEA 1MG3C 2XLLA 2RACA 1NICA 1BXVA 4DPBX 4RH4A 1KDIA 1NINA 4GP5B 3H4FA 2UXGA 1ID2A 2PPFA 1WAEA 4NAJA 1J9TA 2YAHA 2QPDB 1TU2A 2XXGA 1OCZB 2H47C 4AZUA 3NP4A 4JHVA 4WTQA 4DP7X 2IAAC 5D4HA 3DTUB 3G5WA 1CURA 1V10A 1ET7A 1XB6A 1BQRA 5I6KA 4E9VA 2VM3A 1PLBA 2XX0A 4BK5C 2YAPA 1R1CA 2IDQA 5D4IA 1ASOA 4HHGA 1PNCA 5PAZA 1MDAA 3X1EA 4BWUA 1SDDA 4DPAX 3EH3B 1IBZA 3EF4A 3SBQA 3QJSB 5B1AB 4HHWA 3CDZB 3ERXA 4JKNA 4QLWA 3TBCA 2XV0A 3MBWB 1NIDA 1E30A 3GYRA 3NJGA 1RZQA 1FFTB 2XXFA 3NSFA 3WKPA 3QQXA 4BXVA 4DP6X 1AZCA 2BW4A 1AG6A 3UAAA 4DPCX 5F7AA 1SNRA 3NSCA 5TK4A 1AS6A 1L9PA 2XX1A 3FSZA 2A3TA 2PPDA 2UXTA 3ASNB 1WS8A 1DYZA 3S3CB 2JXMA 3S8GB 2VMJA 1X9UA 3L45A 3PLYA 2PLTA 1ZIAA 1GS7A 3GXUB 2YAOA 5AZUA 2HXAA 1PZAA 2JKWA 3NJNA 1JXFA 2FWLB 1UATA 3CZUB 2CCWA 2H5UA 5B1JC 2FQGA 3V9EA 3WIAA 2GB2A 3S3BB 4CSPA 3QJTB 5IY5B 3NSYA 3WNJA 3ZDWA 3DIVA 4YVNA 1PY0A 3IN2A 2Y1AA 5AFAA 2B3IA 1URIA 2R7EA 3D12B 4F2FA 1JXDA 1BAWA 3PXLA 3AG4B 3EHBB 4E9SA 3FSWA 4E9QA 2GC7C 4DP0X 1WA2X 2EIJB 4P5RA 4Q8BA 2CAKA 1RKRA 2TSAA 1IC0A 1WS7A 1AZNA 1PNDA 1RZPA 2CUAA 3QJQB 3ZX1A 3X2QB 2VSKB 3UADA 3V9CA 1N68A 1IKOP 1TEGA 5I5MA 1PZCA 2WSDA 4HAKA 2XU9A 2YQBA 4HCFA 4BDVB 2ZONA 3T6ZA 1BQ5A 1HFUA 3NJMA 1GSKA 3NJKA 1AS7A 4KOCA 2VW6A 2PCFA 1AR1B 5A7EA 2PPCA 5FC9A 2WO3B 4YL4A 2IDUA 2FQFA 3FU7B 2BP0B 4DP5X 4DP2X 5LDUA 1AAJA 1ETJA 1E65A 3KW7A 3ABLB 2IH8A 2HX9A 1TEFA 4BWTA 8PAZA 1J9SA 1PZBA 2DWTA 2UXVA 3NSDA 5I6OA 4TXVB 1J9QA 1KBWA 3N2JA 2EIKB 3C75A 5PCYA 3WKQA 2YAFA 4E9TA 4KO7A 4A2DA 4GXFA 3ABKB 4A2GA 2ZOOA 5I5IA 4W1TA 2X88A 3JTBA 3NT0A 3UAEA 3X1BA 4GP4B 1JZHA 1NWOA 3U25A 1ILSA 2X87A 4WKXA 1BYPA 1L9OA 3T6WA 4E9XA 5ANHA 4DP4X 1X9RA 1NIEA 1A3ZA 1OV8A 3TBBA 1PLCA 2HRGA 4YSTA 3S3DB 1BQKA 2DV6A 1N70A 4KNUA 1L9TA 2JFCA 3NJFA 1M9WA 2CBPA 1A8ZA 4P5SA 4AKQA 2J56A 3WNIA 4L0PB 1CC3A 1CYWA 5I6PA 3PPSA 1E67A 3ASOB 3S8FB 3AG3B 1GY1A 3SQRA 3X1NA 3PAVA 1ZPUA 3NP3A 3AG2B 1A65A 4AKPA 1E5ZA 2Y69B 3H4HA 2XV2A 1ASQA 2FT7A 4A67A 3IEAA 4A66A 4A2FA 2AZAA 4YSQA 1PAZA 1EZLA 3FSAA 1JZGA 3TU6A 1M57B 3AZUA 3EH5B 4EF3A 1WA1X 3X1FA 2YXVA 1ASPA 3HEIB 1SDDB 1SJMA 2HX7A 3FQ1A 1SF3A 3QJVB 5TK2A 3TASA 4NB7A 4AI7A 1CUOA 1A4BA 2GI0A 4KO6A 1SHWA 1IBYA 4FA7B 4HCGA 1XB8A 1AS8A 3SBPA 2BP8A 1VLXA 2IWKA 1AQ8A 1KGYE 1ZDSA 1ET8A 2IDTA 2BWIA 4E9RA 1OE3A 3JT2A 2J55A 1M56B 3OMNB 3OM3B 2BHFA 1KV7A 3UGEA 2AFNA 4A2HA 4BXSV 2XV3A 3NJLA 1IUZA 1ZIBA 4M4RB 1JVLA 4M3HA 3FT0A 4YSUA 1XB3A 2QDVA 2W8CA 4QKTA 4YVUA 4UANA 4GY4A 1NWPA 3IE9A 2VN3A 3WI9A 4FAAB 1JXGA 1W6LA 2CALA 1NPNA 2FJSA 3TA4D 4YSCA 1JERA 1T5KA 5E9NA 2DWSA 1AG0A 5AKRA 4ENZA 2IDSA 1E5YA 5I26A 3OMIB 4KOBA 4BWWA 3KW8A 3T6XA 1NDTA 1J5DA 1V55B 3H56A 2XWZA 3NYKA 2IWEA
chains in the Genus database with same CATH superfamily
3D0AA 1OLLA 4G83A 5E4EB 2DQIH 5EU4A 3SKOA 2HPOA 3TPUA 3K6IA 4JGJA 1T0NB 5BXFA 3HE7A 3LEVL 3CVDA 3CVHH 5ALBL 4X4KA 4NFCA 4LXFA 4WWNA 5FDYA 2F19L 3GJFK 4OLZL 2B20A 3MKGA 3EJYC 2BZCA 2YARA 4JDVB 3V0IA 1DBJH 2PP8A 4UOZA 3QVAA 4CVZA 1AGCB 4LEBA 4XAWH 2V8LA 2X12A 2CGRL 3KEDA 4HISA 5EO1B 3U1SL 2E7LA 4AT6A 4HEME 4BUGA 1BD2E 5K9OB 2WK2A 3OKKA 2BCMA 1KF9B 1G0YR 1QASA 1YECH 1NTDA 1BVLB 5EZPA 2Q8AL 1FGVH 4EKJA 2J5LB 3GMLB 1KCKA 3F6LA 3TN0C 1FGNL 4PJFE 3NZSA 1CFSA 1FVDA 2XKNB 2CKBA 5E00B 2OA9A 5DF0A 3WKML 5FOJA 4MCZA 4XE0A 3ARPA 5AW2B 5IB4B 3ZYJA 1QHQA 4PP1D 3U36B 1K5NB 3AADB 3AAZB 3IJSB 1UOKA 3MLRL 4MLIA 5AB2A 1TU2B 2AANA 4Z7OB 1IM9B 3GI8L 1YEEL 3J8F7 1UZ6F 3VYPA 3GJFB 2NY3B 4YIQA 4V1DA 1VZIA 4BV1A 2OMNA 1AQDB 4WW2F 3O41B 4QRPB 5CXPA 5IFJB 1YY9D 1I85C 3W82A 4A37A 4XP4L 5C2UB 2ZKMX 1D7DA 1XR9B 3L81A 1UD8A 3LN9A 1ZLEA 2YEZA 3CU7A 5D5MF 1T5XB 4LAQH 2IWFA 4NQSB 4FLSA 4FLRA 4KK5C 1U2YA 4EI6B 4HMEA 4PGZA 3ZTEA 2FO8A 3DRTA 4FGMA 3DX8B 4NC1C 1HIMH 5EV7A 4PRHD 1YUHB 3B9KB 3K2UH 3PJSB 4XMXA 4KKAD 4IIQC 4UILH 3IE4A 1ZS8A 4PJEB 3GT6A 2DRUA 4JHUA 5IESL 2XI9A 4HALA 3BWAB 2BY0A 2IMMA 5LCVL 2WTOA 2MNWA 3L48A 3ZN6A 1KPRA 3JUZA 2F74A 3QDJB 1MY5A 1YMMD 5DJ8B 4JFYA 4ELMA 1ORQA 4OZHE 3A47A 3L9EA 3QXDA 3QXVA 5GRWA 4RGND 4OLWH 1GZQB 5HYSG 4YHZH 5H4YA 4Q97A 5EA0L 3GNMH 4JO3L 5D2LE 1CO1A 3KPTA 3BQUA 4RESB 5F7BA 1E9PB 3H9HA 1JZFA 2V5RA 3T8XB 1L3NA 2QQNH 3FKUS 5HGBB 1JSYA 1QFUH 2VL5B 3JTSB 4ZMTA 3ZGIA 3RX9A 4Z0XA 2VISA 5E1AB 3BO8B 2Z8SA 1JZ4A 1LVEA 2X6UA 4JM2B 1D5BA 4XOAA 4P48A 4N28A 2IANB 3N55A 4ONOA 5H35A 1PMYA 2AEPL 1N64H 1WAAA 2F6AA 3KDMA 2P49B 4ZUUB 3NVQA 1SF5A 1MPAL 5C0GB 3LB6D 1D7CA 1G84A 1OCOB 4AL8L 3M17B 5IVXA 4KX7A 5GHWL 4N20A 3WEMA 1G1CA 2UXFA 3IJ7A 4L3CA 4YHLL 4IGBD 1K8DB 3R06A 4G7QB 4YBLB 1U8KB 5MP6H 4M6OL 2C9SA 1V05A 5KVFH 3MLSL 3LAFA 2R4RH 4J4PA 3BKYH 1PKQA 3IB4A 1FUNA 4LBEB 1A1OA 2NXZC 4KK9C 1FAIH 1SMAA 1X5GA 4GFXA 5IVNA 3GSNA 1T3FA 1URZA 4CW1A 2OFQA 5EOQH 4K3JL 1TOXA 2WM0A 3P0YL 4PCYA 2E56A 4KRLB 4Q6IA 3SKNB 3FCGA 4RCAA 1KTKE 1TMCB 1EO5A 4CSZA 5D1QD 3JWDL 2J21A 3L95A 2OR8A 5IBUG 2J8UF 4G43A 1BEYL 3FUDA 4MAUH 4LVHB 1DVQA 2XG4A 3PAUA 4HH9B 4YDMA 4YFDB 4ZX4A 3HFML 2VXQL 3BAYA 3BUPA 2OXGB 1IEAA 4TQEH 3RZCD 2RGSA 1WZLA 2HZHA 2ZCLL 1HK6A 4FQCH 2J20A 2TSBA 4NKOA 3NRQA 1WGOA 5IHZA 4O2FA 3BKCH 4AVHA 2XQBL 5L6YL 4OD1L 4AV5A 2FR4B 1YJDL 2FJGB 3OZKA 4WNJA 2W80C 5DYOB 1SXCA 2Q3XA 5FEBA 3CMGA 3L5HA 2KZBA 4QAMB 4TQPA 3QJFB 4H8WL 4QRUA 4AQ1A 1E9QA 1IFRA 4IMLA 3TO4C 1MWAA 2QKIC 1X5FA 3UJTL 2X6CA 3L9RB 5IW1B 5TFSH 3FT3A 2ODHA 1IAMA 3C6LB 2VLRA 5ADPH 4TMPA 5KZCD 3OJMB 5EF2A 3I6GA 4NQVA 3HC0A 1LD9B 4LVEA 4OGXL 1UVQA 3PGDA 4FNLL 2YD6A 4XP5L 5C0DB 1FL6A 1THCA 5ID1B 3J7HA 4PI2A 3DGGB 1CXIA 2EVIA 4BFFA 3JUYA 1AH1A 1M53A 4IBWA 5GS0L 4OZGF 3BN3B 2VTFA 3OPZH 1ED3A 1R3IH 1ZTXL 3B2XA 1DBBL 4KTYA 4HP5A 1YYCA 1NMAL 4HUVA 1FYHB 2YPVA 4DW2H 2E7HA 2MQCA 1RPKA 2EC9T 3L3GA 3QT2A 1JPST 1S7VB 2ZX7A 3TX4A 2FIKA 1NCCL 4GW4A 2D4DA 2WD0A 2PABA 4W9KC 2Q8BL 2HKHL 2UWEE 4L8BB 1VFUA 5HVWA 2LVEA 2VDPL 3D0LA 3GUTB 3A6BH 4DVRL 1MAJA 1PSKL 2HT4D 3ARBC 2BW4A 3KPRD 4GKZB 3LRLA 1C12A 1UACH 1HVXA 3AUVA 3L5WA 1IGCH 3L3HB 1AI1H 2VDRH 2B2XL 4QIRA 2ISDA 2GKIA 4WGWB 4HYTB 4LLYA 5EC1B 5JHDE 2YBGA 2V7HB 3WXVL 1KJVB 5FHAH 2GJ6D 5EZIH 2VC2B 3FO2A 3O9WA 3VQ1C 4Z3FA 4ODWB 3V0DA 2EYSB 2WCGA 5GGTH 2PLTA 2Q6WB 1SEQL 4FCHA 1CDGA 3ZL2A 5KSAD 2FWLB 2X53A 3NRFA 1JI1A 4LNVA 1D9KD 1MHCB 3TTYA 3MR9B 5DMIH 2JJSA 3M1CA 2X9ZA 4QDGA 3LKNB 2PYFB 4WHDA 5ADOL 4RGNB 5EU5B 5IJVB 5L0QC 2CO4A 1N59A 4J8RB 2YGVA 4NJ9H 4JFFD 2B3IA 4U7SA 5E6ID 3WIIH 2P5WB 4NKMB 3HNVL 4I0PC 2WLJA 1KIQB 1UH2A 1I4FA 2P47B 1IGIL 4AC4A 2OMYB 2CUAA 5F1IB 3I9GH 5HVGB 1C08A 4R7NB 5TQ0L 1XVSA 3PP4L 4JW3A 2XXMB 4W93A 1UUNA 3HFFA 3MV8B 4HK3J 5DA4A 3D3VD 2EKSB 5F9OH 1SN0A 4LT7A 3BZEB 4O58H 5GZND 3UIYA 3UJJL 1NUFA 1GSKA 2OZ4A 3VA6A 4RRPA 3UEZA 3T3MF 4IRJB 4ODVH 1S7SB 2V2TA 3LPGA 1U92B 1ZT1B 1ZOXA 2Y7MA 3RIFK 3AREC 2D3NA 3MUHL 4P5TB 5DZ9A 4LCWA 2A6JA 1J0KA 2PXYD 3G6JA 4C54A 1J5IA 2DQGH 5HI3C 4ZW7A 1RIVH 4DN3H 4XO9A 4PJ5D 2QQKH 3G04B 3W9DB 4Y19E 4N8VB 2JCCF 1PD0A 4M5ZL 5I5IA 5DO8A 4EXPX 4WUUB 3UROR 3LKRA 1TQCB 4WKXA 2MQ0A 4HU2A 4J12A 4PHZA 2WW8A 1U91A 2OX5B 2XPYA 1GZPA 5GQBA 3MZGB 3WNNA 4TOYH 3FN0H 4PWJA 2FX9H 1I1CA 4QLRA 4ORGA 2QBWA 1OAZL 1AE6H 4R0LA 1A6VH 1GTNA 4JO8A 5C6TL 4F7EB 3RNKA 4MXQD 1W0YT 4NM8H 5I8KH 3O3EB 4M02A 3IXTB 1RZJL 1YN7A 2R2BA 3FT4A 4NKDB 3RZCB 3UTQB 2NTSP 2CM5A 3HBQA 4KROD 3MJ6A 4DGUA 1FVCB 2NZ9D 4NSKB 4UT6L 2HLAA 4PREA 1SOKA 2YA1A 2XZAL 4OGQC 5DQDH 3A21A 3GZOA 4JFDA 4HEPA 5EOTB 1DCEA 2WQAA 4PJ9D 1AC6A 4JRYD 3TV3H 2CM6A 2E4TA 4G2AA 4LLDB 5BZWB 1PG7W 1I8KB 3MTXA 3NZHL 3EJJX 1YEIH 3WIHH 3BDXA 4U1NA 1BQLH 1JNHB 3O6FA 3IGAB 3QUXD 1RK7A 2Y5QA 4LO9A 1PIGA 3KLSA 4NPKA 5CSGA 1E6JH 5KZCB 3Q6GH 1TFPA 1Z6JT 3CV5A 3MI6A 3NJVA 2ZUQC 3Q2VA 1HESA 4Y4KA 3TBVB 1UD4A 3FFCE 5JA9A 4NUQA 2V5MA 5INCA 2V3EA 2P24A 2BSTA 4FFZA 3GKWH 3J27A 4ZSOE 5CJQL 4N0YL 2WTRA 4P3CL 1XGPB 1ZLWH 3VI4B 2DQEL 2AJ3B 4PJHF 4G6AC 4MD0A 3DX9A 3GMPA 2WLZA 3P77B 4I2XB 1BJ1J 4XAKE 3FFDB 4PV8B 5A2KH 5B39B 2O5ZH 3ESMA 4QKTA 4KFZC 5E1QA 4OI8A 4HIXL 2I26N 3CFKA 3GFUA 4CSTA 1OEZW 3HKZA 5FGSA 3GMNA 5DQJA 2CALA 4BSWA 3HHSA 4YSCA 4JGNA 3D8MA 5E94B 1KCUH 3POHA 1TYRA 1TIUA 5T8IA 2K7QA 2E6QA 3HZ3A 4ENED 4JLRB 3FK3A 2GTZB 1QPXA 3UZEA 5E0FA 3UTPE 2OBGA 3SE3C 4JE4B 2CHXA 4IRZL 2JKIS 4ADIA 3S48A 3ZW3A 4PS4H 1MCOL 2OS7A 3K4DA 4H1LG 1YEFH 1U58A 1VZGA 1P7QD 1RL1A 3KE0A 2ESVA 4MX7B 5TE4L 4AKOA 1A4AA 3MSPA 4TSBH 3U4EB 3UBHA 4Z7AA 1QNZL 5IT2L 1CF8H 1FJ1A 4XXDB 4PLNC 2BOCB 3HE6C 4JDTL 4GAJH 2R27A 4FF9A 3N85H 4N0FB 1FH5L 2DLEA 3OAZK 3VWJC 3QJRB 5M94B 4HK0A 2BS9A 1J18A 2HJLA 2JKRM 5IF0B 43C9A 4PB0L 3HBGA 3L3JA 4KKRA 4H5SA 1U8CB 3ZTNH 5DRXA 4K7FA 5ILTL 1U3ZA 2HVKA 4YHOL 3X3GH 1B3JA 1GGCH 2OYLA 3QXUA 4Y9GA 2DWYA 2WO2B 1N3NA 1KCLA 4G9FD 1HXKA 3WD5H 4POZD 2IG2L 2AJZA 1IGYA 3B3BA 2P8PB 4Y5VB 3Q5OA 1AP2B 2EUWA 2BWDA 1WE5A 3TYFB 1NEZG 1QOKA 3L9BA 4UF7C 5DVMA 1LQSR 5I0ZA 2WVVB 2E7BA 5I75C 1AGDA 3QPKA 4Q9RL 2Q7YA 4F37K 4LCYB 4NGHH 1IGMH 2L04A 1A6TA 3LV3B 2HTKD 4NNPL 4EN3D 2CLVB 5DO2C 4GNKB 5E24E 3E80A 2A1WL 2F53D 5FDWB 5BRZD 5KYYA 1MFAL 1R46A 4MD5A 4RFNC 4G8EA 3CZFA 2PXYB 4J3OD 4P5MA 3OKOA 1J0HA 3IS1X 1IAOB 3VB8A 4PJ5B 4G1EB 2V17H 1OP3K 2XRAH 4F7MB 2WXMA 1KJMA 3LYRA 2O5NA 5KS9B 1MFMA 4P49A 2MPAH 1BREA 3VTTA 3EYFB 1RIHH 2NY7H 3NIGF 4F8LA 3NGBB 1NIBA 5HJ3A 4BEIA 4H25B 4HQQL 5GS2D 4B7LA 1QFPA 4P99A 2N1TE 4RGOL 3UBXA 1KJ2A 4MYPA 4DKFL 5J5EA 3KR3L 3I3BA 1CD8A 4YLCA 1MFNA 3CLEH 4UQBA 1JNLH 2FHBA 5LGJA 4PRAA 1ZHKB 5C0JB 1EEUA 3NBNA 5EBMA 5DJ0A 1H6EA 4KROB 5KBKA 3MUGA 4Q2ZB 1Z3RA 1HQ4B 1TNNA 1ROWA 4A04A 1P5VB 5DQ9B 3QUYB 4HUWB 3T0ED 3MDJA 3IGLA 4DEPC 5SX4I 1KCVL 5C07A 4PD4K 1E8XA 2Q9OA 4PJ9B 4KTEL 4JRYB 2V2XA 1KB5B 2A2QT 2RA1A 4ZTEA 5C09A 5HD8D 4FP8H 2CLRB 5EPMB 5A2FA 4UINL 1J05A 4XNQA 3NA4A 5GGQL 1S7UB 2OL3H 2ZXWB 4NUPA 4PBVC 4PGDA 2DIAA 2GK2A 3MV9A 1MVUB 1M6OB 3QUXB 4TLSA 2HJFA 2PTVA 5E8NB 3I75A 4KKCC 2V3DA 3QI9A 1E28A 1GVIA 4YSAA 2R7EB 2P8MA 2VSMB 1ETB1 3QUMH 5IEKA 2XWXA 4A2MA 4D0DB 5CLYA 2ID5A 5F6IC 2IOOA 2Y6SD 2FEEL 3UAJD 3FUFA 4KJPD 4MD4B 3RDJA 3N1GC 2PR4L 4IJ3B 4LLAA 2ARJB 4MNQE 4XPBL 1R19A 1LP9F 4MB3A 2HMIC 2PPAA 2YWYA 1HE8A 1PU0A 5I6XC 3LXCA 3GBML 4XWGH 5BO1L 2NR6C 2BH0A 1JOIA 2XNAB 1H5BA 4JY5H 5MI0B 1KCSL 3VH8A 4QRRB 1UWGH 4PGEB 4X9YA 1JGEA 4AM0B 5J3HD 3QAQA 4GINA 4WI0A 3HZKA 3KYOB 4EIBA 2VCOA 4J3TA 3ETSA 1E5AA 2FEDC 4NCDA 4AMXA 2WNWA 4GP8B 5BOPA 1PF3A 3X12A 1G1OA 1DBAL 5FYLD 1E27A 2EICA 2NDFA 2WSPA 1A7PL 3C5SB 3LSOB 1DQQB 2QV2A 1O7DE 4DK3A 2HN7B 5F1SA 4FKEA 4TVPL 2A74C 1GGIL 3FQYA 1CPUA 2PW1B 3MRQA 5IK3B 1P7QB 1LM8V 2FYYB 2CJUL 3PUUA 3RTQB 4DCQA 4P04A 2R2EB 3OAYK 1Q0EA 3F7VB 2VR8A 3OR7A 1RULH 3VDAA 4TUOA 4KVCL 1XGYL 1BM3L 4GP5B 5I1GL 4PM1A 1ZK5A 3MLZH 1ID2A 2PPFA 2C3VA 4L3ED 4TUJB 1E4XL 2MCMA 32C2A 3E3QC 1T03H 2QSCL 2Z9TA 4X5WB 1RUML 4BZYA 1E9OB 1EBPA 3QFDA 4PY8I 4KRPD 5EFIA 2B3RA 5HHOE 5D93B 5BS0E 5ITBH 4XCYA 3N1FC 4AXWA 4F8QA 2QMKA 1ZA6A 5I73B 1Y6NR 3G6DH 3G5WA 4OLUL 3VXNB 3IJYA 1NGYB 4PRBB 2G5UA 4JO4L 4LDLB 4Y2OA 4KWUA 4AVIA 5C0NC 4E9VA 3HRZB 1GMIA 4XNZC 1HH9A 4Y4HA 1ASOA 1XL6A 4OLYH 1UM6L 3DOIA 4UU9B 4BWUA 1MDAA 4DH2A 1P53A 1SDDA 4I8DA 1I1FB 4EN3B 3SBQA 1WCBA 2WKGA 4HHWA 2BNUB 2C4FT 5BUAA 5BRZB 4N0UB 3VFSA 2V7NB 2WXNA 3V0WL 3PWLA 4TUKH 4KITB 1OAXH 4HKBB 4NZ8A 5CHNA 5GJSL 1LWHA 3O3DA 1OAUL 4XCEA 3ASWA 1T04A 3RFRA 1I9IL 2X4NA 1LILA 2A6KA 1CDJA 1O9VA 1ZTMA 3TZVA 2EDBA 1JRHL 2E8ZA 4LL4A 4B3EA 4FXTA 5CCKH 4P2QA 1U8PB 1N6UA 3OZ9L 4JFTA 4U6YB 2WANA 4Y2LA 5BW7C 3CHXA 3UG5A 3BZFA 5DS2A 1GS7A 1YY8B 3BAXA 2BERA 1UXWA 2MNJB 2CGYA 1FIGL 3W38A 3DHUA 3NJNA 4YFLI 1BZ7B 1EIBA 1HCYA 3LZOA 4XMPH 1IEBB 3MBXH 2V9UA 2XTJD 1QBMH 1RUPH 4FFYL 1K6QL 1FG2A 4NO2B 4CU6A 5LCVA 4X6CA 3N3EA 4PSRA 4N2OA 4RMUA 4HSAC 5CS7A 5EOCL 3GLAA 5FUOL 1NCGA 5DK3A 1HOCB 4RAUB 1SYVB 4XNAA 3RVTD 4L1HA 5T3ZD 1A9BB 2UUDK 3KS0H 3FONB 5EZLB 1NFIB 4LDCA 4DO6A 2ITCB 1LO2L 1KC5H 1W91A 1N6QH 3MRCA 1KN4H 1BX2B 3UBGA 1KXTB 2KYIA 4OZIE 5ICYA 5AWNL 4NUJB 3QFJA 1TQVA 3SGKC 3VYOA 5JOFB 1IKOP 4QGTA 4AEHH 4FG6D 1ZANH 1I8AA 2UY7B 4PBWD 3V7MA 3UYPA 4CKVX 1SJEA 1WQVT 1ZLUK 3BE1L 2BVQB 5DRNA 4JZOA 3GIVB 2G0LA 1BLNB 4DOHE 5AAWA 1AS7A 4P4RA 2WQSA 1NCDL 4XHJD 3SYOA 5EIQA 5LDUA 2FQFA 3FU7B 3FCBA 3U46A 3DURB 5J89A 4BQ9A 1FVEB 4NUMA 3CK0H 4FFVC 4M7KH 2VN6A 4PGCA 3ZDZE 3BC9A 2BS71 3DUUA 2BRRL 2WN3A 3AABA 1BOGB 1WC7A 3ROLB 1XF2A 5F8QC 4Y9CA 1YN6A 4K2UH 1P1ZB 4L9DA 2YD0A 3JYBA 2E8YA 4XP9H 4TTDD 5CEZL 3IMSA 4GG6B 5FCUL 4N90D 3LRSA 1NC2A 2Z35A 3JTBA 3VM5A 1NWOA 4LLMB 1Q9OA 1DANT 2IPTL 2ZXAA 4FXGB 1OXYA 2CCLA 3BAEL 4PJXF 3KGUA 3VGDA 4XVUC 4M48H 3F12B 4EKXA 4X8JA 3HC4L 5GSVB 5JMRA 3AB0C 4GOSA 1XH2A 3VGFA 3S3DB 4M1CC 5HGGS 4AYFA 2YN5A 5F7LB 1OPGH 5J06A 1XIWB 4PJAA 3RVUC 4EVNB 4G80B 4KKQA 3U9PH 3B5HA 4U1HA 3PP3H 5C0CE 3UPAA 2WQ8A 3VI3A 3HPLB 1YEDA 2VXQA 1E8WA 4D7BA 2WVSA 3BGAA 4PJIA 1EV2E 5EF0A 2VO8A 4X6DB 1J1PL 1TZGH 4PS7A 4IRSD 3EGXB 4A6YB 4FYRA 3QDMB 3QIUC 3MLUH 2DYPB 4K0OA 5H94B 2PO6C 5F7HA 1MRCH 2WZPA 2YEQA 3GIZH 3UDWA 3AXLA 4BKLB 3VFMB 3TH2T 3X1FA 4FYQA 3HEIB 4D0CB 2QZQA 2I9LB 1TZIB 4I7ZC 3ZE1B 4ZS7H 5AW3B 1BVKA 1KTDB 2WQXA 5CIPA 4L3EB 2R59A 1RQ5A 2JCWA 4K9EH 4KRPB 4LPUA 2A77L 5LAXA 1VLXA 4Y2DC 2OMUB 2F58H 1CTOA 2Z8RA 3KPMB 3DROB 4C4KT 1BXXA 1I9RH 3C60D 4H8HA 4XPAL 3OHXA 4YK4C 3E2HB 3ZT6A 4DF9A 2EDQA 2EDWA 2Q1EA 5EUKB 2IDTA 3ES6A 3LKQB 1S78C 1M56B 1CGUA 4UOQA 3ULVC 1KJ3L 2WWMD 5D5MB 4M4RB 4BFGA 2YSSA 1TDQA 1G7JB 1JAEA 5G5DA 1G7PB 5EU7E 4EZJA 3VE0A 4R26L 1QSEE 2Y25A 1LXMA 4R4FL 1DLFH 4K3EH 4LP4A 3FQUA 3AUWB 4X7TB 1AG0A 1UEMA 5LBVA 4CADB 4Y0GA 3APFA 3R19A 4WO0A 5GGRA 3WDIA 2WIIB 2ZG3A 4L29B 4IOSA 2KH2B 2WHVA 2NY0B 3B1UA 2IWGA 2YPKB 4BSVA 4Z5RB 3L16A 4FZ8H 3KPOB 2ZKWA 1SM3H 1R5IB 3O3BA 4PBXA 1OGTB 5AKSA 3NYKA 3ZKSD 1DBKH 4R2GD 5J6HB 1QO3B 2Q86A 4PRNA 4JRLA 2GSGA 5HI5C 1CFNB 5CUSH 3VXMA 1H3GA 4AEFA 2XTJB 1MFDH 5KYWB 3NFNA 1Q1PA 1YC8A 5IUSA 4QHMA 1DE4B 5D96C 4LE8A 5FUZH 4YBQC 4BZ1H 1EFXA 3SJVE 2CDEB 1Z9SA 2F15A 1BLIA 1GGBL 1TKWB 3DK0A 3QR1A 4P2AA 1MHHA 2NNAB 3PDGA 5B22A 4GMTH 3WFDL 5MEOB 4F7CB 2JJVA 4MDIB 3EDEA 4NWUL 3OQRA 4PJ7B 2WUCH 3FYIB 3SE8H 3U9WA 1MW0A 5IGXH 1PCXA 5MEQB 4GSDL 2ZKYA 4F2EA 1OGSA 3CHQA 3IDUA 5I19L 4FNUA 2FNWA 4H1LB 4HUXA 4XCNB 4WO4C 3SOTA 3ESOA 3U0WL 3UOAB 1XMEB 1NCBH 5F7NC 1EBAA 2N7SA 3BWZA 1HZHL 4WFFD 5DJXA 2B7DT 3SDXA 5I28A 3ARSA 2X4RA 5HJGA 1AFVH 1TTBA 3L7EB 2QSQA 3I02B 2WXFA 2SEBA 3SGJC 1J9RA 4TLUA 4AIZA 3BJ91 1CLOH 5I0XA 5C0AD 3NIFE 2WWKT 3MNVB 1I31A 2G4GA 1CGTA 3MCG1 4WHYH 3MFFB 2G9HB 3VRJB 2ADFL 2WXJA 1V3MA 2YGQA 4ZXBD 1BIHA 3PNWB 3AW5A 4H8QA 1KB9K 3PL6A 2QPEB 3PV6B 4JDZB 1RY7B 2ZUTA 1BBDH 3T9WA 2W9EH 1J0JA 2X10A 3P4NA 5E9DE 2P8LB 4UZUA 3QEUB 3F62A 3UTSD 1MJJB 4L9LA 1AGFB 2Y7QB 2BCKA 4CDHA 2JJTA 5DFVC 4Z7UF 2R69L 3KXFA 3UCQA 1A5FH 3H2PA 1U8LA 4IBQA 4QRBA 4AX3A 1MJUH 4GSRA 5KYUA 5T3XD 1NEZB 1INQA 2YIHA 1J12A 4LRIC 1S9VA 2QTEA 1LO5B 2KDGA 3D39B 3GGWA 2F8VA 3DLQR 4UQ3B 4G5ZL 2JK5B 3MBWA 3KWVA 4S1RH 2IV8A 2CGZA 4PJBE 3A6CL 4NO0D 3VG0L 1QSZA 4J3BA 3V4PL 4FQXC 2B8OT 1KFAL 4YSOA 3L3OB 4RDQF 4F7PB 2F5BL 2PMZA 5KG9A 5FYJD 4IRSB 1U6AL 2NYYD 2YO3A 1Q1JH 3LEXA 3REVB 3MRMA 1FO0B 1RCYA 5A16B 1CICB 3F7RA 3QCUL 3BP7B 3FO0L 4JCLA 3JVFC 2YN3A 4OZGB 1SLXA 4CC1A 3HE7C 1ZAGA 4JDEA 4XX5A 1ZT7A 3LPWA 2KT6A 3QNXB 1G5GA 4ODHH 5L2JA 4IKNA 3TVMA 4MS8C 5E2WL 1T1ZB 2C26A 2VN4A 2B1HL 5F7MC 4LASH 4OAWA 2PTTB 2Y9RT 3C60B 3FU8A 2E7LC 5E2UL 1WFOA 2C1PB 2YD2A 1UASA 3VG9C 1HE7A 5KUMA 1Z9PA 1RERA 2MRYA 4NQED 2OR9L 2V9RA 5DK0A 4CBPA 1ZXKA 1OSZB 3QPQD 1E2WA 5D1ZB 3WL9B 2HUHA 3V4VH 4XC3H 5EUOF 1OM9A 4L4VE 4O5LH 3AS0A 5CJBA 2JIXD 3EYQD 4WQOA 5HHQB 1N12A 5KAQG 2RD0A 1I7ZA 2D0GA 2FB4H 4CSSA 5D1XE 4F2ME 5JW4Q 1BYNA 4L1SA 4ZZFA 4R90L 5FB8A 3NJXA 3IDMB 5B1JA 1YYLH 3HG0A 1MFEH 4PJ8B 4EIUA 2DWDB 2DDQL 3LPOA 3TA3A 3RNQB 2Y22A 3OGCB 2YMOA 5L88H 1AGEA 1B3IA 4ZOEA 1SOSA 2FWSA 5CFHA 2F61A 1IL1A 3C8HA 3NABH 25C8L 2R0LH 3CFDA 4MB4A 3DO7A 2AXGA 2IGFH 3IFPB 5FKAA 2OMWA 1AVAA 4GRLC 4IOIB 4IRZA 1RMFH 5B4MC 2EILB 1G1YA 5TH2A 3VXSD 5C9KA 3GBNH 2Z65C 3UBXI 1H6UA 3BPCA 4IBUA 3IFNH 2ICEB 4CC0A 1BYOA 4OM1L 3IDIB 4ZUWB 3NMEA 2UV3A 4XOCA 3QARA 3DDFA 1UWEL 4P9HC 2EIZA 2DD8H 4QHUB 3OKNA 4MAZA 1SFDA 3CN2A 3N50A 4KHTH 4OJEH 1OM3L 5E8DL 1KNOB 2O4EA 4JRFA 2H0JA 1HILA 1MLBB 3ATDA 1IO4C 4ZPVA 4DPBX 3Q48A 3P2DA 3QEQE 3VFUA 1YEHL 3DO4A 4D9RE 3SBWC 4FNSA 3SQOL 1FYTE 1MCDA 4XPHH 4Y1AE 1CQKA 2G5RA 4ICWA 4XWOC 3OSVA 5KYXB 3QZWG 5KVEE 2XWCA 1CURA 4OSUL 1ZT4B 4BQ6A 3BQUC 5KW9H 4B9KC 4LEOB 4KVNH 5EIIA 2UZXA 2ICWA 1OTSC 4NNXB 1R1CA 3ARDA 3MODL 2JCCB 4O9HH 3VFNB 3VD1A 3UCRA 1A9EA 1PNCA 2GCYA 3LNGA 4HJ0D 5IB5A 3ELQA 5KBLA 4D0BA 1IT9H 1JVKA 2HVJA 3B3IB 1BD2B 3EYOB 4N85A 5B1AB 2OP4L 2VGLM 3HG1E 3EYSH 6TAAA 1OTTD 4HPYH 3OR6B 3NJGA 2Z3FA 1TQWA 4ZXBB 1I1AD 4QWWC 1FNSH 5AUMB 2VJ8A 2I07A 3VD5A 5F3BB 1MAMH 5F7EH 2VAAB 3PGCA 1SNRA 3MYJA 3BT2H 3CC5B 4NKIH 1P4IH 4TVUA 4HXBH 1KCRL 2P43B 1OZUA 3D25B 4Z8FH 4O02H 5GIRA 4HETA 1A3RH 1TEYA 4ZDHB 5FWRA 1Z9NA 5DMGC 4BH8B 1HI6A 2JXMA 2W95A 4PJCA 4J4PC 1JNNL 4L3FA 3L45A 4RIRB 2E47A 2VJXA 4KUZH 2CA4A 4K5NA 2YAOA 4UAOC 1RZKC 1K8IB 2BC4B 2PWFA 4PVNA 4N2FA 2NY6D 5JOPE 4O2EB 2OMBA 1AR1D 3FB6A 2CK0H 3OKLB 1NL0L 1C8QA 1IU1A 4JPSA 4NEHB 4Q6IC 2VDMH 1H3TA 4NO0B 1ORSB 3ARGB 3NSYA 5HHNB 2C9VA 3DETD 5JIKA 5E08L 5SX4H 3ULUL 3IN2A 3LXUX 1UEYA 4HS8L 3W2DH 4ZAKD 1JV2A 3IKKA 4I4WA 4ZMPA 4F2FA 5ACMA 2ZCKL 3M45A 3IDGB 1TVBA 3JXAA 3OZLA 4S10A 3MBEB 1UM5L 4KQ0A 3M8OL 3Q3GB 3V4UL 4P2RA 1EFQA 5I8EB 1THAA 4MNHA 4ES8A 4UOW1 1OARH 3V9CA 3TT1L 1EJOL 4Q14A 4LMQI 1TTUA 3PWVB 4H26A 4QXTA 2O6CA 4PBDA 2FVNA 4K23L 4PSPA 4DTGL 2CKBH 4YXKH 1E4WH 4QNPE 3WCYA 4WK4B 3HOGA 3US9A 4NN7B 1MELA 1JFHA 1R5WA 2AJUH 3RDTA 1ZHBB 5LBSL 3FUHA 4GKLA 4AW4A 5A7EA 5D2LB 2B4CL 2VKXA 4DP5X 4DO5A 1QFWI 1QQDB 3H3PL 1DN2A 1LO4H 5L2KD 3KW7A 1U8MA 4WI7A 1KEGH 2YSTA 4KC3B 4NQEB 4MQXD 4PJGE 5AL0A 3SDCD 3WTSA 3GXIA 5IVOA 3TBSB 5CBEA 2P5ED 5CU5A 4I3RL 4M1DL 3RWIB 1ETZA 2YAFA 5BQ7A 1P5UC 2ARJQ 1MI5A 3FB5B 2JIXB 4J5VA 2GEQA 1ULVA 1WBXA 2WLHA 4P46A 1S7XB 5DD5L 2X87A 3T6WA 1N5AB 1BYPA 2Q87A 1ODUA 2XY1A 4FQIH 1MRFL 1UJ3A 2W60A 4JL1A 4OCMC 4P9HH 1JTPA 4WV1A 3LH9A 5SWZD 4U1MA 1D5XA 3QG7L 4AM0Q 4P3WA 2XN9D 3GJEA 2XCMC 4HIJA 3HUJE 1L9TA 3INUH 3MCYA 4JO2L 4XB8A 4P5SA 3VNZA 4L8CA 4Z77B 1CYGA 5LWYL 4E9LA 2H9GB 3VXSB 2EDNA 1FZJB 5JW4R 1CMOA 1X6NA 5F9AC 4L1BA 1GY1A 1JUFA 1HNYA 5AG9A 2GFBB 3O4LE 4N5ED 4YHPA 2AJSH 2OTUA 5IM7B 1T5WB 3K7UA 3FOLA 5T1LD 1P2CA 3CMOL 1BZOA 2EECA 1QX1A 4A66A 5I1HH 1YPZB 4R7DB 1S7RB 4AITA 4X4ME 5FO7A 1E6OH 5C08A 2HX7A 2Y5EA 5K9QI 5D7LA 5TDOB 4J3SA 3CX5J 1OL0A 3UO8B 1G7MB 1BQSA 4B9YA 3DPDA 4D2NA 3SBPA 3W37A 5CZVH 2GSIA 3II3A 2WYHA 5I1AB 3BD4A 4C4KO 4ODBD 1SBSH 2NUPA 2FIRT 1ND0B 1QSFD 4QXGH 4YUEL 4RDQG 5SWSD 1F18A 1BSIA 4E5XG 3V2AR 2WLYA 1RXLA 1MIEL 1S9XB 3ZZLA 4AK1A 1DTUA 1S7WB 1UQSA 3DVGA 2BNRE 4U05A 2W5PA 5DD0L 1V7ML 1YNKH 2C7FA 1CI3M 3U7AA 4JFSA 4G7YH 4OB5L 4W9FC 4OFDA 5BV7C 1CFTA 1G9ML 3NQIA 1KLGB 4KTGA 3M7OA 1RZKH 1ZHLA 4C83A 2DOCA 1IIKA 3GSNH 3GTNA 1AD0B 4P9MH 1RURH 4N25A 1AQKH 4KKLD 3F83A 1XH3A 1I1AB 2DWSA 4GXUN 2V0AA 3RIAF 1E0OB 3I6KB 4ENZA 1H0DA 4XBPB 1NMBH 5E8EA 2ZJSH 5DHVA 4F92B 3NN8A 1A4KB 4QEGA 3PIQA 4X4ZA 5I26A 1XCQA 4GRMA 1ZVSB 3HI6L 2DI8A 1NDTA 1J5DA 2R9HD 3O2DL 2Y36H 2X1QA 3QDGA 5DUJA 1SZNA 1A7NL 1W8OA 1HXMA 5IQ9B 4G5AA 4JPKH 5D6DA 3TM6A 1BZ9A 4I13B 4CMHB 3I6SA 5KVGE 1VPOL 2MNUA 2JKTM 1A0QL 4EO5A 3K5RA 4LL1A 3ZE2E 1MCSA 3VFOA 3OD3A 4QOKA 3EJYD 3BH9B 3T4AC 1HCZA 1Q9KB 5C6WH 4JM4L 1BMGA 2FT6A 4FFYA 3LXBA 4XCFL 1JK8B 3ZUNC 2CO6A 4R0LC 2A6DA 1IARB 4ZAKB 1KIRB 2VDKH 3W5NA 3ARYA 3G6AB 1Z32X 1MWAH 2H2PD 3DA0A 1GCFA 5IG7A 5LKNA 1JVOA 2VLKA 2B9AA 4WJ5B 2DLFL 4BD4A 3L1OH 3QH3A 2MHAA 1J8HE 3COOA 3RUGB 1GA2A 3CVHB 4A2LA 3TN0D 2VM4A 1CGWA 5LG1A 1OHZA 5I6MA 4ICXA 1BAFH 5EZJA 1L3WA 5LJYH 3C5XA 5CINL 3TIDA 4GUPB 1COBA 2BSEA 2XBZA 2RJMA 4G59C 1Y0LB 2GTWB 3BW9B 4YDVB 1AHWC 2B08A 4TULH 2QVIA 3QISA 5HVHC 1VKXB 3S9DB 1TETL 4AG4L 3QQ4B 5T1MA 2QKSA 4L8SA 1RZFL 2YPVH 4H0HB 4A68A 1E7UA 3O6FC 4LQFL 1HJCA 5GZOA 2XYBA 2WUBH 4CNIA 5L2KB 1SQMA 3BIKA 4Z7VA 1U8NA 5DR5L 3ECQA 4Y16A 3L4CA 3SDCB 5I82A 3BISA 4Y4KC 1WVZA 2N0KA 2OJEB 2P5EB 2Z93A 3OMAB 4ZFZA 3KYKH 3GQFA 1JNJA 2K3TA 2DQCH 3KPPB 3NDZE 1ADWA 1KG0B 1W8EA 4RMTA 4HPOH 1XT5A 4P4KB 1FE8L 4KK5D 1K3ZA 1UT1A 2PYED 2WYIA 4LSQH 1MQ8A 3U2IA 3V52L 3VD3A 1U3NA 3P0GB 1SPDA 3HZYA 3P4OB 2W9DL 4YO0B 1LWJA 2CDGA 3P0VL 4XE5B 2P3YA 4YHYC 3EDDA 1PPIA 3MOBL 1II4E 4ZQKA 4NIYE 1K2DA 2XN9B 2X2YA 4GIOA 5GRUH 3M1BA 1Z3GL 8FABB 2A99A 2H8PA 3QJZA 2PWEA 3E6FB 4KMQA 3BEWB 3HMWH 4WTWA 3RB5A 4Y19B 1KYFA 4O4YH 3OXRB 4LVOC 4OF3A 2J3SA 4FNPA 5DVNA 5GGUB 2AABH 2BOBA 2QEJA 3L13A 2Z4QB 4PVMA 3B9EA 1GPOH 3NAAH 1OGAA 3OLDA 5T1LB 4ZD3L 1CZ8H 5HYQA 2W88A 4M62L 1FZMB 3GS7A 3O11B 4R5TA 1HHKA 4WWKA 3H9SA 3LEYH 5L8JB 4Y5YC 5E70A 5EBGA 2YK1L 4MAYA 1MFCL 1DVFA 3QO0A 1WA0X 3RBSA 2ZWLT 2WXPA 4A1RA 3BUBA 5BV7H 3DV4B 2ZOUA 1CXHA 5ALCL 2HRPH 3D18A 3G5VA 4Z7QF 4PJDF 4HOMA 1SMOA 3N43F 2R1YA 4CKQA 1BBJA 5FYKL 3MRPA 2OZ4H 2HG0A 1GS8A 2BVPA 3UACA 1R24A 3BVUA 5J1AB 3S2AA 4WEBL 4GO6B 4N2HA 2FWUA 1MJ8H 3BRGC 5IB1B 2R0WL 3IDNA 2GBAA 4H8PA 5CKGA 2JH2A 2EE0A 4M00A 2NXZD 4KK9D 4KDTA 4HZLB 3OPUA 4G7SB 5I74C 5FO9B 4PWEA 1IQWH 4KQ3L 2MTPA 3H42L 3IU4H 2NY5C 3Q2NA 3G08A 1I3UA 2H1PH 1XSIA 3BUIA 2FO4A 4YSEA 4PTUB 5D7EA 1SY6L 3T04D 3FFCB 1A7RL 1WWBX 1PS3A 3EADA 5C71A 5I1KH 2IQ9L 4ZSOB 1INEH 2I60H 1ZSHA 3FL7A 2JQAA 1CFVH 3TPKA 3HPJA 4MSWB 2IFFL 2CR0A 5F3HA 3MNWB 4OV6F 3KJ6H 3ZBMA 4WNQA 1S8DB 2OJ1A 2PTUA 3CVCA 5ES4B 4MMXC 4GAYB 4BQ8A 3GHPA 5INDB 4FJ6A 4WSKA 5IWLC 2XWEA 1M1XA 4FQHA 2V5YA 5JQHC 1N18A 3CN4A 5I2IB 5FA4B 3QIBB 3EGSA 1GC1L 1PGRB 3LDBB 1ACYL 3RPKA 5JZ7C 2YZ1A 3BUYA 3VFTA 3PWNB 1IM3A 1N26A 4M5YH 1T22A 2NQCA 3VQ2C 2QJDA 3PWPD 3VXQB 4GAGH 4ODTH 5IMKB 4ZG1A 5DZNA 4OCXL 2VLLB 2FRGP 3HW7A 3NA9H 5JPNB 3QJOA 2ADGA 3L3DB 4BELD 1T1XA 5HYJE 1IKFH 2VE6A 3MV7A 1KB5L 4KJQC 2IBBA 4U33A 3AWFA 3UPRA 2DMKA 4FFZH 2F1BA 2XBTA 5EEXA 3DXAE 3MV01 2YAPA 5C0IA 4UM9D 3HRPA 5A2BA 2DQUL 2ITFA 3E38A 1VGKB 4JG0L 2C7UB 2VMCA 4MJ6A 3VXTA 2WBJB 1B0RB 3VSUA 3EF4A 1F8TL 4PJXB 3A24A 5BS0D 4B0MB 1FFTB 3WNOA 3U2JA 5D6CA 4N2GA 2VYRE 5EU6D 3ULVF 1V3KA 1YMHB 4APQA 3I6LD 4H13C 4HA1A 1Z2KA 1AS6A 2VMFA 3FSZA 3QZWB 4J3WA 1FDLH 2Y72A 4KX9A 2PYEB 4ZUVB 4DGYH 5DEFA 5CD5D 2NQDA 4GT0A 4K55A 4FCAA 5DWUL 5IV2A 4ODSL 3L2NA 4GKSA 3U7YH 2ZQKA 3FCSB 5DS8A 3GHBH 5KSUA 1MW1A 1SEBA 1QWUA 3LN5A 5AVQB 3TYGH 1K85A 1NCTA 1UATA 1MVFA 3LPFA 4Y9BA 3MHZA 5E8PA 3FTYA 3T4YA 2VZTA 1C5CL 2H5UA 1MHPH 2R4SH 3IAPA 2QVKA 3BVNB 2A9NL 5C0BA 2LQRA 2YA2A 4NZTL 1LDPL 4PG9A 1KT2A 5F88A 4YGVB 1BIIA 4PR5A 5AW9B 4Z7WF 2H32A 4FQLH 5AAMA 4D8PB 1T1WA 4QMEA 2XWDA 3W0WD 4HS6A 1ONQB 3MRFB 3NACL 4LPYA 5ICXB 2YPLA 2XZQL 5EF1A 3V4PA 2DF3A 3C5JA 3FB7B 4ONGL 2FZ3A 1Q94A 4XP1H 2ZXBA 4MA7H 2WCSA 1JGLH 2Y1VA 3S96A 1AGBB 2X4SB 1S9YA 4EOWH 2CAKA 4ETQB 3PU7A 3V0GA 1QI5A 3TJHD 1AZNA 3N1MC 4QF1B 3O8XD 2QGEA 3ZSSA 1RJCA 5ETUB 1N5YH 1X5KA 3QQDB 3P4MA 1GIGL 4E42B 1G6RB 5TTRA 1Y07A 1CT8B 1JPFA 1JWSB 1PZCA 2X89D 5K93A 4DGWC 4NFBA 3UZVA 2Y5TA 1XD0A 2WZ5A 4HCFA 2M2DA 1ES0B 5DJYB 4DIXA 2E9BA 5GRXG 3A67H 3ARED 4PRPD 4ZT1A 1XAKA 4I0CC 2XZCL 4PU2A 3ZTCC 3RBGA 5K9OA 4M7ZC 3KLLA 5GISH 1TFHA 1TEFA 1OY3B 5HI3D 2YD9A 3LNFA 2G3XA 1BVLA 3EF7A 3RAJH 35C8L 3GMLA 3NSDA 2NXZB 1KTRL 4MCYB 1UXMA 4E9TA 1H6FA 1QMUA 1ZLSL 1RLWA 4W1TA 1TTRA 5B1CA 1R3HA 5CSBA 3P9LB 4EEEA 5CBAA 3EO9H 2AQSA 5I18L 1CXKA 4G6JH 3IJSA 1UH3A 4KU1A 2NXYB 4ONHA 1IM9A 3N9GH 1GYAA 3NCJL 2HFEB 1Z5LB 1YCSA 3GJFA 2R0KL 3SDDC 4UTAL 5FF6B 3IETB 4MNQB 1JZ5A 1KJ2H 3S5YA 4MVBD 4HBCH 4QRTB 2G2NA 1AQDA 1J1XH 5E8OB 3T77B 3O41A 4UT7L 3LQZB 1F45A 3PPSA 4UIMB 3QIWA 1XR9A 4JX0A 1X7QB 4I1NB 1EERB 5IMLB 2EC9U 4NQSA 4YH6A 1A6WL 2JKSA 3UO1H 4XBEL 1PZ2A 1UOWA 4DGIL 4EI6A 3QCTL 2FT7A 3IEAA 4X5XA 3DX8A 2Z8VC 3K74B 4OGAC 3B9KA 3PJSA 3CFUA 1D7BA 4PWIA 1ZLWK 3MXVH 4Y2NA 5EBWB 3U79A 3QDJA 1V3LA 4GMSH 4AQAA 5A6IA 2C9AA 3ECBA 5J0BA 2F54D 4HCGA 4ZTPL 3EJRA 4MJ2A 3M07A 4N3TA 2XWBB 3RFZB 2EEBA 1FLTX 3E8UL 1XTMA 4G8AC 3VXPA 1Z0NA 1VGEL 2JB6A 3FH7A 3JV5A 1VFBB 2A4EA 4XI5D 1CIDA 4OI9A 4P2OD 3BDYL 1E9PA 2IVFC 1ET8A 4X80H 3T8XA 3AM8A 4UUJB 5HGBA 2OI9C 4G6AD 4JFHD 1DJZA 1YVLA 4L5FE 5KBDA 3B7TA 2VLJD 1JF1B 4UM9B 3BO8A 5JTWA 3WIFB 4PRIE 3WKYA 3QHZH 1ZIBA 4AGLA 1OIOA 2A83A 4JM2A 5HXMA 5JXED 3RX8A 2IANA 1OP5H 2G5BA 2WTPA 5KTEH 2R39A 5JLZB 3GB7B 3N44B 4HGWB 5HHOB 5BS0B 3GSXB 1NPNA 3H55A 2FL5B 2YGNA 4D9LH 2VERA 3LHPL 5AAWC 4AQEB 3M17A 5EU6B 4AL8C 4GB9A 3P3YA 3S5LG 1R9FA 2APSA 2Z1KA 3ZDYF 2F0CA 4YHIB 1JV5B 1U8KA 2XHNA 1QLEL 1CGSH 4R7LA 5JR1L 3D2UD 4PN6A 4U1GB 4ZYKA 4KI5E 2DQTH 4E5XB 5I8OL 3EFFB 3VACA 1VIWA 3HG3A 4XVOA 4TQIA 2LTQB 1U8IA 4JFDE 3O6LL 4UAHA 5J6GA 1H8OA 3ESVF 4OJFL 4QHNB 4JFXB 5CKAA 1KFGA 5D7JA 1MHEB 3LEVH 5ALBH 3NTCL 4IEFA 2BNQD 3VGAB 1NLDL 2F19H 4OLZH 1UWXH 5AEAA 3ABMB 2DM7A 3QWRD 4WFGD 4HH9A 2KQNA 4G72B 1D6EA 2OXGA 2WVTA 2DM3A 4Y1TA 2ZXEB 5AB1A 2YRBA 3U1SH 2CGRH 3BZDA 1F58L 2AQQA 1NLBL 3ZY7A 3EXJA 1INDL 1VERA 5AW5B 3HNTL 3BN9C 5KJ7E 3O8XB 1H9VA 2XUWA 3CXHJ 4YNYB 1JGDB 1HNGA 2FR4A 5AAPA 2Z34A 4WKZB 2DJUA 1KELL 2AQTA 3CBRA 1ICTA 4WHYG 2Q8AH 4GW1A 1GGUA 3UDWC 3KL3A 1FGNH 1YJDC 2YQGA 4ELMF 1BZEA 3ZR6A 5SV4A 3VRLE 4ZUSB 2PNDA 2VUYA 3KLKA 4YX2L 3WKMH 4OIAA 5DO2D 2OLDA 3C87A 4H8WC 5D7SL 5D2NA 4DHLA 3NJJA 5C8JB 1IZKA 4UIKL 4PRPB 5LBSA 3C6LA 1A7OL 2F7QA 3HIZA 3U48A 3MLRH 1HINL 4MA8L 1LD9A 4OZIB 2BFVL 5E5MA 2ADIB 2Y24A 3GI8H 1YEEH 2NY4C 1DVZA 3OHXC 1CG9B 1Y1UA 3UTOA 2DBJA 2LE9A 3DVNB 4L4TD 4OFPA 3DGGA 4JCWA 4BJLA 4XCCL 3EDKA 1TTCA 3JWNE 1QA9B 3CFQA 1I8LA 4HZ1A 1WITA 4NHCL 4N8CL 4YLQT 4EUPG 3GDCA 5L4JA 1WAAF 5C70A 4XP4H 4KAQL 1I3VA 1EMTL 4DOHB 1AYRA 1IGTB 2L0DA 3IDYC 3HN3A 2EINB 2W0FB 3BH4A 3DMMA 3GMMB 1S7VA 4LDOB 5IW6A 5IVXF 5EH1A 2MKLC 1Q9WB 4FABH 1JRHI 4E41A 2N7AA 5E1GA 1H15A 3ZDZB 3ZDXF 1GYCA 4IHBA 5DJCA 1KGIA 3ZYOA 2BVUA 4HWBL 2EEAA 3WTTA 5BZZA 2VABA 1A1MA 4JK0D 5LCVH 3V55A 3BEVB 2NSMA 4RAHA 2NY2C 1R5VB 1RU9L 3QORC 1AANA 2WP3O 4I0KA 3D0VB 3RHWK 3BAKA 4N2DA 3IDJB 3TESA 4HD5A 3K0YA 5FLVA 5E2VL 3TBYA 3RWEA 5EC1A 5TQ2L 3WDJA 2VRQA 4LLVB 1BZQK 1OP9A 3FFOA 3KPSD 3LH2L 3HN8A 2H6PB 4R9HA 5EA0H 1UXSB 3EBIA 4JO3H 4LSVL 4ODWA 2EYSA 4R3SB 3D08A 4XMVA 1NCUA 1G7HA 5HHPB 1HSBB 5ELIA 5AZ2L 2GTQA 2WB1A 1MHCA 2AK4E 2Y3NA 3BAIA 3H8NA 4TRPL 4N2LA 4WUKL 2F54B 3FCTA 3T08A 2ICCA 2PYFA 4F9LC 2IMNA 5E1IA 3VXRE 2HYMA 5IJVA 1U93B 5B7FA 1VADB 4J8RA 5T3ZL 2AEPH 3AG1B 3P02A 3TWCH 4WI2A 1J10A 3CVBA 1MPAH 1NBYB 1OAYL 2P5WA 1SJXA 4JHWL 4RWYL 4P2OB 4KXAA 4FLQA 1FH2A 1QR4A 2HMID 1YEKL 1USZA 3QRBA 5GHWH 4NHUA 4QYOB 3O0RL 1CN4A 1KIQA 3GTTA 4F7TB 1AOZA 4NP9A 4YHLH 3ARFD 2OMYA 5EC2B 4Z7OE 4TNFA 4R97C 4FNRA 4M6OH 3FRPG 2CO1A 1ILUA 1QSVA 3MV8A 3X11B 4F58L 2EKSA 3QUMB 3MLSH 4JPIB 3BZEA 3QRGL 4U1IB 1FA4A 4QRPE 1SLVA 4H88H 5JW4N 2FEDD 5CO1A 3V6OA 1WUZA 3L17A 1DN0B 3UYRL 3QZLA 5CZKA 4IRJA 3P0YH 5DUPH 4DPRA 1P4LA 1U92A 1ZT1A 5EHFA 2E0PA 2RHEA 1ZD6A 2K6ZA 4P5TA 1Y18A 4EI5C 3QP3A 3U6XS 4DKAA 4GAFB 2YKKA 2OMTA 3D2UB 5TDNA 1XEDA 3JWDH 4Q0XL 1U3YA 4PJEE 1BEYH 2DQJL 3W9DA 2AP2A 5E4IA 3EZJB 2AXHA 4I1RA 2VXQH 4WUUA 5C97A 2JJTC 4XN7A 5JIDA 1KXVA 1DQLL 5EEWA 3L7FB 2ZCLH 5J9PA 2OX5A 5FW7A 2FQEA 2CIIB 1AO7D 3HR5B 3VUAA 3EH4B 1MCKA 3OB8A 3RGBA 2CA3A 1M4KA 4G8GE 3FO1B 3TF7C 3ABZA 5L6YH 2XQBH 1JZEA 2M26A 4OD1H 1QWNA 1YJDH 4JHBA 2BNQB 1EGJL 3WFZA 2HRLA 5JW5B 2W59A 1NINA 2OW7A 2RQEA 3BSGA 1CXEA 4H8WH 2CXKA 1NANH 3L4VA 3O3EA 3QAZB 4I9XA 1KSRA 5CIPH 5ESVB 5I16A 2H47C 3UJTH 3UTQA 3PHOB 4JG1L 1BA9A 1RZJC 3MROB 4AE1A 1FVCA 4NSKA 3EW3B 3TLRA 1R4XA 3GPEA 3GSWB 3BCFA 1FO0L 5E99L 1WTGT 1XF4B 3TOPA 4ETYA 2J1XA 2VITA 5E1HB 1RP8A 4OGXH 3RPBA 2X2UA 2K6WA 4UDTB 2XX0A 2Y06L 4XP5H 3SY6A 3AC0A 1A6UH 1T0MA 2FDBP 1QR1A 3KL0A 3KLQA 1KYOK 4RX4D 4LLDA 1I8KA 2EDTA 4J6RL 5GS0H 2D31A 5T1KD 5LHDA 4G6ML 1ZTXH 1DBBH 1IBZA 1MXGA 4XGZB 3T3PE 1NMAH 3BX7C 4FQJL 3QJSB 5CCJA 3EJUA 4K71B 4C56A 1IAKA 4ZO9A 4JKPH 2KL6A 3ZKXB 3BSZL 2GQHA 4IJTA 3N06B 5CZXD 1NCCH 3QQXA 2AQPA 3CIAA 2HKHH 2BMKA 1WICA 1AG6A 3SPHA 2RIKA 2VDPH 4L4TB 1CD1A 5DRZA 2CLZB 1PSKH 1AKJA 1IV8A 3GTVA 4HWZA 2HWZL 4OQ1A 4CJ0A 1BF8A 2UXTA 1B0IA 4JFPB 3U30B 1XGPA 3OTTA 5KN5B 2AJ3A 1MREL 4KXBA 2B2XH 2W65B 5CNHA 1M6UA 3FFDA 3NIFB 5IJKC 5B39A 1NJ9A 3IFOA 5GGSB 4NM4L 2IGLA 4TKWA 3HG1D 3H6JA 1MAKA 3DJZA 3WXVH 5FCSH 2W0KA 1N19A 4MZIA 3SCMC 4Y1SA 1UUSA 3EO0B 3IRCA 4JKLA 5B1JC 2QSTA 5FOBA 5JPMB 4JUTA 5E94A 1SEQH 2JTYA 3G6JF 4IIQA 2Q7NA 2EDMA 3KVPA 1T4KA 5GGVY 2OMXB 1AHKA 4X99A 2Y1AA 2FJHB 4AVJA 5K59E 4HV8A 5E6RB 1QRKA 4NKQB 3O4OC 3NRPA 5GRZA 5ADOH 2ATKB 5JIQA 4ZZKA 4X6FA 2DIBA 1LE9B 4ABUA 2BY3A 3IMUA 4FADA 1KULA 4OY9A 4UQCA 3S6CA 2D7OA 4TUUA 1N8OE 3IU3A 4BFNA 3T0VA 3U4EA 5D7IE 3HNVH 2E4FA 3WLWC 2DMBA 3AQYA 2BOLA 2FGZA 3ATBA 3HNSL 5B8CB 1IGIH 4PJBB 1PY4A 2HJKA 2XWJA 4MNGE 3PP4H 4D3CL 2YQBA 1EEYB 1BAGA 3WEAA 4Y89A 3FHAA 2EO9A 4JREB 1U8CA 4LVNC 4NZFA 3RRQA 5KSBA 3RB7A 3UJJH 4A39A 3LOWA 1GZHC 2HX9A 4NENB 2RQ8A 3ARWA 4J3UA 4LKXA 4FTVD 3RLSA 5TPWL 2R8SL 3ARFB 3QQ3A 1PZBA 4R5XA 2UXVA 3LJ3A 4HUMB 4TXVB 3R7QA 4LRNL 1AP2A 4GXFA 2ADYA 2ZAIA 3TYFA 1I8UA 3PDOA 3UAEA 5E2TL 3ARDC 2WLMA 1CS6A 4Y9EA 4M5ZH 1B4JH 4LCYA 3V0VB 4HF5L 1XF5A 4XNMA 4M1CD 2ZG2A 2CLVA 4UDUB 1PLCA 1SY6A 1WWCA 2DL2A 3L6FA 4KNUA 3RGVB 5FDWA 4V11A 1J11A 3L5XL 3PYCA 2BIMA 5C0EA 1OAZH 1T21B 3WNIA 2WGXA 4L0PB 4PRHE 1XCWA 2QGCA 4J28A 3UX9B 5C6TH 1CFQB 1NFKA 3DHJA 3POCA 4G1EA 1AXSB 3ZKMD 2OW6A 2ZP9A 1HYSD 2LGNA 1U3HB 2DM2A 3HLAA 3PAVA 1RZJH 3HB3C 5KS9A 3AG2B 1YMME 3QIUD 3SKMB 4KDVA 2HFTA 2X0VA 3CFEA 3EYFA 3ALWA 1SJVA 2LFEA 2E76C 5JORB 4RGNE 1MFBH 5F7KC 1WIPA 1JIBA 3FUNA 2XZAH 1HXYB 2P26A 3AZUA 3I50L 2P4AB 2CG9X 2FO1A 4X4XA 4U1LA 3DHMA 3QCVL 1JTOA 4JPWL 4OUUA 3MOAL 4AJ0A 1SF3A 5CP7B 5HDBF 4CUCA 4RISL 5IVZA 4MRBA 4Q9QH 2JSFA 2GAZA 3NZHH 4JAMB 4UM8A 3QYMA 3DYPA 4Y2DD 3TO4A 1XB8A 2GK0B 4NQDA 1CBVL 4CMMB 4XTRD 3JQOB 3IFLL 4HJGB 3C5ZB 4MA3B 1HQ4A 2EZ0C 2X3BA 1P5VA 1XV8A 4NQXB 3BZ5A 2EYTA 3QUYA 5DUML 5K39B 2NT0A 1S78D 4XPTL 5ISZD 4XNZB 4H44C 2IOMA 1KB5A 5DHYB 1A6AA 1PDKB 3EOTL 4GBXA 2CLRA 5EPMA 1EZVX 4M3HA 4N0YH 2ED6A 5T1KB 1S7UA 4E0RB 4MWFB 2WPGA 4P3CH 3TBWB 4LESA 2DQEH 1MVUA 1M6OA 5E8NA 4OBRA 4JRXD 1JXGA 4X9HA 2NMSA 2W38A 3F65A 2FJSA 3RWDB 3RDTC 2HA1A 4HIXH 4D0DA 1F6FB 4UB0L 4LCIL 1DJSA 4JY6B 4UBDC 5FM5O 4ILDA 3ZRFC 4GS7C 2OR7A 4JN1L 3GINA 4MD4A 4YHNB 3FUIA 1IC5L 5F72S 5C0FB 4KOBA 2E9GA 4BWWA 1KGCD 3ARBA 3RWJA 2ARJA 2VOTA 1A21A 5D1QE 5IOKA 3OF6A 4IRZH 5HI5D 1RZ7H 4P59L 1MCOH 2WYZA 4HIIB 1SDYA 4U1KB 4PRDB 3MJ7A 5LNEA 3MNZB 3HG1B 4I48B 4KMTL 5AW1B 2XNAA 1SXAA 4P46C 4QRRA 4AM0A 1K5WA 1PZDA 2YD8A 4UNUA 3LQAH 4F20A 4N1CA 4YBQD 2VXTL 4B95C 1UJ3C 1HN1A 3LN4B 5I5JA 1QNZH 4N6RB 1WFIA 5IT2H 1ANUA 4NRXA 1M2VA 4JDTH 1AKPA 3Q7JA 1E90A 2KERA 2IH3A 5IR1B 1FH5H 1UG9A 3BQVA 4XP6L 2F08A 4FKHA 3C5SA 1NEUA 3SYCA 3S5LB 4PJDB 2NSQA 3FQXB 2I69A 4PB0H 5ACZB 1FL5B 2Y7LA 5M95B 5ILTH 5BVJB 4WO4D 5DI8B 5A6LA 2L7JA 5DFAA 5HGAA 1ZEAL 4KZ0A 2FYYA 2PWHA 3RTQA 5AW4B 1BFOB 4KY1L 2VN7A 4I0PA 5D8JL 2IG2H 3WUWG 1IGJB 2R2EA 4F1ZA 1QBAA 2BVEA 3F7VA 1B0GA 3Q2WA 4QXUL 4X6BA 2XN0A 3ETBF 2E59A 4KXZI 2Y7NA 2P80A 3HG4A 1CJYA 3VI4E 4TUJA 2GJZB 1FFOB 2BO0A 3KNBB 4X5WA 1PYWB 4AC2A 4Q9RH 2H6OA 3CBJB 4O51B 4I88A 4YGAB 3AQZA 4I2XE 3FUKA 3P40A 4JFQB 4NNPH 3ZQWA 1YNTA 1FPTL 2A1WH 3WY3A 3VXNA 4MCMA 5LGHL 3DJSA 1MFAH 5DK2B 3V10A 2OK0H 3X1GA 1JHKL 4NUGL 1LEKA 3HRZA 4S0TD 3DV6B 4XXWA 4IQHA 5B3JF 3KPRE 3DGDA 3MNDA 1G9HA 3NJIA 2QELA 3WN5B 4AQZA 1RHHA 1Q4NX 2ERJC 3MJGX 2FJFA 4UU9A 5ERWB 1U8QA 4Z76B 2EE9A 1I1FA 1W0VA 1OSPH 4Y4FB 1YEJL 1T7ZA 3MRKB 4TNWF 2NOYA 5E51A 2BNUA 2XQYA 4OF8A 2BDNL 2HFFA 4N0UA 2GJ6E 2V7NA 4HQQH 1AZVA 3STLB 2K6YA 4HKBA 2ZSVA 4HIQA 4UTAA 4YSRA 1EHNA 3TV8A 2DH2A 1MCRA 1UXLA 3GXNA 4RGOH 4DKFH 2MJWA 3U2SB 2BP8B 1R6VA 1FFRA 3KR3H 3D85D 4NNYB 3GMQA 3DYOA 5DEJA 2KUTA 4QI3A 4LARL 1L9QA 1U8PA 4U6YA 2E27L 2VL4A 1CLCA 1TLKA 1V3JA 1E8ZA 4TTGA 4FXKC 4JFFE 4CL7A 3F00A 3HE7D 5D6DC 2BSSB 1YY8A 1KCVH 4HJTA 4EUPB 1A9VA 3VRIA 2BVOA 4NRYA 3I3DA 1UWYA 1BZ7A 3SGEI 4KTEH 4MS8D 4KV5E 4RRPG 5JQIB 2DL9A 3J07A 4K9JA 1V54B 4O2CB 1CYXA 4UINH 1LEIB 2KLRA 5GXBB 1U21A 4LLUB 3PJNA 4Y2DB 5GGQH 2YAMA 4BH7B 6FABH 1PLAA 2NW3A 4YSSA 5AVYB 1HOCA 3H1ZA 4RAUA 5IBTL 2J1ZA 3D3VE 1PBYA 4PGBB 1JTTA 4C57C 1HAWA 2ATAA 1JF5A 1BMWA 1A9BA 5KVMC 2LV4A 3FONA 5ISZB 3C09C 1NFIA 2BSRA 1U2CA 1H8NA 3EBAA 4NN5C 4QGYA 3G3LA 2ZOKB 1BX2A 3S3SA 5IFHL 2G75B 2I7SA 5F1KC 2PR4H 1M7IA 1DBJL 1HKLL 2AV7B 5B38G 4XPBH 1UB6B 4JMNA 2MH4A 3BVTA 1UA3A 4JJHA 3K46A 4B9FA 1I3GL 2AEIT 2IXQB 1PKOA 1NBZA 2O6EA 4W81A 5BJTA 2BVQA 1QNIA 4PJ5E 4Z7NE 1W72L 1BLNA 3GBMH 4N2EA 5BO1H 1OOWA 4DP9X 1L0XA 2CZNA 1HQRA 1FGVL 1KCSH 4L8SC 4N5UA 4ZUTA 3FU7A 4PCKA 1HH6B 3FBQA 2VDQB 5GZOC 2XBDA 4W9DC 4V1DD 5LGKA 1NFDA 3MRBB 3T71A 3V4VB 4S1SL 5ANMA 4Y16C 1HL8A 5B4MD 2Y23A 2EDYA 4GRWE 1PAMA 3F58L 4HEPG 4RBPK 1P1ZA 1DSWA 4FI6A 1DBAH 1MCWM 3FPXA 3WGUB 3ZIYA 2X05A 3Q43A 1JK9B 2ENQA 2BVYA 4GJTB 4B53A 4XMKL 4DAGL 5IHUL 4M4PA 4GG6A 3VVWA 4U7KA 3MGTB 1DEEA 3BMVA 1TQSA 5DVOA 1GGIH 4G42A 4YDLC 2D4FA 4L23A 3P73A 1MCQA 2YMXL 4ZX3A 2CJUH 3F12A 3KJ4C 5GSVA 1RV6X 4HMCA 2UYLA 3HE6A 4W70A 4RH4A 1EQWA 1WK0A 1XIWA 2YOCA 4PYGA 3VWJA 4EVNA 4G80A 4JEGB 3QULA 1U30A 3ILQD 4KVCH 1XGYH 3V9FA 4B5ZA 1BM3H 1XSKA 3AQXA 4QTFA 5I1GH 1HS6A 4XNUL 4WTQA 2V8MA 1NGZA 1GKOA 2XVKA 4GXVL 4YC2B 4J39A 3BQUD 2HT2C 1RUMH 4NIKB 4X6DA 1BQRA 1FSKB 2OMVA 5HP5A 3QDMA 5H94A 2DYPA 5LQBL 1M7DB 4PWFA 2IPUG 2KI6A 4OLUH 1PLBA 2WV3A 4X6CF 1PJ9A 4HIHA 3VFMA 1X5ZA 1RK1B 4QRSB 1L6PA 4JO4H 4U0RB 2IADB 3X1EA 5I8CA 1TZIA 1DVFC 5BUPA 1PX3A 3AT8A 4IDJL 5MENE 1XO8A 3FAXA 3I9IA 2APFA 4AK2A 4M43L 3V6FA 4JY4B 1J8HB 2J1KA 5I17B 2VDOL 4DK5A 7TAAA 2J71A 3JWNG 3HHMA 2PR9A 1FNGB 2VLMD 1KGXA 1N4XL 1NGPH 3DROA 4JHZA 4IOFC 4AQ8C 2TAAA 3T0BA 4HU8A 3VD0A 4W9GC 1BDYA 3V0WH 2K3HA 3MGOB 1Y7VA 5EUKA 3T2PA 1UFUA 5DHVH 1OAUH 4RNRB 3WYRA 3GBDA 1N64L 2YS4A 1I9IH 1LYQA 3VW3L 3EJQA 1PD6A 1JRHH 4P3DA 4KDTC 4M4RA 4AYSA 3P11L 2UZYA 1ZIAA 2X4TB 3PABA 1G7JA 3OZ9H 4XBGA 2X4QB 1PJWA 3R18A 1OAJA 1RUAL 2NY1C 3L4TA 2XA8L 3EAKA 3G5YB 2CO7B 3FB8A 2FQGA 2DIJA 4RGMB 3NIDF 1FIGH 1GOHA 4WU5B 4GPVA 4Q6YA 4X7TA 4CADA 5DC4B 2DQFA 4NPYB 3S7GA 3DIVA 4O02B 3D85B 1K6QH 4FFYH 3HZMB 1TJIL 4GSQA 2F7IA 3X13B 2AGJH 4LP8A 4Z5RA 2ZWZA 3PXLA 5IUCA 4MQ7A 2GITB 5EOCH 5FO8B 2Z31C 3FSWA 4LSTL 1PZSA 1R5IA 5FUOH 2Q20A 2WIMA 2A4ZA 1OGTA 1YZZA 3NK3A 5CZRA 2ZCHL 3NCYS 4JG5A 3SKOB 1E5CA 3QZMA 1RH8A 4IW4C 3SY0B 5BXFB 4X98A 3QJQB 3DOSB 4XHQA 3S37L 4K8RC 4O00A 1CFNA 3UADA 1LO2H 4JFEA 4P8QA 3CN3A 5KYWA 4G9FE 4PJAF 1R3KB 4YZFF 1KLUA 4NBZB 5AWNH 5CJXA 3WO4C 1A3LL 3BUQA 3T09A 1BFSA 2YRPA 1IBHA 1RZ8B 4KI5C 1HFUA 4AUJA 2A9ML 2CDEA 3VI3F 3B56A 3QRFM 2UZIL 4AT6B 2ORBL 4RZCB 5IIEA 4X7SL 4UMSA 2ZUYA 1RK0A 2VLRD 4ZFOL 4PJIF 5FC9A 2NNAA 4M1GL 4HOWA 5F0MB 4F7CA 5IQMA 3BE1H 5MEOA 1QWHA 4PB9L 1VACA 1DP0A 4JFOA 4PFEA 2W07A 4PJ7A 4UZSA 1YYML 2H2SD 1F42A 1QRNA 1NCDH 3RWFA 4BRJA 4GI6A 5AVRB 2HT3C 5MEQA 3BJLA 1T89A 3ZDYB 4H1LA 1CFSB 3EZ8A 2CKBB 3ZL4L 2F53E 5T5FL 4DZBB 2BRRH 5BRZE 5ITFA 3VXUA 4MCZB 2IV9A 2ZOOA 3PQYA 1S3KL 1M42A 3U25A 5CEZH 3I02A 3UBXG 2J88L 4B6ZA 1L9OA 2QGDA 2AXWA 4M3KB 5FCUH 2FNBA 5K5YA 2CSPA 5G4MA 4N2KA 2YZ8A 4S1QL 4AVKA 3QYCA 2O5XL 2IPTH 4X7DC 2DV6A 3BAEH 2HVBA 2G9HA 3MFFA 3VRJA 5I9QB 5ICZA 1PTZA 1EDHA 2FSEA 4IDLA 3HC4H 3PNWA 3QUZB 3IAQA 3PV6A 4JDZA 4UNVA 2IOIA 1QG3A 4APQC 2YEZB 1JE6A 2P8LA 2RFXB 3D30A 3QEUA 1MJJA 4ZX5A 1AGFA 3UGUA 5F7FA 1C7SA 1LO0L 2EEFA 1CF1A 2E5EA 4FNTA 4H0LC 3O9WD 4KBPA 4N87A 3IWVA 2A74A 1I1YA 3IT8D 1ASQA 5DEGB 4P2RE 1NEZA 2WLIB 1KTCA 1M57B 1U42A 2F1AA 1Z5HA 4X8CA 3T0EE 1KPRB 3BYTA 3D39A 1E4HA 2F74B 2ZXQA 2JK5A 4JFYB 3MZTA 1EGJA 2P5PA 3QXDB 4KO6A 1SHWA 4U2ZA 4G8FB 1NKRA 2VQ1A 4JN2B 1ZA3A 2DLTA 5H4ZA 4B7IA 5AAMC 1F3DJ 2IWKA 5TE7L 4F7PA 5DS1A 1F5WA 1R75A 4OGYL 1XF3A 2W91A 1CK0L 4HFUL 2A77H 1ZDSA 1WZKA 3REVA 1NCAL 2UZPA 4Z0XB 2VISB 5A16A 1LL1A 1CICA 2VR5A 4XPAH 3IJEA 1OE3A 3UG4A 3I2CL 5E4EC 3HCVA 3QR0A 3VH8G 1A8JH 2DQMA 1CGYA 4X5RA 1IGFH 1D5BB 1QW8A 5H35B 1G6RL 1MI5E 1UKTA 1DJHA 3QNXA 1KJ3H 3WBDA 2VN3A 3TWYA 2VXSL 3O2WL 4BK4A 1QHPA 5IVXB 5FAAA 3KGTA 1W0WB 4R26H 5CSZB 2PTTA 3D34A 3I9GL 1FF5A 4R4FH 3R06B 4LCWD 2GUOA 3EJZD 4JO1L 4XPGL 3SDXF 4OF0A 3Q6FB 5F6HJ 1XD1A 1I1RA 4B27A 5D1ZA 1URLA 2XA3A 3WL9A 4PRID 3R0MA 1WHOA 1B4LA 2J5LC 1A1OB 4UAOB 5EWIL 3APNA 2DEYX 5FGCE 3O3UN 2BHUA 5FYLE 4MA1B 4ODVL 5HHQA 2P9RA 1NIAA 3D6GA 3K1KC 2UX6A 4ZPTA 5BW7A 1DQDL 3IDMA 1JDAA 4PJ8A 3TFKC 2ZPKL 5JOEA 3RNQA 3REWB 3VWKB 3FYEB 3L95B 4GI8A 3WU1A 5DZAA 4NQCA 4CGUB 4U1SA 2NY3C 1ZK9A 3PRZA 1WEJL 2UX7A 1LE5A 3QA3A 5C2BL 1IEAB 4M29A 3IFPA 4MJIA 4DNLA 3R8BB 4IOIA 1GGBH 1ZRUA 3CFIC 4NPJA 4E68A 1B9ZA 3WFDH 4YPJA 4NN6B 5HYFA 2I25N 4HUKB 3TH3T 3V6ZB 3ISRA 1TCRB 4JFDD 4L3EE 4NWUH 4KO9A 2LT9A 5B7EA 4ZS6C 1C8PA 2PF6A 4GSDH 5I19H 5DJ2B 5AOMA 7PCYA 2VDKB 4AQ1B 1UZ6E 1TJHL 2JV6A 1E9QB 2NYKA 1F00I 4IMLB 3U0WH 3B9KC 1HZHH 3Q13A 1AIZA 2P52A 3CFBB 3NH7L 1S7TB 4JKMA 2AKRB 1CDYA 4M9OA 3O6FD 4XNXL 3UJIL 4EDWL 2VLRB 4BZ1A 1NCOA 3EFOA 4K3GA 1D5IL 1K4CB 4M8UA 2Z1PA 3HC0B 1T7VA 2ZYIA 3BWSA 1UVQB 5CD3A 5D5ME 4Y4KD 3CXHK 1GH7A 1FL6B 1YRKA 4MZ3A 3FOMA 5KYXA 1FCCA 1JPSL 2ADFH 1JCVA 3V8OA 1CCZA 2WSKA 4XMWA 4LEOA 4KY2A 5G4NA 1ED3B 5FXCH 3BDBA 3AM8C 3Q9PA 5DDHB 1CLVA 2WMPA 4HUVB 3KYMB 4NNXA 4X6EA 4DFIA 3AY4A 1L7IH 3VFNA 2GBTA 4B5EA 5JNYB 3WUWB 4NLHA 3CSFA 4CVXA 5CLWA 4JM2C 3QDAA 4HEMA 1BD2A 5LLIC 3QJXA 2EDDA 3OR6A 3C2SA 1L0YA 4KZEL 1C12B 3HS9A 3GZQA 4G5ZH 5K9QG 3PXHA 2ALWA 4PJFA 4Q58C 2RALA 5T33L 4Q89A 4AENB 4HPHA 2H32H 1FP5A 4LLYB 3A6CH 2HH0L 3ZE0F 5HHVL 4N0CC 4YBLC 2AAVA 3Q1EA 1B4TA 4JANA 3SZ6A 3VG0H 1F6LL 3O9WB 1GOGA 1JS4A 1QI4A 3FO2B 3FQRA 4ZDHA 3V4PH 1KFAH 5EO0A 1NM4A 3P3TA 2ESVD 1SYSB 4WIQA 2QVTA 3TNMB 3INOA 4RIRA 1U6AH 4QJ5B 1KY6A 4X2UA 4QT5B 2PO6A 4ATTA 3QCUH 2I7OA 3FO0H 1T7WA 3G9VA 4HK3N 4XNYL 5HHNA 1ORSA 3ARGA 5I15L 3CLFH 3CUPB 4WI9A 3VA2C 1L9SA 4NI6A 2D7TH 1KIPB 1SMDA 2DBLL 5E2WH 3S34L 1HHJA 3AY2A 2X1OA 4LVHC 2B1HH 2KZWA 2WXRA 4OTXL 3MBEA 1PEWA 3VSQA 1KGJA 4FLHA 3MRRA 5E2UH 5CF3A 5I8EA 2APTA 2ODIA 2BWQA 2X6BA 1CL7L 3KBFA 2XVBA 1NBQA 4XMZA 3U4BL 2X5PA 43CAA 4OD2A 1F6AA 2OR9H 3PWVA 1U4EA 3PAYA 2IEPA 1CLZL 5CWSA 4OZHA 2DQ6A 1E7VA 5DURB 3I9AA 4U49A 4M61A 4EMZA 2J8UE 1LO3L 5KVDH 2NW2A 1ZHBA 4K5PA 4FG0A 3WNLA 2V2TB 2GY7B 3MA9L 4Y8DC 2QT6A 4N90E 5D2LA 4A7SA 1TPXB 3O3AB 4R90H 5IQ7L 1TNMA 3C6LC 4LCWB 3KAAA 2DDQH 4ZI8A 2D2OA 3G6JB 5IP4A 3LZFL 2Z4TA 2B4CC 1F3JB 4OU3A 3JZ7A 4W9LC 3GJFH 2Z0BA 4X7FC 3UC2A 4PRIB 3D06A 2B1AH 25C8H 4BFRA 2GYSA 4LCCB 1MNNA 1U36A 1B9KA 1XWVA 4MMYA 4RRPM