1JWQA

Structure of the catalytic domain of cwlv, n-acetylmuramoyl-l-alanine amidase from bacillus(paenibacillus) polymyxa var.colistinus
Total Genus 70
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
70
sequence length
179
structure length
179
Chain Sequence
MKVVVIDAGHGAKDSGAVGISRKNYEKTFNLAMALKVESILKQNPKLEVVLTRSDDTFLELKQRVKVAENLKANVFVSIHANSSGSSASNGTETYYQRSASKAFANVMHKYFAPATGLTDRGIRYGNFHVIRETTMPAVLLEVGYLSNAKEEATLFDEDFQNRVAQGIADGITEYLDVK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords N-ACETYLMURAMOYL-L-ALANINE AMIDASE CwlV
publication title The Structure of the catalytic domain of N-acetylmuramoyl-L-alanine amidase, a cell wall hydrolase from Bacillus polymyxa var.colistinus and its resemblance to the structure of carboxypeptidases
rcsb
source organism Paenibacillus polymyxa
molecule tags Hydrolase
total genus 70
structure length 179
sequence length 179
ec nomenclature ec 3.5.1.28: N-acetylmuramoyl-L-alanine amidase.
pdb deposition date 2001-09-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01520 Amidase_3 N-acetylmuramoyl-L-alanine amidase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.40 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Zn-dependent exopeptidases 1jwqA00
4RN7A 3CZXA 5EMIA 3QAYA 1JWQA 4BINA 2Q7SA 2ODFA 4M6IA 4M6HA 1XOVA 4M6GA 4LQ6A 3NE8A
chains in the Genus database with same CATH superfamily
3R95A 1CBXA 2CTCA 1TKFA 1NSAA 3SI2A 4CYQA 4OC4A 3B3WA 4YRHA 3BLNA 2JDCA 1TKJA 5EBVA 2PC1A 2PJBA 3SI1A 4YFJA 2GLJA 2OZGA 4A30A 4CPAA 5CBMA 4JLYA 4W9YA 3RYOA 4FAIA 4KS9A 2ZEFA 3F5BA 3VATA 3DGVA 2BOAA 2POKA 3LMSA 1Y7RA 3ZJ0A 4IK2A 2HB6A 4B10A 1KUXA 2R7HA 3TOAA 4CGNA 2CY2A 5A27A 1DE4C 3FH4A 3IWEA 4ONUA 1S7FA 4EMEA 4MHYA 2EK9A 1AUGA 4KOVA 3NH5A 3TT2A 1GHEA 4FD6A 4MCSA 4B5PB 3B2YA 3SXNA 2PJ2A 1WWZA 3QAYA 3BJ8A 3FMCA 3SJFA 3IFEA 3B3SA 3WABA 3P2FA 1IYLA 1YVOA 4QVTA 5CNPA 1FY7A 4Q7AA 3FYNA 5IV0A 1B6BA 4HKFA 4FBEA 2QVPA 4UFXA 3TO6A 1YW6A 1M44A 4IUSA 3TX8A 2V8HA 2FL4A 4PXEA 2JLMA 4TWEA 3S9MA 4BINA 4LUAA 1PU9A 5DWMA 3DR8A 2Q4ZA 1P0HA 4KUBA 3H8EA 1Q2YA 1RTQA 1XFOA 5HVFA 1Z8WA 2REEA 4JJXA 1VHSA 4LX9A 4Y49C 4YGOA 4CYPA 2NMTA 3FF3A 3NA6A 3I9SA 1Z9UA 3KR5A 4NGSA 4R8FA 3NH4A 3KR4A 2FVGA 5K8OA 1Z8LA 4JWPA 2Q0YA 1Y9KA 2AE6A 2GANA 3ISXA 4HNXB 3HLPA 1PUAA 4CGMA 4R7MA 2EK8A 3NH8A 2R1IA 2EUIA 4B13A 2BEIA 1CP6A 1ARMA 2ZW7A 2Q04A 1HDUA 1QSRA 3KQZA 3NE7A 4KVME 4XPLA 4C7HA 2B5GA 5AG4A 1NE9A 5JM6A 4MCRA 2WPWA 2OB0A 4OKOA 3BXMA 4XNHB 3G8WA 4PK2A 4NGRA 2NSMA 3BJ7A 4MHDA 1ZO0A 4OC2A 4MRIA 4FD7A 4H6UA 2DEAA 4X2TA 5KTCA 3WC5A 4P4DA 4P4EA 2OU2A 3KI9A 4ZY1A 1S60A 2V77A 4NGMA 3D2MA 1S5KA 2ZEPA 4M6IA 1R43A 3KGQA 2F7VA 5K8NA 4UEEA 3SJGA 5FVJA 2ZEOA 1IIDA 3FVLA 4R87A 3T90A 1LAPA 2FSRA 1Z5RA 4A32A 3IWWA 4ZBGA 1QSNA 3EFAA 1YVKA 4UWIA 2CTBA 2PR1A 4R3LA 4NJQA 4AG9A 4CAWA 2BO9A 2B3VA 5G1ZA 3K2KA 3TTHA 2B4DA 3H4QA 3R9EA 3W6XA 2G3AA 8CPAA 5H84A 2QECA 3NFZA 2C6GA 1YSJA 2QMLA 4RI1A 3SHPA 4ZYQA 4IF5A 4KSIA 4Q36A 3D67A 3F8KA 1LOKA 2VQYA 4CGLA 2QJ8A 1S3ZA 2PRBA 2PJ5A 4KOXA 4P6YA 5J8CA 2Q4VA 1XRYA 1Y7EA 2OH1A 4E2AA 1CPXA 4X3RA 4ZX8A 3C26A 4QB9A 3LACA 3TO9A 4II9A 2P0WA 1LCPA 4KSAA 4X5KA 3RO0A 3S6HA 2AFOA 2P6GA 1P4NA 1M1DA 2CF4A 4UFVA 4UCMA 4BMHA 4CAVA 1IICA 4OMEA 1VHEA 2VBQA 4MFLA 4BD9A 1YQEA 3OWCA 1F2PA 1JWQA 1R3NA 2G3TA 4UWJA 1OZPA 1N71A 7CPAA 2XEFA 3R9GA 5K8PA 4KOSA 3VWEA 3D2PA 1I12A 3PB8X 4NEXA 5E96A 5JH9A 4OADA 1ZG7A 4MY0A 3SXOA 1QSOA 4KVOE 5HVHA 4PPZA 1VKCA 4Q38A 4MFJA 4A37A 3I3GA 2WYRA 2FCKA 4G1PA 2Z3LA 3IO1A 4KZTA 1Z4RA 4P4BA 4A95A 1IY7A 4B5OA 2CIJA 3LD2A 2EBJA 2Z11A 1Y9WA 2FXFA 2PJ7A 1XMBA 4CRYB 3DNSA 2JEWA 2ZOGA 4R76A 1TIQA 3B3TA 1EE3P 2I79A 3FNCA 1U6MA 3ZZIA 3GKRA 4GS4A 1YX0A 4ZI6A 2Q7SA 2DXQA 3EO4A 5ISVA 2CNMA 4KORA 2XEIA 4CYNA 2O53A 5LRKA 5AG5A 2OZUA 2B58A 3B8GA 1Q7LA 2J8MA 4B14A 2Q43A 4C68A 4BBHA 1XOVA 3KASA 3CPXA 3TO7A 3QB8A 2REFA 3IU1A 1Z8XA 3KZWA 3DSBA 3NE8A 3QAHA 2PJ1A 2ABZA 4KSFA 2FT0A 5EMIA 1CG2A 3DDDA 2VXKA 3PP9A 2D4OA 3B3VA 1YR0A 2BSWA 4NCZA 1AYEA 5F48A 2G0BA 4MCQA 4OC5A 2IJZA 2YNDA 2PIZA 1XEBA 1YK3A 1SQHA 2KCWA 2OR4A 4UEZA 4L89A 1RXTA 2AFWA 3VWDA 3WT4A 4HPSA 1J4JA 2C1CA 4P4IA 4CAFA 2PCUA 3V7ZA 3WC7A 4C2YA 2B4BA 4P10A 4PXBA 2AJ6A 3DR6A 5LYLA 2JBKA 2R98A 3S9NA 3GYAA 3FIXA 3W91A 2Z3MA 2PQ8A 3N7ZA 3BI1A 5CPAA 5F47A 1LAMA 1JQGA 4OIWA 1ON0A 2CNTA 3G3SA 3S9LA 3K9TA 1YLEA 2PJ3A 3GIUA 4QC6A 4P44A 4UA3A 3SJXA 2Z3KA 3PBEA 2GFQA 4IHMA 1TXRA 2YGWA 3TCVA 3I1UA 1R57A 4KOYA 5JPHA 2Z0ZA 3CDXA 2EVNA 5LRJA 3IJ3A 3JVNA 4MJ8A 2VEZA 2O4HA 4MHPA 2Q51A 2JEVA 5AGEA 1KWMA 1ELMP 4AVAA 1IB1E 5IB9A 3HUVA 3T8WA 5BWAB 4YWYA 4AVBA 2QIRA 4NSQA 1MK4A 4F9VA 1Z8TA 4M85A 1X12A 3FRMA 1YLOA 4KVXA 4LQ6A 2BUEA 4E8OA 6CPAA 3CPAA 2R8VA 3F0AA 4A94A 4H6ZA 1QSMA 1F2OA 2ZEEA 3FB3A 4JZ0A 1Z4EA 4DJLA 4WWVA 2YNEA 1XF8A 2VZYA 2PJ9A 3FEDA 2Z3NA 3PB4X 2BCOA 1HEEA 4E0AA 1ELLP 2AFMA 5J8FA 2RB7A 3KKWA 2ZENA 3PEIA 3FXTA 4JYWA 5AG6A 1X10A 2AFUA 4MFZA 4NGPA 4PSWA 2WUUA 3RNZA 4AXVA 4CAEA 1XBUA 2B5GB 4DNCA 2C27A 4XPDB 2IMOA 3WC6A 2HC9A 4MFPA 4O23A 2DPTA 1LFWA 3IIBA 1UWYA 4NFRA 4F9UA 3LWUA 2BL1A 4PXCA 4CGOA 4GM5A 3CZXA 3D68A 4XNHC 2DPSA 2XEJA 4NGQA 4OAEA 3B3CA 3S6FA 2RC4A 3GY9A 1LANA 4MHNA 3IC1A 3PFOA 1S7KA 3B7IA 4UIAA 1M4LA 2WZNA 4QBJA 2AFSA 4QUSA 4KOUA 3SI0A 1L0CA 2I3CA 2PJ6A 3CXPA 4GXHA 5C88A 1CX8A 4AVCA 4C2ZA 3IEHA 2Z3OA 1FNOA 1OBRA 1YREA 2IQ6A 4RUHA 5JQ4A 4MY3A 4UFWA 3D7HA 5HVGA 1H8LA 3N5FA 4ZY2A 2GIVA 4ZY0A 3TOBA 1I21A 4JXQA 4X8IA 3JRUA 2B4DB 1CM0A 2V8GA 2FS5A 3PBBA 4KUAA 2PVWA 1XMTA 3FJUA 4I49A 3PGPA 3D66A 2C6PA 2ZEDA 2ZW6A 2ZXVA 2PJAA 4A39A 3E0KA 1CP7A 3TFYA 4B5PA 3PB9X 3FBUA 4R9MA 4LQGA 4OC1A 1M4GA 1IOFA 1FT7A 1QSTA 1TF8A 4FD4A 3WR7A 3RZAA 1K4JA 4XPKA 1IU8A 3V38A 1CPSA 2G9DA 3K9UA 4H89A 2VZZA 4R3KA 3VARA 4HNWB 2Y0MA 3PB6X 4NGTA 5C82A 4EWTA 4F6AA 5DS0A 3L2NA 4JD6A 2XEGA 5LRGA 3KQXA 3D7FA 4C7IA 3GUXA 2Q7BA 4CYOA 2Q44A 2WSAA 4Y49B 1MJBA 1XIXA 3CXSA 4UEFA 2A4NA 1BPMA 4K30A 4OC3A 4DUKA 4WJBA 4KLVA 4CAXA 4K3NA 1XJOA 2PRQA 4JXRA 2Z3PA 1QQ9A 1QMUA 3EY5A 2ANPA 1XE4A 1ZLHA 3B35A 3ISZA 5DWNA 1IYKA 2CXAA 1IGBA 1LRZA 3BHXA 1WK4A 4FD5A 4MBUA 2RFHA 4UCPA 1IOIA 3FX6A 1F57A 4CRZB 5K8MA 1BAVA 4PXDA 1UFHA 1HDQA 5D29A 3TC8A 4A2ZA 2PIYA 1VIXA 3JUWA 3S6KA 4C2XA 1GYTA 3R96A 2FIAA 1PYTB 3D7DA 2ZPAA 4B12A 2PE3A 4NJRA 3V8IA 4U9ZA 5GCNA 1Z2LA 1BPNA 3JTKA 2CNSA 1DTDA 3UY5A 4R6TA 4TNUA 3IWGA 2ZEMA 3MN8A 5LYIA 4A33A 2WPXA 2FE7A 2AFZA 2H5MA 2HUZA 3BI0A 2DF5A 4PV6A 2VL1A 4F8ZA 5A28A 4MMOA 2HV2A 5THWA 2PJ0A 1Y0RA 2D4PA 2V8VA 4UF4A 1Y0YA 2EO8A 2AFXA 2YNCC 3H5ZA 4U5YA 2NYQA 4EVYA 2P6EA 3KHZA 4UBRA 1MJAA 4Z65A 3TE4A 2ZW4A 2J8NA 2Q4YA 2ODFA 4PSXA 3D3SA 2GLFA 5D8NA 1ARLA 3VH9A 2FIWA 5I4MA 1BOBA 2ZEHA 4NF1A 4MI4A 5ELYA 4MCPA 2OOTA 1PCAA 2P6FA 5I0CA 3P2HA 3PFEA 4M3SA 2ARHA 1TKHA 4RS2A 1KZFA 2K5TA 4U9YA 3H8GA 4RN7A 4UIBA 2PJCA 5AG7A 2HQYA 4NGNA 1BO4A 1Q2CA 1RO5A 1VGYA 2J8RA 1MJ9A 2PSWA 1ZG8A 4H2KA 4KOWA 4ONWA 3SJEA 2F8HA 5G20A 2ATRA 1YMEA 4AB7A 4OLLA 4P4FA 5IB0A 3LODA 4P45A 3DLJA 4UCNA 2GE3A 2PJ4A 3GLJA 3FEEA 3PRTA 4FUUA 4B6ZA 4F0XA 5J1QA 4M6GA 2PR8A 4HNYB 4AG7A 1A2ZA 2PVVA 5KTDA 3H8FA 5G22A 1B87A 3W6SA 2GU2A 3PB7X 3CXQA 2F5IA 4L8AA 2OZHA 4A38A 1S7NA 3CT9A 4DYOA 1VHOA 2JBJA 3RBUA 3S6GA 2ZELA 3FECA 1ZLIA 1KUYA 3MGDA 3QNVA 4MFQA 1M4IA 5G21A 1I1DA 4FWUA 4OP4A 4ZX9A 2IL4A 2ZW5A 2VI7A 1V0CA 4PK3A 1AMPA 4J3GA 5F46A 1Q2DA 3KHXA 1ZG9A 3R9FA 4IAVA 4KOTA 4MFKA 2C6CA 4ORFA 4CS0B 5HH1A 4ZGYB 5F09A 1NMTA 2J9AA 4P4JA 5LYDA 2EWBA 1NSLA 4KLWA 4A31A 3A9LA 2GREA 2JDDA 1KUVA 5F49A 5LYFA 5IX3A 1S7LA 4PQAA 1BLLE 3IU2A 4EFDA 2QYVA 2V8DA 5HMNA 4MXUA 4OIDA 1YGHA 5JGFA 3EXNA 5HXDA 3KL9A 3IGRA 2O28A 5EC4A 4YU9A 4M6HA 3D7GA 3EC4A 5H86A 4XPDC 4OC0A 4F0YA 2Z10A 3GB0A 1YW4A 2X7BA 3D8PA 3D4UA 3R1KA 3PZJA 2I00A 4NXYA 3MRUA 4R57A 4MHZA 3T9YA 2PDOA 2PJ8A 4B11A 3RAMA 1CJWA 2YNCA 2ZOFA 4CGPA 1M4DA 1TF9A 2ZEGA 5KTAA 2B3UA
chains in the Genus database with same CATH topology
4RN7A 3CZXA 5EMIA 3QAYA 1JWQA 2HB6A 4BINA 2Q7SA 2ODFA 4EFDA 4M6HA 4M6IA 2HC9A 1XOVA 4M6GA 4LQ6A 3NE8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4RN7 A;  3CZX A;  5EMI A;  3QAY A;  1JWQ A;  4BIN A;  2Q7S A;  2ODF A;  4M6I A;  4M6H A;  1XOV A;  4M6G A;  4LQ6 A;  3NE8 A; 
#chains in the Genus database with same CATH topology
 3R95 A;  1CBX A;  2CTC A;  1TKF A;  1NSA A;  3SI2 A;  4CYQ A;  4OC4 A;  3B3W A;  4YRH A;  3BLN A;  2JDC A;  1TKJ A;  5EBV A;  2PC1 A;  2PJB A;  3SI1 A;  4YFJ A;  2GLJ A;  2OZG A;  4A30 A;  4CPA A;  5CBM A;  4JLY A;  4W9Y A;  3RYO A;  4FAI A;  4KS9 A;  2ZEF A;  3F5B A;  3VAT A;  3DGV A;  2BOA A;  2POK A;  3LMS A;  1Y7R A;  3ZJ0 A;  4IK2 A;  2HB6 A;  4B10 A;  1KUX A;  2R7H A;  3TOA A;  4CGN A;  2CY2 A;  5A27 A;  1DE4 C;  3FH4 A;  3IWE A;  4ONU A;  1S7F A;  4EME A;  4MHY A;  2EK9 A;  1AUG A;  4KOV A;  3NH5 A;  3TT2 A;  1GHE A;  4FD6 A;  4MCS A;  4B5P B;  3B2Y A;  3SXN A;  2PJ2 A;  1WWZ A;  3QAY A;  3BJ8 A;  3FMC A;  3SJF A;  3IFE A;  3B3S A;  3WAB A;  3P2F A;  1IYL A;  1YVO A;  4QVT A;  5CNP A;  1FY7 A;  4Q7A A;  3FYN A;  5IV0 A;  1B6B A;  4HKF A;  4FBE A;  2QVP A;  4UFX A;  3TO6 A;  1YW6 A;  1M44 A;  4IUS A;  3TX8 A;  2V8H A;  2FL4 A;  4PXE A;  2JLM A;  4TWE A;  3S9M A;  4BIN A;  4LUA A;  1PU9 A;  5DWM A;  3DR8 A;  2Q4Z A;  1P0H A;  4KUB A;  3H8E A;  1Q2Y A;  1RTQ A;  1XFO A;  5HVF A;  1Z8W A;  2REE A;  4JJX A;  1VHS A;  4LX9 A;  4Y49 C;  4YGO A;  4CYP A;  2NMT A;  3FF3 A;  3NA6 A;  3I9S A;  1Z9U A;  3KR5 A;  4NGS A;  4R8F A;  3NH4 A;  3KR4 A;  2FVG A;  5K8O A;  1Z8L A;  4JWP A;  2Q0Y A;  1Y9K A;  2AE6 A;  2GAN A;  3ISX A;  4HNX B;  3HLP A;  1PUA A;  4CGM A;  4R7M A;  2EK8 A;  3NH8 A;  2R1I A;  2EUI A;  4B13 A;  2BEI A;  1CP6 A;  1ARM A;  2ZW7 A;  2Q04 A;  1HDU A;  1QSR A;  3KQZ A;  3NE7 A;  4KVM E;  4XPL A;  4C7H A;  2B5G A;  5AG4 A;  1NE9 A;  5JM6 A;  4MCR A;  2WPW A;  2OB0 A;  4OKO A;  3BXM A;  4XNH B;  3G8W A;  4PK2 A;  4NGR A;  2NSM A;  3BJ7 A;  4MHD A;  1ZO0 A;  4OC2 A;  4MRI A;  4FD7 A;  4H6U A;  2DEA A;  4X2T A;  5KTC A;  3WC5 A;  4P4D A;  4P4E A;  2OU2 A;  3KI9 A;  4ZY1 A;  1S60 A;  2V77 A;  4NGM A;  3D2M A;  1S5K A;  2ZEP A;  4M6I A;  1R43 A;  3KGQ A;  2F7V A;  5K8N A;  4UEE A;  3SJG A;  5FVJ A;  2ZEO A;  1IID A;  3FVL A;  4R87 A;  3T90 A;  1LAP A;  2FSR A;  1Z5R A;  4A32 A;  3IWW A;  4ZBG A;  1QSN A;  3EFA A;  1YVK A;  4UWI A;  2CTB A;  2PR1 A;  4R3L A;  4NJQ A;  4AG9 A;  4CAW A;  2BO9 A;  2B3V A;  5G1Z A;  3K2K A;  3TTH A;  2B4D A;  3H4Q A;  3R9E A;  3W6X A;  2G3A A;  8CPA A;  5H84 A;  2QEC A;  3NFZ A;  2C6G A;  1YSJ A;  2QML A;  4RI1 A;  3SHP A;  4ZYQ A;  4IF5 A;  4KSI A;  4Q36 A;  3D67 A;  3F8K A;  1LOK A;  2VQY A;  4CGL A;  2QJ8 A;  1S3Z A;  2PRB A;  2PJ5 A;  4KOX A;  4P6Y A;  5J8C A;  2Q4V A;  1XRY A;  1Y7E A;  2OH1 A;  4E2A A;  1CPX A;  4X3R A;  4ZX8 A;  3C26 A;  4QB9 A;  3LAC A;  3TO9 A;  4II9 A;  2P0W A;  1LCP A;  4KSA A;  4X5K A;  3RO0 A;  3S6H A;  2AFO A;  2P6G A;  1P4N A;  1M1D A;  2CF4 A;  4UFV A;  4UCM A;  4BMH A;  4CAV A;  1IIC A;  4OME A;  1VHE A;  2VBQ A;  4MFL A;  4BD9 A;  1YQE A;  3OWC A;  1F2P A;  1JWQ A;  1R3N A;  2G3T A;  4UWJ A;  1OZP A;  1N71 A;  7CPA A;  2XEF A;  3R9G A;  5K8P A;  4KOS A;  3VWE A;  3D2P A;  1I12 A;  3PB8 X;  4NEX A;  5E96 A;  5JH9 A;  4OAD A;  1ZG7 A;  4MY0 A;  3SXO A;  1QSO A;  4KVO E;  5HVH A;  4PPZ A;  1VKC A;  4Q38 A;  4MFJ A;  4A37 A;  3I3G A;  2WYR A;  2FCK A;  4G1P A;  2Z3L A;  3IO1 A;  4KZT A;  1Z4R A;  4P4B A;  4A95 A;  1IY7 A;  4B5O A;  2CIJ A;  3LD2 A;  2EBJ A;  2Z11 A;  1Y9W A;  2FXF A;  2PJ7 A;  1XMB A;  4CRY B;  3DNS A;  2JEW A;  2ZOG A;  4R76 A;  1TIQ A;  3B3T A;  1EE3 P;  2I79 A;  3FNC A;  1U6M A;  3ZZI A;  3GKR A;  4GS4 A;  1YX0 A;  4ZI6 A;  2Q7S A;  2DXQ A;  3EO4 A;  5ISV A;  2CNM A;  4KOR A;  2XEI A;  4CYN A;  2O53 A;  5LRK A;  5AG5 A;  2OZU A;  2B58 A;  3B8G A;  1Q7L A;  2J8M A;  4B14 A;  2Q43 A;  4C68 A;  4BBH A;  1XOV A;  3KAS A;  3CPX A;  3TO7 A;  3QB8 A;  2REF A;  3IU1 A;  1Z8X A;  3KZW A;  3DSB A;  3NE8 A;  3QAH A;  2PJ1 A;  2ABZ A;  4KSF A;  2FT0 A;  5EMI A;  1CG2 A;  3DDD A;  2VXK A;  3PP9 A;  2D4O A;  3B3V A;  1YR0 A;  2BSW A;  4NCZ A;  1AYE A;  5F48 A;  2G0B A;  4MCQ A;  4OC5 A;  2IJZ A;  2YND A;  2PIZ A;  1XEB A;  1YK3 A;  1SQH A;  2KCW A;  2OR4 A;  4UEZ A;  4L89 A;  1RXT A;  2AFW A;  3VWD A;  3WT4 A;  4HPS A;  1J4J A;  2C1C A;  4P4I A;  4CAF A;  2PCU A;  3V7Z A;  3WC7 A;  4C2Y A;  2B4B A;  4P10 A;  4PXB A;  2AJ6 A;  3DR6 A;  5LYL A;  2JBK A;  2R98 A;  3S9N A;  3GYA A;  3FIX A;  3W91 A;  2Z3M A;  2PQ8 A;  3N7Z A;  3BI1 A;  5CPA A;  5F47 A;  1LAM A;  1JQG A;  4OIW A;  1ON0 A;  2CNT A;  3G3S A;  3S9L A;  3K9T A;  1YLE A;  2PJ3 A;  3GIU A;  4QC6 A;  4P44 A;  4UA3 A;  3SJX A;  2Z3K A;  3PBE A;  2GFQ A;  4IHM A;  1TXR A;  2YGW A;  3TCV A;  3I1U A;  1R57 A;  4KOY A;  5JPH A;  2Z0Z A;  3CDX A;  2EVN A;  5LRJ A;  3IJ3 A;  3JVN A;  4MJ8 A;  2VEZ A;  2O4H A;  4MHP A;  2Q51 A;  2JEV A;  5AGE A;  1KWM A;  1ELM P;  4AVA A;  1IB1 E;  5IB9 A;  3HUV A;  3T8W A;  5BWA B;  4YWY A;  4AVB A;  2QIR A;  4NSQ A;  1MK4 A;  4F9V A;  1Z8T A;  4M85 A;  1X12 A;  3FRM A;  1YLO A;  4KVX A;  4LQ6 A;  2BUE A;  4E8O A;  6CPA A;  3CPA A;  2R8V A;  3F0A A;  4A94 A;  4H6Z A;  1QSM A;  1F2O A;  2ZEE A;  3FB3 A;  4JZ0 A;  1Z4E A;  4DJL A;  4WWV A;  2YNE A;  1XF8 A;  2VZY A;  2PJ9 A;  3FED A;  2Z3N A;  3PB4 X;  2BCO A;  1HEE A;  4E0A A;  1ELL P;  2AFM A;  5J8F A;  2RB7 A;  3KKW A;  2ZEN A;  3PEI A;  3FXT A;  4JYW A;  5AG6 A;  1X10 A;  2AFU A;  4MFZ A;  4NGP A;  4PSW A;  2WUU A;  3RNZ A;  4AXV A;  4CAE A;  1XBU A;  2B5G B;  4DNC A;  2C27 A;  4XPD B;  2IMO A;  3WC6 A;  2HC9 A;  4MFP A;  4O23 A;  2DPT A;  1LFW A;  3IIB A;  1UWY A;  4NFR A;  4F9U A;  3LWU A;  2BL1 A;  4PXC A;  4CGO A;  4GM5 A;  3CZX A;  3D68 A;  4XNH C;  2DPS A;  2XEJ A;  4NGQ A;  4OAE A;  3B3C A;  3S6F A;  2RC4 A;  3GY9 A;  1LAN A;  4MHN A;  3IC1 A;  3PFO A;  1S7K A;  3B7I A;  4UIA A;  1M4L A;  2WZN A;  4QBJ A;  2AFS A;  4QUS A;  4KOU A;  3SI0 A;  1L0C A;  2I3C A;  2PJ6 A;  3CXP A;  4GXH A;  5C88 A;  1CX8 A;  4AVC A;  4C2Z A;  3IEH A;  2Z3O A;  1FNO A;  1OBR A;  1YRE A;  2IQ6 A;  4RUH A;  5JQ4 A;  4MY3 A;  4UFW A;  3D7H A;  5HVG A;  1H8L A;  3N5F A;  4ZY2 A;  2GIV A;  4ZY0 A;  3TOB A;  1I21 A;  4JXQ A;  4X8I A;  3JRU A;  2B4D B;  1CM0 A;  2V8G A;  2FS5 A;  3PBB A;  4KUA A;  2PVW A;  1XMT A;  3FJU A;  4I49 A;  3PGP A;  3D66 A;  2C6P A;  2ZED A;  2ZW6 A;  2ZXV A;  2PJA A;  4A39 A;  3E0K A;  1CP7 A;  3TFY A;  4B5P A;  3PB9 X;  3FBU A;  4R9M A;  4LQG A;  4OC1 A;  1M4G A;  1IOF A;  1FT7 A;  1QST A;  1TF8 A;  4FD4 A;  3WR7 A;  3RZA A;  1K4J A;  4XPK A;  1IU8 A;  3V38 A;  1CPS A;  2G9D A;  3K9U A;  4H89 A;  2VZZ A;  4R3K A;  3VAR A;  4HNW B;  2Y0M A;  3PB6 X;  4NGT A;  5C82 A;  4EWT A;  4F6A A;  5DS0 A;  3L2N A;  4JD6 A;  2XEG A;  5LRG A;  3KQX A;  3D7F A;  4C7I A;  3GUX A;  2Q7B A;  4CYO A;  2Q44 A;  2WSA A;  4Y49 B;  1MJB A;  1XIX A;  3CXS A;  4UEF A;  2A4N A;  1BPM A;  4K30 A;  4OC3 A;  4DUK A;  4WJB A;  4KLV A;  4CAX A;  4K3N A;  1XJO A;  2PRQ A;  4JXR A;  2Z3P A;  1QQ9 A;  1QMU A;  3EY5 A;  2ANP A;  1XE4 A;  1ZLH A;  3B35 A;  3ISZ A;  5DWN A;  1IYK A;  2CXA A;  1IGB A;  1LRZ A;  3BHX A;  1WK4 A;  4FD5 A;  4MBU A;  2RFH A;  4UCP A;  1IOI A;  3FX6 A;  1F57 A;  4CRZ B;  5K8M A;  1BAV A;  4PXD A;  1UFH A;  1HDQ A;  5D29 A;  3TC8 A;  4A2Z A;  2PIY A;  1VIX A;  3JUW A;  3S6K A;  4C2X A;  1GYT A;  3R96 A;  2FIA A;  1PYT B;  3D7D A;  2ZPA A;  4B12 A;  2PE3 A;  4NJR A;  3V8I A;  4U9Z A;  5GCN A;  1Z2L A;  1BPN A;  3JTK A;  2CNS A;  1DTD A;  3UY5 A;  4R6T A;  4TNU A;  3IWG A;  2ZEM A;  3MN8 A;  5LYI A;  4A33 A;  2WPX A;  2FE7 A;  2AFZ A;  2H5M A;  2HUZ A;  3BI0 A;  2DF5 A;  4PV6 A;  2VL1 A;  4F8Z A;  5A28 A;  4MMO A;  2HV2 A;  5THW A;  2PJ0 A;  1Y0R A;  2D4P A;  2V8V A;  4UF4 A;  1Y0Y A;  2EO8 A;  2AFX A;  2YNC C;  3H5Z A;  4U5Y A;  2NYQ A;  4EVY A;  2P6E A;  3KHZ A;  4UBR A;  1MJA A;  4Z65 A;  3TE4 A;  2ZW4 A;  2J8N A;  2Q4Y A;  2ODF A;  4PSX A;  3D3S A;  2GLF A;  5D8N A;  1ARL A;  3VH9 A;  2FIW A;  5I4M A;  1BOB A;  2ZEH A;  4NF1 A;  4MI4 A;  5ELY A;  4MCP A;  2OOT A;  1PCA A;  2P6F A;  5I0C A;  3P2H A;  3PFE A;  4M3S A;  2ARH A;  1TKH A;  4RS2 A;  1KZF A;  2K5T A;  4U9Y A;  3H8G A;  4RN7 A;  4UIB A;  2PJC A;  5AG7 A;  2HQY A;  4NGN A;  1BO4 A;  1Q2C A;  1RO5 A;  1VGY A;  2J8R A;  1MJ9 A;  2PSW A;  1ZG8 A;  4H2K A;  4KOW A;  4ONW A;  3SJE A;  2F8H A;  5G20 A;  2ATR A;  1YME A;  4AB7 A;  4OLL A;  4P4F A;  5IB0 A;  3LOD A;  4P45 A;  3DLJ A;  4UCN A;  2GE3 A;  2PJ4 A;  3GLJ A;  3FEE A;  3PRT A;  4FUU A;  4B6Z A;  4F0X A;  5J1Q A;  4M6G A;  2PR8 A;  4HNY B;  4AG7 A;  1A2Z A;  2PVV A;  5KTD A;  3H8F A;  5G22 A;  1B87 A;  3W6S A;  2GU2 A;  3PB7 X;  3CXQ A;  2F5I A;  4L8A A;  2OZH A;  4A38 A;  1S7N A;  3CT9 A;  4DYO A;  1VHO A;  2JBJ A;  3RBU A;  3S6G A;  2ZEL A;  3FEC A;  1ZLI A;  1KUY A;  3MGD A;  3QNV A;  4MFQ A;  1M4I A;  5G21 A;  1I1D A;  4FWU A;  4OP4 A;  4ZX9 A;  2IL4 A;  2ZW5 A;  2VI7 A;  1V0C A;  4PK3 A;  1AMP A;  4J3G A;  5F46 A;  1Q2D A;  3KHX A;  1ZG9 A;  3R9F A;  4IAV A;  4KOT A;  4MFK A;  2C6C A;  4ORF A;  4CS0 B;  5HH1 A;  4ZGY B;  5F09 A;  1NMT A;  2J9A A;  4P4J A;  5LYD A;  2EWB A;  1NSL A;  4KLW A;  4A31 A;  3A9L A;  2GRE A;  2JDD A;  1KUV A;  5F49 A;  5LYF A;  5IX3 A;  1S7L A;  4PQA A;  1BLL E;  3IU2 A;  4EFD A;  2QYV A;  2V8D A;  5HMN A;  4MXU A;  4OID A;  1YGH A;  5JGF A;  3EXN A;  5HXD A;  3KL9 A;  3IGR A;  2O28 A;  5EC4 A;  4YU9 A;  4M6H A;  3D7G A;  3EC4 A;  5H86 A;  4XPD C;  4OC0 A;  4F0Y A;  2Z10 A;  3GB0 A;  1YW4 A;  2X7B A;  3D8P A;  3D4U A;  3R1K A;  3PZJ A;  2I00 A;  4NXY A;  3MRU A;  4R57 A;  4MHZ A;  3T9Y A;  2PDO A;  2PJ8 A;  4B11 A;  3RAM A;  1CJW A;  2YNC A;  2ZOF A;  4CGP A;  1M4D A;  1TF9 A;  2ZEG A;  5KTA A;  2B3U A; 
#chains in the Genus database with same CATH homology
 4RN7 A;  3CZX A;  5EMI A;  3QAY A;  1JWQ A;  2HB6 A;  4BIN A;  2Q7S A;  2ODF A;  4EFD A;  4M6H A;  4M6I A;  2HC9 A;  1XOV A;  4M6G A;  4LQ6 A;  3NE8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...