1JWVA

Crystal structure of g238a mutant of tem-1 beta-lactamase in complex with a boronic acid inhibitor (sefb4)
Total Genus 92
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
92
sequence length
263
structure length
263
Chain Sequence
HPETLVKVKDAEDQLGARVGYIELDLNSGKILESFRPEERFPMMSTFKVLLCGAVLSRVDAGQEQLGRRIHYSQNDLVEYSPVTEKHLTDGMTVRELCSAAITMSDNTAANLLLTTIGGPKELTAFLHNMGDHVTRLDRWEPELNEAIPNDERDTTMPAAMATTLRKLLTGELLTLASRQQLIDWMEADKVAGPLLRSALPAGWFIADKSGAAERGSRGIIAALGPDGKPSRIVVIYTTGSQATMDERNRQIAEIGASLIKHW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Evolution of an antibiotic resistance enzyme constrained by stability and activity trade-offs.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase
molecule keywords BETA-LACTAMASE TEM
total genus 92
structure length 263
sequence length 263
ec nomenclature ec 3.5.2.6: Beta-lactamase.
pdb deposition date 2001-09-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13354 Beta-lactamase2 Beta-lactamase enzyme family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 1jwvA00
5EVLA 1K38A 3V50A 5EE8A 5U47A 1SDEA 3W4QA 4KZ4A 2C5WB 3WRTA 4U3TA 3O3VA 3C4OA 3VFHA 4WMCA 4KQOA 3Q1FA 5AQ7A 2Z2MB 1L0FA 3IH9A 3NY4A 3TG9A 5HAQA 1TEMA 4RYEA 1PWCA 2V2FF 1ONHA 4KG6A 3ZNTA 3FV7A 4R4RA 3VP3A 3V3SA 1O07A 2XF3A 3NIAA 1XKZA 3VP4A 3NI9A 4L0LA 5DF8A 3ZCZA 1YLPA 5DVAA 1K57C 3E2KA 4OVDA 1W79A 2HPBA 3ISGA 5JYOA 5TR7A 2EX8A 3UO9A 3PBOA 3ZVWA 2WKIA 1FR1A 5CEDA 1QMEA 3VP0A 1LL5A 4E3OA 5KSHA 2ZQAA 2OLUA 4UAAA 2EX2A 3UPNA 4KG5A 3IF6A 1G68A 1KGFA 1N9BA 3MXSA 3ZNYA 4DE2A 2WGWB 2Y2GA 1K25A 2BG1A 3UDFA 5F83A 2Y4AA 4RA7A 4X6TA 4S2MA 3SS3A 1KE0A 1K6SA 1XA7A 2ZM0A 4LCMA 4OPZA 1K55A 4R3BA 3MZFA 3C5AA 3E2LA 3IWIA 4RVAA 2QPNA 3C7VA 4PM7A 3P98A 5GHYA 2X02A 4EBLA 2A3UA 3BM6A 4WMCD 4OPYA 3Q82A 3O88A 1XGIA 3N8LA 4RX3A 1K56A 1TVFA 4Y0OA 4OOYA 4OOMA 3I7JA 1NYYA 1ES5A 5F1GA 1YLJA 3CG5A 1FR6A 4N9KA 2Y2PA 4N92A 5CGSA 2XD1A 5GLDA 3P09A 3A3IA 4DXCA 4QHCA 3SH7A 1GCEA 4CJNA 3PBNA 1Q2QA 3LCEA 4K91A 5EVIC 2EX6A 3A3FA 3UE1A 1KVMA 1GA0A 5HW3A 2JE5A 1IEMA 1S0WA 3OPPA 3Q07A 3UE3A 1BTLA 1DY6A 2ZC4B 4OONA 4A5RA 4XUZA 2X01A 3Q7VA 2Y59A 3BLMA 5FASA 2I72A 4S2LA 3UDIA 1PYYA 4X56A 2PBYA 4JKTA 3BFEA 3RJUA 3VSLA 3HLWA 4OOLA 3HLDA 4IEDA 3HREA 1L2SA 4DF6A 1BLHA 3O87A 4X53A 5F82A 3NBLA 4WZ5C 3G2YA 3IWOA 3W8KA 1OMEA 4KZ5A 3LY4A 2JBFA 1C3BA 3BFGA 2ZQ7A 1ERQA 2XLNA 3GQZA 4KQQA 4PM8A 1XP4A 4DKIA 2IWDA 1SCWA 3G4PA 4Y0UA 4Y7PA 5D3OA 4WBGA 5TGFA 4CPKA 2WGIA 5FAQA 1MWRA 1E3UA 4E6XA 2Y55A 3A3EA 5IHVA 1CI9A 3ZG9B 3DW0A 1NZOA 5HAIA 3GV9A 1L0GA 5CTNA 4FSFA 2Y2HA 4MNRA 3SS5A 3UPOA 3IH8A 3OZHA 2IWBA 3BFCA 5DF9A 5HX9A 4FH4A 1S6RA 2WAFA 1LL9A 4BLMA 4S2NC 1I5QA 4EBNA 2HDQA 5GLBA 3UE0A 1FSWA 4R0QA 4FH2A 4GNUA 1PI4A 4HESA 1GHIA 4DDSA 3IQAA 2Y2LA 3FWLA 3Q81A 3HUNA 3C7UA 2ZQDA 5E2HA 2QZ6A 4E6WA 3TOIA 1IYOA 2HDSA 2XH9A 2Q9MA 1ES4A 1MPLA 3S1YA 1ES3A 1H8YA 1LLBA 3WS5A 1KE3A 5DTSA 5EOOA 5M19A 4EQIA 1YQSA 3IT9A 4YFMA 3HLFA 4LV3A 1RGYA 1FCMA 1Y54A 1YLYA 4U0XA 5FQJA 4KZAA 4ZJ2A 2JC7A 5FAPA 5CERA 2R9WA 3G35A 3JYIA 1NJ4A 1J9MA 1RCJA 3ITBA 1JWPA 4KENB 4QY6A 2H10A 3HUOA 1PZPA 4OKPA 5M18A 2ZM8A 2EFUA 3AGDA 5DTTA 1VM1A 4DE3A 3VOZA 4LV0A 3WRZA 3ZGAB 1ES2A 2XDMA 1K54C 3A3JA 3AGFA 3DWKA 4PMAA 4E3JA 1XA1A 5AQAA 1K6RA 1PW1A 3ZG8B 3MBZA 3QHYA 4GB7A 3Q7VB 1E3UD 3GMWA 3G32A 4JXSA 4RX2A 3OCLA 2Y2KA 4PM6A 2OLVA 4MBHA 4GN2A 5KZHA 1QMFA 2X71A 3SH8A 1PW8A 2XEPA 1ZG6A 5HL1A 1PZOA 5GHXA 4OH0A 1K4EA 2H0TA 5FAOA 3IHBA 4OQGA 2XGNA 1EROA 1VQQA 1ZKJA 2ZLYA 2VGKA 3LO7A 1KDWA 2C6WB 3MKFA 5G18A 4BQMA 4D2OA 2J9OA 3V39A 3BFDA 5EECA 3GRJA 1IELA 4C6YA 1DJBA 3G30A 5JYPA 1FCNA 1ZG4A 4JF6A 5CHUA 5FATA 1W8YA 3PTEA 4B88A 1KGEA 3WS4A 1KGGA 3QNBA 1HZOA 3HL9A 5CECA 3V5MA 3HLCA 5L2FA 2XK1A 4E3NA 4KZ7A 2G2WA 2ZC6B 3IWQA 4N1XA 3ZDJA 1K57A 2ZM2A 4QU3A 1JWZA 5E43A 1EI5A 2E8IA 5FQKA 3MZEA 1NRFA 3EQUA 3M2KA 2EXAA 2ZQCA 1LHYA 4FD8A 4QY5A 2Y2QA 3FZCA 4KZ9A 1ZC2A 2ZC3B 5FI2A 1PIOA 5A93A 3HLGA 5GHZA 2XD5A 4OLGA 4O7DA 1AXBA 4ID4A 1DJCA 3VSKA 5A90A 1GHMA 2J8YA 3GSGA 4MBKA 3BLSA 3UN7A 1LI9A 5CRFA 4ZDXA 1DJAA 5FSRA 5FQIA 4Z9QA 1H5XA 1K55C 3BEBA 3UNWA 3ZFZA 2Z2LB 2WYXA 2RCXA 3NCKA 4JPMA 1WYCA 3ZHHA 3ZG5A 3UDXA 1GHPA 3VP1A 3WS0A 5FQQA 5CTMA 4DXBA 4GD6A 4JXVA 5HAPA 1BLPA 5GLAA 1GA9A 1BZAA 3M6BA 2IWCA 4LV2A 5A91A 4DRTA 3FYZA 3D4FA 4WM9A 3WS2A 4FCFA 4B4ZA 1NXYA 4KQRA 3PAEA 2R9XA 4OQHA 5A92A 4GKUA 5TFQA 4C3QA 2P9VA 1TDGA 4P6BA 4NETA 2WADA 1W8QA 4EV4A 4BD0A 2PU2A 1YLWA 3DWZA 4JF5A 3ZG0A 1NY0A 3MFDA 5FDHA 4EBPA 3ZVTA 2EXBA 4LV1A 1EWZA 3GTCA 4EWFA 5J8XA 1E4DA 1HVBA 4JLFA 4LCLA 4IBRA 1MWTA 5KSCA 3SOIA 2BLSA 4GD8A 1PI5A 1NZUA 1ALQA 5AQBA 1M40A 2ZMAA 1KVLA 3HLEA 3AGEA 4P0MA 3SH9A 2DCFA 4M3KA 1IYSA 5EPHA 3IXHA 1WYBA 4WELA 3MZDA 1NYMA 5CGWA 4GDBA 4HBTA 3N8RA 1BUEA 2ZQ9A 3GVBA 5HARA 3UY6A 4BL3A 3N8SA 1BSGA 3S22A 4HBUA 4ZAMA 4U0TA 5M1AA 4UHUA 3BFFA 1BLSA 1BT5A 3HLBA 2Q9NA 2FFYA 3IHAA 2EFXA 4X55A 1HTZA 2P74A 4WZ4A 5CHMA 1H8ZA 2H5SA 1CEFA 3N7WA 4P87A 4BENA 4PM5A 3S4XA 3WS1A 1KDSA 5FI7A 4Q8IA 2ZJ9A 2WKHA 3PBSA 3RXXA 3M6HA 2HDRA 3VMAA 1E25A 2J7VA 4KZ6A 5EVIA 1SKFA 3OPRA 4OLDA 1MWSA 1RGZA 1BLCA 3LY3A 2A49A 4S2KA 4S2NA 1ESUA 2ZC7A 1YM1A 3CZDA 3IXDA 5AQ9A 1K54A 4R4SA 4OQIA 3W4OA 1L0DA 3OPHA 2ZD8A 4EUZA 1MY8A 2OV5A 4UA7A 3SS4A 4K0XA 2QMIA 4JXWA 4PPRA 3VP2A 5CEBA 2DRWA 1PWDA 3DTMA 4PM9A 2VGJA 3N6IA 4OPQA 3CJMA 1YMXA 3BECA 5GL9A 1YLTA 4JBFA 1MXOA 5KMWA 2WZZA 4JXGA 4R23A 4DDYA 4KZBA 2WZXA 2J9PA 2Y2JA 2HP6A 4P85A 4MBFA 1M6KA 2Y2MA 4IVIA 4WEKA 4WYYA 2V20A 4B4XA 3HUMA 4BD1A 3IXBA 5CXWA 5FI6A 3WWXA 2H0YA 2WGVA 1YLZA 4ZBEA 2G2UA 1JTDA 1JVJA 1RP5A 3HBRA 4WEJA 4R1GA 3G2ZA 5GLCA 1SDNA 4GDNA 5DTKA 3G34A 5EOEA 1ERMA 1I2WA 2OSUA 3NDGA 4XXRA 4KZ3A 2B5RA 3HVFA 5EVID 1K56D 4S2IA 1WE4A 5FQ9A 2WUQA 4IVKA 1KE4A 4E3MA 1L0EA 4N1HA 2WAEA 4ZTKA 1FSYA 5E2EA 2P9VB 4OP5A 1PWGA 1Q2PA 1XXMA 3LEZA 3B3XA 3NC8A 3MKEA 3N4IA 1CEGA 2FFFB 3NDEA 3PBQA 1YMSA 1YT4A 4X69A 4DE1A 3Q7ZA 3UPPA 2JCHA 4X68A 4E3LA 3GR2A 4KG2A 4S2PA 3IF6B 1I2SA 3QNCA 4E3IA 1Z6FA 4OQ0A 1MWUA 4UA6A 3TSGA 5E2GA 3CMZA 5FQMA 1LI0A 2PU4A 1U60A 1ONGA 2Y2IA 3OCNA 4LENA 3VFFA 1JWVA 5I94A 4R3JA 3IF5A 1O7EA 4GZBA 1XGJA 4WZ5A 3RXWA 4BJPA 4JF4A 5F1FA 4Y0TA 1MKIA 4N9LA 2XQZA 3EQVA 3MXRA 4OP8A 2ZQ8A 2UWXA 2Y2OA 1BULA 2GDNA 3FKVA 3PBRA 1FCOA 4YINA 3C4PA 4ZJ1A 4IBXA 4HEFA 1FQGA 4F94A 3OPLA 2V1ZA 3M2JA 4GOGA 4BL2A 2ZC5B 1N4OA 1G6AA 2HDUA 2WK0A 1TDLA 3PBTA 2Y2NA 3ZG7B 2WKEA 3IF6C 2XR0A 1IKGA 1CI8A 3G31A 1XPBA 3PAGA 5HFOA 5CHJA 3ITAA 5DF7A 1IYPA 1IKIA 1ESIA 5BOHA 4QD4A 1HD8A 2CC1A 3W4PA 1IYQA 5FA7A 3OC2A 1W5DA 4E3KA 4QJGA 1W7FA 5CGXA 2XFSA 4MEZA 4C75A 2WGWA 3FKWA 1CK3A 1JTGA 1XX2A 4KZ8A 2HP5A 3IXGA 1FOFA 5EUAA 1SHVA 1MBLA 3BRMA 4UA9A 2XFTA 3A3DA 4QB8A 4ZJ3A 4DE0A 4H8RA 3VOYA 4OPRA 4S2OA 5EVIB 2DNSA 2RL3A 3BYDA 4MLLA 4K0WA 4XUXA 1K4FA 3V3RA 4NK3A 4S2JA 5E2FA 2HP9A 2EX9A 3O86A 2Y91A
chains in the Genus database with same CATH superfamily
1K38A 5U47A 2NUPC 3WRTA 4U3TA 3CITA 4DJ3A 1P97A 2Z2MB 3NY4A 5HAQA 3OLOA 3H82B 2P04A 1OTEA 3E4QA 3VP3A 1DRMA 3F1NB 2XF3A 1XKZA 3VP4A 1LT0A 3NI9A 4L0LA 1YLPA 5DVAA 1K57C 1PFLA 3E2KA 4OVDA 3BQ8A 3CUEC 2EX8A 1FR1A 5CEDA 2GZAA 2M1CA 3VP0A 4UAAA 3E0YA 3ZNYA 4Q0HA 3JPUA 5F83A 3UE6A 4WF0A 2DMWA 4LCMA 4R3BA 3C5AA 2H28A 3E2LA 4RVAA 3IWIA 3L9KA 2QPNA 3PHYA 3T4KA 2A3UA 3T4LA 2M7VA 1OTIA 4OOYA 3CLOA 4Y17A 4M4XA 1NYYA 4N92A 5GLDA 4QHCA 1Q2QA 3QP8A 1GA0A 2JE5A 2O9BA 3UB5P 3OPPA 4L9EA 2ZC4B 2KDKA 4A5RA 5FASA 3B47A 3UDIA 2PBYA 5IU1A 3BFEA 5CX7A 4DF6A 2YKHA 3NBLA 4HJ4A 5HSQA 2PR6A 2GX5A 3LY4A 2QJ5A 2J3TC 4DKIA 1HLUP 1VETA 2LB9A 5TGFA 5D3OA 4WN5A 2D01A 2Z6DA 3EEHA 5HAIA 4MNRA 3UPOA 4MCWA 3GECA 5HX9A 1XJ2A 4G3KA 4S2NC 5GLBA 4GNUA 4DDSA 2P08A 2PDRA 3TOIA 5HWWA 2XH9A 1ES4A 1MPLA 3S1YA 1LLBA 2V8CA 3WS5A 5EOOA 1YQSA 1CF0A 3HLFA 4I39A 1TS8A 4ZJ2A 2W1RA 5CERA 3JYIA 2A24B 2Q0OA 1PZPA 3NECA 2W3DA 1ES2A 1K54C 1P9RA 4E3JA 1XA1A 4AFIA 1PW1A 1STZA 3MQOA 2B02A 4PM6A 3SZTA 4MBHA 2XEPA 5GHXA 4OH0A 4ARZA 4KQDA 4P6ZM 4GLQA 5JYPA 3PTEA 1KGEA 3WS4A 2ZMVA 3QNBA 3R7WB 1HZOA 3CPTA 1K57A 4IUKA 5E43A 1S1YA 2ZQCA 2G7UA 2ZC3B 2L0WA 3NHQA 2XD5A 4OLGA 4QPRA 1AXBA 3VSKA 5A90A 2J8YA 4MBKA 3JVUA 4FUWA 3IBRA 1LI9A 5KIZA 4Z9QA 1H5XA 3UNWA 3ZG5A 1WYCA 1GHPA 2W3FA 1BLPA 2INWA 5FEGA 2IWCA 2XA7S 2HJEA 4EESA 4B4ZA 1UWPX 2R9XA 5A92A 4GKUA 4C3QA 1TDGA 4NETA 1W8QA 4BD0A 2PU2A 4KUOA 1YLWA 4JF5A 5AVFA 1DP6A 2EXBA 2JKFA 1OPXA 4DJ2A 5KSCA 1NZUA 3CAXA 3UB7A 2ZMAA 1KVLA 3AGEA 3SH9A 2PD7A 4WELA 5J4EA 4HBTA 3KO6A 4BL3A 3UY6A 3N8SA 4L9FA 1BSGA 3S22A 4ZAMA 4U0TA 5M1AA 1BT5A 2Q9NA 3IHAA 3N7WA 4BENA 3T50A 2YKFA 3WS1A 1KDSA 4Q8IA 2ZJ9A 3PBSA 2HDRA 2K2NA 3VMAA 2J7VA 5EVIA 4KZ6A 3E4PA 3OPRA 2J80A 2LB5A 1RGZA 1T1CA 4LRZE 1ESUA 4R4SA 4OQIA 1ZTUA 4NXGA 4K0XA 3P7NA 2DRWA 3BECA 4P85A 2Y2MA 3CWFA 4B4XA 5DKLA 4BWIA 2G2UA 1JTDA 3HBRA 4WEJA 4R1GA 2VJWA 2V8FA 1ERMA 1I2WA 3IX3A 3F1NA 2ZOHA 3W2ZA 2P7JA 5EVID 3P01A 2ZL1A 4S2IA 3EGDC 2WUQA 1N9NA 4N1HA 4ZTKA 4O8GA 5E2EA 2P9VB 1PWGA 1Q2PA 2O9CA 1CJFA 3LEZA 3MKEA 3N4IA 4X69A 2FFFB 5A8BA 1YT4A 3UPPA 4S2PA 3IF6B 2HZ5A 4OQ0A 2EWVA 4EEPA 5DFYA 2PU4A 1U60A 4LFUA 5I94A 4R3JA 4GZBA 4WZ5A 4JF4A 5F1FA 2HGVA 3EEAA 2XQZA 5FDSA 3LI9A 3C4PA 3FPVA 4IBXA 4HP4A 4F94A 3ULFA 2V1ZA 4GOGA 2JKTI 1TDLA 3PBTA 2VV7A 1IKGA 3D72A 2PR5A 3G31A 3IX8A 5HD5A 5CHJA 3ITAA 1GSVA 5DF7A 1IYQA 3OC2A 1W5DA 1GSXA 2JKGA 3FKWA 1JTGA 4KZ8A 5EUAA 1MBLA 4H6JB 3A3DA 4QWOA 5F5YA 1G5UA 4P6ZS 2ZOIA 5E2FA 1TD5A 5G4ZA 2Y91A 1S1ZA 5EVLA 3W4QA 4HP9A 4KZ4A 2C5WB 3O3VA 3C4OA 4ETZA 3KYEA 4I3JA 5AQ7A 1L0FA 3IH9A 4RYEA 1FIKA 1PWCA 3ZNTA 3FV7A 3VV4A 4R4RA 4F3LB 1NLZA 5DF8A 5L07A 2HPBA 5TR7A 3PBOA 3ZVWA 3F1PA 2V0WA 1QMEA 4E3OA 1LL5A 5KSHA 3UPNA 3IF6A 1N9BA 1IFQA 3UB9A 4X6TA 1KE0A 2ZM0A 2O9AA 4JGPA 1K55A 2VKSA 4PM7A 3HJKA 3P98A 2X02A 2VEAA 1TS6A 1K56A 1CQAA 4NKPA 1YLJA 3CG5A 3S7PA 4N9KA 5CGSA 4X1MA 4HH2A 4XT2A 2XSSA 1GCEA 2EX6A 3A3FA 2QWSA 3FG8A 5HDDA 1SKOA 1IEMA 1D06A 3RH8B 4BBVA 1DY6A 2X01A 3KX0X 3Q7VA 3BLMA 1P9WA 2I72A 1PYYA 4I38A 1L3LA 4NXEA 4JKTA 5HPIA 3LGOA 3HLWA 4OOLA 1L2SA 3O87A 2K31A 3G2YA 3IWOA 1OMEA 4G3WA 3LIEA 3C8CA 3PR6A 2A24A 2L1MA 2V1BA 4PM8A 2VGLS 3G4PA 4Y0UA 3H82A 4Y3IA 2WGIA 4MN6A 5K5BA 4E6XA 5L10A 2Y55A 5IHVA 2J3TD 1CI9A 1NZOA 3GV9A 1L0GA 1MC0A 5CTNA 4FSFA 2Y2HA 1N9LA 1ZHHB 2PT7A 3OZHA 5DF9A 4FH4A 2WAFA 2B95A 5AVEA 1YAXA 2V9AA 1FSWA 4II7A 3IQAA 1V9YA 1T19A 1OT9A 3VOLA 3F1PB 1VETB 4EEUA 1H8YA 1S4RA 1OJGA 4EQIA 2KOIA 1YLYA 3PXPA 5FQJA 4KZAA 2JC7A 2R9WA 1J9MA 3T1QB 3ITBA 2JKTM 5LBRA 2EFUA 5DTTA 1BYWA 3IS2B 1VM1A 3HJIA 3ZGAB 4LLOB 2UV0E 3A3JA 3DWKA 1N9OA 1VB6A 3DTKA 3ZG8B 1E3UD 3OCLA 2Y2KA 2OLVA 4GN2A 5KZHA 3CHWP 1PW8A 2MJ6A 3TE8A 2H0TA 4OQGA 2HF6A 2VGKA 4D2OA 3BFDA 1IELA 4LRYC 3U2AA 3ICYA 4JF6A 5FATA 2QHKA 4R70A 2ACGA 3HL9A 5CECA 4E3NA 1LL8A 4KZ7A 2G2WA 2ZC6B 3IWQA 3T4TA 3DTEA 1EI5A 1T18A 3LR3A 1NRFA 2EXAA 4FD8A 4QY5A 4KZ9A 1ZC2A 1K0KA 4O7DA 1DJCA 4MN5A 1UWNX 3V67A 4ZDXA 1DJAA 2ZL1B 2V0UA 1XJ3A 3BEBA 3NCKA 3ZHHA 3WS0A 4DXBA 2J3WA 5GLAA 4K08A 1YSPA 4YOFA 4WM9A 4FCFA 1YKDA 2P9VA 4EV4A 3DWZA 3ZG0A 5FDHA 2BASA 3IS2A 3O5YA 3KYQA 3GTCA 5J8XA 2QJ7A 1HVBA 4JLFA 1MWTA 4GD8A 1PI5A 1M40A 4BBTA 3HLEA 3C30A 2DCFA 4M3KA 1NYMA 1KOUA 4R6LA 4HBUA 3E98A 2PD8A 1S67L 4PHTA 1BLSA 3HLBA 2FFYA 3KSIA 4WZ4A 2H5SA 5FI7A 2W3EA 2WKHA 4Y2FA 1SKFA 2PRFA 1MWSA 4JGQA 2I9VA 5MC7A 5J7EA 2VK3A 1XFNA 2ZC7A 3CZDA 3DTIA 3IXDA 5C5KA 3ZYTA 3MJQA 3RTYA 3OPHA 2ZD8A 2OV5A 4UA7A 2QMIA 4PPRA 1YSQA 1PWDA 2V1AA 3CJMA 1YMXA 1YLTA 5F69A 1MXOA 5KMWA 4DDYA 4KZBA 4WEKA 4WYYA 3T4QA 1RP5A 3A0VA 1DP8A 5IS1A 1SDNA 4EW7A 4HJ6A 4XXRA 4KZ3A 3HVFA 4EETB 5HPFA 3NJAA 4HIAA 5L8MA 3NOTC 5HWVA 2EA9A 5F6AA 2W1TB 4EERA 3NDEA 3PBQA 4DE1A 2JCHA 3B33A 3GR2A 3TJZC 4KG2A 1I2SA 3QNCA 3CPTB 3TSGA 5FQMA 4LENA 1JWVA 4ME4A 2KX6A 1XGJA 4BJPA 5AJGA 4Y0TA 4NEED 3FKVA 4HOIA 1FCOA 4HEFA 1FQGA 3M2JA 1N4OA 2Y2NA 3IF6C 2XR0A 3PAGA 5HFOA 4GJ4A 3LI8A 4ETXA 1IKIA 1ESIA 2CC1A 3W4PA 5FA7A 1W7FA 2XFSA 3F1OB 1XX2A 4HNBA 2HP5A 3IXGA 4F3LA 1SHVA 3BRMA 2XFTA 2OAP1 3VOYA 4OPRA 4S2OA 2DNSA 3IX4A 4YNRA 1K4FA 3V3RA 4S2JA 1NRJA 3O86A 5HDSA 3H7WA 1SDEA 3VFHA 3BQAA 4KQOA 5TJJA 3Q1FA 3TG9A 1Y28A 2V2FF 1ONHA 4MN7A 3V3SA 1O07A 1EW0A 3ZCZA 3ISGA 5HD3A 1UGUA 2ZQAA 2OLUA 1G68A 1KGFA 1TS7A 2WGWB 1K25A 2W1TA 4RA7A 3DAVA 3LIDA 4CLCA 4S2MA 1XA7A 1K6SA 4OPZA 2PHYA 4X25A 3C7VA 4EBLA 3BM6A 4OPYA 3KSHA 3N8LA 3MXQA 2BTFP 4OOMA 5TBMB 2Y2PA 3T1SA 2XD1A 1OTBA 3P09A 1TF1A 3A3IA 2Y8HA 3MR0A 4DXCA 4HQAA 3LR5A 3SH7A 4CJNA 3PBNA 3LCEA 4K91A 3C38A 1KVMA 5HW3A 1S0WA 3Q07A 1BTLA 4CLCE 2Y59A 3A0SA 4X56A 3UMEA 2XA7M 1BLHA 1LSXA 4WZ5C 3W8KA 3MS6A 1ERQA 2XLNA 4KQQA 1XP4A 1SCWA 4LRXC 1YPRA 4Y7PA 4CPKA 4WBGA 1MWRA 1E3UA 1MZUA 1D7EA 3ZG9B 3T4OA 3T1RA 2HJ9C 3SS5A 3LIFA 3LFVA 2XROA 1LL9A 4EBNA 1I5QA 3SW1A 2OWHA 4R0QA 4FH2A 5FL3A 1T1AA 3C7UA 2W3HA 2ZQDA 1TS0A 2QZ6A 4E6WA 1IYOA 2HDSA 2Q9MA 3MSHA 1ES3A 1KE3A 4DN0A 5M19A 1W63M 4WL9A 3IT9A 4LV3A 1RGYA 1FCMA 1Y54A 3GDIA 4FTXA 5FAPA 2M7UA 3T4SA 1MKMA 3G35A 1NJ4A 4YWZA 1RCJA 1JWPA 1PRQA 2H10A 4OKPA 5M18A 2ZM8A 3AGDA 4O01A 4DE3A 3VOZA 5EV0A 2NUTC 2XDMA 1JNUA 5AQAA 3B42A 3QHYA 4GHIB 3Q7VB 3G32A 3KYZA 3SH8A 3BJNA 1SKOB 3LICA 1ZG6A 2L4RA 5EM0A 5FAOA 2XGNA 1EROA 1VQQA 1ZKJA 2ZLYA 5G18A 1KDWA 2C6WB 4BQMA 2J9OA 4MDZA 3TRCA 1FCNA 2ZBBA 5CHUA 1W8YA 4MMNA 4GS9A 3V5MA 3OBFA 3HLCA 4EXOA 4G3VA 4I5SA 2XK1A 2W0NA 4N1XA 2K7SA 1X0OA 2ZM2A 2E8IA 3MZEA 5TBMA 3EQUA 3M2KA 5G4YA 2Y2QA 2JHEA 5FI2A 1PIOA 5A93A 3HLGA 5HDCA 5GHZA 2WKQA 3BLSA 3K3CA 3S7OA 2Y79A 3ZFZA 4JPMA 3LEQA 3UDXA 3VP1A 4GD6A 4JXVA 5HAPA 1GA9A 1BZAA 4LV2A 4DRTA 3D4FA 3OOVA 3WS2A 1NXYA 4KQRA 3PAEA 4NXBA 3MMHA 3UMDA 4OQHA 3EOIA 4Q0JA 4PKYA 4P6BA 4CLCD 1WA9A 1NY0A 2OWJA 3MFDA 3ZVTA 4HY8A 3MFXA 1EWZA 4EWFA 4FOFA 1E4DA 4LCLA 2BLSA 4RQ9A 1T1BA 1S66L 3EGXC 4Y13A 3H7WB 4IHQA 3N8RA 1BUEA 3GVBA 5HARA 2A2LA 4UHUA 3BFFA 5CHMA 3UB8A 4P87A 1FILA 3RXXA 2KLIA 3BY8A 3PYPA 4HI4A 3LY3A 3HCYA 2A49A 4S2NA 4DMZA 5AQ9A 3T4JA 2B18A 1K54A 1L0DA 3FPWA 4O0PA 4EUZA 1MY8A 5DKKA 3NOPC 4JXWA 5CEBA 3DTMA 4JGOA 2VGJA 4Y5FA 3N6IA 3S7NA 4OPQA 5GL9A 4R23A 2WZXA 2J9PA 2Y2JA 5DJTA 2WKRA 2V20A 3HUMA 3VE4A 1XFQA 5FI6A 3WWXA 4GHIA 2WGVA 1YLZA 4ZBEA 5GLCA 3KSGA 4GDNA 2OSUA 3NDGA 1WE4A 5FQ9A 3NOUC 1D1JA 1FSYA 4OP5A 1XXMA 3U4LP 1VEUB 3B3XA 3Q7ZA 4E3LA 4X68A 4I3AA 3FC7A 4ARZB 3QP4A 4E3IA 2FH5A 4UA6A 5E2GA 3CMZA 1LI0A 3OCNA 3IF5A 1O7EA 1MKIA 2WKPA 4N9LA 3MXRA 4OP8A 2FZ0A 2ZQ8A 2UWXA 2QYBA 1VHMA 2Y2OA 4Q0IA 2GDNA 3PBRA 3MQ0A 4BL2A 2ZC5B 1G6AA 3ZG7B 2WKEA 4B93A 1CI8A 1IYPA 2VLGA 1IOUA 1V9ZA 5BOHA 1HD8A 1LSVA 4E3KA 3DBAA 3QP2A 3KSFA 4MEZA 4C75A 1VEUA 1FOFA 2CMNA 3MQQA 4QB8A 4ZJ3A 4MLLA 4EUVA 3RFBA 4XUXA 2EX9A 4WUJA 4EQ1A 3V50A 5EE8A 4JGRA 4WMCA 4XT2B 4D60A 1GSWA 1S4SA 2JKRM 1TEMA 2O99A 4KG6A 4L9GA 1DP9A 2JKRI 3NIAA 5EFWA 4E04A 1F2KA 1W79A 5JYOA 3UO9A 3EWKA 3LIAA 2WKIA 4BBUA 4CLCC 4HJ3A 2EX2A 1ACFA 4KG5A 3MXSA 4DE2A 2Y2GA 2BG1A 3UDFA 2Y4AA 3SS3A 2GNXA 3MZFA 5GHYA 1OJ5A 1F98A 4WMCD 3Q82A 3O88A 1XGIA 4RX3A 1TVFA 4Y0OA 3JVVA 2EWWA 4LPZA 3I7JA 5F1GA 1ES5A 4PKYG 1FR6A 3T1XA 2VGLM 4LGWA 1F5MA 3A0RA 1H3QA 5EVIC 3F1OA 3UE1A 5L09A 5FEFA 4UEYA 1OTDA 3S7QA 3UE3A 2R78A 4OONA 4XUZA 3BY9A 3G6OA 4S2LA 2PYRA 5IT5A 3RJUA 3VSLA 3HLDA 4IEDA 3HREA 1G6OA 4X53A 5F82A 4HH3A 2HV1A 3VE3A 4KZ5A 2JBFA 1C3BA 3BFGA 2ZQ7A 3GQZA 4IJGA 4Y15A 2IWDA 2W27A 5FAQA 3R7WA 4WLAA 3A3EA 3CI6A 3DW0A 3LR4A 3C2WA 3IH8A 2IWBA 3BFCA 1S6RA 4BLMA 2HDQA 3UE0A 1PI4A 4HESA 1GHIA 1Y4OA 2Y2LA 2VZWA 3FWLA 3Q81A 3HUNA 5E2HA 5DTSA 4YFMA 1G28A 4U0XA 3LR0A 3ZQ5A 2OOLA 1Z09A 4KENB 4QY6A 3HUOA 4H6JA 4LV0A 3WRZA 3AGFA 4PMAA 2VV8A 4NG2A 1ODVA 1K6RA 3MBZA 4GB7A 3CUEA 3GMWA 4JXSA 4RX2A 1QMFA 2X71A 4I3IA 5HL1A 1PZOA 1K4EA 3IHBA 2D02A 3H9WA 3NULA 3TW8A 3MKFA 3LO7A 3V39A 5EECA 3GRJA 4C6YA 1DJBA 3G30A 3QP5A 1ZG4A 4B88A 1KGGA 5DFXA 5L2FA 3ZDJA 5HZHA 1H8MA 1F9IA 4QU3A 1JWZA 1PNEA 5FQKA 2QKPA 1LHYA 3FZCA 4CLCB 3D9YA 2AVXA 3QP1A 4ID4A 1GHMA 3GSGA 3UN7A 5CRFA 2XRNA 5FSRA 5FQIA 1K55C 2VA0A 2WYXA 2RCXA 2Z2LB 5FQQA 5CTMA 1SZVA 3M6BA 5A91A 1P0ZA 3FYZA 3QP6A 4PAUA 5TFQA 2WADA 2E8JA 1NLYA 3E4OA 4EBPA 4LV1A 3MF0A 1W63Q 1H0MA 4IBRA 5EM1A 3SOIA 3D3OA 2ZMFA 1ALQA 5AQBA 4P0MA 1IYSA 5EPHA 3IXHA 4ESPA 1WYBA 3MZDA 5CGWA 4GDBA 2ZQ9A 4IUHA 2PAVP 4GCZA 2EFXA 4X55A 1HTZA 2P74A 3BW6A 1H8ZA 1CEFA 4PM5A 3S4XA 3M6HA 2Z6CA 1E25A 1A0KA 1XJ6A 4OLDA 1BLCA 4S2KA 1YM1A 4B9OA 3W4OA 1OT6A 3SS4A 2IA2A 3VP2A 1OTAA 4PM9A 4X1LA 4EU0A 4JBFA 3T12B 2WZZA 4JXGA 3K2NA 5F68A 2O0YA 5HWTA 2HP6A 4MBFA 2VV6A 1M6KA 2OAQ1 3LYXA 4HHDA 4IVIA 4BD1A 3IXBA 3K3DA 5CXWA 2H0YA 4CQHA 4KUKA 3LIBA 1JVJA 2PBDP 4NXFA 3G2ZA 5DTKA 3G34A 5EOEA 2B5RA 4ZRRA 1K56D 4IVKA 2JN7A 1KE4A 4E3MA 1L0EA 2WAEA 5J3WA 4Z1WA 3NC8A 1CEGA 1YMSA 3L7HA 1Z6FA 3LUQA 1MWUA 4UQIM 3R4KA 1ONGA 2Y2IA 3VFFA 4R38A 3RXWA 1AWIA 1J3WA 4UQIS 3EQVA 4GS9B 1BULA 4YINA 4GW9A 4ZJ1A 2W3GA 3OPLA 5EVEA 2HDUA 2GJ3A 2WK0A 5DJUA 3BWLA 3UB6A 4R3AA 1XPBA 2PYPA 4QD4A 4QJGA 5CGXA 5I5LA 2WGWA 1CK3A 1NWZA 3IBJA 2VX8A 4UA9A 4DE0A 4H8RA 5EVIB 2RL3A 4BMWA 3BYDA 1LSWA 4K0WA 5HL6A 4NK3A 2HP9A 1XJ4A
chains in the Genus database with same CATH topology
5EVLA 1K38A 3V50A 5EE8A 5U47A 1SDEA 3W4QA 4KZ4A 2C5WB 3WRTA 4U3TA 3O3VA 3C4OA 3VFHA 4WMCA 4KQOA 3Q1FA 5AQ7A 2Z2MB 1L0FA 3IH9A 3NY4A 3TG9A 5HAQA 1TEMA 4RYEA 1PWCA 2V2FF 1ONHA 4KG6A 3ZNTA 3FV7A 4R4RA 3VP3A 3V3SA 1O07A 2XF3A 3NIAA 1XKZA 3VP4A 3NI9A 4L0LA 5DF8A 3ZCZA 1YLPA 5DVAA 1K57C 3E2KA 4OVDA 1W79A 2HPBA 3ISGA 5JYOA 5TR7A 2EX8A 3UO9A 3PBOA 3ZVWA 2WKIA 1FR1A 5CEDA 1QMEA 3VP0A 1LL5A 4E3OA 5KSHA 2ZQAA 2OLUA 4UAAA 2EX2A 3UPNA 4KG5A 3IF6A 1G68A 1KGFA 1N9BA 3MXSA 3ZNYA 4DE2A 2WGWB 2Y2GA 1K25A 2BG1A 3UDFA 5F83A 2Y4AA 4RA7A 4X6TA 4S2MA 3SS3A 1KE0A 1K6SA 1XA7A 2ZM0A 4LCMA 4OPZA 1K55A 4R3BA 3MZFA 3C5AA 3E2LA 3IWIA 4RVAA 2QPNA 3C7VA 4PM7A 3P98A 5GHYA 2X02A 4EBLA 2A3UA 3BM6A 4WMCD 4OPYA 3Q82A 3O88A 1XGIA 3N8LA 4RX3A 1K56A 1TVFA 4Y0OA 4OOYA 4OOMA 3I7JA 1NYYA 1ES5A 5F1GA 1YLJA 3CG5A 1FR6A 4N9KA 2Y2PA 4N92A 5CGSA 2XD1A 5GLDA 3P09A 3A3IA 4DXCA 4QHCA 3SH7A 1GCEA 4CJNA 3PBNA 1Q2QA 3LCEA 4K91A 5EVIC 2EX6A 3A3FA 3UE1A 1KVMA 1GA0A 5HW3A 2JE5A 1IEMA 1S0WA 3OPPA 3Q07A 3UE3A 1BTLA 1DY6A 2ZC4B 4OONA 4A5RA 4XUZA 2X01A 3Q7VA 2Y59A 3BLMA 5FASA 2I72A 4S2LA 3UDIA 1PYYA 4X56A 2PBYA 4JKTA 3BFEA 3RJUA 3VSLA 3HLWA 4OOLA 3HLDA 4IEDA 3HREA 1L2SA 4DF6A 1BLHA 3O87A 4X53A 5F82A 3NBLA 4WZ5C 3G2YA 3IWOA 3W8KA 1OMEA 4KZ5A 3LY4A 2JBFA 1C3BA 3BFGA 2ZQ7A 1ERQA 2XLNA 3GQZA 4KQQA 4PM8A 1XP4A 4DKIA 2IWDA 1SCWA 3G4PA 4Y0UA 4Y7PA 5D3OA 4WBGA 5TGFA 4CPKA 2WGIA 5FAQA 1MWRA 1E3UA 4E6XA 2Y55A 3A3EA 5IHVA 1CI9A 3ZG9B 3DW0A 1NZOA 5HAIA 3GV9A 1L0GA 5CTNA 4FSFA 2Y2HA 4MNRA 3SS5A 3UPOA 3IH8A 3OZHA 2IWBA 3BFCA 5DF9A 5HX9A 4FH4A 1S6RA 2WAFA 1LL9A 4BLMA 4S2NC 1I5QA 4EBNA 2HDQA 5GLBA 3UE0A 1FSWA 4R0QA 4FH2A 4GNUA 1PI4A 4HESA 1GHIA 4DDSA 3IQAA 2Y2LA 3FWLA 3Q81A 3HUNA 3C7UA 2ZQDA 5E2HA 2QZ6A 4E6WA 3TOIA 1IYOA 2HDSA 2XH9A 2Q9MA 1ES4A 1MPLA 3S1YA 1ES3A 1H8YA 1LLBA 3WS5A 1KE3A 5DTSA 5EOOA 5M19A 4EQIA 1YQSA 3IT9A 4YFMA 3HLFA 4LV3A 1RGYA 1FCMA 1Y54A 1YLYA 4U0XA 5FQJA 4KZAA 4ZJ2A 2JC7A 5FAPA 5CERA 2R9WA 3G35A 3JYIA 1NJ4A 1J9MA 1RCJA 3ITBA 1JWPA 4KENB 4QY6A 2H10A 3HUOA 1PZPA 4OKPA 5M18A 2ZM8A 2EFUA 3AGDA 5DTTA 1VM1A 4DE3A 3VOZA 4LV0A 3WRZA 3ZGAB 1ES2A 2XDMA 1K54C 3A3JA 3AGFA 3DWKA 4PMAA 4E3JA 1XA1A 5AQAA 1K6RA 1PW1A 3ZG8B 3MBZA 3QHYA 4GB7A 3Q7VB 1E3UD 3GMWA 3G32A 4JXSA 4RX2A 3OCLA 2Y2KA 4PM6A 2OLVA 4MBHA 4GN2A 5KZHA 1QMFA 2X71A 3SH8A 1PW8A 2XEPA 1ZG6A 5HL1A 1PZOA 5GHXA 4OH0A 1K4EA 2H0TA 5FAOA 3IHBA 4OQGA 2XGNA 1EROA 1VQQA 1ZKJA 2ZLYA 2VGKA 3LO7A 1KDWA 2C6WB 3MKFA 5G18A 4BQMA 4D2OA 2J9OA 3V39A 3BFDA 5EECA 3GRJA 1IELA 4C6YA 1DJBA 3G30A 5JYPA 1FCNA 1ZG4A 4JF6A 5CHUA 5FATA 1W8YA 3PTEA 4B88A 1KGEA 3WS4A 1KGGA 3QNBA 1HZOA 3HL9A 5CECA 3V5MA 3HLCA 5L2FA 2XK1A 4E3NA 4KZ7A 2G2WA 2ZC6B 3IWQA 4N1XA 3ZDJA 1K57A 2ZM2A 4QU3A 1JWZA 5E43A 1EI5A 2E8IA 5FQKA 3MZEA 1NRFA 3EQUA 3M2KA 2EXAA 2ZQCA 1LHYA 4FD8A 4QY5A 2Y2QA 3FZCA 4KZ9A 1ZC2A 2ZC3B 5FI2A 1PIOA 5A93A 3HLGA 5GHZA 2XD5A 4OLGA 4O7DA 1AXBA 4ID4A 1DJCA 3VSKA 5A90A 1GHMA 2J8YA 3GSGA 4MBKA 3BLSA 3UN7A 1LI9A 5CRFA 4ZDXA 1DJAA 5FSRA 5FQIA 4Z9QA 1H5XA 1K55C 3BEBA 3UNWA 3ZFZA 2Z2LB 2WYXA 2RCXA 3NCKA 4JPMA 1WYCA 3ZHHA 3ZG5A 3UDXA 1GHPA 3VP1A 3WS0A 5FQQA 5CTMA 4DXBA 4GD6A 4JXVA 5HAPA 1BLPA 5GLAA 1GA9A 1BZAA 3M6BA 2IWCA 4LV2A 5A91A 4DRTA 3FYZA 3D4FA 4WM9A 3WS2A 4FCFA 4B4ZA 1NXYA 4KQRA 3PAEA 2R9XA 4OQHA 5A92A 4GKUA 5TFQA 4C3QA 2P9VA 1TDGA 4P6BA 4NETA 2WADA 1W8QA 4EV4A 4BD0A 2PU2A 1YLWA 3DWZA 4JF5A 3ZG0A 1NY0A 3MFDA 5FDHA 4EBPA 3ZVTA 2EXBA 4LV1A 1EWZA 3GTCA 4EWFA 5J8XA 1E4DA 1HVBA 4JLFA 4LCLA 4IBRA 1MWTA 5KSCA 3SOIA 2BLSA 4GD8A 1PI5A 1NZUA 1ALQA 5AQBA 1M40A 2ZMAA 1KVLA 3HLEA 3AGEA 4P0MA 3SH9A 2DCFA 4M3KA 1IYSA 5EPHA 3IXHA 1WYBA 4WELA 3MZDA 1NYMA 5CGWA 4GDBA 4HBTA 3N8RA 1BUEA 2ZQ9A 3GVBA 5HARA 3UY6A 4BL3A 3N8SA 1BSGA 3S22A 4HBUA 4ZAMA 4U0TA 5M1AA 4UHUA 3BFFA 1BLSA 1BT5A 3HLBA 2Q9NA 2FFYA 3IHAA 2EFXA 4X55A 1HTZA 2P74A 4WZ4A 5CHMA 1H8ZA 2H5SA 1CEFA 3N7WA 4P87A 4BENA 4PM5A 3S4XA 3WS1A 1KDSA 5FI7A 4Q8IA 2ZJ9A 2WKHA 3PBSA 3RXXA 3M6HA 2HDRA 3VMAA 1E25A 2J7VA 4KZ6A 5EVIA 1SKFA 3OPRA 4OLDA 1MWSA 1RGZA 1BLCA 3LY3A 2A49A 4S2KA 4S2NA 1ESUA 2ZC7A 1YM1A 3CZDA 3IXDA 5AQ9A 1K54A 4R4SA 4OQIA 3W4OA 1L0DA 3OPHA 2ZD8A 4EUZA 1MY8A 2OV5A 4UA7A 3SS4A 4K0XA 2QMIA 4JXWA 4PPRA 3VP2A 5CEBA 2DRWA 1PWDA 3DTMA 4PM9A 2VGJA 3N6IA 4OPQA 3CJMA 1YMXA 3BECA 5GL9A 1YLTA 4JBFA 1MXOA 5KMWA 2WZZA 4JXGA 4R23A 4DDYA 4KZBA 2WZXA 2J9PA 2Y2JA 2HP6A 4P85A 4MBFA 1M6KA 2Y2MA 4IVIA 4WEKA 4WYYA 2V20A 4B4XA 3HUMA 4BD1A 3IXBA 5CXWA 5FI6A 3WWXA 2H0YA 2WGVA 1YLZA 4ZBEA 2G2UA 1JTDA 1JVJA 1RP5A 3HBRA 4WEJA 4R1GA 3G2ZA 5GLCA 1SDNA 4GDNA 5DTKA 3G34A 5EOEA 1ERMA 1I2WA 2OSUA 3NDGA 4XXRA 4KZ3A 2B5RA 3HVFA 5EVID 1K56D 4S2IA 1WE4A 5FQ9A 2WUQA 4IVKA 1KE4A 4E3MA 1L0EA 4N1HA 2WAEA 4ZTKA 1FSYA 5E2EA 2P9VB 4OP5A 1PWGA 1Q2PA 1XXMA 3LEZA 3B3XA 3NC8A 3MKEA 3N4IA 1CEGA 2FFFB 3NDEA 3PBQA 1YMSA 1YT4A 4X69A 4DE1A 3Q7ZA 3UPPA 2JCHA 4X68A 4E3LA 3GR2A 4KG2A 4S2PA 3IF6B 1I2SA 3QNCA 4E3IA 1Z6FA 4OQ0A 1MWUA 4UA6A 3TSGA 5E2GA 3CMZA 5FQMA 1LI0A 2PU4A 1U60A 1ONGA 2Y2IA 3OCNA 4LENA 3VFFA 1JWVA 5I94A 4R3JA 3IF5A 1O7EA 4GZBA 1XGJA 4WZ5A 3RXWA 4BJPA 4JF4A 5F1FA 4Y0TA 1MKIA 4N9LA 2XQZA 3EQVA 3MXRA 4OP8A 2ZQ8A 2UWXA 2Y2OA 1BULA 2GDNA 3FKVA 3PBRA 1FCOA 4YINA 3C4PA 4ZJ1A 4IBXA 4HEFA 1FQGA 4F94A 3OPLA 2V1ZA 3M2JA 4GOGA 4BL2A 2ZC5B 1N4OA 1G6AA 2HDUA 2WK0A 1TDLA 3PBTA 2Y2NA 3ZG7B 2WKEA 3IF6C 2XR0A 1IKGA 1CI8A 3G31A 1XPBA 3PAGA 5HFOA 5CHJA 3ITAA 5DF7A 1IYPA 1IKIA 1ESIA 5BOHA 4QD4A 1HD8A 2CC1A 3W4PA 1IYQA 5FA7A 3OC2A 1W5DA 4E3KA 4QJGA 1W7FA 5CGXA 2XFSA 4MEZA 4C75A 2WGWA 3FKWA 1CK3A 1JTGA 1XX2A 4KZ8A 2HP5A 3IXGA 1FOFA 5EUAA 1SHVA 1MBLA 3BRMA 4UA9A 2XFTA 3A3DA 4QB8A 4ZJ3A 4DE0A 4H8RA 3VOYA 4OPRA 4S2OA 5EVIB 2DNSA 2RL3A 3BYDA 4MLLA 4K0WA 4XUXA 1K4FA 3V3RA 4NK3A 4S2JA 5E2FA 2HP9A 2EX9A 3O86A 2Y91A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5EVL A;  1K38 A;  3V50 A;  5EE8 A;  5U47 A;  1SDE A;  3W4Q A;  4KZ4 A;  2C5W B;  3WRT A;  4U3T A;  3O3V A;  3C4O A;  3VFH A;  4WMC A;  4KQO A;  3Q1F A;  5AQ7 A;  2Z2M B;  1L0F A;  3IH9 A;  3NY4 A;  3TG9 A;  5HAQ A;  1TEM A;  4RYE A;  1PWC A;  2V2F F;  1ONH A;  4KG6 A;  3ZNT A;  3FV7 A;  4R4R A;  3VP3 A;  3V3S A;  1O07 A;  2XF3 A;  3NIA A;  1XKZ A;  3VP4 A;  3NI9 A;  4L0L A;  5DF8 A;  3ZCZ A;  1YLP A;  5DVA A;  1K57 C;  3E2K A;  4OVD A;  1W79 A;  2HPB A;  3ISG A;  5JYO A;  5TR7 A;  2EX8 A;  3UO9 A;  3PBO A;  3ZVW A;  2WKI A;  1FR1 A;  5CED A;  1QME A;  3VP0 A;  1LL5 A;  4E3O A;  5KSH A;  2ZQA A;  2OLU A;  4UAA A;  2EX2 A;  3UPN A;  4KG5 A;  3IF6 A;  1G68 A;  1KGF A;  1N9B A;  3MXS A;  3ZNY A;  4DE2 A;  2WGW B;  2Y2G A;  1K25 A;  2BG1 A;  3UDF A;  5F83 A;  2Y4A A;  4RA7 A;  4X6T A;  4S2M A;  3SS3 A;  1KE0 A;  1K6S A;  1XA7 A;  2ZM0 A;  4LCM A;  4OPZ A;  1K55 A;  4R3B A;  3MZF A;  3C5A A;  3E2L A;  3IWI A;  4RVA A;  2QPN A;  3C7V A;  4PM7 A;  3P98 A;  5GHY A;  2X02 A;  4EBL A;  2A3U A;  3BM6 A;  4WMC D;  4OPY A;  3Q82 A;  3O88 A;  1XGI A;  3N8L A;  4RX3 A;  1K56 A;  1TVF A;  4Y0O A;  4OOY A;  4OOM A;  3I7J A;  1NYY A;  1ES5 A;  5F1G A;  1YLJ A;  3CG5 A;  1FR6 A;  4N9K A;  2Y2P A;  4N92 A;  5CGS A;  2XD1 A;  5GLD A;  3P09 A;  3A3I A;  4DXC A;  4QHC A;  3SH7 A;  1GCE A;  4CJN A;  3PBN A;  1Q2Q A;  3LCE A;  4K91 A;  5EVI C;  2EX6 A;  3A3F A;  3UE1 A;  1KVM A;  1GA0 A;  5HW3 A;  2JE5 A;  1IEM A;  1S0W A;  3OPP A;  3Q07 A;  3UE3 A;  1BTL A;  1DY6 A;  2ZC4 B;  4OON A;  4A5R A;  4XUZ A;  2X01 A;  3Q7V A;  2Y59 A;  3BLM A;  5FAS A;  2I72 A;  4S2L A;  3UDI A;  1PYY A;  4X56 A;  2PBY A;  4JKT A;  3BFE A;  3RJU A;  3VSL A;  3HLW A;  4OOL A;  3HLD A;  4IED A;  3HRE A;  1L2S A;  4DF6 A;  1BLH A;  3O87 A;  4X53 A;  5F82 A;  3NBL A;  4WZ5 C;  3G2Y A;  3IWO A;  3W8K A;  1OME A;  4KZ5 A;  3LY4 A;  2JBF A;  1C3B A;  3BFG A;  2ZQ7 A;  1ERQ A;  2XLN A;  3GQZ A;  4KQQ A;  4PM8 A;  1XP4 A;  4DKI A;  2IWD A;  1SCW A;  3G4P A;  4Y0U A;  4Y7P A;  5D3O A;  4WBG A;  5TGF A;  4CPK A;  2WGI A;  5FAQ A;  1MWR A;  1E3U A;  4E6X A;  2Y55 A;  3A3E A;  5IHV A;  1CI9 A;  3ZG9 B;  3DW0 A;  1NZO A;  5HAI A;  3GV9 A;  1L0G A;  5CTN A;  4FSF A;  2Y2H A;  4MNR A;  3SS5 A;  3UPO A;  3IH8 A;  3OZH A;  2IWB A;  3BFC A;  5DF9 A;  5HX9 A;  4FH4 A;  1S6R A;  2WAF A;  1LL9 A;  4BLM A;  4S2N C;  1I5Q A;  4EBN A;  2HDQ A;  5GLB A;  3UE0 A;  1FSW A;  4R0Q A;  4FH2 A;  4GNU A;  1PI4 A;  4HES A;  1GHI A;  4DDS A;  3IQA A;  2Y2L A;  3FWL A;  3Q81 A;  3HUN A;  3C7U A;  2ZQD A;  5E2H A;  2QZ6 A;  4E6W A;  3TOI A;  1IYO A;  2HDS A;  2XH9 A;  2Q9M A;  1ES4 A;  1MPL A;  3S1Y A;  1ES3 A;  1H8Y A;  1LLB A;  3WS5 A;  1KE3 A;  5DTS A;  5EOO A;  5M19 A;  4EQI A;  1YQS A;  3IT9 A;  4YFM A;  3HLF A;  4LV3 A;  1RGY A;  1FCM A;  1Y54 A;  1YLY A;  4U0X A;  5FQJ A;  4KZA A;  4ZJ2 A;  2JC7 A;  5FAP A;  5CER A;  2R9W A;  3G35 A;  3JYI A;  1NJ4 A;  1J9M A;  1RCJ A;  3ITB A;  1JWP A;  4KEN B;  4QY6 A;  2H10 A;  3HUO A;  1PZP A;  4OKP A;  5M18 A;  2ZM8 A;  2EFU A;  3AGD A;  5DTT A;  1VM1 A;  4DE3 A;  3VOZ A;  4LV0 A;  3WRZ A;  3ZGA B;  1ES2 A;  2XDM A;  1K54 C;  3A3J A;  3AGF A;  3DWK A;  4PMA A;  4E3J A;  1XA1 A;  5AQA A;  1K6R A;  1PW1 A;  3ZG8 B;  3MBZ A;  3QHY A;  4GB7 A;  3Q7V B;  1E3U D;  3GMW A;  3G32 A;  4JXS A;  4RX2 A;  3OCL A;  2Y2K A;  4PM6 A;  2OLV A;  4MBH A;  4GN2 A;  5KZH A;  1QMF A;  2X71 A;  3SH8 A;  1PW8 A;  2XEP A;  1ZG6 A;  5HL1 A;  1PZO A;  5GHX A;  4OH0 A;  1K4E A;  2H0T A;  5FAO A;  3IHB A;  4OQG A;  2XGN A;  1ERO A;  1VQQ A;  1ZKJ A;  2ZLY A;  2VGK A;  3LO7 A;  1KDW A;  2C6W B;  3MKF A;  5G18 A;  4BQM A;  4D2O A;  2J9O A;  3V39 A;  3BFD A;  5EEC A;  3GRJ A;  1IEL A;  4C6Y A;  1DJB A;  3G30 A;  5JYP A;  1FCN A;  1ZG4 A;  4JF6 A;  5CHU A;  5FAT A;  1W8Y A;  3PTE A;  4B88 A;  1KGE A;  3WS4 A;  1KGG A;  3QNB A;  1HZO A;  3HL9 A;  5CEC A;  3V5M A;  3HLC A;  5L2F A;  2XK1 A;  4E3N A;  4KZ7 A;  2G2W A;  2ZC6 B;  3IWQ A;  4N1X A;  3ZDJ A;  1K57 A;  2ZM2 A;  4QU3 A;  1JWZ A;  5E43 A;  1EI5 A;  2E8I A;  5FQK A;  3MZE A;  1NRF A;  3EQU A;  3M2K A;  2EXA A;  2ZQC A;  1LHY A;  4FD8 A;  4QY5 A;  2Y2Q A;  3FZC A;  4KZ9 A;  1ZC2 A;  2ZC3 B;  5FI2 A;  1PIO A;  5A93 A;  3HLG A;  5GHZ A;  2XD5 A;  4OLG A;  4O7D A;  1AXB A;  4ID4 A;  1DJC A;  3VSK A;  5A90 A;  1GHM A;  2J8Y A;  3GSG A;  4MBK A;  3BLS A;  3UN7 A;  1LI9 A;  5CRF A;  4ZDX A;  1DJA A;  5FSR A;  5FQI A;  4Z9Q A;  1H5X A;  1K55 C;  3BEB A;  3UNW A;  3ZFZ A;  2Z2L B;  2WYX A;  2RCX A;  3NCK A;  4JPM A;  1WYC A;  3ZHH A;  3ZG5 A;  3UDX A;  1GHP A;  3VP1 A;  3WS0 A;  5FQQ A;  5CTM A;  4DXB A;  4GD6 A;  4JXV A;  5HAP A;  1BLP A;  5GLA A;  1GA9 A;  1BZA A;  3M6B A;  2IWC A;  4LV2 A;  5A91 A;  4DRT A;  3FYZ A;  3D4F A;  4WM9 A;  3WS2 A;  4FCF A;  4B4Z A;  1NXY A;  4KQR A;  3PAE A;  2R9X A;  4OQH A;  5A92 A;  4GKU A;  5TFQ A;  4C3Q A;  2P9V A;  1TDG A;  4P6B A;  4NET A;  2WAD A;  1W8Q A;  4EV4 A;  4BD0 A;  2PU2 A;  1YLW A;  3DWZ A;  4JF5 A;  3ZG0 A;  1NY0 A;  3MFD A;  5FDH A;  4EBP A;  3ZVT A;  2EXB A;  4LV1 A;  1EWZ A;  3GTC A;  4EWF A;  5J8X A;  1E4D A;  1HVB A;  4JLF A;  4LCL A;  4IBR A;  1MWT A;  5KSC A;  3SOI A;  2BLS A;  4GD8 A;  1PI5 A;  1NZU A;  1ALQ A;  5AQB A;  1M40 A;  2ZMA A;  1KVL A;  3HLE A;  3AGE A;  4P0M A;  3SH9 A;  2DCF A;  4M3K A;  1IYS A;  5EPH A;  3IXH A;  1WYB A;  4WEL A;  3MZD A;  1NYM A;  5CGW A;  4GDB A;  4HBT A;  3N8R A;  1BUE A;  2ZQ9 A;  3GVB A;  5HAR A;  3UY6 A;  4BL3 A;  3N8S A;  1BSG A;  3S22 A;  4HBU A;  4ZAM A;  4U0T A;  5M1A A;  4UHU A;  3BFF A;  1BLS A;  1BT5 A;  3HLB A;  2Q9N A;  2FFY A;  3IHA A;  2EFX A;  4X55 A;  1HTZ A;  2P74 A;  4WZ4 A;  5CHM A;  1H8Z A;  2H5S A;  1CEF A;  3N7W A;  4P87 A;  4BEN A;  4PM5 A;  3S4X A;  3WS1 A;  1KDS A;  5FI7 A;  4Q8I A;  2ZJ9 A;  2WKH A;  3PBS A;  3RXX A;  3M6H A;  2HDR A;  3VMA A;  1E25 A;  2J7V A;  4KZ6 A;  5EVI A;  1SKF A;  3OPR A;  4OLD A;  1MWS A;  1RGZ A;  1BLC A;  3LY3 A;  2A49 A;  4S2K A;  4S2N A;  1ESU A;  2ZC7 A;  1YM1 A;  3CZD A;  3IXD A;  5AQ9 A;  1K54 A;  4R4S A;  4OQI A;  3W4O A;  1L0D A;  3OPH A;  2ZD8 A;  4EUZ A;  1MY8 A;  2OV5 A;  4UA7 A;  3SS4 A;  4K0X A;  2QMI A;  4JXW A;  4PPR A;  3VP2 A;  5CEB A;  2DRW A;  1PWD A;  3DTM A;  4PM9 A;  2VGJ A;  3N6I A;  4OPQ A;  3CJM A;  1YMX A;  3BEC A;  5GL9 A;  1YLT A;  4JBF A;  1MXO A;  5KMW A;  2WZZ A;  4JXG A;  4R23 A;  4DDY A;  4KZB A;  2WZX A;  2J9P A;  2Y2J A;  2HP6 A;  4P85 A;  4MBF A;  1M6K A;  2Y2M A;  4IVI A;  4WEK A;  4WYY A;  2V20 A;  4B4X A;  3HUM A;  4BD1 A;  3IXB A;  5CXW A;  5FI6 A;  3WWX A;  2H0Y A;  2WGV A;  1YLZ A;  4ZBE A;  2G2U A;  1JTD A;  1JVJ A;  1RP5 A;  3HBR A;  4WEJ A;  4R1G A;  3G2Z A;  5GLC A;  1SDN A;  4GDN A;  5DTK A;  3G34 A;  5EOE A;  1ERM A;  1I2W A;  2OSU A;  3NDG A;  4XXR A;  4KZ3 A;  2B5R A;  3HVF A;  5EVI D;  1K56 D;  4S2I A;  1WE4 A;  5FQ9 A;  2WUQ A;  4IVK A;  1KE4 A;  4E3M A;  1L0E A;  4N1H A;  2WAE A;  4ZTK A;  1FSY A;  5E2E A;  2P9V B;  4OP5 A;  1PWG A;  1Q2P A;  1XXM A;  3LEZ A;  3B3X A;  3NC8 A;  3MKE A;  3N4I A;  1CEG A;  2FFF B;  3NDE A;  3PBQ A;  1YMS A;  1YT4 A;  4X69 A;  4DE1 A;  3Q7Z A;  3UPP A;  2JCH A;  4X68 A;  4E3L A;  3GR2 A;  4KG2 A;  4S2P A;  3IF6 B;  1I2S A;  3QNC A;  4E3I A;  1Z6F A;  4OQ0 A;  1MWU A;  4UA6 A;  3TSG A;  5E2G A;  3CMZ A;  5FQM A;  1LI0 A;  2PU4 A;  1U60 A;  1ONG A;  2Y2I A;  3OCN A;  4LEN A;  3VFF A;  1JWV A;  5I94 A;  4R3J A;  3IF5 A;  1O7E A;  4GZB A;  1XGJ A;  4WZ5 A;  3RXW A;  4BJP A;  4JF4 A;  5F1F A;  4Y0T A;  1MKI A;  4N9L A;  2XQZ A;  3EQV A;  3MXR A;  4OP8 A;  2ZQ8 A;  2UWX A;  2Y2O A;  1BUL A;  2GDN A;  3FKV A;  3PBR A;  1FCO A;  4YIN A;  3C4P A;  4ZJ1 A;  4IBX A;  4HEF A;  1FQG A;  4F94 A;  3OPL A;  2V1Z A;  3M2J A;  4GOG A;  4BL2 A;  2ZC5 B;  1N4O A;  1G6A A;  2HDU A;  2WK0 A;  1TDL A;  3PBT A;  2Y2N A;  3ZG7 B;  2WKE A;  3IF6 C;  2XR0 A;  1IKG A;  1CI8 A;  3G31 A;  1XPB A;  3PAG A;  5HFO A;  5CHJ A;  3ITA A;  5DF7 A;  1IYP A;  1IKI A;  1ESI A;  5BOH A;  4QD4 A;  1HD8 A;  2CC1 A;  3W4P A;  1IYQ A;  5FA7 A;  3OC2 A;  1W5D A;  4E3K A;  4QJG A;  1W7F A;  5CGX A;  2XFS A;  4MEZ A;  4C75 A;  2WGW A;  3FKW A;  1CK3 A;  1JTG A;  1XX2 A;  4KZ8 A;  2HP5 A;  3IXG A;  1FOF A;  5EUA A;  1SHV A;  1MBL A;  3BRM A;  4UA9 A;  2XFT A;  3A3D A;  4QB8 A;  4ZJ3 A;  4DE0 A;  4H8R A;  3VOY A;  4OPR A;  4S2O A;  5EVI B;  2DNS A;  2RL3 A;  3BYD A;  4MLL A;  4K0W A;  4XUX A;  1K4F A;  3V3R A;  4NK3 A;  4S2J A;  5E2F A;  2HP9 A;  2EX9 A;  3O86 A;  2Y91 A; 
#chains in the Genus database with same CATH topology
 1K38 A;  5U47 A;  2NUP C;  3WRT A;  4U3T A;  3CIT A;  4DJ3 A;  1P97 A;  2Z2M B;  3NY4 A;  5HAQ A;  3OLO A;  3H82 B;  2P04 A;  1OTE A;  3E4Q A;  3VP3 A;  1DRM A;  3F1N B;  2XF3 A;  1XKZ A;  3VP4 A;  1LT0 A;  3NI9 A;  4L0L A;  1YLP A;  5DVA A;  1K57 C;  1PFL A;  3E2K A;  4OVD A;  3BQ8 A;  3CUE C;  2EX8 A;  1FR1 A;  5CED A;  2GZA A;  2M1C A;  3VP0 A;  4UAA A;  3E0Y A;  3ZNY A;  4Q0H A;  3JPU A;  5F83 A;  3UE6 A;  4WF0 A;  2DMW A;  4LCM A;  4R3B A;  3C5A A;  2H28 A;  3E2L A;  4RVA A;  3IWI A;  3L9K A;  2QPN A;  3PHY A;  3T4K A;  2A3U A;  3T4L A;  2M7V A;  1OTI A;  4OOY A;  3CLO A;  4Y17 A;  4M4X A;  1NYY A;  4N92 A;  5GLD A;  4QHC A;  1Q2Q A;  3QP8 A;  1GA0 A;  2JE5 A;  2O9B A;  3UB5 P;  3OPP A;  4L9E A;  2ZC4 B;  2KDK A;  4A5R A;  5FAS A;  3B47 A;  3UDI A;  2PBY A;  5IU1 A;  3BFE A;  5CX7 A;  4DF6 A;  2YKH A;  3NBL A;  4HJ4 A;  5HSQ A;  2PR6 A;  2GX5 A;  3LY4 A;  2QJ5 A;  2J3T C;  4DKI A;  1HLU P;  1VET A;  2LB9 A;  5TGF A;  5D3O A;  4WN5 A;  2D01 A;  2Z6D A;  3EEH A;  5HAI A;  4MNR A;  3UPO A;  4MCW A;  3GEC A;  5HX9 A;  1XJ2 A;  4G3K A;  4S2N C;  5GLB A;  4GNU A;  4DDS A;  2P08 A;  2PDR A;  3TOI A;  5HWW A;  2XH9 A;  1ES4 A;  1MPL A;  3S1Y A;  1LLB A;  2V8C A;  3WS5 A;  5EOO A;  1YQS A;  1CF0 A;  3HLF A;  4I39 A;  1TS8 A;  4ZJ2 A;  2W1R A;  5CER A;  3JYI A;  2A24 B;  2Q0O A;  1PZP A;  3NEC A;  2W3D A;  1ES2 A;  1K54 C;  1P9R A;  4E3J A;  1XA1 A;  4AFI A;  1PW1 A;  1STZ A;  3MQO A;  2B02 A;  4PM6 A;  3SZT A;  4MBH A;  2XEP A;  5GHX A;  4OH0 A;  4ARZ A;  4KQD A;  4P6Z M;  4GLQ A;  5JYP A;  3PTE A;  1KGE A;  3WS4 A;  2ZMV A;  3QNB A;  3R7W B;  1HZO A;  3CPT A;  1K57 A;  4IUK A;  5E43 A;  1S1Y A;  2ZQC A;  2G7U A;  2ZC3 B;  2L0W A;  3NHQ A;  2XD5 A;  4OLG A;  4QPR A;  1AXB A;  3VSK A;  5A90 A;  2J8Y A;  4MBK A;  3JVU A;  4FUW A;  3IBR A;  1LI9 A;  5KIZ A;  4Z9Q A;  1H5X A;  3UNW A;  3ZG5 A;  1WYC A;  1GHP A;  2W3F A;  1BLP A;  2INW A;  5FEG A;  2IWC A;  2XA7 S;  2HJE A;  4EES A;  4B4Z A;  1UWP X;  2R9X A;  5A92 A;  4GKU A;  4C3Q A;  1TDG A;  4NET A;  1W8Q A;  4BD0 A;  2PU2 A;  4KUO A;  1YLW A;  4JF5 A;  5AVF A;  1DP6 A;  2EXB A;  2JKF A;  1OPX A;  4DJ2 A;  5KSC A;  1NZU A;  3CAX A;  3UB7 A;  2ZMA A;  1KVL A;  3AGE A;  3SH9 A;  2PD7 A;  4WEL A;  5J4E A;  4HBT A;  3KO6 A;  4BL3 A;  3UY6 A;  3N8S A;  4L9F A;  1BSG A;  3S22 A;  4ZAM A;  4U0T A;  5M1A A;  1BT5 A;  2Q9N A;  3IHA A;  3N7W A;  4BEN A;  3T50 A;  2YKF A;  3WS1 A;  1KDS A;  4Q8I A;  2ZJ9 A;  3PBS A;  2HDR A;  2K2N A;  3VMA A;  2J7V A;  5EVI A;  4KZ6 A;  3E4P A;  3OPR A;  2J80 A;  2LB5 A;  1RGZ A;  1T1C A;  4LRZ E;  1ESU A;  4R4S A;  4OQI A;  1ZTU A;  4NXG A;  4K0X A;  3P7N A;  2DRW A;  3BEC A;  4P85 A;  2Y2M A;  3CWF A;  4B4X A;  5DKL A;  4BWI A;  2G2U A;  1JTD A;  3HBR A;  4WEJ A;  4R1G A;  2VJW A;  2V8F A;  1ERM A;  1I2W A;  3IX3 A;  3F1N A;  2ZOH A;  3W2Z A;  2P7J A;  5EVI D;  3P01 A;  2ZL1 A;  4S2I A;  3EGD C;  2WUQ A;  1N9N A;  4N1H A;  4ZTK A;  4O8G A;  5E2E A;  2P9V B;  1PWG A;  1Q2P A;  2O9C A;  1CJF A;  3LEZ A;  3MKE A;  3N4I A;  4X69 A;  2FFF B;  5A8B A;  1YT4 A;  3UPP A;  4S2P A;  3IF6 B;  2HZ5 A;  4OQ0 A;  2EWV A;  4EEP A;  5DFY A;  2PU4 A;  1U60 A;  4LFU A;  5I94 A;  4R3J A;  4GZB A;  4WZ5 A;  4JF4 A;  5F1F A;  2HGV A;  3EEA A;  2XQZ A;  5FDS A;  3LI9 A;  3C4P A;  3FPV A;  4IBX A;  4HP4 A;  4F94 A;  3ULF A;  2V1Z A;  4GOG A;  2JKT I;  1TDL A;  3PBT A;  2VV7 A;  1IKG A;  3D72 A;  2PR5 A;  3G31 A;  3IX8 A;  5HD5 A;  5CHJ A;  3ITA A;  1GSV A;  5DF7 A;  1IYQ A;  3OC2 A;  1W5D A;  1GSX A;  2JKG A;  3FKW A;  1JTG A;  4KZ8 A;  5EUA A;  1MBL A;  4H6J B;  3A3D A;  4QWO A;  5F5Y A;  1G5U A;  4P6Z S;  2ZOI A;  5E2F A;  1TD5 A;  5G4Z A;  2Y91 A;  1S1Z A;  5EVL A;  3W4Q A;  4HP9 A;  4KZ4 A;  2C5W B;  3O3V A;  3C4O A;  4ETZ A;  3KYE A;  4I3J A;  5AQ7 A;  1L0F A;  3IH9 A;  4RYE A;  1FIK A;  1PWC A;  3ZNT A;  3FV7 A;  3VV4 A;  4R4R A;  4F3L B;  1NLZ A;  5DF8 A;  5L07 A;  2HPB A;  5TR7 A;  3PBO A;  3ZVW A;  3F1P A;  2V0W A;  1QME A;  4E3O A;  1LL5 A;  5KSH A;  3UPN A;  3IF6 A;  1N9B A;  1IFQ A;  3UB9 A;  4X6T A;  1KE0 A;  2ZM0 A;  2O9A A;  4JGP A;  1K55 A;  2VKS A;  4PM7 A;  3HJK A;  3P98 A;  2X02 A;  2VEA A;  1TS6 A;  1K56 A;  1CQA A;  4NKP A;  1YLJ A;  3CG5 A;  3S7P A;  4N9K A;  5CGS A;  4X1M A;  4HH2 A;  4XT2 A;  2XSS A;  1GCE A;  2EX6 A;  3A3F A;  2QWS A;  3FG8 A;  5HDD A;  1SKO A;  1IEM A;  1D06 A;  3RH8 B;  4BBV A;  1DY6 A;  2X01 A;  3KX0 X;  3Q7V A;  3BLM A;  1P9W A;  2I72 A;  1PYY A;  4I38 A;  1L3L A;  4NXE A;  4JKT A;  5HPI A;  3LGO A;  3HLW A;  4OOL A;  1L2S A;  3O87 A;  2K31 A;  3G2Y A;  3IWO A;  1OME A;  4G3W A;  3LIE A;  3C8C A;  3PR6 A;  2A24 A;  2L1M A;  2V1B A;  4PM8 A;  2VGL S;  3G4P A;  4Y0U A;  3H82 A;  4Y3I A;  2WGI A;  4MN6 A;  5K5B A;  4E6X A;  5L10 A;  2Y55 A;  5IHV A;  2J3T D;  1CI9 A;  1NZO A;  3GV9 A;  1L0G A;  1MC0 A;  5CTN A;  4FSF A;  2Y2H A;  1N9L A;  1ZHH B;  2PT7 A;  3OZH A;  5DF9 A;  4FH4 A;  2WAF A;  2B95 A;  5AVE A;  1YAX A;  2V9A A;  1FSW A;  4II7 A;  3IQA A;  1V9Y A;  1T19 A;  1OT9 A;  3VOL A;  3F1P B;  1VET B;  4EEU A;  1H8Y A;  1S4R A;  1OJG A;  4EQI A;  2KOI A;  1YLY A;  3PXP A;  5FQJ A;  4KZA A;  2JC7 A;  2R9W A;  1J9M A;  3T1Q B;  3ITB A;  2JKT M;  5LBR A;  2EFU A;  5DTT A;  1BYW A;  3IS2 B;  1VM1 A;  3HJI A;  3ZGA B;  4LLO B;  2UV0 E;  3A3J A;  3DWK A;  1N9O A;  1VB6 A;  3DTK A;  3ZG8 B;  1E3U D;  3OCL A;  2Y2K A;  2OLV A;  4GN2 A;  5KZH A;  3CHW P;  1PW8 A;  2MJ6 A;  3TE8 A;  2H0T A;  4OQG A;  2HF6 A;  2VGK A;  4D2O A;  3BFD A;  1IEL A;  4LRY C;  3U2A A;  3ICY A;  4JF6 A;  5FAT A;  2QHK A;  4R70 A;  2ACG A;  3HL9 A;  5CEC A;  4E3N A;  1LL8 A;  4KZ7 A;  2G2W A;  2ZC6 B;  3IWQ A;  3T4T A;  3DTE A;  1EI5 A;  1T18 A;  3LR3 A;  1NRF A;  2EXA A;  4FD8 A;  4QY5 A;  4KZ9 A;  1ZC2 A;  1K0K A;  4O7D A;  1DJC A;  4MN5 A;  1UWN X;  3V67 A;  4ZDX A;  1DJA A;  2ZL1 B;  2V0U A;  1XJ3 A;  3BEB A;  3NCK A;  3ZHH A;  3WS0 A;  4DXB A;  2J3W A;  5GLA A;  4K08 A;  1YSP A;  4YOF A;  4WM9 A;  4FCF A;  1YKD A;  2P9V A;  4EV4 A;  3DWZ A;  3ZG0 A;  5FDH A;  2BAS A;  3IS2 A;  3O5Y A;  3KYQ A;  3GTC A;  5J8X A;  2QJ7 A;  1HVB A;  4JLF A;  1MWT A;  4GD8 A;  1PI5 A;  1M40 A;  4BBT A;  3HLE A;  3C30 A;  2DCF A;  4M3K A;  1NYM A;  1KOU A;  4R6L A;  4HBU A;  3E98 A;  2PD8 A;  1S67 L;  4PHT A;  1BLS A;  3HLB A;  2FFY A;  3KSI A;  4WZ4 A;  2H5S A;  5FI7 A;  2W3E A;  2WKH A;  4Y2F A;  1SKF A;  2PRF A;  1MWS A;  4JGQ A;  2I9V A;  5MC7 A;  5J7E A;  2VK3 A;  1XFN A;  2ZC7 A;  3CZD A;  3DTI A;  3IXD A;  5C5K A;  3ZYT A;  3MJQ A;  3RTY A;  3OPH A;  2ZD8 A;  2OV5 A;  4UA7 A;  2QMI A;  4PPR A;  1YSQ A;  1PWD A;  2V1A A;  3CJM A;  1YMX A;  1YLT A;  5F69 A;  1MXO A;  5KMW A;  4DDY A;  4KZB A;  4WEK A;  4WYY A;  3T4Q A;  1RP5 A;  3A0V A;  1DP8 A;  5IS1 A;  1SDN A;  4EW7 A;  4HJ6 A;  4XXR A;  4KZ3 A;  3HVF A;  4EET B;  5HPF A;  3NJA A;  4HIA A;  5L8M A;  3NOT C;  5HWV A;  2EA9 A;  5F6A A;  2W1T B;  4EER A;  3NDE A;  3PBQ A;  4DE1 A;  2JCH A;  3B33 A;  3GR2 A;  3TJZ C;  4KG2 A;  1I2S A;  3QNC A;  3CPT B;  3TSG A;  5FQM A;  4LEN A;  1JWV A;  4ME4 A;  2KX6 A;  1XGJ A;  4BJP A;  5AJG A;  4Y0T A;  4NEE D;  3FKV A;  4HOI A;  1FCO A;  4HEF A;  1FQG A;  3M2J A;  1N4O A;  2Y2N A;  3IF6 C;  2XR0 A;  3PAG A;  5HFO A;  4GJ4 A;  3LI8 A;  4ETX A;  1IKI A;  1ESI A;  2CC1 A;  3W4P A;  5FA7 A;  1W7F A;  2XFS A;  3F1O B;  1XX2 A;  4HNB A;  2HP5 A;  3IXG A;  4F3L A;  1SHV A;  3BRM A;  2XFT A;  2OAP 1;  3VOY A;  4OPR A;  4S2O A;  2DNS A;  3IX4 A;  4YNR A;  1K4F A;  3V3R A;  4S2J A;  1NRJ A;  3O86 A;  5HDS A;  3H7W A;  1SDE A;  3VFH A;  3BQA A;  4KQO A;  5TJJ A;  3Q1F A;  3TG9 A;  1Y28 A;  2V2F F;  1ONH A;  4MN7 A;  3V3S A;  1O07 A;  1EW0 A;  3ZCZ A;  3ISG A;  5HD3 A;  1UGU A;  2ZQA A;  2OLU A;  1G68 A;  1KGF A;  1TS7 A;  2WGW B;  1K25 A;  2W1T A;  4RA7 A;  3DAV A;  3LID A;  4CLC A;  4S2M A;  1XA7 A;  1K6S A;  4OPZ A;  2PHY A;  4X25 A;  3C7V A;  4EBL A;  3BM6 A;  4OPY A;  3KSH A;  3N8L A;  3MXQ A;  2BTF P;  4OOM A;  5TBM B;  2Y2P A;  3T1S A;  2XD1 A;  1OTB A;  3P09 A;  1TF1 A;  3A3I A;  2Y8H A;  3MR0 A;  4DXC A;  4HQA A;  3LR5 A;  3SH7 A;  4CJN A;  3PBN A;  3LCE A;  4K91 A;  3C38 A;  1KVM A;  5HW3 A;  1S0W A;  3Q07 A;  1BTL A;  4CLC E;  2Y59 A;  3A0S A;  4X56 A;  3UME A;  2XA7 M;  1BLH A;  1LSX A;  4WZ5 C;  3W8K A;  3MS6 A;  1ERQ A;  2XLN A;  4KQQ A;  1XP4 A;  1SCW A;  4LRX C;  1YPR A;  4Y7P A;  4CPK A;  4WBG A;  1MWR A;  1E3U A;  1MZU A;  1D7E A;  3ZG9 B;  3T4O A;  3T1R A;  2HJ9 C;  3SS5 A;  3LIF A;  3LFV A;  2XRO A;  1LL9 A;  4EBN A;  1I5Q A;  3SW1 A;  2OWH A;  4R0Q A;  4FH2 A;  5FL3 A;  1T1A A;  3C7U A;  2W3H A;  2ZQD A;  1TS0 A;  2QZ6 A;  4E6W A;  1IYO A;  2HDS A;  2Q9M A;  3MSH A;  1ES3 A;  1KE3 A;  4DN0 A;  5M19 A;  1W63 M;  4WL9 A;  3IT9 A;  4LV3 A;  1RGY A;  1FCM A;  1Y54 A;  3GDI A;  4FTX A;  5FAP A;  2M7U A;  3T4S A;  1MKM A;  3G35 A;  1NJ4 A;  4YWZ A;  1RCJ A;  1JWP A;  1PRQ A;  2H10 A;  4OKP A;  5M18 A;  2ZM8 A;  3AGD A;  4O01 A;  4DE3 A;  3VOZ A;  5EV0 A;  2NUT C;  2XDM A;  1JNU A;  5AQA A;  3B42 A;  3QHY A;  4GHI B;  3Q7V B;  3G32 A;  3KYZ A;  3SH8 A;  3BJN A;  1SKO B;  3LIC A;  1ZG6 A;  2L4R A;  5EM0 A;  5FAO A;  2XGN A;  1ERO A;  1VQQ A;  1ZKJ A;  2ZLY A;  5G18 A;  1KDW A;  2C6W B;  4BQM A;  2J9O A;  4MDZ A;  3TRC A;  1FCN A;  2ZBB A;  5CHU A;  1W8Y A;  4MMN A;  4GS9 A;  3V5M A;  3OBF A;  3HLC A;  4EXO A;  4G3V A;  4I5S A;  2XK1 A;  2W0N A;  4N1X A;  2K7S A;  1X0O A;  2ZM2 A;  2E8I A;  3MZE A;  5TBM A;  3EQU A;  3M2K A;  5G4Y A;  2Y2Q A;  2JHE A;  5FI2 A;  1PIO A;  5A93 A;  3HLG A;  5HDC A;  5GHZ A;  2WKQ A;  3BLS A;  3K3C A;  3S7O A;  2Y79 A;  3ZFZ A;  4JPM A;  3LEQ A;  3UDX A;  3VP1 A;  4GD6 A;  4JXV A;  5HAP A;  1GA9 A;  1BZA A;  4LV2 A;  4DRT A;  3D4F A;  3OOV A;  3WS2 A;  1NXY A;  4KQR A;  3PAE A;  4NXB A;  3MMH A;  3UMD A;  4OQH A;  3EOI A;  4Q0J A;  4PKY A;  4P6B A;  4CLC D;  1WA9 A;  1NY0 A;  2OWJ A;  3MFD A;  3ZVT A;  4HY8 A;  3MFX A;  1EWZ A;  4EWF A;  4FOF A;  1E4D A;  4LCL A;  2BLS A;  4RQ9 A;  1T1B A;  1S66 L;  3EGX C;  4Y13 A;  3H7W B;  4IHQ A;  3N8R A;  1BUE A;  3GVB A;  5HAR A;  2A2L A;  4UHU A;  3BFF A;  5CHM A;  3UB8 A;  4P87 A;  1FIL A;  3RXX A;  2KLI A;  3BY8 A;  3PYP A;  4HI4 A;  3LY3 A;  3HCY A;  2A49 A;  4S2N A;  4DMZ A;  5AQ9 A;  3T4J A;  2B18 A;  1K54 A;  1L0D A;  3FPW A;  4O0P A;  4EUZ A;  1MY8 A;  5DKK A;  3NOP C;  4JXW A;  5CEB A;  3DTM A;  4JGO A;  2VGJ A;  4Y5F A;  3N6I A;  3S7N A;  4OPQ A;  5GL9 A;  4R23 A;  2WZX A;  2J9P A;  2Y2J A;  5DJT A;  2WKR A;  2V20 A;  3HUM A;  3VE4 A;  1XFQ A;  5FI6 A;  3WWX A;  4GHI A;  2WGV A;  1YLZ A;  4ZBE A;  5GLC A;  3KSG A;  4GDN A;  2OSU A;  3NDG A;  1WE4 A;  5FQ9 A;  3NOU C;  1D1J A;  1FSY A;  4OP5 A;  1XXM A;  3U4L P;  1VEU B;  3B3X A;  3Q7Z A;  4E3L A;  4X68 A;  4I3A A;  3FC7 A;  4ARZ B;  3QP4 A;  4E3I A;  2FH5 A;  4UA6 A;  5E2G A;  3CMZ A;  1LI0 A;  3OCN A;  3IF5 A;  1O7E A;  1MKI A;  2WKP A;  4N9L A;  3MXR A;  4OP8 A;  2FZ0 A;  2ZQ8 A;  2UWX A;  2QYB A;  1VHM A;  2Y2O A;  4Q0I A;  2GDN A;  3PBR A;  3MQ0 A;  4BL2 A;  2ZC5 B;  1G6A A;  3ZG7 B;  2WKE A;  4B93 A;  1CI8 A;  1IYP A;  2VLG A;  1IOU A;  1V9Z A;  5BOH A;  1HD8 A;  1LSV A;  4E3K A;  3DBA A;  3QP2 A;  3KSF A;  4MEZ A;  4C75 A;  1VEU A;  1FOF A;  2CMN A;  3MQQ A;  4QB8 A;  4ZJ3 A;  4MLL A;  4EUV A;  3RFB A;  4XUX A;  2EX9 A;  4WUJ A;  4EQ1 A;  3V50 A;  5EE8 A;  4JGR A;  4WMC A;  4XT2 B;  4D60 A;  1GSW A;  1S4S A;  2JKR M;  1TEM A;  2O99 A;  4KG6 A;  4L9G A;  1DP9 A;  2JKR I;  3NIA A;  5EFW A;  4E04 A;  1F2K A;  1W79 A;  5JYO A;  3UO9 A;  3EWK A;  3LIA A;  2WKI A;  4BBU A;  4CLC C;  4HJ3 A;  2EX2 A;  1ACF A;  4KG5 A;  3MXS A;  4DE2 A;  2Y2G A;  2BG1 A;  3UDF A;  2Y4A A;  3SS3 A;  2GNX A;  3MZF A;  5GHY A;  1OJ5 A;  1F98 A;  4WMC D;  3Q82 A;  3O88 A;  1XGI A;  4RX3 A;  1TVF A;  4Y0O A;  3JVV A;  2EWW A;  4LPZ A;  3I7J A;  5F1G A;  1ES5 A;  4PKY G;  1FR6 A;  3T1X A;  2VGL M;  4LGW A;  1F5M A;  3A0R A;  1H3Q A;  5EVI C;  3F1O A;  3UE1 A;  5L09 A;  5FEF A;  4UEY A;  1OTD A;  3S7Q A;  3UE3 A;  2R78 A;  4OON A;  4XUZ A;  3BY9 A;  3G6O A;  4S2L A;  2PYR A;  5IT5 A;  3RJU A;  3VSL A;  3HLD A;  4IED A;  3HRE A;  1G6O A;  4X53 A;  5F82 A;  4HH3 A;  2HV1 A;  3VE3 A;  4KZ5 A;  2JBF A;  1C3B A;  3BFG A;  2ZQ7 A;  3GQZ A;  4IJG A;  4Y15 A;  2IWD A;  2W27 A;  5FAQ A;  3R7W A;  4WLA A;  3A3E A;  3CI6 A;  3DW0 A;  3LR4 A;  3C2W A;  3IH8 A;  2IWB A;  3BFC A;  1S6R A;  4BLM A;  2HDQ A;  3UE0 A;  1PI4 A;  4HES A;  1GHI A;  1Y4O A;  2Y2L A;  2VZW A;  3FWL A;  3Q81 A;  3HUN A;  5E2H A;  5DTS A;  4YFM A;  1G28 A;  4U0X A;  3LR0 A;  3ZQ5 A;  2OOL A;  1Z09 A;  4KEN B;  4QY6 A;  3HUO A;  4H6J A;  4LV0 A;  3WRZ A;  3AGF A;  4PMA A;  2VV8 A;  4NG2 A;  1ODV A;  1K6R A;  3MBZ A;  4GB7 A;  3CUE A;  3GMW A;  4JXS A;  4RX2 A;  1QMF A;  2X71 A;  4I3I A;  5HL1 A;  1PZO A;  1K4E A;  3IHB A;  2D02 A;  3H9W A;  3NUL A;  3TW8 A;  3MKF A;  3LO7 A;  3V39 A;  5EEC A;  3GRJ A;  4C6Y A;  1DJB A;  3G30 A;  3QP5 A;  1ZG4 A;  4B88 A;  1KGG A;  5DFX A;  5L2F A;  3ZDJ A;  5HZH A;  1H8M A;  1F9I A;  4QU3 A;  1JWZ A;  1PNE A;  5FQK A;  2QKP A;  1LHY A;  3FZC A;  4CLC B;  3D9Y A;  2AVX A;  3QP1 A;  4ID4 A;  1GHM A;  3GSG A;  3UN7 A;  5CRF A;  2XRN A;  5FSR A;  5FQI A;  1K55 C;  2VA0 A;  2WYX A;  2RCX A;  2Z2L B;  5FQQ A;  5CTM A;  1SZV A;  3M6B A;  5A91 A;  1P0Z A;  3FYZ A;  3QP6 A;  4PAU A;  5TFQ A;  2WAD A;  2E8J A;  1NLY A;  3E4O A;  4EBP A;  4LV1 A;  3MF0 A;  1W63 Q;  1H0M A;  4IBR A;  5EM1 A;  3SOI A;  3D3O A;  2ZMF A;  1ALQ A;  5AQB A;  4P0M A;  1IYS A;  5EPH A;  3IXH A;  4ESP A;  1WYB A;  3MZD A;  5CGW A;  4GDB A;  2ZQ9 A;  4IUH A;  2PAV P;  4GCZ A;  2EFX A;  4X55 A;  1HTZ A;  2P74 A;  3BW6 A;  1H8Z A;  1CEF A;  4PM5 A;  3S4X A;  3M6H A;  2Z6C A;  1E25 A;  1A0K A;  1XJ6 A;  4OLD A;  1BLC A;  4S2K A;  1YM1 A;  4B9O A;  3W4O A;  1OT6 A;  3SS4 A;  2IA2 A;  3VP2 A;  1OTA A;  4PM9 A;  4X1L A;  4EU0 A;  4JBF A;  3T12 B;  2WZZ A;  4JXG A;  3K2N A;  5F68 A;  2O0Y A;  5HWT A;  2HP6 A;  4MBF A;  2VV6 A;  1M6K A;  2OAQ 1;  3LYX A;  4HHD A;  4IVI A;  4BD1 A;  3IXB A;  3K3D A;  5CXW A;  2H0Y A;  4CQH A;  4KUK A;  3LIB A;  1JVJ A;  2PBD P;  4NXF A;  3G2Z A;  5DTK A;  3G34 A;  5EOE A;  2B5R A;  4ZRR A;  1K56 D;  4IVK A;  2JN7 A;  1KE4 A;  4E3M A;  1L0E A;  2WAE A;  5J3W A;  4Z1W A;  3NC8 A;  1CEG A;  1YMS A;  3L7H A;  1Z6F A;  3LUQ A;  1MWU A;  4UQI M;  3R4K A;  1ONG A;  2Y2I A;  3VFF A;  4R38 A;  3RXW A;  1AWI A;  1J3W A;  4UQI S;  3EQV A;  4GS9 B;  1BUL A;  4YIN A;  4GW9 A;  4ZJ1 A;  2W3G A;  3OPL A;  5EVE A;  2HDU A;  2GJ3 A;  2WK0 A;  5DJU A;  3BWL A;  3UB6 A;  4R3A A;  1XPB A;  2PYP A;  4QD4 A;  4QJG A;  5CGX A;  5I5L A;  2WGW A;  1CK3 A;  1NWZ A;  3IBJ A;  2VX8 A;  4UA9 A;  4DE0 A;  4H8R A;  5EVI B;  2RL3 A;  4BMW A;  3BYD A;  1LSW A;  4K0W A;  5HL6 A;  4NK3 A;  2HP9 A;  1XJ4 A; 
#chains in the Genus database with same CATH homology
 5EVL A;  1K38 A;  3V50 A;  5EE8 A;  5U47 A;  1SDE A;  3W4Q A;  4KZ4 A;  2C5W B;  3WRT A;  4U3T A;  3O3V A;  3C4O A;  3VFH A;  4WMC A;  4KQO A;  3Q1F A;  5AQ7 A;  2Z2M B;  1L0F A;  3IH9 A;  3NY4 A;  3TG9 A;  5HAQ A;  1TEM A;  4RYE A;  1PWC A;  2V2F F;  1ONH A;  4KG6 A;  3ZNT A;  3FV7 A;  4R4R A;  3VP3 A;  3V3S A;  1O07 A;  2XF3 A;  3NIA A;  1XKZ A;  3VP4 A;  3NI9 A;  4L0L A;  5DF8 A;  3ZCZ A;  1YLP A;  5DVA A;  1K57 C;  3E2K A;  4OVD A;  1W79 A;  2HPB A;  3ISG A;  5JYO A;  5TR7 A;  2EX8 A;  3UO9 A;  3PBO A;  3ZVW A;  2WKI A;  1FR1 A;  5CED A;  1QME A;  3VP0 A;  1LL5 A;  4E3O A;  5KSH A;  2ZQA A;  2OLU A;  4UAA A;  2EX2 A;  3UPN A;  4KG5 A;  3IF6 A;  1G68 A;  1KGF A;  1N9B A;  3MXS A;  3ZNY A;  4DE2 A;  2WGW B;  2Y2G A;  1K25 A;  2BG1 A;  3UDF A;  5F83 A;  2Y4A A;  4RA7 A;  4X6T A;  4S2M A;  3SS3 A;  1KE0 A;  1K6S A;  1XA7 A;  2ZM0 A;  4LCM A;  4OPZ A;  1K55 A;  4R3B A;  3MZF A;  3C5A A;  3E2L A;  3IWI A;  4RVA A;  2QPN A;  3C7V A;  4PM7 A;  3P98 A;  5GHY A;  2X02 A;  4EBL A;  2A3U A;  3BM6 A;  4WMC D;  4OPY A;  3Q82 A;  3O88 A;  1XGI A;  3N8L A;  4RX3 A;  1K56 A;  1TVF A;  4Y0O A;  4OOY A;  4OOM A;  3I7J A;  1NYY A;  1ES5 A;  5F1G A;  1YLJ A;  3CG5 A;  1FR6 A;  4N9K A;  2Y2P A;  4N92 A;  5CGS A;  2XD1 A;  5GLD A;  3P09 A;  3A3I A;  4DXC A;  4QHC A;  3SH7 A;  1GCE A;  4CJN A;  3PBN A;  1Q2Q A;  3LCE A;  4K91 A;  5EVI C;  2EX6 A;  3A3F A;  3UE1 A;  1KVM A;  1GA0 A;  5HW3 A;  2JE5 A;  1IEM A;  1S0W A;  3OPP A;  3Q07 A;  3UE3 A;  1BTL A;  1DY6 A;  2ZC4 B;  4OON A;  4A5R A;  4XUZ A;  2X01 A;  3Q7V A;  2Y59 A;  3BLM A;  5FAS A;  2I72 A;  4S2L A;  3UDI A;  1PYY A;  4X56 A;  2PBY A;  4JKT A;  3BFE A;  3RJU A;  3VSL A;  3HLW A;  4OOL A;  3HLD A;  4IED A;  3HRE A;  1L2S A;  4DF6 A;  1BLH A;  3O87 A;  4X53 A;  5F82 A;  3NBL A;  4WZ5 C;  3G2Y A;  3IWO A;  3W8K A;  1OME A;  4KZ5 A;  3LY4 A;  2JBF A;  1C3B A;  3BFG A;  2ZQ7 A;  1ERQ A;  2XLN A;  3GQZ A;  4KQQ A;  4PM8 A;  1XP4 A;  4DKI A;  2IWD A;  1SCW A;  3G4P A;  4Y0U A;  4Y7P A;  5D3O A;  4WBG A;  5TGF A;  4CPK A;  2WGI A;  5FAQ A;  1MWR A;  1E3U A;  4E6X A;  2Y55 A;  3A3E A;  5IHV A;  1CI9 A;  3ZG9 B;  3DW0 A;  1NZO A;  5HAI A;  3GV9 A;  1L0G A;  5CTN A;  4FSF A;  2Y2H A;  4MNR A;  3SS5 A;  3UPO A;  3IH8 A;  3OZH A;  2IWB A;  3BFC A;  5DF9 A;  5HX9 A;  4FH4 A;  1S6R A;  2WAF A;  1LL9 A;  4BLM A;  4S2N C;  1I5Q A;  4EBN A;  2HDQ A;  5GLB A;  3UE0 A;  1FSW A;  4R0Q A;  4FH2 A;  4GNU A;  1PI4 A;  4HES A;  1GHI A;  4DDS A;  3IQA A;  2Y2L A;  3FWL A;  3Q81 A;  3HUN A;  3C7U A;  2ZQD A;  5E2H A;  2QZ6 A;  4E6W A;  3TOI A;  1IYO A;  2HDS A;  2XH9 A;  2Q9M A;  1ES4 A;  1MPL A;  3S1Y A;  1ES3 A;  1H8Y A;  1LLB A;  3WS5 A;  1KE3 A;  5DTS A;  5EOO A;  5M19 A;  4EQI A;  1YQS A;  3IT9 A;  4YFM A;  3HLF A;  4LV3 A;  1RGY A;  1FCM A;  1Y54 A;  1YLY A;  4U0X A;  5FQJ A;  4KZA A;  4ZJ2 A;  2JC7 A;  5FAP A;  5CER A;  2R9W A;  3G35 A;  3JYI A;  1NJ4 A;  1J9M A;  1RCJ A;  3ITB A;  1JWP A;  4KEN B;  4QY6 A;  2H10 A;  3HUO A;  1PZP A;  4OKP A;  5M18 A;  2ZM8 A;  2EFU A;  3AGD A;  5DTT A;  1VM1 A;  4DE3 A;  3VOZ A;  4LV0 A;  3WRZ A;  3ZGA B;  1ES2 A;  2XDM A;  1K54 C;  3A3J A;  3AGF A;  3DWK A;  4PMA A;  4E3J A;  1XA1 A;  5AQA A;  1K6R A;  1PW1 A;  3ZG8 B;  3MBZ A;  3QHY A;  4GB7 A;  3Q7V B;  1E3U D;  3GMW A;  3G32 A;  4JXS A;  4RX2 A;  3OCL A;  2Y2K A;  4PM6 A;  2OLV A;  4MBH A;  4GN2 A;  5KZH A;  1QMF A;  2X71 A;  3SH8 A;  1PW8 A;  2XEP A;  1ZG6 A;  5HL1 A;  1PZO A;  5GHX A;  4OH0 A;  1K4E A;  2H0T A;  5FAO A;  3IHB A;  4OQG A;  2XGN A;  1ERO A;  1VQQ A;  1ZKJ A;  2ZLY A;  2VGK A;  3LO7 A;  1KDW A;  2C6W B;  3MKF A;  5G18 A;  4BQM A;  4D2O A;  2J9O A;  3V39 A;  3BFD A;  5EEC A;  3GRJ A;  1IEL A;  4C6Y A;  1DJB A;  3G30 A;  5JYP A;  1FCN A;  1ZG4 A;  4JF6 A;  5CHU A;  5FAT A;  1W8Y A;  3PTE A;  4B88 A;  1KGE A;  3WS4 A;  1KGG A;  3QNB A;  1HZO A;  3HL9 A;  5CEC A;  3V5M A;  3HLC A;  5L2F A;  2XK1 A;  4E3N A;  4KZ7 A;  2G2W A;  2ZC6 B;  3IWQ A;  4N1X A;  3ZDJ A;  1K57 A;  2ZM2 A;  4QU3 A;  1JWZ A;  5E43 A;  1EI5 A;  2E8I A;  5FQK A;  3MZE A;  1NRF A;  3EQU A;  3M2K A;  2EXA A;  2ZQC A;  1LHY A;  4FD8 A;  4QY5 A;  2Y2Q A;  3FZC A;  4KZ9 A;  1ZC2 A;  2ZC3 B;  5FI2 A;  1PIO A;  5A93 A;  3HLG A;  5GHZ A;  2XD5 A;  4OLG A;  4O7D A;  1AXB A;  4ID4 A;  1DJC A;  3VSK A;  5A90 A;  1GHM A;  2J8Y A;  3GSG A;  4MBK A;  3BLS A;  3UN7 A;  1LI9 A;  5CRF A;  4ZDX A;  1DJA A;  5FSR A;  5FQI A;  4Z9Q A;  1H5X A;  1K55 C;  3BEB A;  3UNW A;  3ZFZ A;  2Z2L B;  2WYX A;  2RCX A;  3NCK A;  4JPM A;  1WYC A;  3ZHH A;  3ZG5 A;  3UDX A;  1GHP A;  3VP1 A;  3WS0 A;  5FQQ A;  5CTM A;  4DXB A;  4GD6 A;  4JXV A;  5HAP A;  1BLP A;  5GLA A;  1GA9 A;  1BZA A;  3M6B A;  2IWC A;  4LV2 A;  5A91 A;  4DRT A;  3FYZ A;  3D4F A;  4WM9 A;  3WS2 A;  4FCF A;  4B4Z A;  1NXY A;  4KQR A;  3PAE A;  2R9X A;  4OQH A;  5A92 A;  4GKU A;  5TFQ A;  4C3Q A;  2P9V A;  1TDG A;  4P6B A;  4NET A;  2WAD A;  1W8Q A;  4EV4 A;  4BD0 A;  2PU2 A;  1YLW A;  3DWZ A;  4JF5 A;  3ZG0 A;  1NY0 A;  3MFD A;  5FDH A;  4EBP A;  3ZVT A;  2EXB A;  4LV1 A;  1EWZ A;  3GTC A;  4EWF A;  5J8X A;  1E4D A;  1HVB A;  4JLF A;  4LCL A;  4IBR A;  1MWT A;  5KSC A;  3SOI A;  2BLS A;  4GD8 A;  1PI5 A;  1NZU A;  1ALQ A;  5AQB A;  1M40 A;  2ZMA A;  1KVL A;  3HLE A;  3AGE A;  4P0M A;  3SH9 A;  2DCF A;  4M3K A;  1IYS A;  5EPH A;  3IXH A;  1WYB A;  4WEL A;  3MZD A;  1NYM A;  5CGW A;  4GDB A;  4HBT A;  3N8R A;  1BUE A;  2ZQ9 A;  3GVB A;  5HAR A;  3UY6 A;  4BL3 A;  3N8S A;  1BSG A;  3S22 A;  4HBU A;  4ZAM A;  4U0T A;  5M1A A;  4UHU A;  3BFF A;  1BLS A;  1BT5 A;  3HLB A;  2Q9N A;  2FFY A;  3IHA A;  2EFX A;  4X55 A;  1HTZ A;  2P74 A;  4WZ4 A;  5CHM A;  1H8Z A;  2H5S A;  1CEF A;  3N7W A;  4P87 A;  4BEN A;  4PM5 A;  3S4X A;  3WS1 A;  1KDS A;  5FI7 A;  4Q8I A;  2ZJ9 A;  2WKH A;  3PBS A;  3RXX A;  3M6H A;  2HDR A;  3VMA A;  1E25 A;  2J7V A;  4KZ6 A;  5EVI A;  1SKF A;  3OPR A;  4OLD A;  1MWS A;  1RGZ A;  1BLC A;  3LY3 A;  2A49 A;  4S2K A;  4S2N A;  1ESU A;  2ZC7 A;  1YM1 A;  3CZD A;  3IXD A;  5AQ9 A;  1K54 A;  4R4S A;  4OQI A;  3W4O A;  1L0D A;  3OPH A;  2ZD8 A;  4EUZ A;  1MY8 A;  2OV5 A;  4UA7 A;  3SS4 A;  4K0X A;  2QMI A;  4JXW A;  4PPR A;  3VP2 A;  5CEB A;  2DRW A;  1PWD A;  3DTM A;  4PM9 A;  2VGJ A;  3N6I A;  4OPQ A;  3CJM A;  1YMX A;  3BEC A;  5GL9 A;  1YLT A;  4JBF A;  1MXO A;  5KMW A;  2WZZ A;  4JXG A;  4R23 A;  4DDY A;  4KZB A;  2WZX A;  2J9P A;  2Y2J A;  2HP6 A;  4P85 A;  4MBF A;  1M6K A;  2Y2M A;  4IVI A;  4WEK A;  4WYY A;  2V20 A;  4B4X A;  3HUM A;  4BD1 A;  3IXB A;  5CXW A;  5FI6 A;  3WWX A;  2H0Y A;  2WGV A;  1YLZ A;  4ZBE A;  2G2U A;  1JTD A;  1JVJ A;  1RP5 A;  3HBR A;  4WEJ A;  4R1G A;  3G2Z A;  5GLC A;  1SDN A;  4GDN A;  5DTK A;  3G34 A;  5EOE A;  1ERM A;  1I2W A;  2OSU A;  3NDG A;  4XXR A;  4KZ3 A;  2B5R A;  3HVF A;  5EVI D;  1K56 D;  4S2I A;  1WE4 A;  5FQ9 A;  2WUQ A;  4IVK A;  1KE4 A;  4E3M A;  1L0E A;  4N1H A;  2WAE A;  4ZTK A;  1FSY A;  5E2E A;  2P9V B;  4OP5 A;  1PWG A;  1Q2P A;  1XXM A;  3LEZ A;  3B3X A;  3NC8 A;  3MKE A;  3N4I A;  1CEG A;  2FFF B;  3NDE A;  3PBQ A;  1YMS A;  1YT4 A;  4X69 A;  4DE1 A;  3Q7Z A;  3UPP A;  2JCH A;  4X68 A;  4E3L A;  3GR2 A;  4KG2 A;  4S2P A;  3IF6 B;  1I2S A;  3QNC A;  4E3I A;  1Z6F A;  4OQ0 A;  1MWU A;  4UA6 A;  3TSG A;  5E2G A;  3CMZ A;  5FQM A;  1LI0 A;  2PU4 A;  1U60 A;  1ONG A;  2Y2I A;  3OCN A;  4LEN A;  3VFF A;  1JWV A;  5I94 A;  4R3J A;  3IF5 A;  1O7E A;  4GZB A;  1XGJ A;  4WZ5 A;  3RXW A;  4BJP A;  4JF4 A;  5F1F A;  4Y0T A;  1MKI A;  4N9L A;  2XQZ A;  3EQV A;  3MXR A;  4OP8 A;  2ZQ8 A;  2UWX A;  2Y2O A;  1BUL A;  2GDN A;  3FKV A;  3PBR A;  1FCO A;  4YIN A;  3C4P A;  4ZJ1 A;  4IBX A;  4HEF A;  1FQG A;  4F94 A;  3OPL A;  2V1Z A;  3M2J A;  4GOG A;  4BL2 A;  2ZC5 B;  1N4O A;  1G6A A;  2HDU A;  2WK0 A;  1TDL A;  3PBT A;  2Y2N A;  3ZG7 B;  2WKE A;  3IF6 C;  2XR0 A;  1IKG A;  1CI8 A;  3G31 A;  1XPB A;  3PAG A;  5HFO A;  5CHJ A;  3ITA A;  5DF7 A;  1IYP A;  1IKI A;  1ESI A;  5BOH A;  4QD4 A;  1HD8 A;  2CC1 A;  3W4P A;  1IYQ A;  5FA7 A;  3OC2 A;  1W5D A;  4E3K A;  4QJG A;  1W7F A;  5CGX A;  2XFS A;  4MEZ A;  4C75 A;  2WGW A;  3FKW A;  1CK3 A;  1JTG A;  1XX2 A;  4KZ8 A;  2HP5 A;  3IXG A;  1FOF A;  5EUA A;  1SHV A;  1MBL A;  3BRM A;  4UA9 A;  2XFT A;  3A3D A;  4QB8 A;  4ZJ3 A;  4DE0 A;  4H8R A;  3VOY A;  4OPR A;  4S2O A;  5EVI B;  2DNS A;  2RL3 A;  3BYD A;  4MLL A;  4K0W A;  4XUX A;  1K4F A;  3V3R A;  4NK3 A;  4S2J A;  5E2F A;  2HP9 A;  2EX9 A;  3O86 A;  2Y91 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...