1JWVA

Crystal structure of g238a mutant of tem-1 beta-lactamase in complex with a boronic acid inhibitor (sefb4)
Total Genus 92
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
92
sequence length
263
structure length
263
Chain Sequence
HPETLVKVKDAEDQLGARVGYIELDLNSGKILESFRPEERFPMMSTFKVLLCGAVLSRVDAGQEQLGRRIHYSQNDLVEYSPVTEKHLTDGMTVRELCSAAITMSDNTAANLLLTTIGGPKELTAFLHNMGDHVTRLDRWEPELNEAIPNDERDTTMPAAMATTLRKLLTGELLTLASRQQLIDWMEADKVAGPLLRSALPAGWFIADKSGAAERGSRGIIAALGPDGKPSRIVVIYTTGSQATMDERNRQIAEIGASLIKHW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords BETA-LACTAMASE TEM
publication title Evolution of an antibiotic resistance enzyme constrained by stability and activity trade-offs.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase
total genus 92
structure length 263
sequence length 263
ec nomenclature ec 3.5.2.6: Beta-lactamase.
pdb deposition date 2001-09-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13354 Beta-lactamase2 Beta-lactamase enzyme family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 1jwvA00
5FI2A 2ZM0A 3IH8A 2EX2A 5GLAA 2EXAA 2HP5A 4WMCA 2IWBA 5KSCA 2WGWA 4GDBA 4ZJ3A 3G2YA 2HDRA 4DE3A 4R1GA 4LV0A 1BULA 3VP0A 4KZ3A 4RX2A 3BECA 3IHAA 3ZG8B 4LV2A 1IKIA 4ZJ2A 3NCKA 4C6YA 1NXYA 2P9VA 1ONHA 3PTEA 4B88A 5KZHA 2Z2LB 3Q7ZA 2Y2HA 3GV9A 1KE4A 1KE0A 5CTNA 1PW1A 3VP4A 1C3BA 2WADA 3HLWA 1N9BA 2V2FF 2WKHA 2ZM2A 3IT9A 3M6HA 3P98A 5DF7A 5GHZA 1U60A 4PM9A 5GHXA 3ZNYA 4BD0A 2WK0A 4FH2A 5F83A 3GMWA 1NYMA 1XKZA 1GA0A 1KGGA 3MBZA 4KG2A 4WYYA 5GHYA 2E8IA 1W79A 1TVFA 4FCFA 5CHMA 3MZFA 5E2HA 1K6RA 3MFDA 2XDMA 4HEFA 1I5QA 4RVAA 4S2PA 1DJCA 4LV3A 4N92A 4P0MA 4N9LA 1K54C 2HP6A 2XEPA 4LENA 4PM7A 4WZ5A 4BL2A 1Y54A 4GB7A 3V3SA 1DY6A 1SDNA 5CEBA 1BSGA 3BFDA 4IEDA 5E2EA 5HW3A 5AQAA 3VP1A 4OP5A 2HDUA 2Y2KA 5CTMA 1G68A 4RYEA 3CMZA 4JXVA 5EECA 1L2SA 3S4XA 3S22A 1MPLA 1W8QA 3IXDA 5EVIA 1RGZA 1YLWA 2QMIA 5CRFA 1LL5A 3WWXA 1K57C 1XGJA 1K55C 4DE0A 3D4FA 1N4OA 1S0WA 3WRTA 5CEDA 1O7EA 2WAFA 1XA1A 4MLLA 4S2IA 3C7VA 1YLZA 4S2LA 4U0TA 1PWGA 1GHPA 2V20A 2R9XA 2ZC5B 2FFFB 3BM6A 4KZ5A 5FASA 3UDFA 5HAIA 2Y2GA 2DRWA 3IF6C 3RJUA 4LV1A 3A3EA 1L0EA 1ES3A 2PBYA 5HAQA 1XX2A 5D3OA 1FSWA 4EBLA 3HUOA 4MBFA 1CI9A 3NBLA 2H5SA 2ZC3B 2WZXA 1O07A 3NC8A 5FAQA 1IYOA 1ZC2A 2ZM8A 4WELA 5GL9A 4BLMA 1BLHA 3VFHA 1MWSA 3OZHA 4OOMA 1K6SA 3DWZA 2WGWB 2ZQDA 4WEKA 1YLYA 3OPHA 1K56D 3OPLA 4KZ4A 4KZ8A 3IXGA 3OCLA 4NK3A 3HLGA 2DCFA 5FQQA 3OCNA 3G31A 3CG5A 1NY0A 3WS5A 4R23A 4HBUA 1KVLA 5F82A 3UE0A 4E3NA 3UPOA 4OPRA 1XPBA 2P9VB 3PBRA 4RA7A 2EFXA 3PBNA 1ESIA 3BEBA 3Q1FA 2XFTA 3NI9A 4L0LA 5FA7A 4QD4A 4JXGA 4KZ6A 4Y0TA 4JLFA 2ZMAA 1E4DA 4EWFA 3FKVA 2BG1A 2Y59A 3MXRA 1WYCA 3JYIA 1K38A 4OPQA 3HLCA 3VOYA 3ISGA 3MKEA 4HBTA 5DTKA 3PAEA 3VFFA 3ITBA 4Q8IA 5M19A 3HL9A 1NJ4A 1FR6A 4KZAA 1K56A 4X53A 3N8LA 4JPMA 4GOGA 3PBQA 4GNUA 3ZDJA 3TOIA 4F94A 1RCJA 3G32A 5F1FA 5L2FA 1ESUA 3SS4A 4Y0OA 5CHUA 3WRZA 3ZG7B 1MWRA 4OQGA 3VP2A 4O7DA 2C6WB 3IWIA 5E2GA 5CGXA 5A91A 4GN2A 1YQSA 2Y2JA 1IYPA 4N1HA 1HZOA 2EXBA 1CK3A 3LEZA 3ZNTA 4OQIA 1JWPA 3IHBA 1KGFA 2Y2LA 1ES2A 2B5RA 3NIAA 5EVLA 4PM6A 3N4IA 3NDGA 3WS2A 1EROA 3N6IA 3FWLA 2ZQAA 4A5RA 4EV4A 2ZC6B 3TSGA 1H8YA 2ZC4B 3BRMA 4IVIA 1IYSA 3LY3A 1S6RA 4BQMA 4X6TA 5EVIB 4C75A 2X02A 5HX9A 3WS1A 4N9KA 4FD8A 2J7VA 4JXSA 2HDQA 1Q2QA 1QMEA 3HUMA 4IVKA 1XXMA 3QNCA 1J9MA 1GCEA 1PWCA 4R3BA 1YLJA 2FFYA 1ZG6A 3FYZA 5DVAA 1HVBA 2ZC7A 3M6BA 4DDSA 5M18A 4ZJ1A 2XF3A 2XLNA 3Q7VB 5FSRA 4DRTA 2Y55A 5E2FA 1KGEA 4OH0A 5FQ9A 4DXBA 4U3TA 1L0FA 4E3OA 1PI5A 1YMSA 2HDSA 2BLSA 3G2ZA 4MNRA 2IWDA 5DF8A 1DJAA 1KDWA 4R3JA 2WUQA 2Z2MB 2ZQ8A 4B4ZA 2JBFA 2WAEA 3N7WA 1SKFA 4JKTA 4WZ4A 5KMWA 4OP8A 2Q9MA 3HVFA 3IWQA 3GQZA 3N8RA 4GDNA 3E2LA 1E25A 1I2SA 2ZLYA 3IXHA 4FH4A 5GLCA 4UA6A 3LCEA 3BFEA 3P09A 3BFCA 1L0GA 1SDEA 2WKIA 1YM1A 4JBFA 3FKWA 2OLVA 1FCNA 5DTSA 2EX6A 3DW0A 2ZQCA 4ZTKA 4DE1A 1GA9A 3N8SA 5G18A 2XH9A 5FQMA 4JF6A 5FDHA 2HP9A 4S2MA 1IELA 5CECA 3HLDA 5A92A 1LL9A 4KG6A 3ZHHA 4B4XA 3HLEA 4KQRA 5BOHA 5HARA 1PZOA 5M1AA 3C7UA 1ES5A 3AGFA 3HBRA 1RGYA 3Q7VA 2GDNA 4QB8A 4S2NA 2VGKA 3ITAA 4X69A 2XK1A 1L0DA 4UA9A 2JE5A 3EQUA 4ZBEA 4WBGA 3MZDA 2JCHA 4D2OA 5FAPA 3IXBA 1BZAA 2WGVA 4KZBA 4BD1A 2WKEA 4LCMA 4N1XA 4E3LA 2OSUA 3IF5A 3BYDA 5AQ7A 1LLBA 1MWUA 2QZ6A 1JTGA 4FSFA 3SS5A 1AXBA 2X71A 3B3XA 5CGWA 3AGEA 4OQHA 1WYBA 3M2JA 4R4SA 3ZG9B 1IKGA 2X01A 1CI8A 3V50A 3M2KA 1W8YA 3W4OA 3C4OA 4YFMA 3VSKA 1LI0A 1I2WA 3SOIA 4OLGA 1XP4A 4EUZA 2Y4AA 4X56A 1DJBA 1M40A 1JTDA 1FR1A 1HTZA 1MWTA 3UE3A 5FI7A 5EOEA 1BLSA 5FI6A 2WGIA 1MKIA 4XUXA 4JXWA 3CZDA 1M6KA 5J8XA 2OLUA 3ZGAB 2G2WA 1BLCA 4UA7A 2VGJA 1BTLA 2J9PA 3A3IA 4OONA 2H0YA 4GKUA 3WS4A 3UDIA 1SHVA 2ZQ9A 1FSYA 5DF9A 5JYOA 2V1ZA 3BFFA 3VMAA 4WZ5C 1PYYA 5JYPA 2Y2OA 1E3UD 3FV7A 4PM5A 1ERQA 1IYQA 4WM9A 1K25A 4KZ7A 1MXOA 1ERMA 2PU4A 2XQZA 3S1YA 4M3KA 4QY6A 4MBHA 4X55A 3UNWA 4HESA 4WMCD 2HPBA 3C5AA 1K4EA 3SH7A 4KZ9A 1XGIA 3G34A 5CERA 5CHJA 3A3DA 4ID4A 4K0XA 4KG5A 3V39A 3VOZA 4BJPA 3PBOA 5A93A 1RP5A 1ES4A 5EVIC 1K57A 4NETA 1MBLA 4K91A 5DTTA 2Y2PA 1OMEA 1CEFA 3LY4A 3DWKA 4R4RA 4BENA 4IBXA 5EPHA 4RX3A 1BT5A 2JC7A 4ZAMA 1ZKJA 2EX9A 1PWDA 4X68A 5EE8A 2OV5A 2IWCA 3A3FA 2QPNA 4S2NC 4PPRA 5GLDA 2Y2IA 5E43A 4S2KA 2P74A 1NZUA 1TDLA 3IQAA 5EOOA 1TEMA 3UY6A 3HLBA 4EQIA 5EUAA 1VM1A 4PM8A 1YLPA 1NZOA 3SH9A 3V5MA 1LHYA 4Y0UA 1W7FA 1NYYA 1YT4A 3UPNA 1KVMA 4QU3A 5TR7A 4JF5A 3UO9A 1KDSA 2G2UA 3GVBA 4DF6A 1QMFA 3IWOA 1GHMA 3V3RA 1SCWA 2DNSA 3MXSA 4IBRA 4DE2A 3O88A 3A3JA 1G6AA 2WYXA 2XR0A 3PAGA 2PU2A 5KSHA 3GSGA 1PZPA 1XA7A 2XFSA 3W4PA 1TDGA 4E3JA 5EVID 2A49A 3Q82A 4BL3A 1YMXA 4OQ0A 3ZVTA 3E2KA 4JF4A 2EFUA 3BFGA 4QJGA 1ONGA 4OOYA 1EI5A 3ZFZA 4WEJA 3MKFA 3QHYA 2H10A 1JVJA 4XUZA 5I94A 3GRJA 4MBKA 3W4QA 4MEZA 1FCMA 3LO7A 4OKPA 3Q07A 3NY4A 4Y7PA 4CPKA 2RL3A 1W5DA 3SH8A 4P87A 1MY8A 5FQKA 4E3IA 3BLMA 1H5XA 3HLFA 3PBSA 3G30A 1GHIA 2Y91A 1NRFA 5F1GA 4Z9QA 2ZJ9A 2R9WA 4EBNA 2CC1A 1PIOA 3NDEA 4KQOA 3PBTA 1H8ZA 4CJNA 4E6XA 3FZCA 4KQQA 1ZG4A 3VSLA 3VP3A 1LI9A 5A90A 3ZVWA 1IEMA 4C3QA 4GD6A 4K0WA 2XGNA 4H8RA 2ZD8A 3Q81A 1PI4A 3O86A 1Z6FA 4UAAA 3SS3A 3UE1A 3W8KA 1VQQA 3OPPA 3AGDA 5U47A 4QHCA 4S2OA 4E3KA 3CJMA 1BUEA 3I7JA 5AQBA 3IH9A 3RXXA 4PMAA 5FQJA 2Y2QA 3G35A 1BLPA 3IF6B 3DTMA 3EQVA 3QNBA 4KENB 4OLDA 5GLBA 1FCOA 3G4PA 5TGFA 3TG9A 1K54A 4LCLA 2I72A 3WS0A 4GZBA 5TFQA 3HREA 3OPRA 1HD8A 1PW8A 2WZZA 2J9OA 3BLSA 3ZG0A 2UWXA 3HUNA 4P6BA 4GD8A 3UN7A 4E3MA 1KE3A 4OVDA 1YLTA 5CXWA 1FOFA 4QY5A 3GTCA 1FQGA 1EWZA 4S2JA 4P85A 3MZEA 2H0TA 4XXRA 5HFOA 2Y2NA 3C4PA 1WE4A 4ZDXA 1JWZA 2RCXA 4E6WA 2Q9NA 1JWVA 1K4FA 1K55A 2J8YA 5FATA 2A3UA 2XD1A 3OC2A 3ZCZA 5IHVA 2ZQ7A 5AQ9A 4DXCA 1Q2PA 2C5WB 5CGSA 2XD5A 2Y2MA 3O87A 4UHUA 4U0XA 3UPPA 1CEGA 5HL1A 1E3UA 2EX8A 4R0QA 4DKIA 4OPZA 5FQIA 5HAPA 4OPYA 3RXWA 3GR2A 3O3VA 4YINA 3UDXA 1ALQA 4OOLA 3ZG5A 4DDYA 4EBPA 5FAOA 3IF6A
chains in the Genus database with same CATH superfamily
2D02A 2ZM0A 3E4QA 2J3WA 4LV0A 5FL3A 2A2LA 5F69A 4C6YA 2P9VA 3TJZC 4Y13A 4CLCE 1KE4A 1PW1A 1C3BA 2WADA 3FC7A 1U60A 3GMWA 2Z6DA 5F68A 4FCFA 5CHMA 2FH5A 4S2PA 4HI4A 4LENA 3V3SA 1DY6A 3KYZA 3BFDA 3BY9A 2PR5A 4RYEA 3CMZA 5EVIA 1YLWA 1K57C 2M7UA 1N4OA 1S0WA 4ME4A 3IBRA 1XA1A 4MLLA 1UWNX 3T4QA 4S2LA 1PWGA 2FFFB 4MCWA 1PFLA 3S7PA 4LV1A 1L0EA 5HAQA 3BQ8A 1XX2A 3BQAA 1NLYA 1IYOA 4WELA 4BLMA 1MWSA 3DWZA 4AFIA 3HJKA 3K3CA 3OCNA 3IX4A 3IX8A 4HBUA 3UPOA 4OPRA 2WKPA 1CF0A 3Q1FA 4L0LA 5FA7A 4QWOA 4KZ6A 4Y0TA 5TBMA 2Y59A 3NULA 3R7WA 3NHQA 4Q8IA 1NJ4A 5J3WA 2P08A 4X53A 4QPRA 5DKKA 1MZUA 2W1TB 3G32A 4II7A 3SS4A 4DJ3A 5CHUA 3ZG7B 1MWRA 2C6WB 1YQSA 2Y2LA 4WF0A 2AVXA 3N4IA 4PM6A 2K2NA 3WS2A 3N6IA 3FWLA 2ZQAA 2KOIA 1G28A 1IYSA 1S67L 3FPWA 4N9KA 1OTDA 2HDQA 1J9MA 3C2WA 5DVAA 1ZG6A 5HDCA 3M6BA 4GS9B 4DDSA 2O99A 2XF3A 2Y55A 4MMNA 1YMSA 2HDSA 5DF8A 1DJAA 1KDWA 4R3JA 4B4ZA 3JVUA 2JBFA 3N7WA 2XRNA 1SKFA 4JKTA 5KMWA 2V1BA 4EEPA 1I2SA 3BY8A 3BFEA 4XT2A 1L0GA 4WUJA 3FKWA 2IA2A 2VJWA 3N8SA 2LB5A 3HLDA 4KG6A 4FOFA 2ZMFA 1PZOA 3AGFA 2PRFA 3HBRA 3Q7VA 4QB8A 2XK1A 1L0DA 4ZBEA 5FAPA 2M7VA 4K08A 4LLOB 4LRZE 3JPUA 1OTBA 1VETA 2X71A 3PXPA 3V50A 1CI8A 3C4OA 4Z1WA 1LI0A 4OLGA 4EUZA 1FR1A 1HTZA 5EOEA 1BLSA 1TF1A 5J8XA 2OLUA 3ZGAB 4HY8A 4Y15A 2VGJA 1BTLA 3H7WA 3A3IA 5DFXA 4GKUA 3WS4A 1SHVA 4I5SA 1J3WA 2PU4A 3L7HA 3UB7A 4HESA 4MN5A 3G34A 3A3DA 1TS0A 4BJPA 3PBOA 3LUQA 1ES4A 5EVIC 4NETA 2VKSA 1CEFA 2EWVA 3LY4A 1XFQA 5EPHA 3VOLA 3O5YA 2VV6A 3VE4A 4ZAMA 3U2AA 1KOUA 1ZKJA 1PWDA 2OV5A 5GLDA 1DP8A 4X25A 3HLBA 1NZOA 3V5MA 3NOTC 3PR6A 4Y0UA 1W7FA 1YSQA 1KVMA 4JF5A 4WLAA 3LIBA 1KDSA 3GVBA 5HD5A 4X1LA 4DF6A 3LEQA 3IWOA 3V3RA 2DNSA 3MXSA 4IBRA 1K0KA 2QHKA 3IS2A 3A3JA 4UQIM 1G6AA 2WYXA 2XR0A 3NECA 1XA7A 4OQ0A 5F6AA 3E2KA 2EFUA 1LSXA 1XJ6A 2PR6A 4WEJA 4Y3IA 3F1NA 4XUZA 4DMZA 4CPKA 2ZBBA 3SH8A 1D06A 4P87A 5FQKA 1VEUA 5FDSA 2VV8A 3G30A 2Y91A 5L07A 4BWIA 2V8CA 1OJGA 4CLCB 4KQOA 1H8ZA 4CJNA 3V67A 4MDZA 3F1OB 3VSLA 2W3GA 4GD6A 3NOUC 5J7EA 4B93A 2ZD8A 4ETZA 2OWHA 3A0VA 5EM0A 4QHCA 2O0YA 2GJ3A 1V9YA 1OJ5A 3DTMA 1FCOA 3UB9A 2I72A 3WS0A 4GZBA 1PW8A 1LL8A 2JN7A 5MC7A 5HWWA 3QP5A 4GD8A 4E3MA 1SKOA 3CPTA 2Q0OA 4HP9A 1FOFA 1HLUP 2VEAA 3LI8A 3W2ZA 2H0TA 5HFOA 4ZDXA 1OTAA 2A3UA 2ZQ7A 5AQ9A 2C5WB 2Y2MA 3O87A 3JVVA 3UPPA 4YWZA 5EVEA 2EX8A 4OPZA 5HAPA 5DKLA 3RXWA 3GR2A 2Y79A 3UDXA 3CI6A 2A24B 3E4PA 5FI2A 3IH8A 4GW9A 4WMCA 2NUTC 2IWBA 3MR0A 5KSCA 2WGWA 2HDRA 3P7NA 3T4LA 4D60A 4RX2A 3ZG8B 3PTEA 4B88A 5I5LA 2Z2LB 4G3VA 2Y2HA 4Q0IA 4F3LB 1N9BA 4KUKA 5DF7A 3ZNYA 4BD0A 4PM9A 4FH2A 5F83A 1GA0A 2B02A 3OOVA 4WYYA 5GHYA 4R3AA 2E8IA 1W79A 3S7OA 4NXEA 5E2HA 3MFDA 3UMDA 4BMWA 4DN0A 3MMHA 4LV3A 4P0MA 4N9LA 4PM7A 1Y54A 1TS6A 2HZ5A 4BBTA 5E2EA 5AQAA 2OAP1 1MKMA 3QP1A 4JXVA 5EECA 1MPLA 3BWLA 1RGZA 1XGJA 1K55C 2GX5A 5CEDA 3K2NA 4Y2FA 2W1RA 3C7VA 4Q0HA 5TBMB 1TD5A 2V20A 4HIAA 1CQAA 2YKHA 3UDFA 5HAIA 2Y2GA 3IF6C 3RJUA 3A3EA 2PBYA 5D3OA 1FSWA 5G4YA 4EBLA 4MBFA 2MJ6A 3NC8A 5FAQA 2PT7A 5GL9A 4OOMA 1K6SA 2PDRA 1YLYA 4NK3A 4KZ8A 1NY0A 2PD7A 3E0YA 4PAUA 2OAQ1 3PBNA 4DJ2A 1ESIA 3BEBA 2XFTA 3G6OA 3MXQA 4JXGA 2JKRI 4GJ4A 1VHMA 2ZMAA 3MQ0A 4OPQA 1WYCA 3JYIA 1K38A 3HLCA 3MKEA 1TS7A 3OLOA 3P01A 4HH3A 3VE3A 1OPXA 3EEAA 2J3TD 1P97A 3SW1A 3N8LA 4H6JB 4JPMA 4LPZA 5AJGA 1RCJA 5F1FA 3WRZA 1UGUA 3VP2A 3BW6A 4HOIA 5A91A 4GN2A 2Y2JA 3D3OA 1IYPA 1DRMA 3ZNTA 5AVEA 1SZVA 3IHBA 1XJ2A 4XT2B 3NDGA 2V0WA 1H8YA 4IVIA 5DJTA 2DMWA 4FTXA 4R3BA 2FFYA 1BYWA 1G6OA 1HVBA 3KYEA 3LIEA 5M18A 3Q7VB 4DRTA 5E2FA 5FQ9A 4E3OA 4MNRA 2IWDA 2Z2MB 2ZQ8A 3QP8A 2WAEA 2Q9MA 3IWQA 1E25A 2ZLYA 1MC0A 4ARZB 1SDEA 2WKIA 4I38A 1YM1A 3T1RA 5FEGA 5EV0A 5DTSA 5AVFA 4DE1A 3T1XA 1PNEA 5FDHA 4EW7A 4HJ3A 1S4SA 1OT6A 5A92A 1LL9A 2JKTI 1F5MA 4KQRA 5BOHA 2M1CA 5M1AA 3C7UA 5HD3A 4X69A 2GDNA 2VGKA 3ITAA 1ACFA 4UA9A 3EQUA 2JCHA 3IXBA 1BZAA 2WGVA 4KZBA 2WKQA 4N1XA 4E3LA 3IF5A 1LLBA 3ULFA 1MWUA 2QZ6A 1AXBA 5CGWA 3E98A 4OQHA 3M2JA 3VSKA 2LB9A 1I2WA 3OBFA 1JTDA 3UE3A 2VX8A 2G2WA 3A0SA 5JYOA 2ZQ9A 2V1ZA 3ZYTA 3F1PA 1PYYA 4HH2A 1E3UD 2QYBA 3FV7A 4EQ1A 1IYQA 4IJGA 4WM9A 2XA7S 4M3KA 4QY6A 4MBHA 3UNWA 3C5AA 1D1JA 3L9KA 4KZ9A 3SH7A 4G3WA 5CHJA 4K0XA 3V39A 2EA9A 1H3QA 1RP5A 3IS2B 2Y2PA 1OMEA 3B33A 1W63Q 4RX3A 2XROA 3T1QB 3D9YA 5EE8A 3H82A 2PAVP 3A3FA 2QPNA 4PPRA 5E43A 3C8CA 2PYPA 1TEMA 3UY6A 2JHEA 3SH9A 3UB6A 3UO9A 2G2UA 2O9CA 4L9FA 1T19A 1GHMA 1SCWA 2VGLS 4JGRA 3PAGA 2XFSA 1TDGA 1YMXA 1FIKA 3LR5A 1ONGA 4OOYA 1EI5A 3ZFZA 3FG8A 1ZHHB 5I94A 1Y28A 4OKPA 1GSVA 1ZTUA 4R38A 3MSHA 4WN5A 3BLMA 4HJ6A 5F1GA 2ZJ9A 1S1YA 1PIOA 3NDEA 4EERA 1ZG4A 1N9LA 2UV0E 4C3QA 5K5BA 3O86A 1Z6FA 1T18A 2L4RA 3AGDA 4E3KA 1NWZA 1BUEA 3I7JA 3MQOA 5FQJA 3QNBA 4KENB 5TGFA 4R6LA 3TG9A 2ZL1B 2CMNA 3HREA 3UE6A 2WZZA 2J9OA 3ZG0A 3KSGA 1GSWA 1KE3A 1YLTA 3GTCA 3MJQA 1EWZA 4S2JA 3MZEA 3MQQA 3NOPC 2VA0A 3C4PA 1WE4A 2PYRA 1JWVA 1K55A 1YPRA 5IHVA 4DXCA 1Q2PA 5CGSA 2XD5A 2W27A 4UHUA 4U0XA 4GHIB 5FQIA 2BASA 4YINA 3ZG5A 3EGXC 3IF6A 3PYPA 2HP5A 5GLAA 4ZJ3A 4GDBA 3G2YA 1G5UA 4R1GA 1BULA 3VP0A 1F98A 3BECA 3IHAA 3T4SA 4ZJ2A 1ONHA 3K3DA 5KZHA 3TRCA 3Q7ZA 5IT5A 3HLWA 3IT9A 5GHXA 2WK0A 1NYMA 3MBZA 4EESA 5J4EA 2XDMA 1I5QA 4HJ4A 4YOFA 5FEFA 2W1TA 1DJCA 4N92A 2HP6A 2XEPA 3LICA 3KSFA 4GB7A 1SDNA 5CEBA 1BSGA 4IEDA 3VP1A 3GECA 2Y2KA 1G68A 3KSIA 3S4XA 5HL6A 2QMIA 5CRFA 5F5YA 1LL5A 1P9RA 3WWXA 4DE0A 1T1BA 4YNRA 2WAFA 4S2IA 5HDDA 2R9XA 4GS9A 3BM6A 4KZ5A 2DRWA 1ES3A 3ICYA 2W3EA 2VLGA 1S1ZA 4Y5FA 1CI9A 2H5SA 1O07A 3LI9A 2B18A 1ZC2A 2ZM8A 3VFHA 3OZHA 4EUVA 2ZQDA 3OPHA 3OPLA 3OCLA 3HLGA 2DCFA 2V1AA 5FQQA 3WS5A 5F82A 3UE0A 4E3NA 1OT9A 1XPBA 2P9VB 3PBRA 4RA7A 3TE8A 4QD4A 4JLFA 4EWFA 3FKVA 2BG1A 2XSSA 3T12B 3ISGA 3EGDC 3EWKA 1PRQA 4HNBA 2V9AA 5M19A 3EEHA 4EXOA 1FR6A 4KZAA 2VK3A 1Z09A 4GNUA 3ZDJA 1CJFA 4F94A 1ESUA 5C5KA 4LRXC 4OQGA 3IWIA 5E2GA 1HZOA 5L09A 4OQIA 1JWPA 1KGFA 5EVLA 4EV4A 2HV1A 2ZC6B 4NKPA 3BRMA 3LY3A 4IHQA 5EVIB 3WS1A 5HPFA 2J7VA 4IVKA 1QMEA 3HUMA 3QNCA 2XA7M 1YLJA 3FYZA 4BBVA 2ZC7A 3RFBA 4ZJ1A 3KO6A 1KGEA 4U3TA 1L0FA 3G2ZA 2WUQA 4WZ4A 4GDNA 4FH4A 3IXHA 4UA6A 3LCEA 2ZOHA 3P09A 2EX6A 4P6ZS 2ZQCA 1GA9A 5G18A 2QJ7A 5FQMA 4JF6A 2HP9A 4S2MA 3ZHHA 3DBAA 3HLEA 5HARA 2JKGA 3S7QA 5HDSA 1RGYA 3R7WB 2H28A 2JE5A 4WBGA 2VGLM 4BD1A 1JNUA 4LCMA 1YAXA 1ODVA 4L9GA 3SS5A 4R4SA 1WYBA 2KX6A 3RH8B 4EETB 2WKRA 1D7EA 4G3KA 3SOIA 3T4TA 4CLCD 5IS1A 2V8FA 5FI7A 1MKIA 4XUXA 4JXWA 3CZDA 2HJ9C 1BLCA 2O9BA 2J9PA 4OONA 2H0YA 3UDIA 1FSYA 5DF9A 1WA9A 2I9VA 3BFFA 3QP4A 3VMAA 4ZRRA 5JYPA 3LR4A 1ERQA 1K25A 4KZ7A 4CLCA 3S1YA 1ERMA 2XQZA 3LIDA 4X55A 3ZQ5A 1XGIA 3IBJA 5A93A 3VOZA 5EFWA 1MBLA 4K91A 4L9EA 5DTTA 4R4RA 1LSWA 4IBXA 2V0UA 1BT5A 1STZA 4O0PA 2EX9A 4X68A 3CUEA 2JKRM 2YKFA 4S2NC 4S2KA 1NZUA 3IQAA 2J80A 4EQIA 1YLPA 1LHYA 3EOIA 1NYYA 4NXFA 3UPNA 5HPIA 4QU3A 5TR7A 1W63M 1QMFA 2JKFA 1VETB 1A0KA 5KSHA 3TW8A 4E3JA 5EVID 2A49A 3Q82A 4BL3A 1LSVA 3ZVTA 1NRJA 1XJ4A 2A24A 2H10A 1JVJA 4MBKA 4MEZA 4Y7PA 3LO7A 3Q07A 3NY4A 3RTYA 2RL3A 3H7WB 4E3IA 1H5XA 3LGOA 1GHIA 4F3LA 4EBNA 2CC1A 3QP6A 4E6XA 3GDIA 1LI9A 3SZTA 5HWVA 1IEMA 4MN6A 2P7JA 2PHYA 4HP4A 1VQQA 3LR0A 5U47A 2JKTM 5AQBA 3IH9A 3RXXA 2Y2QA 3IF6B 4OLDA 5GLBA 4WL9A 2L0WA 5TFQA 3OPRA 3BLSA 2UWXA 3HUNA 1XFNA 2EWWA 2KDKA 5CXWA 3HCYA 4QY5A 3LFVA 1FQGA 4NXGA 4P85A 2Y2NA 1L3LA 4E6WA 2Q9NA 3T50A 2XD1A 3OC2A 3ZCZA 4FUWA 4LGWA 4MN7A 1CEGA 4R70A 1E3UA 4DKIA 4OPYA 4EBPA 1ALQA 1DP6A 2R78A 3MFXA 2EX2A 2EXAA 3F1NB 4DE3A 4KZ3A 4I39A 3IX3A 4LV2A 1IKIA 3NCKA 3KX0X 1LT0A 3NJAA 1NXYA 1VEUB 2PD8A 3GV9A 1KE0A 5CTNA 3VP4A 5EM1A 2W3FA 1P0ZA 2V2FF 2WKHA 3BJNA 2ZM2A 3P98A 3M6HA 5GHZA 4BBUA 3UB8A 1AWIA 1XKZA 1KGGA 4KG2A 2B95A 1TVFA 4ETXA 3MZFA 4H6JA 1K6RA 4HEFA 5IU1A 4RVAA 1K54C 2HF6A 3E4OA 4WZ5A 4BL2A 4O8GA 5HW3A 4OP5A 2HDUA 4CLCC 1IFQA 5CTMA 1L2SA 3S22A 3CHWP 3B47A 3CWFA 1W8QA 3IXDA 1T1CA 2ZMVA 1SKOB 3CPTB 3D4FA 3CITA 3WRTA 1O7EA 1YLZA 4U0TA 2J3TC 1GHPA 2ZC5B 4KUOA 1EW0A 5FASA 1T1AA 3UB5P 2ACGA 3CUEC 4GCZA 4I3IA 2KLIA 3HUOA 3NBLA 1X0OA 2ZC3B 2WZXA 1F9IA 5DJUA 1BLHA 4P6ZM 5HWTA 4ARZA 1N9OA 4E04A 5KIZA 2WGWB 2QWSA 4WEKA 4KZ4A 1K56D 3IXGA 3G31A 3CG5A 4R23A 1KVLA 3CAXA 2EFXA 3DAVA 4I3AA 4GLQA 2FZ0A 2P04A 3NI9A 1E4DA 3MXRA 3VOYA 4HBTA 5DTKA 3PAEA 3VFFA 1V9ZA 3D72A 3ITBA 3LR3A 3HL9A 1GSXA 1DP9A 4O01A 1K56A 4GOGA 2HGVA 2OOLA 3PBQA 4I3JA 3TOIA 1F2KA 3DTKA 5L2FA 2PBDP 4NXBA 4Y0OA 4O7DA 5A8BA 5CGXA 5CX7A 4N1HA 2EXBA 3LEZA 1CK3A 1S66L 4JGQA 1UWPX 1ES2A 2B5RA 3NIAA 1OTIA 1EROA 4A5RA 3TSGA 2ZC4B 1S6RA 4BQMA 4X6TA 4C75A 2X02A 3DTIA 5HX9A 4IUHA 4FD8A 3DTEA 5DFYA 3C30A 4JXSA 1Q2QA 2G7UA 1XXMA 2Y8HA 1GCEA 1PWCA 2GNXA 2XLNA 3PHYA 5FSRA 4DXBA 4OH0A 1PI5A 1NLZA 2BLSA 4CQHA 2Z6CA 4OP8A 3HVFA 3GQZA 3N8RA 4PKYG 3E2LA 5GLCA 3S7NA 4EU0A 3BFCA 4JBFA 1VB6A 4ESPA 1YKDA 2OLVA 1FCNA 2D01A 3DW0A 4ZTKA 2XH9A 1IELA 5CECA 2VV7A 3CLOA 4B4XA 4JGPA 1ES5A 3LIAA 3H9WA 4S2NA 3LYXA 3MZDA 4D2OA 2WKEA 3KYQA 3QP2A 2OSUA 3BYDA 3U4LP 5AQ7A 2ZOIA 1FILA 2HJEA 1JTGA 4FSFA 3B3XA 3AGEA 2L1MA 3ZG9B 1IKGA 2X01A 4B9OA 3M2KA 1W8YA 3W4OA 4YFMA 1XP4A 2Y4AA 4X56A 1DJBA 1M40A 2VZWA 1MWTA 3C38A 2K31A 5FI6A 2WGIA 1M6KA 2E8JA 5LBRA 2W3DA 4UA7A 4HHDA 5TJJA 4WZ5C 2Y2OA 4PM5A 2OWJA 1N9NA 1MXOA 2K7SA 1S4RA 4WMCD 2HPBA 1K4EA 5CERA 1P9WA 4ID4A 4KG5A 1K57A 3DWKA 2GZAA 4BENA 4UEYA 2JC7A 3UMEA 3MS6A 2BTFP 2IWCA 3T4KA 3MF0A 2Y2IA 2P74A 2ZL1A 1TDLA 5EOOA 5EUAA 1VM1A 4RQ9A 4PM8A 1YT4A 4HQAA 4Y17A 4DE2A 3O88A 4NEED 3HJIA 2INWA 2PU2A 3GSGA 1PZPA 3W4PA 2W3HA 4GHIA 4JF4A 3BFGA 4EEUA 4QJGA 4M4XA 3T4JA 5HZHA 3MKFA 3QHYA 3A0RA 3GRJA 3W4QA 4PKYA 1FCMA 2QKPA 5HSQA 4KQDA 1W5DA 1OTEA 1H8MA 1MY8A 4X1MA 2W0NA 3HLFA 3PBSA 1IOUA 3F1PB 1NRFA 4Z9QA 2R9WA 4LRYC 1TS8A 3PBTA 4Q0JA 3FZCA 4KQQA 3VP3A 4LFUA 5A90A 3ZVWA 4K0WA 2XGNA 4H8RA 3Q81A 1PI4A 4UAAA 3SS3A 3UE1A 3W8KA 3OPPA 3VV4A 3T1SA 1XJ3A 4S2OA 3FPVA 3CJMA 4PMAA 3G35A 1BLPA 3H82B 3EQVA 3G4PA 1K54A 4LCLA 4IUKA 5L8MA 1HD8A 4P6BA 3UN7A 5L10A 4OVDA 1H0MA 3F1OA 1Y4OA 1YSPA 4XXRA 4JGOA 1JWZA 5G4ZA 2RCXA 1K4FA 3T4OA 2O9AA 2J8YA 5FATA 2NUPC 4PHTA 3KSHA 5HL1A 3R4KA 4UQIS 4R0QA 3LIFA 2QJ5A 3O3VA 4OOLA 4DDYA 5FAOA 4NG2A 3B42A
chains in the Genus database with same CATH topology
5FI2A 2ZM0A 3IH8A 2EX2A 5GLAA 2EXAA 2HP5A 4WMCA 2IWBA 5KSCA 2WGWA 4GDBA 4ZJ3A 3G2YA 2HDRA 4DE3A 4R1GA 4LV0A 1BULA 3VP0A 4KZ3A 4RX2A 3BECA 3IHAA 3ZG8B 4LV2A 1IKIA 4ZJ2A 3NCKA 4C6YA 1NXYA 2P9VA 1ONHA 3PTEA 4B88A 5KZHA 2Z2LB 3Q7ZA 2Y2HA 3GV9A 1KE4A 1KE0A 5CTNA 1PW1A 3VP4A 1C3BA 2WADA 3HLWA 1N9BA 2V2FF 2WKHA 2ZM2A 3IT9A 3M6HA 3P98A 5DF7A 5GHZA 1U60A 4PM9A 5GHXA 3ZNYA 4BD0A 2WK0A 4FH2A 5F83A 3GMWA 1NYMA 1XKZA 1GA0A 1KGGA 3MBZA 4KG2A 4WYYA 5GHYA 2E8IA 1W79A 1TVFA 4FCFA 5CHMA 3MZFA 5E2HA 1K6RA 3MFDA 2XDMA 4HEFA 1I5QA 4RVAA 4S2PA 1DJCA 4LV3A 4N92A 4P0MA 4N9LA 1K54C 2HP6A 2XEPA 4LENA 4PM7A 4WZ5A 4BL2A 1Y54A 4GB7A 3V3SA 1DY6A 1SDNA 5CEBA 1BSGA 3BFDA 4IEDA 5E2EA 5HW3A 5AQAA 3VP1A 4OP5A 2HDUA 2Y2KA 5CTMA 1G68A 4RYEA 3CMZA 4JXVA 5EECA 1L2SA 3S4XA 3S22A 1MPLA 1W8QA 3IXDA 5EVIA 1RGZA 1YLWA 2QMIA 5CRFA 1LL5A 3WWXA 1K57C 1XGJA 1K55C 4DE0A 3D4FA 1N4OA 1S0WA 3WRTA 5CEDA 1O7EA 2WAFA 1XA1A 4MLLA 4S2IA 3C7VA 1YLZA 4S2LA 4U0TA 1PWGA 1GHPA 2V20A 2R9XA 2ZC5B 2FFFB 3BM6A 4KZ5A 5FASA 3UDFA 5HAIA 2Y2GA 2DRWA 3IF6C 3RJUA 4LV1A 3A3EA 1L0EA 1ES3A 2PBYA 5HAQA 1XX2A 5D3OA 1FSWA 4EBLA 3HUOA 4MBFA 1CI9A 3NBLA 2H5SA 2ZC3B 2WZXA 1O07A 3NC8A 5FAQA 1IYOA 1ZC2A 2ZM8A 4WELA 5GL9A 4BLMA 1BLHA 3VFHA 1MWSA 3OZHA 4OOMA 1K6SA 3DWZA 2WGWB 2ZQDA 4WEKA 1YLYA 3OPHA 1K56D 3OPLA 4KZ4A 4KZ8A 3IXGA 3OCLA 4NK3A 3HLGA 2DCFA 5FQQA 3OCNA 3G31A 3CG5A 1NY0A 3WS5A 4R23A 4HBUA 1KVLA 5F82A 3UE0A 4E3NA 3UPOA 4OPRA 1XPBA 2P9VB 3PBRA 4RA7A 2EFXA 3PBNA 1ESIA 3BEBA 3Q1FA 2XFTA 3NI9A 4L0LA 5FA7A 4QD4A 4JXGA 4KZ6A 4Y0TA 4JLFA 2ZMAA 1E4DA 4EWFA 3FKVA 2BG1A 2Y59A 3MXRA 1WYCA 3JYIA 1K38A 4OPQA 3HLCA 3VOYA 3ISGA 3MKEA 4HBTA 5DTKA 3PAEA 3VFFA 3ITBA 4Q8IA 5M19A 3HL9A 1NJ4A 1FR6A 4KZAA 1K56A 4X53A 3N8LA 4JPMA 4GOGA 3PBQA 4GNUA 3ZDJA 3TOIA 4F94A 1RCJA 3G32A 5F1FA 5L2FA 1ESUA 3SS4A 4Y0OA 5CHUA 3WRZA 3ZG7B 1MWRA 4OQGA 3VP2A 4O7DA 2C6WB 3IWIA 5E2GA 5CGXA 5A91A 4GN2A 1YQSA 2Y2JA 1IYPA 4N1HA 1HZOA 2EXBA 1CK3A 3LEZA 3ZNTA 4OQIA 1JWPA 3IHBA 1KGFA 2Y2LA 1ES2A 2B5RA 3NIAA 5EVLA 4PM6A 3N4IA 3NDGA 3WS2A 1EROA 3N6IA 3FWLA 2ZQAA 4A5RA 4EV4A 2ZC6B 3TSGA 1H8YA 2ZC4B 3BRMA 4IVIA 1IYSA 3LY3A 1S6RA 4BQMA 4X6TA 5EVIB 4C75A 2X02A 5HX9A 3WS1A 4N9KA 4FD8A 2J7VA 4JXSA 2HDQA 1Q2QA 1QMEA 3HUMA 4IVKA 1XXMA 3QNCA 1J9MA 1GCEA 1PWCA 4R3BA 1YLJA 2FFYA 1ZG6A 3FYZA 5DVAA 1HVBA 2ZC7A 3M6BA 4DDSA 5M18A 4ZJ1A 2XF3A 2XLNA 3Q7VB 5FSRA 4DRTA 2Y55A 5E2FA 1KGEA 4OH0A 5FQ9A 4DXBA 4U3TA 1L0FA 4E3OA 1PI5A 1YMSA 2HDSA 2BLSA 3G2ZA 4MNRA 2IWDA 5DF8A 1DJAA 1KDWA 4R3JA 2WUQA 2Z2MB 2ZQ8A 4B4ZA 2JBFA 2WAEA 3N7WA 1SKFA 4JKTA 4WZ4A 5KMWA 4OP8A 2Q9MA 3HVFA 3IWQA 3GQZA 3N8RA 4GDNA 3E2LA 1E25A 1I2SA 2ZLYA 3IXHA 4FH4A 5GLCA 4UA6A 3LCEA 3BFEA 3P09A 3BFCA 1L0GA 1SDEA 2WKIA 1YM1A 4JBFA 3FKWA 2OLVA 1FCNA 5DTSA 2EX6A 3DW0A 2ZQCA 4ZTKA 4DE1A 1GA9A 3N8SA 5G18A 2XH9A 5FQMA 4JF6A 5FDHA 2HP9A 4S2MA 1IELA 5CECA 3HLDA 5A92A 1LL9A 4KG6A 3ZHHA 4B4XA 3HLEA 4KQRA 5BOHA 5HARA 1PZOA 5M1AA 3C7UA 1ES5A 3AGFA 3HBRA 1RGYA 3Q7VA 2GDNA 4QB8A 4S2NA 2VGKA 3ITAA 4X69A 2XK1A 1L0DA 4UA9A 2JE5A 3EQUA 4ZBEA 4WBGA 3MZDA 2JCHA 4D2OA 5FAPA 3IXBA 1BZAA 2WGVA 4KZBA 4BD1A 2WKEA 4LCMA 4N1XA 4E3LA 2OSUA 3IF5A 3BYDA 5AQ7A 1LLBA 1MWUA 2QZ6A 1JTGA 4FSFA 3SS5A 1AXBA 2X71A 3B3XA 5CGWA 3AGEA 4OQHA 1WYBA 3M2JA 4R4SA 3ZG9B 1IKGA 2X01A 1CI8A 3V50A 3M2KA 1W8YA 3W4OA 3C4OA 4YFMA 3VSKA 1LI0A 1I2WA 3SOIA 4OLGA 1XP4A 4EUZA 2Y4AA 4X56A 1DJBA 1M40A 1JTDA 1FR1A 1HTZA 1MWTA 3UE3A 5FI7A 5EOEA 1BLSA 5FI6A 2WGIA 1MKIA 4XUXA 4JXWA 3CZDA 1M6KA 5J8XA 2OLUA 3ZGAB 2G2WA 1BLCA 4UA7A 2VGJA 1BTLA 2J9PA 3A3IA 4OONA 2H0YA 4GKUA 3WS4A 3UDIA 1SHVA 2ZQ9A 1FSYA 5DF9A 5JYOA 2V1ZA 3BFFA 3VMAA 4WZ5C 1PYYA 5JYPA 2Y2OA 1E3UD 3FV7A 4PM5A 1ERQA 1IYQA 4WM9A 1K25A 4KZ7A 1MXOA 1ERMA 2PU4A 2XQZA 3S1YA 4M3KA 4QY6A 4MBHA 4X55A 3UNWA 4HESA 4WMCD 2HPBA 3C5AA 1K4EA 3SH7A 4KZ9A 1XGIA 3G34A 5CERA 5CHJA 3A3DA 4ID4A 4K0XA 4KG5A 3V39A 3VOZA 4BJPA 3PBOA 5A93A 1RP5A 1ES4A 5EVIC 1K57A 4NETA 1MBLA 4K91A 5DTTA 2Y2PA 1OMEA 1CEFA 3LY4A 3DWKA 4R4RA 4BENA 4IBXA 5EPHA 4RX3A 1BT5A 2JC7A 4ZAMA 1ZKJA 2EX9A 1PWDA 4X68A 5EE8A 2OV5A 2IWCA 3A3FA 2QPNA 4S2NC 4PPRA 5GLDA 2Y2IA 5E43A 4S2KA 2P74A 1NZUA 1TDLA 3IQAA 5EOOA 1TEMA 3UY6A 3HLBA 4EQIA 5EUAA 1VM1A 4PM8A 1YLPA 1NZOA 3SH9A 3V5MA 1LHYA 4Y0UA 1W7FA 1NYYA 1YT4A 3UPNA 1KVMA 4QU3A 5TR7A 4JF5A 3UO9A 1KDSA 2G2UA 3GVBA 4DF6A 1QMFA 3IWOA 1GHMA 3V3RA 1SCWA 2DNSA 3MXSA 4IBRA 4DE2A 3O88A 3A3JA 1G6AA 2WYXA 2XR0A 3PAGA 2PU2A 5KSHA 3GSGA 1PZPA 1XA7A 2XFSA 3W4PA 1TDGA 4E3JA 5EVID 2A49A 3Q82A 4BL3A 1YMXA 4OQ0A 3ZVTA 3E2KA 4JF4A 2EFUA 3BFGA 4QJGA 1ONGA 4OOYA 1EI5A 3ZFZA 4WEJA 3MKFA 3QHYA 2H10A 1JVJA 4XUZA 5I94A 3GRJA 4MBKA 3W4QA 4MEZA 1FCMA 3LO7A 4OKPA 3Q07A 3NY4A 4Y7PA 4CPKA 2RL3A 1W5DA 3SH8A 4P87A 1MY8A 5FQKA 4E3IA 3BLMA 1H5XA 3HLFA 3PBSA 3G30A 1GHIA 2Y91A 1NRFA 5F1GA 4Z9QA 2ZJ9A 2R9WA 4EBNA 2CC1A 1PIOA 3NDEA 4KQOA 3PBTA 1H8ZA 4CJNA 4E6XA 3FZCA 4KQQA 1ZG4A 3VSLA 3VP3A 1LI9A 5A90A 3ZVWA 1IEMA 4C3QA 4GD6A 4K0WA 2XGNA 4H8RA 2ZD8A 3Q81A 1PI4A 3O86A 1Z6FA 4UAAA 3SS3A 3UE1A 3W8KA 1VQQA 3OPPA 3AGDA 5U47A 4QHCA 4S2OA 4E3KA 3CJMA 1BUEA 3I7JA 5AQBA 3IH9A 3RXXA 4PMAA 5FQJA 2Y2QA 3G35A 1BLPA 3IF6B 3DTMA 3EQVA 3QNBA 4KENB 4OLDA 5GLBA 1FCOA 3G4PA 5TGFA 3TG9A 1K54A 4LCLA 2I72A 3WS0A 4GZBA 5TFQA 3HREA 3OPRA 1HD8A 1PW8A 2WZZA 2J9OA 3BLSA 3ZG0A 2UWXA 3HUNA 4P6BA 4GD8A 3UN7A 4E3MA 1KE3A 4OVDA 1YLTA 5CXWA 1FOFA 4QY5A 3GTCA 1FQGA 1EWZA 4S2JA 4P85A 3MZEA 2H0TA 4XXRA 5HFOA 2Y2NA 3C4PA 1WE4A 4ZDXA 1JWZA 2RCXA 4E6WA 2Q9NA 1JWVA 1K4FA 1K55A 2J8YA 5FATA 2A3UA 2XD1A 3OC2A 3ZCZA 5IHVA 2ZQ7A 5AQ9A 4DXCA 1Q2PA 2C5WB 5CGSA 2XD5A 2Y2MA 3O87A 4UHUA 4U0XA 3UPPA 1CEGA 5HL1A 1E3UA 2EX8A 4R0QA 4DKIA 4OPZA 5FQIA 5HAPA 4OPYA 3RXWA 3GR2A 3O3VA 4YINA 3UDXA 1ALQA 4OOLA 3ZG5A 4DDYA 4EBPA 5FAOA 3IF6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5FI2 A;  2ZM0 A;  3IH8 A;  2EX2 A;  5GLA A;  2EXA A;  2HP5 A;  4WMC A;  2IWB A;  5KSC A;  2WGW A;  4GDB A;  4ZJ3 A;  3G2Y A;  2HDR A;  4DE3 A;  4R1G A;  4LV0 A;  1BUL A;  3VP0 A;  4KZ3 A;  4RX2 A;  3BEC A;  3IHA A;  3ZG8 B;  4LV2 A;  1IKI A;  4ZJ2 A;  3NCK A;  4C6Y A;  1NXY A;  2P9V A;  1ONH A;  3PTE A;  4B88 A;  5KZH A;  2Z2L B;  3Q7Z A;  2Y2H A;  3GV9 A;  1KE4 A;  1KE0 A;  5CTN A;  1PW1 A;  3VP4 A;  1C3B A;  2WAD A;  3HLW A;  1N9B A;  2V2F F;  2WKH A;  2ZM2 A;  3IT9 A;  3M6H A;  3P98 A;  5DF7 A;  5GHZ A;  1U60 A;  4PM9 A;  5GHX A;  3ZNY A;  4BD0 A;  2WK0 A;  4FH2 A;  5F83 A;  3GMW A;  1NYM A;  1XKZ A;  1GA0 A;  1KGG A;  3MBZ A;  4KG2 A;  4WYY A;  5GHY A;  2E8I A;  1W79 A;  1TVF A;  4FCF A;  5CHM A;  3MZF A;  5E2H A;  1K6R A;  3MFD A;  2XDM A;  4HEF A;  1I5Q A;  4RVA A;  4S2P A;  1DJC A;  4LV3 A;  4N92 A;  4P0M A;  4N9L A;  1K54 C;  2HP6 A;  2XEP A;  4LEN A;  4PM7 A;  4WZ5 A;  4BL2 A;  1Y54 A;  4GB7 A;  3V3S A;  1DY6 A;  1SDN A;  5CEB A;  1BSG A;  3BFD A;  4IED A;  5E2E A;  5HW3 A;  5AQA A;  3VP1 A;  4OP5 A;  2HDU A;  2Y2K A;  5CTM A;  1G68 A;  4RYE A;  3CMZ A;  4JXV A;  5EEC A;  1L2S A;  3S4X A;  3S22 A;  1MPL A;  1W8Q A;  3IXD A;  5EVI A;  1RGZ A;  1YLW A;  2QMI A;  5CRF A;  1LL5 A;  3WWX A;  1K57 C;  1XGJ A;  1K55 C;  4DE0 A;  3D4F A;  1N4O A;  1S0W A;  3WRT A;  5CED A;  1O7E A;  2WAF A;  1XA1 A;  4MLL A;  4S2I A;  3C7V A;  1YLZ A;  4S2L A;  4U0T A;  1PWG A;  1GHP A;  2V20 A;  2R9X A;  2ZC5 B;  2FFF B;  3BM6 A;  4KZ5 A;  5FAS A;  3UDF A;  5HAI A;  2Y2G A;  2DRW A;  3IF6 C;  3RJU A;  4LV1 A;  3A3E A;  1L0E A;  1ES3 A;  2PBY A;  5HAQ A;  1XX2 A;  5D3O A;  1FSW A;  4EBL A;  3HUO A;  4MBF A;  1CI9 A;  3NBL A;  2H5S A;  2ZC3 B;  2WZX A;  1O07 A;  3NC8 A;  5FAQ A;  1IYO A;  1ZC2 A;  2ZM8 A;  4WEL A;  5GL9 A;  4BLM A;  1BLH A;  3VFH A;  1MWS A;  3OZH A;  4OOM A;  1K6S A;  3DWZ A;  2WGW B;  2ZQD A;  4WEK A;  1YLY A;  3OPH A;  1K56 D;  3OPL A;  4KZ4 A;  4KZ8 A;  3IXG A;  3OCL A;  4NK3 A;  3HLG A;  2DCF A;  5FQQ A;  3OCN A;  3G31 A;  3CG5 A;  1NY0 A;  3WS5 A;  4R23 A;  4HBU A;  1KVL A;  5F82 A;  3UE0 A;  4E3N A;  3UPO A;  4OPR A;  1XPB A;  2P9V B;  3PBR A;  4RA7 A;  2EFX A;  3PBN A;  1ESI A;  3BEB A;  3Q1F A;  2XFT A;  3NI9 A;  4L0L A;  5FA7 A;  4QD4 A;  4JXG A;  4KZ6 A;  4Y0T A;  4JLF A;  2ZMA A;  1E4D A;  4EWF A;  3FKV A;  2BG1 A;  2Y59 A;  3MXR A;  1WYC A;  3JYI A;  1K38 A;  4OPQ A;  3HLC A;  3VOY A;  3ISG A;  3MKE A;  4HBT A;  5DTK A;  3PAE A;  3VFF A;  3ITB A;  4Q8I A;  5M19 A;  3HL9 A;  1NJ4 A;  1FR6 A;  4KZA A;  1K56 A;  4X53 A;  3N8L A;  4JPM A;  4GOG A;  3PBQ A;  4GNU A;  3ZDJ A;  3TOI A;  4F94 A;  1RCJ A;  3G32 A;  5F1F A;  5L2F A;  1ESU A;  3SS4 A;  4Y0O A;  5CHU A;  3WRZ A;  3ZG7 B;  1MWR A;  4OQG A;  3VP2 A;  4O7D A;  2C6W B;  3IWI A;  5E2G A;  5CGX A;  5A91 A;  4GN2 A;  1YQS A;  2Y2J A;  1IYP A;  4N1H A;  1HZO A;  2EXB A;  1CK3 A;  3LEZ A;  3ZNT A;  4OQI A;  1JWP A;  3IHB A;  1KGF A;  2Y2L A;  1ES2 A;  2B5R A;  3NIA A;  5EVL A;  4PM6 A;  3N4I A;  3NDG A;  3WS2 A;  1ERO A;  3N6I A;  3FWL A;  2ZQA A;  4A5R A;  4EV4 A;  2ZC6 B;  3TSG A;  1H8Y A;  2ZC4 B;  3BRM A;  4IVI A;  1IYS A;  3LY3 A;  1S6R A;  4BQM A;  4X6T A;  5EVI B;  4C75 A;  2X02 A;  5HX9 A;  3WS1 A;  4N9K A;  4FD8 A;  2J7V A;  4JXS A;  2HDQ A;  1Q2Q A;  1QME A;  3HUM A;  4IVK A;  1XXM A;  3QNC A;  1J9M A;  1GCE A;  1PWC A;  4R3B A;  1YLJ A;  2FFY A;  1ZG6 A;  3FYZ A;  5DVA A;  1HVB A;  2ZC7 A;  3M6B A;  4DDS A;  5M18 A;  4ZJ1 A;  2XF3 A;  2XLN A;  3Q7V B;  5FSR A;  4DRT A;  2Y55 A;  5E2F A;  1KGE A;  4OH0 A;  5FQ9 A;  4DXB A;  4U3T A;  1L0F A;  4E3O A;  1PI5 A;  1YMS A;  2HDS A;  2BLS A;  3G2Z A;  4MNR A;  2IWD A;  5DF8 A;  1DJA A;  1KDW A;  4R3J A;  2WUQ A;  2Z2M B;  2ZQ8 A;  4B4Z A;  2JBF A;  2WAE A;  3N7W A;  1SKF A;  4JKT A;  4WZ4 A;  5KMW A;  4OP8 A;  2Q9M A;  3HVF A;  3IWQ A;  3GQZ A;  3N8R A;  4GDN A;  3E2L A;  1E25 A;  1I2S A;  2ZLY A;  3IXH A;  4FH4 A;  5GLC A;  4UA6 A;  3LCE A;  3BFE A;  3P09 A;  3BFC A;  1L0G A;  1SDE A;  2WKI A;  1YM1 A;  4JBF A;  3FKW A;  2OLV A;  1FCN A;  5DTS A;  2EX6 A;  3DW0 A;  2ZQC A;  4ZTK A;  4DE1 A;  1GA9 A;  3N8S A;  5G18 A;  2XH9 A;  5FQM A;  4JF6 A;  5FDH A;  2HP9 A;  4S2M A;  1IEL A;  5CEC A;  3HLD A;  5A92 A;  1LL9 A;  4KG6 A;  3ZHH A;  4B4X A;  3HLE A;  4KQR A;  5BOH A;  5HAR A;  1PZO A;  5M1A A;  3C7U A;  1ES5 A;  3AGF A;  3HBR A;  1RGY A;  3Q7V A;  2GDN A;  4QB8 A;  4S2N A;  2VGK A;  3ITA A;  4X69 A;  2XK1 A;  1L0D A;  4UA9 A;  2JE5 A;  3EQU A;  4ZBE A;  4WBG A;  3MZD A;  2JCH A;  4D2O A;  5FAP A;  3IXB A;  1BZA A;  2WGV A;  4KZB A;  4BD1 A;  2WKE A;  4LCM A;  4N1X A;  4E3L A;  2OSU A;  3IF5 A;  3BYD A;  5AQ7 A;  1LLB A;  1MWU A;  2QZ6 A;  1JTG A;  4FSF A;  3SS5 A;  1AXB A;  2X71 A;  3B3X A;  5CGW A;  3AGE A;  4OQH A;  1WYB A;  3M2J A;  4R4S A;  3ZG9 B;  1IKG A;  2X01 A;  1CI8 A;  3V50 A;  3M2K A;  1W8Y A;  3W4O A;  3C4O A;  4YFM A;  3VSK A;  1LI0 A;  1I2W A;  3SOI A;  4OLG A;  1XP4 A;  4EUZ A;  2Y4A A;  4X56 A;  1DJB A;  1M40 A;  1JTD A;  1FR1 A;  1HTZ A;  1MWT A;  3UE3 A;  5FI7 A;  5EOE A;  1BLS A;  5FI6 A;  2WGI A;  1MKI A;  4XUX A;  4JXW A;  3CZD A;  1M6K A;  5J8X A;  2OLU A;  3ZGA B;  2G2W A;  1BLC A;  4UA7 A;  2VGJ A;  1BTL A;  2J9P A;  3A3I A;  4OON A;  2H0Y A;  4GKU A;  3WS4 A;  3UDI A;  1SHV A;  2ZQ9 A;  1FSY A;  5DF9 A;  5JYO A;  2V1Z A;  3BFF A;  3VMA A;  4WZ5 C;  1PYY A;  5JYP A;  2Y2O A;  1E3U D;  3FV7 A;  4PM5 A;  1ERQ A;  1IYQ A;  4WM9 A;  1K25 A;  4KZ7 A;  1MXO A;  1ERM A;  2PU4 A;  2XQZ A;  3S1Y A;  4M3K A;  4QY6 A;  4MBH A;  4X55 A;  3UNW A;  4HES A;  4WMC D;  2HPB A;  3C5A A;  1K4E A;  3SH7 A;  4KZ9 A;  1XGI A;  3G34 A;  5CER A;  5CHJ A;  3A3D A;  4ID4 A;  4K0X A;  4KG5 A;  3V39 A;  3VOZ A;  4BJP A;  3PBO A;  5A93 A;  1RP5 A;  1ES4 A;  5EVI C;  1K57 A;  4NET A;  1MBL A;  4K91 A;  5DTT A;  2Y2P A;  1OME A;  1CEF A;  3LY4 A;  3DWK A;  4R4R A;  4BEN A;  4IBX A;  5EPH A;  4RX3 A;  1BT5 A;  2JC7 A;  4ZAM A;  1ZKJ A;  2EX9 A;  1PWD A;  4X68 A;  5EE8 A;  2OV5 A;  2IWC A;  3A3F A;  2QPN A;  4S2N C;  4PPR A;  5GLD A;  2Y2I A;  5E43 A;  4S2K A;  2P74 A;  1NZU A;  1TDL A;  3IQA A;  5EOO A;  1TEM A;  3UY6 A;  3HLB A;  4EQI A;  5EUA A;  1VM1 A;  4PM8 A;  1YLP A;  1NZO A;  3SH9 A;  3V5M A;  1LHY A;  4Y0U A;  1W7F A;  1NYY A;  1YT4 A;  3UPN A;  1KVM A;  4QU3 A;  5TR7 A;  4JF5 A;  3UO9 A;  1KDS A;  2G2U A;  3GVB A;  4DF6 A;  1QMF A;  3IWO A;  1GHM A;  3V3R A;  1SCW A;  2DNS A;  3MXS A;  4IBR A;  4DE2 A;  3O88 A;  3A3J A;  1G6A A;  2WYX A;  2XR0 A;  3PAG A;  2PU2 A;  5KSH A;  3GSG A;  1PZP A;  1XA7 A;  2XFS A;  3W4P A;  1TDG A;  4E3J A;  5EVI D;  2A49 A;  3Q82 A;  4BL3 A;  1YMX A;  4OQ0 A;  3ZVT A;  3E2K A;  4JF4 A;  2EFU A;  3BFG A;  4QJG A;  1ONG A;  4OOY A;  1EI5 A;  3ZFZ A;  4WEJ A;  3MKF A;  3QHY A;  2H10 A;  1JVJ A;  4XUZ A;  5I94 A;  3GRJ A;  4MBK A;  3W4Q A;  4MEZ A;  1FCM A;  3LO7 A;  4OKP A;  3Q07 A;  3NY4 A;  4Y7P A;  4CPK A;  2RL3 A;  1W5D A;  3SH8 A;  4P87 A;  1MY8 A;  5FQK A;  4E3I A;  3BLM A;  1H5X A;  3HLF A;  3PBS A;  3G30 A;  1GHI A;  2Y91 A;  1NRF A;  5F1G A;  4Z9Q A;  2ZJ9 A;  2R9W A;  4EBN A;  2CC1 A;  1PIO A;  3NDE A;  4KQO A;  3PBT A;  1H8Z A;  4CJN A;  4E6X A;  3FZC A;  4KQQ A;  1ZG4 A;  3VSL A;  3VP3 A;  1LI9 A;  5A90 A;  3ZVW A;  1IEM A;  4C3Q A;  4GD6 A;  4K0W A;  2XGN A;  4H8R A;  2ZD8 A;  3Q81 A;  1PI4 A;  3O86 A;  1Z6F A;  4UAA A;  3SS3 A;  3UE1 A;  3W8K A;  1VQQ A;  3OPP A;  3AGD A;  5U47 A;  4QHC A;  4S2O A;  4E3K A;  3CJM A;  1BUE A;  3I7J A;  5AQB A;  3IH9 A;  3RXX A;  4PMA A;  5FQJ A;  2Y2Q A;  3G35 A;  1BLP A;  3IF6 B;  3DTM A;  3EQV A;  3QNB A;  4KEN B;  4OLD A;  5GLB A;  1FCO A;  3G4P A;  5TGF A;  3TG9 A;  1K54 A;  4LCL A;  2I72 A;  3WS0 A;  4GZB A;  5TFQ A;  3HRE A;  3OPR A;  1HD8 A;  1PW8 A;  2WZZ A;  2J9O A;  3BLS A;  3ZG0 A;  2UWX A;  3HUN A;  4P6B A;  4GD8 A;  3UN7 A;  4E3M A;  1KE3 A;  4OVD A;  1YLT A;  5CXW A;  1FOF A;  4QY5 A;  3GTC A;  1FQG A;  1EWZ A;  4S2J A;  4P85 A;  3MZE A;  2H0T A;  4XXR A;  5HFO A;  2Y2N A;  3C4P A;  1WE4 A;  4ZDX A;  1JWZ A;  2RCX A;  4E6W A;  2Q9N A;  1JWV A;  1K4F A;  1K55 A;  2J8Y A;  5FAT A;  2A3U A;  2XD1 A;  3OC2 A;  3ZCZ A;  5IHV A;  2ZQ7 A;  5AQ9 A;  4DXC A;  1Q2P A;  2C5W B;  5CGS A;  2XD5 A;  2Y2M A;  3O87 A;  4UHU A;  4U0X A;  3UPP A;  1CEG A;  5HL1 A;  1E3U A;  2EX8 A;  4R0Q A;  4DKI A;  4OPZ A;  5FQI A;  5HAP A;  4OPY A;  3RXW A;  3GR2 A;  3O3V A;  4YIN A;  3UDX A;  1ALQ A;  4OOL A;  3ZG5 A;  4DDY A;  4EBP A;  5FAO A;  3IF6 A; 
#chains in the Genus database with same CATH topology
 2D02 A;  2ZM0 A;  3E4Q A;  2J3W A;  4LV0 A;  5FL3 A;  2A2L A;  5F69 A;  4C6Y A;  2P9V A;  3TJZ C;  4Y13 A;  4CLC E;  1KE4 A;  1PW1 A;  1C3B A;  2WAD A;  3FC7 A;  1U60 A;  3GMW A;  2Z6D A;  5F68 A;  4FCF A;  5CHM A;  2FH5 A;  4S2P A;  4HI4 A;  4LEN A;  3V3S A;  1DY6 A;  3KYZ A;  3BFD A;  3BY9 A;  2PR5 A;  4RYE A;  3CMZ A;  5EVI A;  1YLW A;  1K57 C;  2M7U A;  1N4O A;  1S0W A;  4ME4 A;  3IBR A;  1XA1 A;  4MLL A;  1UWN X;  3T4Q A;  4S2L A;  1PWG A;  2FFF B;  4MCW A;  1PFL A;  3S7P A;  4LV1 A;  1L0E A;  5HAQ A;  3BQ8 A;  1XX2 A;  3BQA A;  1NLY A;  1IYO A;  4WEL A;  4BLM A;  1MWS A;  3DWZ A;  4AFI A;  3HJK A;  3K3C A;  3OCN A;  3IX4 A;  3IX8 A;  4HBU A;  3UPO A;  4OPR A;  2WKP A;  1CF0 A;  3Q1F A;  4L0L A;  5FA7 A;  4QWO A;  4KZ6 A;  4Y0T A;  5TBM A;  2Y59 A;  3NUL A;  3R7W A;  3NHQ A;  4Q8I A;  1NJ4 A;  5J3W A;  2P08 A;  4X53 A;  4QPR A;  5DKK A;  1MZU A;  2W1T B;  3G32 A;  4II7 A;  3SS4 A;  4DJ3 A;  5CHU A;  3ZG7 B;  1MWR A;  2C6W B;  1YQS A;  2Y2L A;  4WF0 A;  2AVX A;  3N4I A;  4PM6 A;  2K2N A;  3WS2 A;  3N6I A;  3FWL A;  2ZQA A;  2KOI A;  1G28 A;  1IYS A;  1S67 L;  3FPW A;  4N9K A;  1OTD A;  2HDQ A;  1J9M A;  3C2W A;  5DVA A;  1ZG6 A;  5HDC A;  3M6B A;  4GS9 B;  4DDS A;  2O99 A;  2XF3 A;  2Y55 A;  4MMN A;  1YMS A;  2HDS A;  5DF8 A;  1DJA A;  1KDW A;  4R3J A;  4B4Z A;  3JVU A;  2JBF A;  3N7W A;  2XRN A;  1SKF A;  4JKT A;  5KMW A;  2V1B A;  4EEP A;  1I2S A;  3BY8 A;  3BFE A;  4XT2 A;  1L0G A;  4WUJ A;  3FKW A;  2IA2 A;  2VJW A;  3N8S A;  2LB5 A;  3HLD A;  4KG6 A;  4FOF A;  2ZMF A;  1PZO A;  3AGF A;  2PRF A;  3HBR A;  3Q7V A;  4QB8 A;  2XK1 A;  1L0D A;  4ZBE A;  5FAP A;  2M7V A;  4K08 A;  4LLO B;  4LRZ E;  3JPU A;  1OTB A;  1VET A;  2X71 A;  3PXP A;  3V50 A;  1CI8 A;  3C4O A;  4Z1W A;  1LI0 A;  4OLG A;  4EUZ A;  1FR1 A;  1HTZ A;  5EOE A;  1BLS A;  1TF1 A;  5J8X A;  2OLU A;  3ZGA B;  4HY8 A;  4Y15 A;  2VGJ A;  1BTL A;  3H7W A;  3A3I A;  5DFX A;  4GKU A;  3WS4 A;  1SHV A;  4I5S A;  1J3W A;  2PU4 A;  3L7H A;  3UB7 A;  4HES A;  4MN5 A;  3G34 A;  3A3D A;  1TS0 A;  4BJP A;  3PBO A;  3LUQ A;  1ES4 A;  5EVI C;  4NET A;  2VKS A;  1CEF A;  2EWV A;  3LY4 A;  1XFQ A;  5EPH A;  3VOL A;  3O5Y A;  2VV6 A;  3VE4 A;  4ZAM A;  3U2A A;  1KOU A;  1ZKJ A;  1PWD A;  2OV5 A;  5GLD A;  1DP8 A;  4X25 A;  3HLB A;  1NZO A;  3V5M A;  3NOT C;  3PR6 A;  4Y0U A;  1W7F A;  1YSQ A;  1KVM A;  4JF5 A;  4WLA A;  3LIB A;  1KDS A;  3GVB A;  5HD5 A;  4X1L A;  4DF6 A;  3LEQ A;  3IWO A;  3V3R A;  2DNS A;  3MXS A;  4IBR A;  1K0K A;  2QHK A;  3IS2 A;  3A3J A;  4UQI M;  1G6A A;  2WYX A;  2XR0 A;  3NEC A;  1XA7 A;  4OQ0 A;  5F6A A;  3E2K A;  2EFU A;  1LSX A;  1XJ6 A;  2PR6 A;  4WEJ A;  4Y3I A;  3F1N A;  4XUZ A;  4DMZ A;  4CPK A;  2ZBB A;  3SH8 A;  1D06 A;  4P87 A;  5FQK A;  1VEU A;  5FDS A;  2VV8 A;  3G30 A;  2Y91 A;  5L07 A;  4BWI A;  2V8C A;  1OJG A;  4CLC B;  4KQO A;  1H8Z A;  4CJN A;  3V67 A;  4MDZ A;  3F1O B;  3VSL A;  2W3G A;  4GD6 A;  3NOU C;  5J7E A;  4B93 A;  2ZD8 A;  4ETZ A;  2OWH A;  3A0V A;  5EM0 A;  4QHC A;  2O0Y A;  2GJ3 A;  1V9Y A;  1OJ5 A;  3DTM A;  1FCO A;  3UB9 A;  2I72 A;  3WS0 A;  4GZB A;  1PW8 A;  1LL8 A;  2JN7 A;  5MC7 A;  5HWW A;  3QP5 A;  4GD8 A;  4E3M A;  1SKO A;  3CPT A;  2Q0O A;  4HP9 A;  1FOF A;  1HLU P;  2VEA A;  3LI8 A;  3W2Z A;  2H0T A;  5HFO A;  4ZDX A;  1OTA A;  2A3U A;  2ZQ7 A;  5AQ9 A;  2C5W B;  2Y2M A;  3O87 A;  3JVV A;  3UPP A;  4YWZ A;  5EVE A;  2EX8 A;  4OPZ A;  5HAP A;  5DKL A;  3RXW A;  3GR2 A;  2Y79 A;  3UDX A;  3CI6 A;  2A24 B;  3E4P A;  5FI2 A;  3IH8 A;  4GW9 A;  4WMC A;  2NUT C;  2IWB A;  3MR0 A;  5KSC A;  2WGW A;  2HDR A;  3P7N A;  3T4L A;  4D60 A;  4RX2 A;  3ZG8 B;  3PTE A;  4B88 A;  5I5L A;  2Z2L B;  4G3V A;  2Y2H A;  4Q0I A;  4F3L B;  1N9B A;  4KUK A;  5DF7 A;  3ZNY A;  4BD0 A;  4PM9 A;  4FH2 A;  5F83 A;  1GA0 A;  2B02 A;  3OOV A;  4WYY A;  5GHY A;  4R3A A;  2E8I A;  1W79 A;  3S7O A;  4NXE A;  5E2H A;  3MFD A;  3UMD A;  4BMW A;  4DN0 A;  3MMH A;  4LV3 A;  4P0M A;  4N9L A;  4PM7 A;  1Y54 A;  1TS6 A;  2HZ5 A;  4BBT A;  5E2E A;  5AQA A;  2OAP 1;  1MKM A;  3QP1 A;  4JXV A;  5EEC A;  1MPL A;  3BWL A;  1RGZ A;  1XGJ A;  1K55 C;  2GX5 A;  5CED A;  3K2N A;  4Y2F A;  2W1R A;  3C7V A;  4Q0H A;  5TBM B;  1TD5 A;  2V20 A;  4HIA A;  1CQA A;  2YKH A;  3UDF A;  5HAI A;  2Y2G A;  3IF6 C;  3RJU A;  3A3E A;  2PBY A;  5D3O A;  1FSW A;  5G4Y A;  4EBL A;  4MBF A;  2MJ6 A;  3NC8 A;  5FAQ A;  2PT7 A;  5GL9 A;  4OOM A;  1K6S A;  2PDR A;  1YLY A;  4NK3 A;  4KZ8 A;  1NY0 A;  2PD7 A;  3E0Y A;  4PAU A;  2OAQ 1;  3PBN A;  4DJ2 A;  1ESI A;  3BEB A;  2XFT A;  3G6O A;  3MXQ A;  4JXG A;  2JKR I;  4GJ4 A;  1VHM A;  2ZMA A;  3MQ0 A;  4OPQ A;  1WYC A;  3JYI A;  1K38 A;  3HLC A;  3MKE A;  1TS7 A;  3OLO A;  3P01 A;  4HH3 A;  3VE3 A;  1OPX A;  3EEA A;  2J3T D;  1P97 A;  3SW1 A;  3N8L A;  4H6J B;  4JPM A;  4LPZ A;  5AJG A;  1RCJ A;  5F1F A;  3WRZ A;  1UGU A;  3VP2 A;  3BW6 A;  4HOI A;  5A91 A;  4GN2 A;  2Y2J A;  3D3O A;  1IYP A;  1DRM A;  3ZNT A;  5AVE A;  1SZV A;  3IHB A;  1XJ2 A;  4XT2 B;  3NDG A;  2V0W A;  1H8Y A;  4IVI A;  5DJT A;  2DMW A;  4FTX A;  4R3B A;  2FFY A;  1BYW A;  1G6O A;  1HVB A;  3KYE A;  3LIE A;  5M18 A;  3Q7V B;  4DRT A;  5E2F A;  5FQ9 A;  4E3O A;  4MNR A;  2IWD A;  2Z2M B;  2ZQ8 A;  3QP8 A;  2WAE A;  2Q9M A;  3IWQ A;  1E25 A;  2ZLY A;  1MC0 A;  4ARZ B;  1SDE A;  2WKI A;  4I38 A;  1YM1 A;  3T1R A;  5FEG A;  5EV0 A;  5DTS A;  5AVF A;  4DE1 A;  3T1X A;  1PNE A;  5FDH A;  4EW7 A;  4HJ3 A;  1S4S A;  1OT6 A;  5A92 A;  1LL9 A;  2JKT I;  1F5M A;  4KQR A;  5BOH A;  2M1C A;  5M1A A;  3C7U A;  5HD3 A;  4X69 A;  2GDN A;  2VGK A;  3ITA A;  1ACF A;  4UA9 A;  3EQU A;  2JCH A;  3IXB A;  1BZA A;  2WGV A;  4KZB A;  2WKQ A;  4N1X A;  4E3L A;  3IF5 A;  1LLB A;  3ULF A;  1MWU A;  2QZ6 A;  1AXB A;  5CGW A;  3E98 A;  4OQH A;  3M2J A;  3VSK A;  2LB9 A;  1I2W A;  3OBF A;  1JTD A;  3UE3 A;  2VX8 A;  2G2W A;  3A0S A;  5JYO A;  2ZQ9 A;  2V1Z A;  3ZYT A;  3F1P A;  1PYY A;  4HH2 A;  1E3U D;  2QYB A;  3FV7 A;  4EQ1 A;  1IYQ A;  4IJG A;  4WM9 A;  2XA7 S;  4M3K A;  4QY6 A;  4MBH A;  3UNW A;  3C5A A;  1D1J A;  3L9K A;  4KZ9 A;  3SH7 A;  4G3W A;  5CHJ A;  4K0X A;  3V39 A;  2EA9 A;  1H3Q A;  1RP5 A;  3IS2 B;  2Y2P A;  1OME A;  3B33 A;  1W63 Q;  4RX3 A;  2XRO A;  3T1Q B;  3D9Y A;  5EE8 A;  3H82 A;  2PAV P;  3A3F A;  2QPN A;  4PPR A;  5E43 A;  3C8C A;  2PYP A;  1TEM A;  3UY6 A;  2JHE A;  3SH9 A;  3UB6 A;  3UO9 A;  2G2U A;  2O9C A;  4L9F A;  1T19 A;  1GHM A;  1SCW A;  2VGL S;  4JGR A;  3PAG A;  2XFS A;  1TDG A;  1YMX A;  1FIK A;  3LR5 A;  1ONG A;  4OOY A;  1EI5 A;  3ZFZ A;  3FG8 A;  1ZHH B;  5I94 A;  1Y28 A;  4OKP A;  1GSV A;  1ZTU A;  4R38 A;  3MSH A;  4WN5 A;  3BLM A;  4HJ6 A;  5F1G A;  2ZJ9 A;  1S1Y A;  1PIO A;  3NDE A;  4EER A;  1ZG4 A;  1N9L A;  2UV0 E;  4C3Q A;  5K5B A;  3O86 A;  1Z6F A;  1T18 A;  2L4R A;  3AGD A;  4E3K A;  1NWZ A;  1BUE A;  3I7J A;  3MQO A;  5FQJ A;  3QNB A;  4KEN B;  5TGF A;  4R6L A;  3TG9 A;  2ZL1 B;  2CMN A;  3HRE A;  3UE6 A;  2WZZ A;  2J9O A;  3ZG0 A;  3KSG A;  1GSW A;  1KE3 A;  1YLT A;  3GTC A;  3MJQ A;  1EWZ A;  4S2J A;  3MZE A;  3MQQ A;  3NOP C;  2VA0 A;  3C4P A;  1WE4 A;  2PYR A;  1JWV A;  1K55 A;  1YPR A;  5IHV A;  4DXC A;  1Q2P A;  5CGS A;  2XD5 A;  2W27 A;  4UHU A;  4U0X A;  4GHI B;  5FQI A;  2BAS A;  4YIN A;  3ZG5 A;  3EGX C;  3IF6 A;  3PYP A;  2HP5 A;  5GLA A;  4ZJ3 A;  4GDB A;  3G2Y A;  1G5U A;  4R1G A;  1BUL A;  3VP0 A;  1F98 A;  3BEC A;  3IHA A;  3T4S A;  4ZJ2 A;  1ONH A;  3K3D A;  5KZH A;  3TRC A;  3Q7Z A;  5IT5 A;  3HLW A;  3IT9 A;  5GHX A;  2WK0 A;  1NYM A;  3MBZ A;  4EES A;  5J4E A;  2XDM A;  1I5Q A;  4HJ4 A;  4YOF A;  5FEF A;  2W1T A;  1DJC A;  4N92 A;  2HP6 A;  2XEP A;  3LIC A;  3KSF A;  4GB7 A;  1SDN A;  5CEB A;  1BSG A;  4IED A;  3VP1 A;  3GEC A;  2Y2K A;  1G68 A;  3KSI A;  3S4X A;  5HL6 A;  2QMI A;  5CRF A;  5F5Y A;  1LL5 A;  1P9R A;  3WWX A;  4DE0 A;  1T1B A;  4YNR A;  2WAF A;  4S2I A;  5HDD A;  2R9X A;  4GS9 A;  3BM6 A;  4KZ5 A;  2DRW A;  1ES3 A;  3ICY A;  2W3E A;  2VLG A;  1S1Z A;  4Y5F A;  1CI9 A;  2H5S A;  1O07 A;  3LI9 A;  2B18 A;  1ZC2 A;  2ZM8 A;  3VFH A;  3OZH A;  4EUV A;  2ZQD A;  3OPH A;  3OPL A;  3OCL A;  3HLG A;  2DCF A;  2V1A A;  5FQQ A;  3WS5 A;  5F82 A;  3UE0 A;  4E3N A;  1OT9 A;  1XPB A;  2P9V B;  3PBR A;  4RA7 A;  3TE8 A;  4QD4 A;  4JLF A;  4EWF A;  3FKV A;  2BG1 A;  2XSS A;  3T12 B;  3ISG A;  3EGD C;  3EWK A;  1PRQ A;  4HNB A;  2V9A A;  5M19 A;  3EEH A;  4EXO A;  1FR6 A;  4KZA A;  2VK3 A;  1Z09 A;  4GNU A;  3ZDJ A;  1CJF A;  4F94 A;  1ESU A;  5C5K A;  4LRX C;  4OQG A;  3IWI A;  5E2G A;  1HZO A;  5L09 A;  4OQI A;  1JWP A;  1KGF A;  5EVL A;  4EV4 A;  2HV1 A;  2ZC6 B;  4NKP A;  3BRM A;  3LY3 A;  4IHQ A;  5EVI B;  3WS1 A;  5HPF A;  2J7V A;  4IVK A;  1QME A;  3HUM A;  3QNC A;  2XA7 M;  1YLJ A;  3FYZ A;  4BBV A;  2ZC7 A;  3RFB A;  4ZJ1 A;  3KO6 A;  1KGE A;  4U3T A;  1L0F A;  3G2Z A;  2WUQ A;  4WZ4 A;  4GDN A;  4FH4 A;  3IXH A;  4UA6 A;  3LCE A;  2ZOH A;  3P09 A;  2EX6 A;  4P6Z S;  2ZQC A;  1GA9 A;  5G18 A;  2QJ7 A;  5FQM A;  4JF6 A;  2HP9 A;  4S2M A;  3ZHH A;  3DBA A;  3HLE A;  5HAR A;  2JKG A;  3S7Q A;  5HDS A;  1RGY A;  3R7W B;  2H28 A;  2JE5 A;  4WBG A;  2VGL M;  4BD1 A;  1JNU A;  4LCM A;  1YAX A;  1ODV A;  4L9G A;  3SS5 A;  4R4S A;  1WYB A;  2KX6 A;  3RH8 B;  4EET B;  2WKR A;  1D7E A;  4G3K A;  3SOI A;  3T4T A;  4CLC D;  5IS1 A;  2V8F A;  5FI7 A;  1MKI A;  4XUX A;  4JXW A;  3CZD A;  2HJ9 C;  1BLC A;  2O9B A;  2J9P A;  4OON A;  2H0Y A;  3UDI A;  1FSY A;  5DF9 A;  1WA9 A;  2I9V A;  3BFF A;  3QP4 A;  3VMA A;  4ZRR A;  5JYP A;  3LR4 A;  1ERQ A;  1K25 A;  4KZ7 A;  4CLC A;  3S1Y A;  1ERM A;  2XQZ A;  3LID A;  4X55 A;  3ZQ5 A;  1XGI A;  3IBJ A;  5A93 A;  3VOZ A;  5EFW A;  1MBL A;  4K91 A;  4L9E A;  5DTT A;  4R4R A;  1LSW A;  4IBX A;  2V0U A;  1BT5 A;  1STZ A;  4O0P A;  2EX9 A;  4X68 A;  3CUE A;  2JKR M;  2YKF A;  4S2N C;  4S2K A;  1NZU A;  3IQA A;  2J80 A;  4EQI A;  1YLP A;  1LHY A;  3EOI A;  1NYY A;  4NXF A;  3UPN A;  5HPI A;  4QU3 A;  5TR7 A;  1W63 M;  1QMF A;  2JKF A;  1VET B;  1A0K A;  5KSH A;  3TW8 A;  4E3J A;  5EVI D;  2A49 A;  3Q82 A;  4BL3 A;  1LSV A;  3ZVT A;  1NRJ A;  1XJ4 A;  2A24 A;  2H10 A;  1JVJ A;  4MBK A;  4MEZ A;  4Y7P A;  3LO7 A;  3Q07 A;  3NY4 A;  3RTY A;  2RL3 A;  3H7W B;  4E3I A;  1H5X A;  3LGO A;  1GHI A;  4F3L A;  4EBN A;  2CC1 A;  3QP6 A;  4E6X A;  3GDI A;  1LI9 A;  3SZT A;  5HWV A;  1IEM A;  4MN6 A;  2P7J A;  2PHY A;  4HP4 A;  1VQQ A;  3LR0 A;  5U47 A;  2JKT M;  5AQB A;  3IH9 A;  3RXX A;  2Y2Q A;  3IF6 B;  4OLD A;  5GLB A;  4WL9 A;  2L0W A;  5TFQ A;  3OPR A;  3BLS A;  2UWX A;  3HUN A;  1XFN A;  2EWW A;  2KDK A;  5CXW A;  3HCY A;  4QY5 A;  3LFV A;  1FQG A;  4NXG A;  4P85 A;  2Y2N A;  1L3L A;  4E6W A;  2Q9N A;  3T50 A;  2XD1 A;  3OC2 A;  3ZCZ A;  4FUW A;  4LGW A;  4MN7 A;  1CEG A;  4R70 A;  1E3U A;  4DKI A;  4OPY A;  4EBP A;  1ALQ A;  1DP6 A;  2R78 A;  3MFX A;  2EX2 A;  2EXA A;  3F1N B;  4DE3 A;  4KZ3 A;  4I39 A;  3IX3 A;  4LV2 A;  1IKI A;  3NCK A;  3KX0 X;  1LT0 A;  3NJA A;  1NXY A;  1VEU B;  2PD8 A;  3GV9 A;  1KE0 A;  5CTN A;  3VP4 A;  5EM1 A;  2W3F A;  1P0Z A;  2V2F F;  2WKH A;  3BJN A;  2ZM2 A;  3P98 A;  3M6H A;  5GHZ A;  4BBU A;  3UB8 A;  1AWI A;  1XKZ A;  1KGG A;  4KG2 A;  2B95 A;  1TVF A;  4ETX A;  3MZF A;  4H6J A;  1K6R A;  4HEF A;  5IU1 A;  4RVA A;  1K54 C;  2HF6 A;  3E4O A;  4WZ5 A;  4BL2 A;  4O8G A;  5HW3 A;  4OP5 A;  2HDU A;  4CLC C;  1IFQ A;  5CTM A;  1L2S A;  3S22 A;  3CHW P;  3B47 A;  3CWF A;  1W8Q A;  3IXD A;  1T1C A;  2ZMV A;  1SKO B;  3CPT B;  3D4F A;  3CIT A;  3WRT A;  1O7E A;  1YLZ A;  4U0T A;  2J3T C;  1GHP A;  2ZC5 B;  4KUO A;  1EW0 A;  5FAS A;  1T1A A;  3UB5 P;  2ACG A;  3CUE C;  4GCZ A;  4I3I A;  2KLI A;  3HUO A;  3NBL A;  1X0O A;  2ZC3 B;  2WZX A;  1F9I A;  5DJU A;  1BLH A;  4P6Z M;  5HWT A;  4ARZ A;  1N9O A;  4E04 A;  5KIZ A;  2WGW B;  2QWS A;  4WEK A;  4KZ4 A;  1K56 D;  3IXG A;  3G31 A;  3CG5 A;  4R23 A;  1KVL A;  3CAX A;  2EFX A;  3DAV A;  4I3A A;  4GLQ A;  2FZ0 A;  2P04 A;  3NI9 A;  1E4D A;  3MXR A;  3VOY A;  4HBT A;  5DTK A;  3PAE A;  3VFF A;  1V9Z A;  3D72 A;  3ITB A;  3LR3 A;  3HL9 A;  1GSX A;  1DP9 A;  4O01 A;  1K56 A;  4GOG A;  2HGV A;  2OOL A;  3PBQ A;  4I3J A;  3TOI A;  1F2K A;  3DTK A;  5L2F A;  2PBD P;  4NXB A;  4Y0O A;  4O7D A;  5A8B A;  5CGX A;  5CX7 A;  4N1H A;  2EXB A;  3LEZ A;  1CK3 A;  1S66 L;  4JGQ A;  1UWP X;  1ES2 A;  2B5R A;  3NIA A;  1OTI A;  1ERO A;  4A5R A;  3TSG A;  2ZC4 B;  1S6R A;  4BQM A;  4X6T A;  4C75 A;  2X02 A;  3DTI A;  5HX9 A;  4IUH A;  4FD8 A;  3DTE A;  5DFY A;  3C30 A;  4JXS A;  1Q2Q A;  2G7U A;  1XXM A;  2Y8H A;  1GCE A;  1PWC A;  2GNX A;  2XLN A;  3PHY A;  5FSR A;  4DXB A;  4OH0 A;  1PI5 A;  1NLZ A;  2BLS A;  4CQH A;  2Z6C A;  4OP8 A;  3HVF A;  3GQZ A;  3N8R A;  4PKY G;  3E2L A;  5GLC A;  3S7N A;  4EU0 A;  3BFC A;  4JBF A;  1VB6 A;  4ESP A;  1YKD A;  2OLV A;  1FCN A;  2D01 A;  3DW0 A;  4ZTK A;  2XH9 A;  1IEL A;  5CEC A;  2VV7 A;  3CLO A;  4B4X A;  4JGP A;  1ES5 A;  3LIA A;  3H9W A;  4S2N A;  3LYX A;  3MZD A;  4D2O A;  2WKE A;  3KYQ A;  3QP2 A;  2OSU A;  3BYD A;  3U4L P;  5AQ7 A;  2ZOI A;  1FIL A;  2HJE A;  1JTG A;  4FSF A;  3B3X A;  3AGE A;  2L1M A;  3ZG9 B;  1IKG A;  2X01 A;  4B9O A;  3M2K A;  1W8Y A;  3W4O A;  4YFM A;  1XP4 A;  2Y4A A;  4X56 A;  1DJB A;  1M40 A;  2VZW A;  1MWT A;  3C38 A;  2K31 A;  5FI6 A;  2WGI A;  1M6K A;  2E8J A;  5LBR A;  2W3D A;  4UA7 A;  4HHD A;  5TJJ A;  4WZ5 C;  2Y2O A;  4PM5 A;  2OWJ A;  1N9N A;  1MXO A;  2K7S A;  1S4R A;  4WMC D;  2HPB A;  1K4E A;  5CER A;  1P9W A;  4ID4 A;  4KG5 A;  1K57 A;  3DWK A;  2GZA A;  4BEN A;  4UEY A;  2JC7 A;  3UME A;  3MS6 A;  2BTF P;  2IWC A;  3T4K A;  3MF0 A;  2Y2I A;  2P74 A;  2ZL1 A;  1TDL A;  5EOO A;  5EUA A;  1VM1 A;  4RQ9 A;  4PM8 A;  1YT4 A;  4HQA A;  4Y17 A;  4DE2 A;  3O88 A;  4NEE D;  3HJI A;  2INW A;  2PU2 A;  3GSG A;  1PZP A;  3W4P A;  2W3H A;  4GHI A;  4JF4 A;  3BFG A;  4EEU A;  4QJG A;  4M4X A;  3T4J A;  5HZH A;  3MKF A;  3QHY A;  3A0R A;  3GRJ A;  3W4Q A;  4PKY A;  1FCM A;  2QKP A;  5HSQ A;  4KQD A;  1W5D A;  1OTE A;  1H8M A;  1MY8 A;  4X1M A;  2W0N A;  3HLF A;  3PBS A;  1IOU A;  3F1P B;  1NRF A;  4Z9Q A;  2R9W A;  4LRY C;  1TS8 A;  3PBT A;  4Q0J A;  3FZC A;  4KQQ A;  3VP3 A;  4LFU A;  5A90 A;  3ZVW A;  4K0W A;  2XGN A;  4H8R A;  3Q81 A;  1PI4 A;  4UAA A;  3SS3 A;  3UE1 A;  3W8K A;  3OPP A;  3VV4 A;  3T1S A;  1XJ3 A;  4S2O A;  3FPV A;  3CJM A;  4PMA A;  3G35 A;  1BLP A;  3H82 B;  3EQV A;  3G4P A;  1K54 A;  4LCL A;  4IUK A;  5L8M A;  1HD8 A;  4P6B A;  3UN7 A;  5L10 A;  4OVD A;  1H0M A;  3F1O A;  1Y4O A;  1YSP A;  4XXR A;  4JGO A;  1JWZ A;  5G4Z A;  2RCX A;  1K4F A;  3T4O A;  2O9A A;  2J8Y A;  5FAT A;  2NUP C;  4PHT A;  3KSH A;  5HL1 A;  3R4K A;  4UQI S;  4R0Q A;  3LIF A;  2QJ5 A;  3O3V A;  4OOL A;  4DDY A;  5FAO A;  4NG2 A;  3B42 A; 
#chains in the Genus database with same CATH homology
 5FI2 A;  2ZM0 A;  3IH8 A;  2EX2 A;  5GLA A;  2EXA A;  2HP5 A;  4WMC A;  2IWB A;  5KSC A;  2WGW A;  4GDB A;  4ZJ3 A;  3G2Y A;  2HDR A;  4DE3 A;  4R1G A;  4LV0 A;  1BUL A;  3VP0 A;  4KZ3 A;  4RX2 A;  3BEC A;  3IHA A;  3ZG8 B;  4LV2 A;  1IKI A;  4ZJ2 A;  3NCK A;  4C6Y A;  1NXY A;  2P9V A;  1ONH A;  3PTE A;  4B88 A;  5KZH A;  2Z2L B;  3Q7Z A;  2Y2H A;  3GV9 A;  1KE4 A;  1KE0 A;  5CTN A;  1PW1 A;  3VP4 A;  1C3B A;  2WAD A;  3HLW A;  1N9B A;  2V2F F;  2WKH A;  2ZM2 A;  3IT9 A;  3M6H A;  3P98 A;  5DF7 A;  5GHZ A;  1U60 A;  4PM9 A;  5GHX A;  3ZNY A;  4BD0 A;  2WK0 A;  4FH2 A;  5F83 A;  3GMW A;  1NYM A;  1XKZ A;  1GA0 A;  1KGG A;  3MBZ A;  4KG2 A;  4WYY A;  5GHY A;  2E8I A;  1W79 A;  1TVF A;  4FCF A;  5CHM A;  3MZF A;  5E2H A;  1K6R A;  3MFD A;  2XDM A;  4HEF A;  1I5Q A;  4RVA A;  4S2P A;  1DJC A;  4LV3 A;  4N92 A;  4P0M A;  4N9L A;  1K54 C;  2HP6 A;  2XEP A;  4LEN A;  4PM7 A;  4WZ5 A;  4BL2 A;  1Y54 A;  4GB7 A;  3V3S A;  1DY6 A;  1SDN A;  5CEB A;  1BSG A;  3BFD A;  4IED A;  5E2E A;  5HW3 A;  5AQA A;  3VP1 A;  4OP5 A;  2HDU A;  2Y2K A;  5CTM A;  1G68 A;  4RYE A;  3CMZ A;  4JXV A;  5EEC A;  1L2S A;  3S4X A;  3S22 A;  1MPL A;  1W8Q A;  3IXD A;  5EVI A;  1RGZ A;  1YLW A;  2QMI A;  5CRF A;  1LL5 A;  3WWX A;  1K57 C;  1XGJ A;  1K55 C;  4DE0 A;  3D4F A;  1N4O A;  1S0W A;  3WRT A;  5CED A;  1O7E A;  2WAF A;  1XA1 A;  4MLL A;  4S2I A;  3C7V A;  1YLZ A;  4S2L A;  4U0T A;  1PWG A;  1GHP A;  2V20 A;  2R9X A;  2ZC5 B;  2FFF B;  3BM6 A;  4KZ5 A;  5FAS A;  3UDF A;  5HAI A;  2Y2G A;  2DRW A;  3IF6 C;  3RJU A;  4LV1 A;  3A3E A;  1L0E A;  1ES3 A;  2PBY A;  5HAQ A;  1XX2 A;  5D3O A;  1FSW A;  4EBL A;  3HUO A;  4MBF A;  1CI9 A;  3NBL A;  2H5S A;  2ZC3 B;  2WZX A;  1O07 A;  3NC8 A;  5FAQ A;  1IYO A;  1ZC2 A;  2ZM8 A;  4WEL A;  5GL9 A;  4BLM A;  1BLH A;  3VFH A;  1MWS A;  3OZH A;  4OOM A;  1K6S A;  3DWZ A;  2WGW B;  2ZQD A;  4WEK A;  1YLY A;  3OPH A;  1K56 D;  3OPL A;  4KZ4 A;  4KZ8 A;  3IXG A;  3OCL A;  4NK3 A;  3HLG A;  2DCF A;  5FQQ A;  3OCN A;  3G31 A;  3CG5 A;  1NY0 A;  3WS5 A;  4R23 A;  4HBU A;  1KVL A;  5F82 A;  3UE0 A;  4E3N A;  3UPO A;  4OPR A;  1XPB A;  2P9V B;  3PBR A;  4RA7 A;  2EFX A;  3PBN A;  1ESI A;  3BEB A;  3Q1F A;  2XFT A;  3NI9 A;  4L0L A;  5FA7 A;  4QD4 A;  4JXG A;  4KZ6 A;  4Y0T A;  4JLF A;  2ZMA A;  1E4D A;  4EWF A;  3FKV A;  2BG1 A;  2Y59 A;  3MXR A;  1WYC A;  3JYI A;  1K38 A;  4OPQ A;  3HLC A;  3VOY A;  3ISG A;  3MKE A;  4HBT A;  5DTK A;  3PAE A;  3VFF A;  3ITB A;  4Q8I A;  5M19 A;  3HL9 A;  1NJ4 A;  1FR6 A;  4KZA A;  1K56 A;  4X53 A;  3N8L A;  4JPM A;  4GOG A;  3PBQ A;  4GNU A;  3ZDJ A;  3TOI A;  4F94 A;  1RCJ A;  3G32 A;  5F1F A;  5L2F A;  1ESU A;  3SS4 A;  4Y0O A;  5CHU A;  3WRZ A;  3ZG7 B;  1MWR A;  4OQG A;  3VP2 A;  4O7D A;  2C6W B;  3IWI A;  5E2G A;  5CGX A;  5A91 A;  4GN2 A;  1YQS A;  2Y2J A;  1IYP A;  4N1H A;  1HZO A;  2EXB A;  1CK3 A;  3LEZ A;  3ZNT A;  4OQI A;  1JWP A;  3IHB A;  1KGF A;  2Y2L A;  1ES2 A;  2B5R A;  3NIA A;  5EVL A;  4PM6 A;  3N4I A;  3NDG A;  3WS2 A;  1ERO A;  3N6I A;  3FWL A;  2ZQA A;  4A5R A;  4EV4 A;  2ZC6 B;  3TSG A;  1H8Y A;  2ZC4 B;  3BRM A;  4IVI A;  1IYS A;  3LY3 A;  1S6R A;  4BQM A;  4X6T A;  5EVI B;  4C75 A;  2X02 A;  5HX9 A;  3WS1 A;  4N9K A;  4FD8 A;  2J7V A;  4JXS A;  2HDQ A;  1Q2Q A;  1QME A;  3HUM A;  4IVK A;  1XXM A;  3QNC A;  1J9M A;  1GCE A;  1PWC A;  4R3B A;  1YLJ A;  2FFY A;  1ZG6 A;  3FYZ A;  5DVA A;  1HVB A;  2ZC7 A;  3M6B A;  4DDS A;  5M18 A;  4ZJ1 A;  2XF3 A;  2XLN A;  3Q7V B;  5FSR A;  4DRT A;  2Y55 A;  5E2F A;  1KGE A;  4OH0 A;  5FQ9 A;  4DXB A;  4U3T A;  1L0F A;  4E3O A;  1PI5 A;  1YMS A;  2HDS A;  2BLS A;  3G2Z A;  4MNR A;  2IWD A;  5DF8 A;  1DJA A;  1KDW A;  4R3J A;  2WUQ A;  2Z2M B;  2ZQ8 A;  4B4Z A;  2JBF A;  2WAE A;  3N7W A;  1SKF A;  4JKT A;  4WZ4 A;  5KMW A;  4OP8 A;  2Q9M A;  3HVF A;  3IWQ A;  3GQZ A;  3N8R A;  4GDN A;  3E2L A;  1E25 A;  1I2S A;  2ZLY A;  3IXH A;  4FH4 A;  5GLC A;  4UA6 A;  3LCE A;  3BFE A;  3P09 A;  3BFC A;  1L0G A;  1SDE A;  2WKI A;  1YM1 A;  4JBF A;  3FKW A;  2OLV A;  1FCN A;  5DTS A;  2EX6 A;  3DW0 A;  2ZQC A;  4ZTK A;  4DE1 A;  1GA9 A;  3N8S A;  5G18 A;  2XH9 A;  5FQM A;  4JF6 A;  5FDH A;  2HP9 A;  4S2M A;  1IEL A;  5CEC A;  3HLD A;  5A92 A;  1LL9 A;  4KG6 A;  3ZHH A;  4B4X A;  3HLE A;  4KQR A;  5BOH A;  5HAR A;  1PZO A;  5M1A A;  3C7U A;  1ES5 A;  3AGF A;  3HBR A;  1RGY A;  3Q7V A;  2GDN A;  4QB8 A;  4S2N A;  2VGK A;  3ITA A;  4X69 A;  2XK1 A;  1L0D A;  4UA9 A;  2JE5 A;  3EQU A;  4ZBE A;  4WBG A;  3MZD A;  2JCH A;  4D2O A;  5FAP A;  3IXB A;  1BZA A;  2WGV A;  4KZB A;  4BD1 A;  2WKE A;  4LCM A;  4N1X A;  4E3L A;  2OSU A;  3IF5 A;  3BYD A;  5AQ7 A;  1LLB A;  1MWU A;  2QZ6 A;  1JTG A;  4FSF A;  3SS5 A;  1AXB A;  2X71 A;  3B3X A;  5CGW A;  3AGE A;  4OQH A;  1WYB A;  3M2J A;  4R4S A;  3ZG9 B;  1IKG A;  2X01 A;  1CI8 A;  3V50 A;  3M2K A;  1W8Y A;  3W4O A;  3C4O A;  4YFM A;  3VSK A;  1LI0 A;  1I2W A;  3SOI A;  4OLG A;  1XP4 A;  4EUZ A;  2Y4A A;  4X56 A;  1DJB A;  1M40 A;  1JTD A;  1FR1 A;  1HTZ A;  1MWT A;  3UE3 A;  5FI7 A;  5EOE A;  1BLS A;  5FI6 A;  2WGI A;  1MKI A;  4XUX A;  4JXW A;  3CZD A;  1M6K A;  5J8X A;  2OLU A;  3ZGA B;  2G2W A;  1BLC A;  4UA7 A;  2VGJ A;  1BTL A;  2J9P A;  3A3I A;  4OON A;  2H0Y A;  4GKU A;  3WS4 A;  3UDI A;  1SHV A;  2ZQ9 A;  1FSY A;  5DF9 A;  5JYO A;  2V1Z A;  3BFF A;  3VMA A;  4WZ5 C;  1PYY A;  5JYP A;  2Y2O A;  1E3U D;  3FV7 A;  4PM5 A;  1ERQ A;  1IYQ A;  4WM9 A;  1K25 A;  4KZ7 A;  1MXO A;  1ERM A;  2PU4 A;  2XQZ A;  3S1Y A;  4M3K A;  4QY6 A;  4MBH A;  4X55 A;  3UNW A;  4HES A;  4WMC D;  2HPB A;  3C5A A;  1K4E A;  3SH7 A;  4KZ9 A;  1XGI A;  3G34 A;  5CER A;  5CHJ A;  3A3D A;  4ID4 A;  4K0X A;  4KG5 A;  3V39 A;  3VOZ A;  4BJP A;  3PBO A;  5A93 A;  1RP5 A;  1ES4 A;  5EVI C;  1K57 A;  4NET A;  1MBL A;  4K91 A;  5DTT A;  2Y2P A;  1OME A;  1CEF A;  3LY4 A;  3DWK A;  4R4R A;  4BEN A;  4IBX A;  5EPH A;  4RX3 A;  1BT5 A;  2JC7 A;  4ZAM A;  1ZKJ A;  2EX9 A;  1PWD A;  4X68 A;  5EE8 A;  2OV5 A;  2IWC A;  3A3F A;  2QPN A;  4S2N C;  4PPR A;  5GLD A;  2Y2I A;  5E43 A;  4S2K A;  2P74 A;  1NZU A;  1TDL A;  3IQA A;  5EOO A;  1TEM A;  3UY6 A;  3HLB A;  4EQI A;  5EUA A;  1VM1 A;  4PM8 A;  1YLP A;  1NZO A;  3SH9 A;  3V5M A;  1LHY A;  4Y0U A;  1W7F A;  1NYY A;  1YT4 A;  3UPN A;  1KVM A;  4QU3 A;  5TR7 A;  4JF5 A;  3UO9 A;  1KDS A;  2G2U A;  3GVB A;  4DF6 A;  1QMF A;  3IWO A;  1GHM A;  3V3R A;  1SCW A;  2DNS A;  3MXS A;  4IBR A;  4DE2 A;  3O88 A;  3A3J A;  1G6A A;  2WYX A;  2XR0 A;  3PAG A;  2PU2 A;  5KSH A;  3GSG A;  1PZP A;  1XA7 A;  2XFS A;  3W4P A;  1TDG A;  4E3J A;  5EVI D;  2A49 A;  3Q82 A;  4BL3 A;  1YMX A;  4OQ0 A;  3ZVT A;  3E2K A;  4JF4 A;  2EFU A;  3BFG A;  4QJG A;  1ONG A;  4OOY A;  1EI5 A;  3ZFZ A;  4WEJ A;  3MKF A;  3QHY A;  2H10 A;  1JVJ A;  4XUZ A;  5I94 A;  3GRJ A;  4MBK A;  3W4Q A;  4MEZ A;  1FCM A;  3LO7 A;  4OKP A;  3Q07 A;  3NY4 A;  4Y7P A;  4CPK A;  2RL3 A;  1W5D A;  3SH8 A;  4P87 A;  1MY8 A;  5FQK A;  4E3I A;  3BLM A;  1H5X A;  3HLF A;  3PBS A;  3G30 A;  1GHI A;  2Y91 A;  1NRF A;  5F1G A;  4Z9Q A;  2ZJ9 A;  2R9W A;  4EBN A;  2CC1 A;  1PIO A;  3NDE A;  4KQO A;  3PBT A;  1H8Z A;  4CJN A;  4E6X A;  3FZC A;  4KQQ A;  1ZG4 A;  3VSL A;  3VP3 A;  1LI9 A;  5A90 A;  3ZVW A;  1IEM A;  4C3Q A;  4GD6 A;  4K0W A;  2XGN A;  4H8R A;  2ZD8 A;  3Q81 A;  1PI4 A;  3O86 A;  1Z6F A;  4UAA A;  3SS3 A;  3UE1 A;  3W8K A;  1VQQ A;  3OPP A;  3AGD A;  5U47 A;  4QHC A;  4S2O A;  4E3K A;  3CJM A;  1BUE A;  3I7J A;  5AQB A;  3IH9 A;  3RXX A;  4PMA A;  5FQJ A;  2Y2Q A;  3G35 A;  1BLP A;  3IF6 B;  3DTM A;  3EQV A;  3QNB A;  4KEN B;  4OLD A;  5GLB A;  1FCO A;  3G4P A;  5TGF A;  3TG9 A;  1K54 A;  4LCL A;  2I72 A;  3WS0 A;  4GZB A;  5TFQ A;  3HRE A;  3OPR A;  1HD8 A;  1PW8 A;  2WZZ A;  2J9O A;  3BLS A;  3ZG0 A;  2UWX A;  3HUN A;  4P6B A;  4GD8 A;  3UN7 A;  4E3M A;  1KE3 A;  4OVD A;  1YLT A;  5CXW A;  1FOF A;  4QY5 A;  3GTC A;  1FQG A;  1EWZ A;  4S2J A;  4P85 A;  3MZE A;  2H0T A;  4XXR A;  5HFO A;  2Y2N A;  3C4P A;  1WE4 A;  4ZDX A;  1JWZ A;  2RCX A;  4E6W A;  2Q9N A;  1JWV A;  1K4F A;  1K55 A;  2J8Y A;  5FAT A;  2A3U A;  2XD1 A;  3OC2 A;  3ZCZ A;  5IHV A;  2ZQ7 A;  5AQ9 A;  4DXC A;  1Q2P A;  2C5W B;  5CGS A;  2XD5 A;  2Y2M A;  3O87 A;  4UHU A;  4U0X A;  3UPP A;  1CEG A;  5HL1 A;  1E3U A;  2EX8 A;  4R0Q A;  4DKI A;  4OPZ A;  5FQI A;  5HAP A;  4OPY A;  3RXW A;  3GR2 A;  3O3V A;  4YIN A;  3UDX A;  1ALQ A;  4OOL A;  3ZG5 A;  4DDY A;  4EBP A;  5FAO A;  3IF6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...