1JWWA

Nmr characterization of the n-terminal domain of a potential copper-translocating p-type atpase from bacillus subtilis
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
80
structure length
80
Chain Sequence
VTEKAEFDIEGMTCAACANRIEKRLNKIEGVANAPVNFALETVTVEYNPKEASVSDLKEAVDKLGYKLKLKGEQDSIEGR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Potential copper-transporting ATPase
publication title Solution structure of the N-terminal domain of a potential copper-translocating P-type ATPase from Bacillus subtilis in the apo and Cu(I) loaded states.
pubmed doi rcsb
source organism Bacillus subtilis
molecule tags Hydrolase
total genus 16
structure length 80
sequence length 80
ec nomenclature ec 7.2.2.8: P-type Cu(+) transporter.
pdb deposition date 2001-09-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00403 HMA Heavy-metal-associated domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.100 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1jwwA00
1S6UA 1GXTA 3LGNA 3BB5A 3HDSA 1TR0A 4HH0A 2QIFA 3HHLB 1Y3JA 2Q3PA 1KVIA 1JWWA 2GA7A 2N7YA 5B0EA 2BJEA 3VTIA 2W4CA 2AJ1A 3TOQA 4ZOSA 2LDIA 2ZDOA 3FMBA 4NPOA 5A6WA 3KNGA 2FIUA 1Q8LA 3HHLC 3IWLA 1YG0A 2JDJA 2QYCA 4YDXA 2PGCA 4A4JA 4EFAC 2W4DA 2LXFA 3MZIA 5B0DA 5IXUA 5B0CA 4Y2MA 1FVQA 1P8GA 2HLTA 1FEEA 3BR8A 2IFXA 1AFJA 1YJRA 2L3MA 3KG0A 4OJHA 3CJKB 2KT3A 3HHLA 1VQYA 3DXSX 2GCFA 3F44A 4OJ3A 1JK9B 1FE4A 1X8DA 1XBWA 1CC8A 3TRGA 1FD8A 1ULRA 2HLUA 1TZ0A 2QLWA 2XMWA 3BM7A 2CRLA 5B0BA 4HL9A 2ZDPA 3TNVA 2OD6A 1OQ6A 2RU9A 3GZ7A 3BDEA 1Q8BA 5KAKA 4QOTA 1SI9A 2XMUA 1SQEA 3BN7A 2RMLA 4ZA1A 3E8OA 2BJDA 5B0GA 5B0AA 1Y9OA 5A6PA 2BYCA 2N4CA 2QLXA 2FB0A 2IYGA 2RILA 3BGUA 4Q2MA 3CJKA 3WDOA 1APSA 2HFOA 2GFFA 4U9RA 3QGPA 4HI1A 1OSDA 4HH1A 1YJVA 1V3ZA 2XMTA 4DPOA 2HQIA 5B09A 5B08A 2FHMA 1R6YA 1LQ9A 1OPZA 1SB6A 1W2IA 1YJUA 4YEAA 1FE0A 1CPZA 1X7VA 1N5TA 1K0VA 1QUPA 2KYZA 2OD4A 2AW0A 1U7LA 2K7KA 2OKQA 1FESA 2ROPA 1GXUA 2OFGX 4NL5A 4Q2LA 3DCAA 1TUVA 4A46A 3HX9A 1URRA 1OQ3A 2FTRA 1FVSA 2KT2A 2OMOA 2RSQA 2PD1A 3IWXA 1MWYA 4A47A 4DL0C 1S6OA 2AJ0A 2AP6A 2OAUA 3KKFA 1KQKA 2XMMA 5T7LB 2OFHX 1WD6A 2BUNA 2GO8A 4FNHA 4OIXA 2EW9A 2K1RB 2ROGA 4F67A 2LQBA 1CC7A 2ROEA 4HI2A 4OJGA 4FNIA 2K7JA 2VH7A 1YJTA 1TL5A 1N5SA 3HF5A 1Y0HA 1KVJA 1VQSA 2N4DA 3UDCA 2GGPA 2BBEA 2HIQA 2LQ9A 2ASYA 2IYIA 1Q4RA 5B0FA 1N5VA 4A48A 1IUJA 2XMJA 2XMVA 1RJJA 2GGPB 3T9NA 1YRXA 2G9OA 2XMKA 1TL4A 3I9ZA 5F0UA 3HFKA 2GV1A 3QMQA 4Y2KA 5T7LA 1X0PA 1P6TA 1Y3KA 3FGVA 3KG1A 4Y2IA 5F0WA 2K1RA 1MWZA 2K2PA 2W4PA 3K7RA 4OJ1A 2HFNA 3FRYA 5K9FA 2KKHA 3HHLD 2ACYA 4DN9A 3BF4A 1AFIA 2VV5A 2OP5A 3LO3A 1N5QA 3LGMA 1AW0A 1Q53A 3MCSA
chains in the Genus database with same CATH superfamily
4Z7CA 7AT1B 4NLUA 2G1DA 4R0JA 2W9CB 2IY5B 4P2MA 3TANA 2YPZA 2C3MA 3GONA 4DN0A 4OI6A 1N0UA 4RNMA 3HSZA 1RT6B 2WB1D 4YY3F 4OJHA 3W2VA 3TP2A 3OR2A 4X64F 2J76E 1OYDA 5H9FJ 5I3UB 4OHYA 2ASLA 3TNVA 4HDGA 1W2BR 3PX4A 2ACMA 2P8IA 1WKJA 1B70B 3GG1A 2ZH3A 2DNNA 1NH7A 3OTOJ 2NXJA 2X1AA 5L39A 3MR3A 2BABA 4CM2A 3QIDA 4OLPA 4C3LA 3OR1A 2YX4A 4X4TA 2VZ9A 3U02A 3KLGB 3IS9B 3HFVA 5C5JA 2Z2YB 4OV6A 2JX2A 3EDQB 4PPZA 2RDJA 3KLIB 3M30A 2XI2A 5HVFA 4FVCA 4TU9A 3ZTSA 5LJ3Y 3THVA 3MTKA 3NEKA 3AOAA 3VZIA 1TL7A 2PO4A 3RGIA 1UW9A 3MD3A 2AJ1A 2C2ZB 3HJVA 4AL7A 1RU1A 1VIOA 3GCWP 2IJRA 5BYSA 5KG1A 3EJMA 1H2TZ 4PG6A 1NB7A 3SIPB 4ED3A 1FJGJ 1BY9A 3QBCA 5LSLA 2HLUA 1RWUA 4GO7X 3I32A 1BD6A 2IMOA 3LW5C 3MR2A 4O44B 3ZC4A 3WDOA 3OL6A 1NDPA 5GMKa 3I4PA 1LQ9A 5L9NA 4K4TA 3L4BC 2RS2A 1R8HA 4NWBA 5K8OA 3FSXA 3DFEA 4A8SA 3B4DA 3SFGA 3V81A 1LWEA 3UNYA 2UVUA 3EPGA 2QMXA 2RE1A 4QIGA 4R25A 3JSYA 1RTJA 5HP1B 4X84A 2IVYA 1X5OA 3QFHA 4LR7A 4USIA 4KGZB 2HNYA 4W90B 1PYSB 4ELVA 4B9SA 5DJBA 5DM6Q 4DUYJ 3R7SB 3WX8A 1CLFA 3Q8SB 4P10A 1OS5A 4DR5J 1PILA 3SSSA 1JWWA 3GFZA 5D8HB 3DLKB 2W24A 2D9PA 4WBFA 3G4SS 4QQBA 2Q66A 1WI8A 5A0YA 3DI6A 3R97A 1UL3A 1U1MA 5KFDA 3J81j 2FQQB 3QAEA 3EGVA 3CCVS 4B3OB 1V9OA 5B0GA 5KFTA 3RB6A 2OSQA 4MIAA 3HP6A 2MGZA 2R7RA 2M7SA 2A2CA 1YJUA 1SL1A 4I64A 3R5BA 4FS1A 4M95A 3UE2A 4WE1B 3J7Z5 3DGPA 1I94F 3TAPA 1CJUB 2IAJB 1J5OA 4GVBA 1LFPA 5D0EA 4V19X 1IBKJ 2UXBJ 3E01A 1HBMB 3OFEA 2RQCA 2MZSA 4TYAA 3RTVA 4RW6A 3AOBA 3S7RA 5KG3A 3DN9A 2UUCF 3DRYA 1H7XA 4KB7A 2L9NA 1N54B 4WYLA 3CCMS 1ZETA 2G4BA 2J8SA 3FQLA 5DM7Q 1MW7A 4WTOB 3EM1A 2DR7A 3HHLA 5T14A 1XNQJ 2CRLA 4ZPBA 2OUGA 3IAM9 3E2EA 3FVYA 5CABA 3GYGA 1KFDA 3JAMY 1BC6A 1NDLA 4L6V3 3RRHA 3DLJA 4EGLA 1Q86T 1VFJA 1UKUA 4OHZA 4IG0A 3VGUA 5M2RA 3BDPA 2JLFA 4WKRA 3DRXA 3HVWA 5CXTA 3IAS9 2HGNA 1D3WA 3PIPQ 1TL4A 3IMQJ 4N41A 4F04B 4K0KJ 2WVFA 2FZKB 3V4IA 3MM6A 4CNZA 4ELTA 1R0AB 2U1AA 1SV5B 1YITS 3ADAC 2KM8C 3QT8A 3KUHA 2C3PA 1FKPB 3TEGA 4USHA 3SFUA 1FWLA 4BDPA 1F6TA 1S9GB 1TL3A 2W4DA 1RTZA 4J5OA 3PM9A 1LNQA 5ETMA 3AA9A 3D1QA 4DR6F 4TLQA 1BUXA 2DYAA 3VVTA 1VQPS 1CC8A 3G71S 3MOJB 4UY8T 2G1HA 5CZVA 4HL9A 1RLCL 1SI9A 5CD4A 2YKNA 2J7KA 1HKAA 4AL5A 1QD1A 1S12A 5B08A 3SV4A 3BYPA 3HVAA 3T5LA 1YZ7A 1WI6A 2IRYA 1HQUA 4Q45A 2M8DB 1GQEA 3R6GB 4FP9A 3EGWB 2QL5B 4OX6A 2CZ9A 1D0EA 4EYIB 3SZ2A 3M4XA 2DGSA 3GR0A 4DL2A 4YFUA 2ASJA 5U47A 1F9EB 3M05A 5DG8A 4L72B 5LMNJ 2PT0A 5THWA 1XK8A 1IBCB 3GIIA 1SJ1A 1D1UA 4DV0J 4JV5F 1NBEB 2CQ4A 2XY6A 3GV8B 3J7AN 1OJ4A 4PWWA 5IT9Y 3CT9A 4ITSA 1RK8A 5C42A 2Y1LB 5KFGA 1UA1A 3TX8A 1TK8A 4DQIA 1YJRA 4F02A 5KT4A 1ZBTA 2AQ4A 3MR5A 2J6TA 1EKSA 3NLCA 4RX6A 5KOXA 3MM5B 1S9FA 4Y34A 1JLBA 3QGGA 2AJFE 3R7NB 3EE3A 2FGCA 4PG4A 1RAHB 3FFIB 4KKOB 2LVWA 2AD9A 1OPIA 2F8EX 2ZHBA 1IKWB 4CLSA 2KZMA 3MEDA 4GVLA 2BR0A 3MEGA 4HT5A 1TKZA 4A8XA 3D54A 2AKWB 2YNGB 2FVQA 4HI2A 4OJGA 3LALA 2E44A 1XMOF 2V50A 2DITA 3RR8A 1TK0A 3T9ZA 4K59A 1SUQB 2W4PA 3JQJA 4OMFG 3OL8A 1XNRJ 2BJ8A 3D7SB 3HZEA 2AGOA 3B82A 2HFZA 1RAEB 1S1XB 2M3DA 4ZP8A 5KFHA 2HGMA 2N7YA 5CAAA 1S77D 3TVZA 4K4SA 1CG2A 4DQPA 2LXFA 4I6AA 3JTPA 2ZBPA 3CCUS 3G6XA 4YR3A 4X4OA 9RUBA 2V9WA 2CNKB 2VBYA 4J9QA 4OX9F 5K14A 4GRSA 1NHVA 1HNZJ 2X3DA 2HGLA 2HAFA 2N4CA 2VIHA 4CLKA 2LMIA 4Q0BA 4YEAA 2D69A 3K59A 2VF3A 3NS7B 5AXKA 3QT7A 3KJVB 1VQ6S 1K1SA 1F2GA 1EETA 2AYEA 3SQGA 4CLUA 2ZFHA 2XZWA 4C9DA 3HSJA 4WZQA 2JL9A 4PUOA 1VCTA 4ZHRB 3CMQA 3ZZPA 4CZCA 5HMXA 4DV5J 2IC3A 5H9EK 3M6VA 3MXHP 2NLWA 4L3NA 2VBXA 1DQAA 2FIUA 2Y1RI 2BQUA 4QWCA 5KFPA 3FQKA 1HR0F 1UETA 2HZAA 3BSNA 4DR1F 2V34A 2EK6A 1U0SA 2HHSA 1EB0A 2GQCA 1UAWA 2WVCA 5D0RA 1FK9B 3T5JA 1RYRA 1B3TA 2OH2A 1CQMA 1M1KT 3MCMA 2YNHB 2ZE2B 2XNRA 3PR5B 4NLVA 3BO4A 4LVNP 2BJ9A 5JMNA 1RXOB 3FBCA 1CJTB 2EC0A 3PYFA 3OT9A 2VL1A 1HNIA 4OZNA 2UUAJ 3MPUB 3TX0A 1CC7A 3V4MA 2FYXA 1KLMB 2V94A 4QU6A 3QZ7A 1YRTA 4M5HA 1MN7A 1JIHA 3KLFA 2DTJA 5I42B 4JI2F 4IKAA 4LF8F 1N36J 4QU7A 2MKSA 3CCRS 3VZHA 1N5QA 5HK4A 5ETSA 2L08A 3MMAB 1EARA 3JAMU 3QSIA 2R7VA 2V8DA 1N88A 3G6YA 5F8MA 1FRKA 3M32A 5J1EA 3CJ5A 3MAQA 2B56A 3ZTQA 5HROB 1DAXA 1RAIB 3GPAA 3K5PA 4TKTA 4AQYJ 2CFXA 1IJFB 4K2JA 4YDDB 1VQLS 3MM8B 4DPTA 2EC2A 2R8IA 4P7TA 1S10A 2FY1A 1JLAA 4IOBA 2VPWB 3ENQA 3BO3A 3M8PB 5AE2A 2DJWA 4LSLB 5LXRA 2B5JB 2NSBA 3UDCA 3P4UB 1IR1A 1RJJA 3JSBA 3L7PA 1K9MT 2RUGA 2HBQB 2GAGC 2IBOA 4CRJA 8RUCA 3HKWA 1T9XA 3BSAA 3C46A 1MLAA 2LXIA 3AB4B 1FJEB 4CM0A 5C2CA 1U6BA 2D9OA 3F44A 4NLTA 1FFGB 1RISA 4ZPVR 3PFEA 4RNNA 3KFWX 2FJEB 3AY0A 2OPSB 4F0MA 5CHCB 5K8PA 1EIYB 4NCGB 3T5KA 2V0NA 3C3LA 2R7SA 4ZVTB 4IRDA 3CD7A 1U2FA 5J2MA 1WOPA 3G8QA 2HVHA 4DX5A 5DO2A 1H3DA 1G6BA 2EW9A 5IT9U 1KQFB 2K7JA 1Q7LB 2VH7A 1YK9A 3OQ2A 3MEKA 4J9MA 1FX2A 1VRTA 1RB0A 2GIRA 3K5OA 4CLYA 4B02A 3TEHB 4IR9A 1G7CB 2I9SA 2YQ0A 2C2NA 3N0VA 1WC0A 3H4BA 5EWGA 4LBPA 4ZK7M 2RDDA 4ECZA 2CPDA 3VTIA 4JP8A 5J2PA 1O51A 1TMMA 5KG2A 1N32J 3I87A 4IFVB 4LT6A 5B0CA 4YS2A 1F5CA 3GCXP 2CA9A 2Z2ZA 3PG9A 1PJ6A 4EBDA 2GJ2A 2UUBF 1LXJA 1NKBA 3JS9A 2Q6CA 3DRPA 1HNVA 4I2QB 1HQ2A 4WP8A 5F8HA 2VC1A 2MKYA 4C6AA 3KOAA 5KFKA 2DH7A 1W2IA 1S1VB 2Y9HA 3NG8A 4RW7B 2VFSA 4IOCQ 1IBLJ 2V4JA 1GMWA 2U2FA 3DRRB 3GYXB 4ED6A 3HD1A 3B78A 3I9ZA 1FA0A 3FBBA 4NXNF 1FHTA 3IGNA 3DLLQ 4DZDA 2VPXB 3R6LB 2HKEA 2CPIA 3H2VE 2QSWA 1ZS6A 2RQMA 1S9EB 3B6BA 3U1MA 5LL6d 4DDFA 2DHXA 1KDNA 3L7UA 5CH7B 3W9IA 4P72A 4WXWA 2A1BA 5LSRA 1ZM4A 1VLYA 3IBFB 4LQ3A 1HBOA 5K20B 3T6JA 2DEIA 2X51A 4ZVEA 5AXMA 4USKA 3TUIC 1ULRA 3BH7B 4P2XA 4F25A 2C3OA 4J9PA 1KRPA 1S0OA 1C1BA 4W92B 3R3TA 2QLXA 2GVZB 3M2RB 3CSKA 4NLOA 4C8OA 5KFRA 1U02A 4F26A 3CXCR 4TYBA 2VG5B 2RDIA 3MD1A 4QW9A 1VQ9S 5KFJA 2FZCB 1FX4A 4DV4J 2WVEA 3FJ2A 1TAUA 3I31A 4J37A 1T05A 4RBTA 3ET6A 3SSRA 3FDSA 3HD2A 5AE3A 2CPFA 4TLRA 1WHYA 4FKXA 1PO6A 1RCOB 2MZTA 4DF8A 5GAHI 3NGTA 2HQ3A 4K4YA 2GW8A 3BJYA 4PR6A 3O5TB 3D1OA 4WP3A 3KMQA 1S49A 4AFFA 1VQOS 1VC6A 4LF7J 4AXJA 2A10A 2ZHOA 3Q83A 1WG1A 4O3NA 2BRKA 2EG1A 1K0TA 5L9XA 2XNQA 3PYGA 2CPZA 2DEJA 4X62J 1NJZA 3ZZZA 3OTOF 2DVIA 2IDLA 1IWAA 3PV8A 4QIWD 5HBMB 4P2SA 1KFSA 2AV5A 4Z7YA 1S1WB 4KC5A 1OWXA 3KUGA 4NMXA 2KDOA 1RI7A 4PWUA 4X4PA 2E1AA 4C98A 2AZ1A 3LPEA 1Z2ZA 2FVCA 2VDIA 1F9FA 3C2PA 2KG0A 2ZVIA 4OFZA 5E7OB 4YHHJ 1FFWB 4JI8J 2KFZA 5E3AA 1MNEA 5KFQA 1QAJA 5LXYA 1MU2B 4RBVA 2VODA 1P8GA 1FFSB 4LRAA 1FJGF 1VQKS 2CZVC 5A8RB 4U7CA 2VG6A 1RTDB 2FLLA 4EZ6A 4B9NA 2YKPA 3TUZC 3LP0A 3OFHA 3LAMA 2H3EB 2R8GA 2B4UA 2RIJA 2YWKA 2HQIA 4LSNA 2B6AB 2M52A 2NUUG 1M5VC 4C3KA 3SI8A 1S57A 3M1VA 1RT1A 2UV8G 1YBTA 1P27B 1Q79A 1N6QB 5GAGI 2DIVA 5DDPC 1WD6A 3OXLA 3ILLA 3OSPA 3HT0A 4L74A 2HWHA 3SMZA 4RNFA 1T03B 3DRSA 3HHKA 3H2UB 4Y6IA 2NREA 3GIJA 2ADCA 1PBUA 5F8GA 4USUA 1D9AA 2HRUA 4YUDA 1CJVB 2ACYA 4M8LA 4DUYF 2YKMB 5D4NA 1X4GA 4RW4A 1FJ7A 5KFXA 2WOMB 2BJEA 3QWUA 2V9KA 4ES1A 1K44A 2EFPA 5AT1B 2WVDA 2W7PA 4JI3F 3I6PA 1RYSA 1O8BA 3RB4A 2WVBA 1ITPA 3KXDA 5GAEI 5F3ZA 2Y1JA 4QIEA 4M5GA 4UY85 3QO9B 3U7JA 1OY6A 1RT4B 3PNIA 3UVJB 4USMA 1B0VA 2ZH1A 5KAKA 5KFVA 4MFBA 3UD5A 4ETZA 2OD4A 3AHPA 3MECA 3VAGA 3TJ8A 3CO9A 4YR0A 1TTHB 3OJSA 2F7VA 1GXLA 3MM7A 3PW7A 2JHEA 4TVAB 2JC1A 5HL7Q 2BRLA 2ROEA 1J2VA 4O23A 1YJNS 3HVTB 1N5SA 3JSMA 3M8QB 4DZ6A 1EHWA 1NXIA 4WP9A 3HO1A 1IBKF 2UXBF 2XHWA 3LPYA 4F4WA 1KEKA 2ZKUA 4LFCJ 1SVDA 2VKRA 3UO0A 4G1IA 1XJWB 2PMHA 3GIRA 4JI7J 3K8WA 1YZ6A 2YQ3A 3EVOA 3P8BB 1CSJA 3DNCA 3E3XA 2Z2LA 1XNQF 4B3RJ 1H73A 2XBPA 2R7OA 1OQ6A 1SC6A 1GT8A 1Y9OA 1FEHA 2XO7A 4QZVB 1HWLA 2IYGA 4DX6A 4GC7A 2IBKA 3H8YA 4FF3A 2HQDA 1SKSA 3N28A 1NO8A 1FXLA 1SB6A 2CG4A 5F8JA 5LMUJ 2OPRB 1Z1ZA 3CJTA 3HHDA 4LRBA 1F3FA 5D4OA 2J0XA 3ICLA 4PZVA 5C24A 3N5BA 2K1RB 4FYXB 2R8HA 2ZNYA 2VOOA 1SL2A 3G82A 4KV8B 4RW9A 3Q24A 4OYIA 1UPPA 3IGVA 3OUYA 2L41A 5EGYA 2D3OR 1PG5B 4ICLA 5BR8J 3L9ZA 3MEEA 3OVBA 2HQCA 3WX4A 4I7FB 1RT7A 4CCHA 3NRBA 2OGUA 2R4FA 2KO1A 3D4JA 1ZZFA 2C2MB 1UWAA 2H9ZA 2G2YA 4KHMA 5H9EJ 1D09B 4ZP9A 2M8HA 4H4OA 2RKIA 1H98A 4KGVB 2ALYB 3CULA 4IRKA 2WONA 1JLEA 2AEJA 1ZZNA 2ABYA 2VUGA 1VQ5S 1X31C 4IFYB 1S6QB 3N6NA 1IKVA 1GTHA 1HD0A 4ETXA 1FJCA 3IXQA 3CC7S 1N5VA 3PKMA 5KFWA 2XS5A 3OBIA 4IRCA 3C19A 3GR1A 1ZYQA 2PI4A 1X0FA 2GS8A 2CJ9A 3EMTA 2HHUA 1REVB 3BGRA 2DRAA 1U1NA 2ZJRQ 4DBQA 2QX0A 1P1TA 5HMYA 2QYGA 1S76D 4K4UA 4DV0F 1AZSB 2RH3A 2HS4A 2FHKA 4YDXA 1HQEA 2CQ3A 5F9NA 3LP1B 5IV4A 2I6WA 4IYQA 1UMJA 3TRGA 1IN0A 3R5CA 5FD1A 4X4UA 5CYQA 1HIYA 4U96A 3PXGa 1SCJB 2IJFA 5A6PA 1CULA 3CJKA 2X7IA 2IIHA 4LF6J 2V63A 3KHRA 1IM6A 4F2SA 5HSPA 1S1UB 1NKEA 2ZH4A 1G1XA 3FUYA 3C6UA 2CJAA 3DLHA 1WHXA 2AP6A 1AYEA 1HMVA 2KXFA 4WTYA 1HI1A 3DOKA 3TVYA 4KYZA 5A8WA 4EI2A 3MDFA 5EWEA 2QL7B 2HPUA 4QIVA 1U2RA 1BQNA 2J0QD 5F0UA 2ZC3A 5GADI 1R8PA 2BM1A 1CJKA 2KM8B 1XNRF 2W2QP 3UNGC 1S6PB 3O8WA 4FPRA 5IC4B 2MQ8A 2LDIA 4HTJA 2XI3A 3DLGA 3QSYB 5KG0A 5C2GA 2ILYA 3MZIA 3W60A 2DR6A 2V8HA 5GAHU 2J9DA 1RSCA 1VQYA 4YOEA 3UN5A 4OX7A 2DXFA 4M5NA 2HIYA 2KRRA 1GAOA 1JLCA 4MKYA 3CEDA 1HNZF 5E3RA 4OZJA 3KK1B 5KFBA 3D9BA 4LFAJ 4CYUB 2NQPA 1IKXA 4I4BA 2UXCF 1JLBB 3K57A 1SKUB 1X7VA 3CJ2A 3KHGA 1U7LA 2KFYA 1DBDA 3H40A 2XC9A 2UVRA 1MG7A 1DLOB 3HVRA 3QJJA 2V8PA 2BUNA 4L73A 4WXOA 4BC7A 2HWIA 4A48A 1E6VB 3PYEA 1Y00A 1RKIA 1VS3A 3D3CJ 1FNOA 1T3NA 1JB0C 2V68A 2W8KA 1VQ8S 4IDKB 2OO4A 4DV5F 1T8EA 1RKJA 4F3QA 4H4MB 2ZH7A 5B0EA 4HVZA 4KBIA 4OL8A 3JTOA 3W5XA 2B4VA 3KNGA 3HPOA 1HARA 3JYTA 2GHPA 1NPRA 1FXRA 1FTRA 3QJPA 3DXSX 3G2XA 3CDAA 3IFEA 3QT5A 2CG8A 4CWBA 5HLFB 2A0FB 1U26A 1M1HA 4X4NA 3J7ZT 3OTDA 4MTPA 3V6KA 3BN7A 5B0AA 2R2SA 4NZ0A 2HMIB 3M8ZA 2B7BB 4QR1A 3BGFA 3P49B 3VAFA 4P73A 3HT3A 3LUYA 3GTYX 4DR7J 3HSDA 2AEFA 4LSZB 4R0EA 4LRCA 3QNWB 5J2QB 3JTNA 3C14A 4FNIA 1U6ZA 1KVJA 5GAGU 1U1LA 3K89A 4P6QA 2D41A 4LVOP 2COLA 2F4FA 4ERDA 3V6JA 4LREA 4ILRA 2YNIB 5FDLB 2KKHA 2O67A 2K06A 4UTGA 4PUOB 3DOMB 2FD2A 2PA8D 3QIPA 2ATCB 1P9QC 2QO3A 1JLQA 5D3GA 2BE2B 3MM9B 1PAUB 1LK5A 2J7UA 4WFZA 4I68A 3NAHA 5GVQA 4DL7A 1VRUA 2OPQA 1Q81T 4TNOA 2VBZA 3W61A 1BWEA 3NNCA 3PEHA 2DD8S 3DMJA 4AQYF 5E2QA 5GAEU 5HMWA 4CLWA 2XM3A 3RU0A 2W9BA 3A8EA 5A76A 2VDHA 3MR7A 2BE7D 4XAKA 3N79A 1VC5A 4ED5A 2AW0A 1HNWJ 2DNKA 2V2ZA 1KTQA 3PRBA 4LF2A 2CQPA 4OYAA 3OXGA 2MQLA 4NCBA 2J0SD 3TA2A 3DM2B 2R3VA 1ACMB 1D9FA 2KL8A 4QR0A 5DDOC 2GIFA 1U0HB 2LQJA 2H5IB 4YMEA 1PCAA 4HKQA 2G13A 2YX1A 4RL1A 3OL7A 2GQQA 4BS2A 2RF2A 3I0RA 1JNRB 1UTAA 1RWPB 4QWBA 3ZZUA 5IOLA 2EVZA 4RNOA 3ZTOA 4P2FA 3PX0A 2CQ2A 3IWLA 2PGCA 2QEXS 4KTQA 4IH6A 2JLGA 1RTHB 3BPDA 1QJHA 2VBWA 3KG4A 2KRBA 3PRDA 3GIKA 2E66A 4K4VA 1G4CA 4ZLNA 2ZJPQ 4QYZK 2CQIA 3GZ7A 3Q8VA 3CDUA 2W7OA 1YJWS 4DHVA 3KLEB 2CVEA 2FB0A 2KXNB 4Z37A 2FHMA 3GILA 3SCJE 2CZ4A 4EZ9A 3DC2A 4KFBB 5B7WA 4CLTA 1U1PA 4TY8B 2JVOA 2PDAA 4OHXA 2BOPA 2HS0A 2NXCA 3F41A 2W2MP 2DR9A 2DY1A 3LANA 1V5VA 1DFDA 3BR9A 1Q1KA 1TV6A 5DQGA 1VJWA 1A9NB 1FDBA 3K58A 2DNOA 3EVWA 1KOHA 2DIUA 3BGLA 3Q2TC 2WW4A 2O3DA 4DJBA 5CCMA 1T02A 4R5PA 3M8WA 1NK8A 1DTQA 3LP2B 1N32F 1JXEA 3PEJA 4YP3A 1DQ9A 4NI2B 1N8RT 2Z8QA 1JLFB 3UW1A 5J1NA 2OPPA 1K8AT 3ISZA 1PKUA 2MZJA 3RBEA 1HYSB 3CCZA 3KLHB 4OX8A 4ZA1A 2FPHX 5F8IA 3CVKA 2GJFA 3GJRB 4DSLA 2QG9B 3V6DA 2EWHA 2YWWA 3OTBA 1RZMA 2CKWA 1HHQA 4ID8A 4F36A 3G8SA 1FWKA 2DH9A 2XGQA 2BEFA 1B64A 3TA0A 4C2MA 3FBEA 3OTEA 4TQSA 2OEKA 4AUKA 4TQRA 4FXVA 2DGOA 4ZP6A 4DV3J 5AXLA 4P74A 4DL4A 1ZM2A 1Y4ZB 1RA6A 3H42A 1FERA 1JKHA 4PQUA 2FZGB 3CE8A 2F8MA 1TMJA 3TZWA 2P6SA 3Q86A 4BC9A 3I82A 2OLWA 2HK2A 2R7XA 4OJ3A 4RLEA 4N7TA 1LW0A 2W1BA 4EBCA 4DR3J 4PQAA 3RUBL 4J90A 5M2PA 3ZTPA 3I5CA 2YX7A 1KKHA 3V5RA 1WEZA 1MROA 4ECRA 1NDCA 1URRA 2CDQA 3BPSP 4OIXA 2JEFA 3A12A 2ZUGA 4KPYA 3CCJS 4DV4F 1RBLA 1JJHA 3MHYA 1UVIA 1IR0A 2HNZB 1NDKA 2GHWA 1ZA2B 1Y3KA 2AGQA 4ED2A 1NJIT 4OI3A 1KONA 1VI7A 2VV5A 3C16A 3DLEB 5ETQA 3CMAS 5GADU 2RU3A 4ECTA 4Y2AA 3KJNB 1SJFA 4ELUA 1N4LA 3GJTB 4K4WA 2DGXA 4FPIA 1UEKA 4ZCIA 2BE9B 2MHEA 2FHJA 4DPXA 2KJWA 4L75A 4DSFA 2AWZA 2VOPA 4DPUA 2RJZA 3JXOA 2W9CA 3IA0A 2K8GA 4LF7F 3GIMA 2SXLA 3FZBA 4C0BA 3L7OA 1RT6A 1NH8A 4QPXA 2C2EA 4DMZA 2GFFA 2HNDB 2RHSB 1V3ZA 4X62F 4NX9A 5I3UA 1Y5IB 3TARA 3RJMB 2JEIA 2B51A 2EFGA 1WELA 1A6LA 3G87A 1ZAVA 4EYHB 1ROFA 5HMZA 1FDAA 1NRKA 1RT2B 3HHNB 3PRVA 2EKYA 4U8YA 1WOOA 2CJYB 2BVZA 3M6WA 4YB7A 2BANB 2XMVA 2MKCA 3KLGA 3A3PB 3IS9A 3RBZA 1S79A 2HFNA 3CPWR 3HHLD 2Y3YA 4JB8B 1VGYA 2EK1A 2IRUA 4YHHF 4EK2A 1S6UA 5BYQA 3KLIA 3D1HA 5HO4A 3DLBA 1WSVA 3EZ5A 3AAWB 1LW2B 3ZNJ1 3ENVA 3I4HX 1RWNB 1SC3B 4MH8A 2PE8A 4NXMJ 2CDRB 3FCVA 1N0VC 2IM1A 1GNKA 5BXIA 1R0BG 2Z2MA 3CC2S 1OMSA 6FD1A 1KC8T 3T3FA 2C2DA 3H98A 3MGJA 1NK7A 2FC9A 2AU0A 2ZH5A 3CO0P 2IA6A 3IR7B 4PKDB 4OQJA 1SQFA 3MI7X 4JI5J 4X64J 2WTFA 4ECXA 1K0VA 3IWNC 2ROPA 3EICA 1MMNA 2OFGX 4CTAB 3VGVA 4O44A 4FDFA 4AXIA 4RZRA 3PKYA 1N56A 4RJVA 1WHWA 1UVKA 2QT7A 9ATCB 1IUJA 2XMJA 3ZTRA 2DISA 4HTIA 5ETLA 1N48A 1DQ8A 3MMCB 4O4GB 3VAIA 1WKLA 2XYHB 2YWGA 2KTQA 2FVPA 3A1YG 4F4YA 2NSCA 5HVHA 5HP1A 3MPDA 3B4MA 3C15B 2R8JA 2DCLA 1KS2A 3W2WB 1RAJA 3ETMA 3G9CA 2LLZA 2HWTA 2E9TA 3QYYA 4WFAQ 2LKZA 1RLDA 3MR6A 1T9YA 3DLKA 3FMWA 3BM7A 3MAAB 3OFFA 4ZP7A 2MSTA 3NNHA 1I6JA 2YNFB 1UFKA 4RW8B 3D6TB 2ZUAA 5HN0A 2ZEJA 4UQGA 2QL9B 4I67A 2CPJA 4IH5A 2DNYA 4A46A 4B3OA 5C25B 3EZOA 5EHHA 2R8KA 4JV1A 4YB5A 1M5SA 3PO4A 2GGPA 4PAAA 3GLJA 3H25A 4WE1A 1YI2S 5IC6B 3FEYB 3BQ2A 1L3SA 1SJ4P 5CCLA 3CTRA 1CJUA 2IAJA 4DFPA 2AEMA 4ZITA 1Q53A 4USJC 4PWDB 4ECWA 4E2FB 1HBMA 4HT7A 3PJXA 1TP7A 2OTLS 2L48A 1BE4A 3KHHA 2IM2A 4JI7F 2FGOA 1RHRB 1RWWB 3MWBA 4DWIA 3CJ8A 2D74B 3H90A 5D78A 3IO1A 2FJAB 3PYDA 5B0BA 3CJSA 4B3RF 4FXDA 3OHBA 5KT5A 2Y8YA 1FT8A 2AYMA 3TZZA 2MQQA 2HQGA 2H51B 2DNPA 5I3PA 2FVSA 1HFEL 5LMUF 4ED0A 2VJUA 5EX0A 1HI0P 1S6OA 2B4PA 4DR4J 4PCQA 1U1QA 1O5JA 2JVRA 2JEGA 5KTQA 3JSMB 2J0WA 3QQCD 3ZZRA 3QZ8A 2OELA 2APOA 2Q43A 1YVFA 3RBDA 3QJLA 3IM9A 1T9TA 4K4ZA 2B4OA 4DL5A 4KGXB 1PYOB 3RAQA 4HHHA 2BACA 2R2UA 2K3KA 2JOQA 3RYLA 1R0AA 1SV5A 1N5YB 3OPKA 3GQCA 2XQCA 5D0HA 2CIMA 1MMDA 5LT5A 1FKPA 5JJBA 3WZ0A 1PAEX 1S9GA 3MMBB 2YH1A 4WZMA 4LRFA 2RD5C 1RACB 3M2VA 1C0UB 2EFOA 1QSLA 2BMBA 1MMLA 2ZD1B 1TKXB 4K2XA 2O1PA 1DJ0A 1UJ6A 1VQNS 2HVEA 3KUEA 2KJVA 1O6XA 1RCXB 4KSEB 1W7WA 2K7KA 5G4DA 4NLQA 2F1FA 4DQSA 3FZ2A 3BGOP 3QAUA 2PSZA 4B17A 1SH0A 2N4DA 2W2NP 3BBBA 3Q89A 2R7UA 2CJKA 3P45B 1TKDA 2GV1A 5KOWA 3PO5A 1SKWA 4EUVA 3BF4A 2UP1A 3R1LA 2JFDA 4RPFA 2MQPA 2WRMA 4OZ3A 4FYDA 4BWJA 3K8VA 4ZCMA 3UFCX 3VVUA 3H7HB 3G8TA 1Q8LA 2NCKL 3HHLC 3IN5A 3BH6B 3S01A 1S7IA 1WHVA 4JV0A 2QN6B 3LAKA 2B3TB 5IQ6A 3QWPA 3WC0A 1FNXH 3VF0B 2QLWA 4O3OA 1B0TA 2BKPA 1WORA 3NMAA 3QRRA 3RAXA 1I5OB 3TAQA 4OYBA 4ZJQA 1LKZA 2ZH6A 2P5VA 5G0RB 3MM5A 4X2BA 3MPWA 3KJQB 4DSIA 2YBVA 4JI1J 1SJQA 3FFIA 1LOUA 4KKOA 2VG7B 4NZ6A 3GYNA 4M5DA 1IKWA 5B0FA 1WC6A 4HDHA 1X4FA 5CYMB 4NA3A 4ANDA 1Y10A 2YNGA 3KG1A 2GMHA 1VDHA 3ZNUA 4LF1A 2FDNA 4ID5B 1SUQA 4NASA 1FTCA 4KH0B 1WSRA 4OI0A 1HQEB 1FDDA 3HM9A 4OI2A 1S1XA 4FXWA 3VQSA 4ZVHA 4KAIA 1J27A 1X8DA 2OI2A 4ZN3A 3W5ZA 4DCPB 4RR5A 2MEWA 3VCDA 2CADA 2DT9A 4LFAF 3DHWC 1RWOB 3W64A 2KT5A 2CXEA 4A8KA 5L8RC 5IV3A 2G0JA 4ANCA 2PI5A 2C2OB 3FNNA 3CNQP 3W62A 3U27A 4IO1A 1FDNA 2LQ9A 4QYZJ 3RAMA 1GMUA 3CJRA 2OMLA 4DV2J 2NPIA 5F8LA 3G86A 2W2PP 3FKBA 1NSPA 1GTEA 2I5JB 4EBEA 3KJVA 2AX0A 3TR5A 4FBUA 3PACA 3UN2A 2I2YA 4QCLA 2WZ1A 3Q23A 2GAHC 4NMLA 2H65B 2IM0A 2F63A 4A4JA 3KJFB 2H4WB 4ES3A 4P71A 2J8AA 3DU6A 4Y2MA 2DHGA 4PXEA 4ILMA 1E6YB 5D6GA 3AQOA 2AIRB 2B7CB 3S6EA 2XMWA 1HNXF 4CH0S 5KFZA 1F9HA 2XMUA 1SBRA 5DQIA 1RAOA 1S48A 4MAKA 3H20A 1ZPWX 2A2DA 3W8GA 4OZ0A 2EBEA 4Q8FA 1FK9A 3GJSB 1T11A 4MKAA 4R8UB 3CIMA 2M88A 4DR7F 1QAYA 3SXLA 2GC8A 2ZBQA 2VA2A 2YNHA 2ZE2A 5KFEA 3FSYA 1TL5A 4LR9A 2BQ3A 3ZZTA 3H59A 4FYVB 2CPXA 5L38A 4DUTA 2ASYA 1QVGR 2J6SA 1CJTA 1X60A 1UVNA 1XR6A 2WSFC 4ZVGA 2DGWA 2XGPA 4PRFA 1F1BB 3NS6A 4QW8A 2V2VA 1KLMA 4DUZJ 2GZOA 2LDYA 3DYAB 2YXLA 3ZZYA 5J2NB 2VFUA 1NU4A 2ALZA 3NL0A 5CD4H 4LF5F 1VBYA 3NCQA 1FRJA 3KNAA 1OY8A 2KVIA 1T7PA 5AE1A 4PG7A 1FNMA 2YKAA 5FIIA 2A6MA 2KT3A 3MMAA 3C6TB 4NYZA 2YWHA 4ECYA 4LRDA 1HBNB 4Q44A 3ILJA 1GMWD 4RO0A 4NLDA 5HROA 2IVFB 2C42A 4FKYA 2EG2A 1Q16B 1UW4A 8ATCB 2QLJB 2BM0A 1DHMA 4HACB 4GKKJ 2OIHA 4NL5A 4LF9J 2FJWA 1HNWF 1JLGB 3HX9A 2OAUA 3ZFVA 2MJUA 2OFHX 5SZTA 3K17A 4ED7A 4ZPWR 3MM8A 3Q8YA 3NGRA 4FF4A 1VQSA 4DSEA 1V3RA 1YIJS 3PW2A 3OVSA 1RWVB 1RTIB 3M8PA 1GFWB 3M2UB 3NBPB 2J9CA 1HBUB 3BKTA 2B5JA 1VQ4S 3IRXB 2E1PA 1RE1B 3UQSA 1VJQA 4YQWA 2D3ZA 1UVMA 4PYAA 4QR2A 2R7TA 2DO0A 3GG0A 4JI2J 4LF8J 3VAHA 4D3HA 3NWGA 4RNHA 4IH7A 2NXNA 5HJXA 3G6ES 1AA1B 2YPYA 3BR8A 1L5UA 2E7WA 3QGIA 1TL1B 4DR2F 2G0CA 4C48A 4DV1J 2BQRA 3A4TA 3U1LA 2UVVA 3Q22A 1S4EA 1NJYA 1UWBB 3BDEA 2E1MC 3MTJA 3LWMA 2RILA 1B7FA 1KP6A 3UCGA 1U24A 2F65A 2VASA 2HBZB 1RQ0A 4WIQA 3DOLB 3D68A 2OPSA 4C8MA 1K73T 2XMMA 4WFYA 5F9LA 1HPZB 4F67A 4NCGA 4F0HA 1WF1A 2DGQA 1VLOA 1WG4A 4UZCA 3W5YA 1IQTA 1TU0B 4H4KA 2VC0A 5K8NA 4RUHA 3T1HJ 4O0IA 1UA0A 2EPIA 4DS5A 4CO1A 5ETVA 4CT9A 3MCSA 2CVIA 4OZ1A 1ZAWA 3K5MA 1QE1B 5IM0B 3GU0A 1YBUA 3WIVA 2QSFA 1XWLA 2D1CA 4O4RA 2WW8A 1C1CB 5KG5A 2HHWA 5K8MA 3BEGB 2BKNA 4F4KA 2ASDA 1B99A 1NSKL 1WC3A 5IQQA 1NSQA 2E5HA 3CDEA 2MZQA 3TUJC 4LIWA 3QLHB 1FKOB 4IFVA 3AH6A 3IG1B 2CPYA 2V2KA 1RADB 3GMGA 2E1CA 3NWRA 3AJ2A 1H74A 5ETTA 2UXDJ 5IT0A 1IR2A 4O3SA 4I2QA 3CMES 2JEJA 4U67Q 2QLBB 3K0JA 3FRZA 2F9JA 3MCOA 3AT1B 2UU9J 2O66A 1S1VA 2UUWA 3D6FB 4RW7A 4TU8A 2FLOA 5HANA 3P6YC 2CPHA 2P9CA 3POTB 4MYUA 1AUDA 1SH3A 5AJ3F 5ETRA 1TK5A 3DRRA 4F4AA 2XZDB 5A2QY 4EO6A 2JH3A 4DV3F 2XEXA 4I2PB 2YY3A 1C0TB 3UWTA 4DS4A 3W9JA 2JDJA 3IR5B 4LFBJ 2PFDA 1S9EA 3BKUA 3MFIA 2JZ5A 4KO0B 4QWAA 4OYXA 5KFFA 1Q5YA 4DR3F 3UI3A 4RU2A 3EUNA 4JI4J 1S99A 2BYCA 1Q95G 1SL0A 4HI1A 4LBHA 4E98A 1HL6A 1UJ4A 1N5TA 2Z0GA 4USWA 4X4QA 1TKTB 2C3YA 2OKQA 2LP4A 4C8KA 2OMOA 4ZVUB 2PD1A 3NCRA 3AA8A 2GVZA 3TJ9A 2HHHJ 3M2RA 2MTLA 1KWMA 5EUHA 4F3OA 4F0KA 4C8ZA 1ZPVA 1IKYB 3CF5Q 2YKQA 5DZ7A 1GEHA 4G1QB 2LQ5A 1N33J 1UVJA 3T5HA 1LWCB 1RWKB 2VG5A 4N8NA 2V8GA 3S1TA 4NA2A 4A8OA 1QAIA 2W2OP 3GJQB 1XMQF 4X66J 4JI6J 2I1RA 3M9OB 4B3SJ 4HYKA 1R7IA 4J9LA 4CO5A 4GO5X 2ZHAA 1JJCB 2HVIA 3SEOA 3DU5A 3ILIA 4NEYA 4NZ7A 1G3OA 2MMYA 1BGXT 3IR6B 3KK2B 1MN9A 1ZAXA 3TVKA 1U4BA 4IG3B 4FF2A 2YTCA 1LWFB 3K5NA 1Q82T 4C11B 3KK3B 1KLNA 2QRRA 5EX3A 4GC6A 5A8KB 2E5LJ 2XS7A 2FTRA 1FVSA 1R8AA 3RZAA 4K50A 3FEXB 3PR4A 3TJAA 2GX8A 3R5AA 4Y28C 4IQMA 1JX4A 4LUBA 1Q4RA 5HBMA 3D0GE 1CEZA 4C0OC 2MXYA 1BQMB 4DQRA 1S1WA 5F0WA 2JC0A 1KTVA 1PIEA 2DCUB 4WFBQ 2HFVA 3CCLS 3EWGA 2LXUA 2MSSA 3X3UA 2I38A 2DB1A 3PW0A 3NGKA 3PFOA 3SDEB 1KOOA 2LU1A 5CQGA 4MYTA 3UN3A 4J9KA 4DG1B 1FE4A 2F4VJ 3PIOQ 2ATLA 1EX8A 4UF4A 1MU2A 1Z2LA 1SQEA 2XG8A 2BDPA 1N34J 6FDRA 2W25A 5A8RA 4JI5F 1RTDA 3GSIA 3GE9A 1U1KA 5AXNA 3M6UA 1TQLA 1U2CA 1RT3B 5T7LB 4TY9A 4FNHA 5ITHA 3ELHA 2R7WA 1UZHA 1F60B 2B6AA 4DQQA 1OSCA 2E9ZA 3UD4P 1KVKA 3AJDA 1N6QA 4ILLA 2ZJQQ 2RT3A 3R5JB 2GJIA 1WDDA 1NHKL 1T03A 1WEYA 6AT1B 3NS5A 3T1YJ 3F0NA 7FDRA 4M5MA 4CNYA 3T19A 3FMBA 4EFAC 5ETPA 1CJVA 2NYHA 4KPCA 2M70A 2YKMA 1FRIA 1AFJA 4ZPTR 2WOMA 1VHIA 1TVRB 3EYZA 1XN9A 2XSJB 3D3BJ 4Y00A 4ZJOA 2ZH2A 2ZH8A 4X4VA 2XZTB 4XO0A 4KT0C 1PYTA 4C0HA 1EP4B 4ED8A 2P2CB 3QO9A 4AD6A 1RT4A 1GXUA 3OD2A 3UVJA 5JVHQ 2OJ3A 3UDVA 4F50A 1M5HA 4E0DA 3EPIA 2G2ZA 2CJBA 2LA6A 3VGTA 2I0XA 2DNLA 1DTTB 3I0SB 4OYMA 2RB7A 5DZ6A 3ITHB 1X0PA 2AHOB 3NP5A 2GMLA 5CYJA 2K2PA 3HVTA 3TUPA 2OP5A 1VBXA 3M8QA 2HBYB 2Q1LA 2DRBA 4DU7A 2B9XA 2DGVA 2BV3A 3TAMB 2N3LA 4B9VA 2Z4PA 4NLSA 2HS3A 3AQPA 1S1TB 4JI3J 4KR0B 4XK8C 4ED1A 1ICEB 1APSA 4N76A 3QGPA 2CUYA 4M5IA 4G1PA 1TFYA 5CZXA 5A2QU 2WSEC 3ULHA 2EI5A 2GVDB 1RHMB 5KFOA 4E8UA 4EWTA 3MUTP 4I6WA 2IA0A 4DR4F 1YKWA 4URQU 1RT5B 3I5BA 1Q5VA 4C97A 2HIQA 2OPRA 2GGPB 4QYRA 5LSOA 4C4WA 2FJXA 1NZ8A 3O2IA 3HFKA 4CT8A 2FUG9 2K1RA 3RG6A 2DH8A 4HH0A 3V2UC 3W2VB 1S97A 3OR2B 2HFSA 2MY7A 3QFWA 4KV8A 1FO1A 2XTJP 1M0SA 2QA4S 3E51A 3C66A 4NCAA 2BKOA 4ZLLA 4ALZA 1NMEB 3N01A 1H38A 4PEOA 2MQMA 1U1OA 2KYXA 1LV5A 2XO6A 4B9TA 4L76A 4U6PA 3OR1B 4DSJA 1SJ3P 4I7FA 2AMCB 3P5BP 2VQFJ 4ZVQB 2HQFA 3G6VA 3PW5A 3J7YI 5DQHA 2J7WA 2CJQA 3M30B 4ZS6A 2YWEA 3OHAA 5HQ8A 2PFFB 4KH1B 1U1RA 1IVZA 4DR5F 1NZAA 3PZPA 1TL7B 4DX7A 3T9NA 5KG6A 2RRAA 3VAJA 4DFJA 4IO9Q 4IFYA 4MK9A 1S6QA 5C7PA 3MUMP 2ILZA 2KG1A 4I69A 3DDIA 2MKKA 1R6VA 3GWCA 5H1SV 2JJ4D 4JI0J 3CDBA 1Q7YT 5K5MA 2WK4A 4ED4A 1REVA 4ZPCA 1CVJA 3KTQA 4LJMA 4DOZA 2NXEA 2GO9A 5F3TA 4MMOA 1AZSA 3W1YC 1YJ7A 4M94A 1S7HA 3LP1A 2D3UA 3FBFA 3V81B 3M2VB 1LWEB 2HFOA 3DXBA 1OSDA 1YJVA 3W63A 4J91A 3M8SA 2X3GA 3TQEA 2V67A 3M8YA 3W9HA 2GMJA 3SBMA 1RTJB 3LWLA 2ZKTA 3KKFA 3CWJA 1FRLA 4JI1F 4WU3A 1XC9A 2HNYB 2DGUA 2AZ3A 1TAQA 2G2OA 1S1UA 5LM7E 3BKFA 5ADZA 2E29A 3Q8UA 4DX8H 3IBCB 5BYRA 1FRHA 1GK8A 1XR7A 5A0YB 4EU0A 1S0NA 3DI6B 2UVWA 2Q3PA 2VQEJ 1RBAA 5M2UA 2KFNA 2RRBA 1NCLA 4JUZA 4Z2XA 4FYWB 4YN3B 1H7WA 1L3TA 4GMKA 2JSXA 4HR2A 3OLAA 3QPIA 3CD5A 3HMJG 2MGZB 1S6PA 1X4BA 1C4AA 5JXSA 2MKJA 1F2HA 4P52A 2DR5A 3DGPB 1VBZA 1H0HB 4U8VA 5KG7A 2NZ4A 1J5OB 1U25A 4GVBB 3GSDA 4IR1A 1PSDA 3M9NB 3CUNA 3KK1A 2CAJA 4K0KF 3E01B 2FHOB 4CYUA 1ZTTA 4JBCA 2QC3A 2CQHA 4RW6B 1EQ0A 4M5DB 1Q78A 2XY5A 4OI4A 1R8BA 4DV2F 1DLOA 2EKNA 4LF4J 4RKUC 4DI6A 2IHR1 3UD3P 2ZWPA 4D3GA 3CCES 5I4MA 2Q79A 3OFGA 4UOGA 1NPPA 5JVGQ 3LGMA 1SIZA 1FD2A 1E6VA 3HHLB 3MFHA 3TI0A 2ZZTA 3CJQA 4XPCA 3JQMA 1WC4A 4IDKA 5T41A 2L3MA 4BBYA 4H4MA 5HQMA 3W66A 3WBZA 3NY0A 3QRQA 4Q8EA 4RBUA 4IG0B 2PN6A 1HWJA 1UFLA 4ZPAA 4DFKA 2XS2A 3IBWA 1GX6A 5HLFA 1EKRA 5L1IA 1CPZA 4KGKA 3MCNA 3P5TL 1VBKA 5LJ5Y 1F5BA 3VWSA 2AJ4A 1YJ9S 2HMIA 1M1GA 4WYWA 3V4IB 3I9V9 3MM6B 5LMNF 5IWAJ 5E41A 2HYIB 2UXCJ 2KN4A 4RWWA 1WNEA 3VGSA 5J2QA 1TL3B 5KFMA 4DUZF 2AYBA 4X65J 1GXTA 3VALA 2GA7A 2VA3A 2HFUA 2XWXA 4NPOA 2YNIA 5FDLA 2QFJA 3UCZP 3VAKA 2QMUB 3IC1A 3DOMA 2YKNB 4DPYA 1FRMA 1T9UA 1QSYA 2AYGA 1XR5A 2DPIA 2Y0BB 2BE2A 3MM9A 3PDNA 1UZDA 1VISA 1HQUB 1L3KA 4ZVPB 2ZM6J 2ZOGA 1WACA 1IBMJ 2DNRA 2N7CA 2Y8WA 1OYEA 2LFVA 4WIIA 2BW7A 4GKKF 2UV8A 3CJ4A 4DEZA 4LF9F 2KT2A 2B8PA 3UR3C 3O6QA 3EGNA 1BQXA 4CO3A 4J9SA 3N6MA 2V6AA 4OYOA 4I6YA 2B9WA 4CO2A 4JYAJ 1W25A 4B3TJ 2JRSA 5KFCA 1JMTA 1LFWA 1QAXA 3K5LA 3DM2A 2JLEA 3TWZA 5C42B 1HW9A 1NM2A 2HW3A 3RW6A 2VKZG 4Y2CA 2V69A 1U0HA 2XSFA 2RNEA 2QTWA 4KJIA 3A3NB 1X9SA 1S0MA 2NUHA 2ZITA 4WCEQ 4W98A 4CO0A 3US5A 3R7BB 4CLPA 2MQNA 3R5GA 3L95X 2RAQA 4MKBA 1M90T 2FLNA 4JV2A 3WC2A 3UDLA 4DV1F 3CB4A 4PXBA 1WTBA 3PHEA 3MEDB 3MEGB 1RTHA 1TKZB 3CGIA 2BJDA 2HBRB 5DGBA 5RUBA 2CQCA 3SYZA 2QJ3A 4Q2LA 4B3MJ 3KLEA 3IWXA 5D77A 3GV7B 1QSSA 4URGA 3P96A 3SCLE 4I1TA 4ATNA 1YJTA 1HD1A 1FXDA 2EEYA 4KFBA 1YTYA 2FHJD 4TY8A 4RUCA 3AODA 1JJ2R 1TUWA 1AROP 3HLUA 1C4CA 5ETNA 4OLOA 1V3SA 1DZ5A 4ER8A 1RAFB 3T1HF 2J9EA 1SXLA 1T94A 3M9MB 4NLRA 4XTTA 2O5DA 4MK7A 5K14B 1FWPA 1C2PA 3TQ1A 1DARA 1RUSA 1WJ9A 1RWXB 3J80Y 4N8OA 1XBWA 4Q0BB 3WHIA 1VYAA 1SC4B 3LP2A 1FKAF 1DY3A 2UUAF 2HHPA 2KH9A 3THPA 1S4FA 4NI2A 2DRDA 5HQLA 1JLFA 2NPFA 2A3JA 3F56A 2UXDF 1EETB 3SQGB 1HYSA 1NSAA 1YWXA 2OTJS 4ZIVA 3KLHA 3UPFA 1N36F 1MWYA 3J7YU 4FVMA 2GO8A 1CS4A 4DPWA 2K3IA 2UU9F 1X4EA 2BZ2A 2IC3B 4N47A 2XMAA 4B9LA 1SJRA 4XDCA 4CIOA 4J9RA 4EMDA 3R1HA 4K5SA 4WJBA 4O3QA 1MWQA 2V4RA 5HVGA 5D4LA 1NK0A 4LBIA 4B9UA 4H54A 1X5SA 1KVIA 1YQHA 2HK3A 3HZGA 4UOHA 3X1LB 2HSEB 3ZXWA 4LFBF 4C8YA 4HLBA 4DV6J 5L46A 2L9WA 1RHQB 2CPEA 2DXDA 4KHPJ 1FCAA 3Q0AA 1NK6A 4M5LA 3LH2S 1R89A 4JI4F 1HNIB 4N77A 1J5EJ 3T6BA 3RB0A 2R7QA 2XMTA 4AYBD 3IRWP 2KYZA 1CQNA 3KLFB 4DXLA 1KSPA 2KXHA 3VV2B 2HHHF 4U7UK 3HF5A 3AXKA 3QT6A 2IYIA 4P75A 5DDRC 4DCOB 1N33F 2CQBA 3GFHA 2MKIA 1P6TA 2DY9A 1B7YB 4BCAA 3TW0A 1H72C 2W8LA 2EXUA 3M32B 5J1EB 4X66F 2MZ1A 2QIFA 4JI6F 3BS9A 1KD1T 2HNZA 4B3SF 1IM4A 3MMJA 4DU8A 4WKYA 1UVLA 5KFUA 3DLEA 1WF0A 3KG0A 2BA9A 4CLFA 2EFVA 2EFQA 3T1AA 1WC5A 3VQTA 1JLAB 2IJNA 3MOZA 1O0PA 3PHTA 1R31A 3OLBA 3TA1A 3NGUA 3AJ1A 3A8IA 2GQ2A 3MPYA 2BJ3A 5KFNA 2E5LF 3T41A 1NLKL 4A47A 3BBFA 4OYWA 1WOSA 2HNDA 2AJQA 3OXFA 2W9AA 1VMBA 4NLPA 4C7QA 3SSQA 2R42A 4HHUA 2ZC4A 1X4DA 1HWIA 2QLFB 3BO2A 2Y1IA 2NXUA 3HSGA 2NZCA 1RT2A 3AOCA 3M6XA 4ZVOB 3D0IE 2BANA 2HEKA 3BB5A 4ES2A 5ETKA 3PJWA 1NK4A 3O1LA 4GKJJ 2G0IA 4QWDA 2XB2D 1PGZA 2KZZA 1FEEA 3N5FA 4ECVA 2F4VF 1LW2A 3FCWA 4RUAA 5J2MB 2RU9A 3CCTA 1IBLF 1FRXA 4F8RA 3H4DA 1N34F 2DHSA 2M0GB 2ZOMA 1JXLA 2HAIA 1P9YA 1U45A 4WF9Q 1VRTB 2NYIA 3R5DA 4O3PA 5KT3A 3SCIE 4FZVA 3PVXA 4EO8A 3AD7C 4FN5A 1VQMS 1NAQA 4CTAA 2MDAA 3W8PA 2XLIA 4MIBA 1Y11A 3DKDA 5J2PB 1QUVA 2WBRA 1MWZA 3H5YA 2F8HA 1EZZB 2BW2A 4LQ9A 2DKOB 4K8RA 1WG5A 3J7A1 3LGNA 3C8YA 3T1YF 4QJVA 1WKKA 4CP5A 4ECQA 3PY8A 3MMCA 3DRPB 4ZLPA 3PJ9A 1HNVB 5B0DA 4O4GA 3KHLA 1JXVA 4IUFA 2DHHA 1H2UX 2E5GA 1A0OB 2W01A 4PG8A 2DBBA 1H6KX 4O3RA 2XY7A 3C15A 2I8EA 1YBAA 3W2WA 1HI8A 2RMLA 4A8MP 4XPEA 3NAIA 4U9RA 4OI1A 2V4JB 4Q7AA 4ZJLA 3MAAA 1K1QA 1OY9A 2YNFA 3NCPA 4K7QA 2CWXA 1OQ3A 2H5EA 4RW8A 1PC4A 2XYGB 4ECUA 3RRKA 2VFRA 4DV7J 2FJBB 2UZAA 4M1KA 1XIQA 5KFYA 2QA2A 3N6LA 2RVJA 3H5UA 4K5RA 5C25A 1I51B 4KE5A 3J80U 3CJ0A 2BOAA 2XCPA 1KQSR 1B4SA 4KQZA 4UOFA 1HBOB 4XIUA 2VB6A 1VHFA 3WIUA 5E33A 2KVQE 1QY7A 3UCUP 4I0WA 4P9SA 2Z58B 3ENAA 4ZCLA 1C1BB 4WFNQ 3M8RA 4PXCA 4NRTA 1UCNA 2CJXB 4G65A 1ZA1B 4PWDA 3F73A 3JQKA 4N5SA 2UUTA 3O44A 4DLGA 1URNA 2VICA 2WB4A 2GNKA 1LEOA 3LTOA 2OSRA 3IP0A 4DFMA 1T05B 3A3OB 2RSQA 3ET6B 2DNZA 2P6TA 1Y7PA 1YX2A 1Q8IA 2J9DE 4WFXA 4DL6A 4CH1A 2MLYA 4JI8F 2VD3A 3ZZ0A 4JOUA 1XQIA 4O0NA 1T3OA 2XWYA 1IWGA 4UW2A 2E9RX 2WCXA 3I96A 3LO3A 4AT1B 4NLGA 1WTFA 2LA4A 2ZBRA 2F3JA 1GMVA 2B9YA 5A6WA 2DHAA 1TELA 2DXEA 2L9DA 3OJUA 4YY3J 2XLKA 2XHCA 3GB0A 3BREA 1NHUA 2ZOFA 5EWFA 1BMQB 2YH0A 4OZ5A 2Z56B 2ZDPA 2PMZD 2HVDA 1YDLA 4DCJB 1N5YA 1RA7A 1SKRA 2WAQD 2MLXA 2VQFF 4LMZA 2CNLB 3EX7B 1MSWD 3MMBA 1HWUA 3BQ0A 2WBMA 1FESA 3AXMA 5MAOA 4FBTA 5SUHA 1C0UA 4DL0C 2MLZA 3OSNA 3L3CA 2ZD1A 1TKXA 1R8CA 3DGVA 4KRWA 2A6OA 2HRTA 2GHVC 3UDEA 3EDRB 2YWFA 1VK3A 1V6HA 5D4PA 5D0GA 2LCWA 4NE9C 2F5GA 2MJNA 3IM8A 2RQKA 2ZH9A 3VAMA 5L1KA 4U7UD 2XCAA 2IM3A 1Y3JA 2LEPA 5JUMA 1U48A 3LF0A 2YKOA 3J81Y 2VG6B 4JI0F 2J6UA 2EBGA 2IVMA 3I56S 3LP0B 3EXYA 1UJ5A 4WWSA 1WF2A 2MYFA 4LR8A 5D15A 1V5IB 4LSNB 2H54B 2PMWA 3M1VB 1RT1B 2CQDA 4NRUA 1VK8A 1LWXA 1QUPA 3DRSB 4USVA 1QVFR 3RW7A 4F2RA 2E5IA 1RABB 2HHVA 4LFCF 2R2RA 1JJ4A 1TFWA 4RW4B 3KWMA 4W4MA 2AF6A 5G0RA 2FC8A 3ENWA 5MLCV 3H5SA 3EZUA 2B0GA 1I1GA 2C28A 2VPZB 5K9FA 3ZO7A 2VG7A 5L1JA 5LOQA 1A7GE 2MY8A 1XTZA 3FK4A 4ZCKA 2LU2A 2VQEF 5CYMA 3HJFA 2DPJA 5IXUA 1KR4A 1F0XA 4MFBB 1X4AA 2M4MA 1WC1A 4ZMMA 1JK9B 3W3SA 4ID5A 4ECSA 2C1EB 2QE5A 4CLZA 3MECB 1U49A 3MM7B 3RR7A 3NOGA 5L1LA 1EAYC 1RU2A 3LQVA 1NKCA 3Q8PB 2ZZNA 1HW8A 2GIQA 3ISND 5EN1A 2KB2A 2DK2A 1RGVA 1VIXA 1I94J 3D0HE 4UOCA 2AJ0A 1DRZA 3R27A 2ROGA 3NKYA 2D7SA 3MURP 4OYZA 1QM9A 1F3VA 1YRXA 4LIRA 4F3MA 4OZLA 3M7VA 2IMWP 3SV3A 5BR8F 3DHXA 2OEMA 2CQ1A 4LF4F 5KFIA 2C2RA 2JNJA 5H9FK 5EDWA 3CCWA 3AD8C 2DGTA 1LK7A 1M5OC 1IQZA 2UUCJ 1HWKA 4OV1A 8AT1B 3KDNA 3O3LA 2M9KA 4ZOSA 2I5JA 1M5PC 5IZHA 2QYCA 1BXNA 3EVMA 4P7VA 5HATA 4DL3A 1U8SA 2LQ8A 1TZ0A 2FY8A 3OW2R 3N4WA 4QPTA 4CH7A 1WDTA 1G2EA 4MK8A 4UUWA 3H2LA 1E6YA 5C24B 1UEVA 2V4QA 5B09A 5KT6A 3CIZA 3B8HA 4UQTA 2X1BA 2PEBA 1D8ZA 4OYPA 5GMEA 4YB1P 3GP9A 3I55S 3OL9A 5DDQC 5DG9A 5IWAF 3G82B 2XLJA 4MT1A 4RW9B 4CI0B 2POKA 4F4XA 1S5ZA 1T95A 3TO8A 2N3OA 2HHTA 1L3UA 3K2YA 4R8UA 4MKVA 3OUYB 3BYRA 2FVRA 2CQGA 2B9EA 2ZVSA 3FGVA 4ZVFA 4ICLB 2YQ1A 1I3OB 3MEEB 4B9MA 1S59A 3ONQA 5IFMA 2HURA 2RUSA 4X65F 2KI2A 2WHOA 1RT7B 1EJ7L 4NYOA 2HHXA 2VU5A 1KNZA 2KU7A 3HKZD 2E1RA 2ZBCA 1R27B 3S8SA 5F8NA 2FLPA 3VHQA 2DNMA 3NGDA 4DR6J 1Z4UA 4FYYB 4LF6F 1N52B 3DYAA 4M63A 4H4OB 2RKIB 5J2NA 2DNHA 3D28A 4FS2A 2X1FA 1AXQA 1PJ7A 2WONB 2Z57B 1JLEB 2DO4A 2BJ1A 2E5JA 4QOTA 1NPKA 2ZM6F 2MPUA 4Q2MA 2D3O1 4HH1A 4DPOA 1IKVB 3C6TA 1IBMF 4CQ1A 4NEZA 5ETOA 1HBNA 1HNXJ 3DCAA 3Q2SC 2VPYB 5KT2A 3BSCA 4K4XA 1KQKA 4OHWA 3OTCA 4WU2A 4MIWA 3BGRB 3L09A 4HACA 4USTA 4WK3A 2VFVA 1JLGA 4WK1A 1WEXA 3SCKE 5DG7A 4A8WA 4JYAF 1YRUA 4Y2IA 4B3TF 3OV7A 1XEZA 2KHCA 3MF5A 3A8JA 3TZXA 4IOAQ 3EXCX 3R8YA 2R9LA 5GMDA 5E3CA 2QFIA 4JV5J 1RTIA 1X5PA 3HULA 3QATA 2QMWA 1Y5LB 3M2UA 3NBPA 4I56A 5CYQB 2F40A 2Q6BA 1HBUA 5E0OA 3IRXA 2MHNA 4PG5A 1CULB 4J9VA 3CJKB 2RHQB 4AE5A 2LECA 1QDUB 3H0PA 1OO0B 3JSRA 2M5YA 3CCQS 5E5NA 2DR8A 1X9WA 4V1Ak 3C6UB 2PEHA 3ETOA 4LF5J 4C8LA 3R2DJ 1TL1A 1HMVB 4J9UE 3DOKB 1OPZA 5A8WB 1U8WA 2O01C 3MAHA 4ZPDA 1BQNB 1UWBA 4DLEA 3KYLA 1M5KC 4B3MF 4QWEA 3J81U 1RHKB 1CJKB 4URSA 1UP1A 2B8QA 1R3NA 1XMOJ 2RRNA 2DNQA 2WSCC 4Q5VA 1RDRA 3LOUA 3CD6S 3SQOP 3B54A 3HFZB 3DOLA 4ZLJA 1WUUA 4Y2KA 5IS2A 1VC0A 2YVSA 1HPZA 3DLGB 3QRPA 4ZHRA 3K7RA 3CJ3A 1BHNA 3R9LA 3RRGA 2ADBA 1GX5A 3HDSA 3AFGA 2RQ4A 3THTA 5F41A 5HJYA 1KHVA 1ZM3A 1AUSL 3AD9C 1JLCB 3LA0A 5KFAA 3HI9A 2HHQA 1IKXB 1QE1A 3BBCA 4ENOA 2LEAA 5FLXY 1ZM9A 4OX9J 1FD8A 1AT1B 2AGPA 5DETA 1X4CA 5IM0A 2Y0SD 2J5AA 1C1CA 1QTNB 5E3QA 5CA5A 1R6YA 1NJXA 3JB9k 4DR2J 4OZ2A 1U47A 3QLHA 1FKOA 3IG1A 4UZBA 2N82B 4YB6A 2HZVA 5KT7A 3A8KA 3VR1A 3ISNC 3KMSA 5I42A 3PW4A 2G9OA 5J1PA 4PPDA 1VR6A 3QMQA 4HHJA 2VFTA 1CBKA 3D6MB 2V8VA 2P9EA 2LEBA 4QIFA 2C22A 2AX1A 3FRYA 2ZNZA 3JYTB 3CD0A 4ZVRB 4Y3CA 4NLWA 3POTA 4B08A 3MPVA 1REGX 2QA1A 5DGAA 1YG0A 2ERRA 1U6FA 4Q43A 2BXJA 1VRQC 1D9DA 4TN2A 1RP5A 1HR0J 3U1NA 1UEUA 4DV6F 1FVQA 3NGSA 2C2KB 4I2PA 4DR1J 1C0TA 4KHPF 1FF2A 1S72S 4EEYA 1PBAA 1YHQS 1XERA 4ZDNA 1Q8BA 3TYTA 4C3MA 2Z30B 4G3IA 1J5EF 1JNZB 4A8QA 2JFKA 3BN4A 3C14B 3DDKA 4KO0A 1RWMB 2VHGA 4Y0FA 1SH2A 5IT4A 3ZZOA 3NOCA 3A13A 3R2CJ 5FJ4A 4LSLA 4BHQA 2MZRA 2HZCA 4YR2A 3D67A 1CS4B 4ANEA 1NJWA 4H4KC 1TKTA 2QV6A 3QIPB 3AB2B 1JLQB 5D3GB 3WQPA 2ZWOA 1RHJB 1AFIA 1IKYA 4L3KA 2BJ7A 3P3DA 4RWXA 4ZKAA 3I5AA 4G1QA 1TR0A 1EQMA 5KG4A 1VRUB 1LWCA 2OPQB 2KHDA 1Q8KA 2W4CA 4M5JA 3TOQA 4A8FA 2NR0A 3DMJB 5AJ3J 1ZTWA 3EGZA 3CC4S 1IXKA 1NEEA 1NB2A 4X4RA 2W9BB 2GCFA 4CO4A 3NMRA 2R2TA 1AB8A 1UPMB 2CNOB 1YGYA 1NK9A 1XMBA 4NYPA 2VJVA 5DLGA 3FCHA 1ELOA 4IQXA 2HG4A 3E8OA 3TZYA 4NLXA 2C3UA 4KY3A 3KK2A 2FJDB 3G96A 3PX6A 2P9GA 1X4HA 4NA1A 4IG3A 3D5MA 2H1YA 1LWFA 1VOMA 2MQOA 5I3QA 4BWMA 2X1GA 4OHVA 4C11A 1FI4A 3KK3A 2RF2B 3I0RB 3BZQA 5A8KA 4NLYA 4F4ZA 1KBRA 1OIAA 1T0TV 4XDDA 5DLFA 4N56A 1L3VA 1AW0A 5HAOA 4PABA 4TXSA 1BQMA 1T9VA 3HK2A 1W26A 3MUVP 3FC9A 4GKJF 3CCSS 2QZ8A 2JWNA 2F9DA 3HHEA 2XULA 1GH8A 3FEZA 1NNDA 1XMQJ 2MB0B 2H5JB 2XYPB 3V6HA 5KFSA 1QTMA 1QLNA 3BSOA 4UUXA 1NK5A 3NXZA 2A18A 3SDEA 4DF4A 3BGUA 1PC5A 4J9OA 1RHUB 2AT1B 4DG1A 4PYDA 1SIWB 3PCOB 3RB3A 1R43A 4C8NA 1TUVA 3KDOA 4F7VA 3GV5B 3GFXA 2LQBA 1TV6B 1S0VA 1KN6A 1U09A 1Y0HA 2BBEA 1RAGB 3QGHA 4HEA9 1HLWA 4AL6A 1LXNA 1DURA 4J7CA 4M5KA 4R5PB 1RT3A 5T7LA 1DTQB 1X9MA 4DN9A 7FD1A 2VONA 1Q0NA 1P1LA 2M2BA 3LGHA 1NUEA 4CDIA 2E7VA 2LYVA 1SQGA 2OPPB 1RBOB 2CYYA 2IDEA 2HLTA 3N9UC 2IFXA 3Q8RB 1T9WA 3PTWA 5DS7A 3BV8A 1Y5NB 3CDWA 2ZBIA 4A8YA 2UUBJ 3V6DB 3DDNA 3W65A 4UT4A 3UR0A 1VQ7S 1SPBP 2V5HG 1ZOTA 2IPOB 1TVRA 1BWVA 1FE0A 2FJVA 1SC1B 1IJEB 2XSJA 1ZH5A 1JQGA 4J9NA 4ZN1A 3CW2C 1UFWA 1EP4A 4DV7F 5E3PA 2V2QA 2QGFB 4RUBA 2HRYA 2H48B 4PXDA 4RU9A 2BX6A 2OEJA 3KLVA 2XMKA 4TU7A 3D6HB 3Q8QB 2QA4G 1JKHB 4NXNJ 4PQUB 5FLXU 1HHSA 1H2VZ 1WWHA 1PJ5A 2PIIA 4Y65A 4OJ1A 2W7AA 1DTTA 4DSKA 2PA3A 3I0SA 1K47A 1YLXA 3BQ1A 1LW0B 2ZDOA 3ITHA 1HA1A 1BLUA 2OHDA 4ZIWA 2AJ2A 2NS1B 5HI7A 4S0MA 2CNNB 4ZVSB 3W7BA 3OVAA 1MROB 4BLGA 4WPAA 4G6VB 2OD6A 3H5XA 2DNGA 1KHWA 1RAAB 3TAMA 2PC6A 4KHRA 2B43A 1TUGB 2H4YB 4QBUA 3D2WA 1HHTP 4KGMA 3D66A 1X5TA 4U95A 1D8YA 2CQ0A 1S1TA 1YSJA 3HXMA 2CWKA 3GFYA 2MKHA 1KQGB 1B0PA 3FSIA 2RS8A 5KFLA 3C16B 4FF1A 5BJRA 2GVDA 2IRXA 4NOHA 4CLLA 2EFNA 1F5AA 2HVZA 3HCXA 4KIAA 4V19J 3NNAA 4NXMF 5DRKA 2E7XA 1RT5A 4MJKA 3ILOA 1R0CB 2ZZMA 4X4SA 3RBXA
chains in the Genus database with same CATH topology
2LDYA 4X66F 2MZ1A 2QIFA 3DYAB 4JI6F 3OUYA 3BS9A 2L41A 1KD1T 2HNZA 4NLUA 3ZZYA 2G1DA 4R0JA 5J2NB 1IM4A 5EGYA 3MMJA 2W9CB 4B3SF 2VFUA 2D3OR 1NU4A 3TANA 4ICLA 2ALZA 4WKYA 2C3MA 4DN0A 1UVLA 3NL0A 3MEEA 4OI6A 5CD4H 4LF5F 1VBYA 3NCQA 1N0UA 1FRJA 3DLEA 5KFUA 1WF0A 4RNMA 3KNAA 3OVBA 1RT6B 2KVIA 3WX4A 5AE1A 1T7PA 4PG7A 2WB1D 1FNMA 2YKAA 3KG0A 4I7FB 5FIIA 1RT7A 4OJHA 2BA9A 2KT3A 3MMAA 3W2VA 4YY3F 4CCHA 2EFVA 3NRBA 2EFQA 3OR2A 2R4FA 3TP2A 4X64F 3C6TB 2KO1A 3T1AA 1ZZFA 2J76E 5H9FJ 5I3UB 4NYZA 2YWHA 3VQTA 4ECYA 1JLAB 2IJNA 4OHYA 2ASLA 3MOZA 3TNVA 1HBNB 2H9ZA 1O0PA 4HDGA 1W2BR 4Q44A 3PX4A 1R31A 4KHMA 3GG1A 2ZH3A 5H9EJ 2DNNA 4NLDA 4ZP9A 5HROA 2M8HA 2IVFB 2C42A 4H4OA 3OLBA 2EG2A 1H98A 1NH7A 2RKIA 3TA1A 1Q16B 1UW4A 3AJ1A 2X1AA 2BM0A 1DHMA 2GQ2A 3CULA 5L39A 3MR3A 3MPYA 4IRKA 2WONA 1JLEA 5KFNA 2BABA 2E5LF 2OIHA 4NL5A 2FJWA 1HNWF 3QIDA 1JLGB 3HX9A 1ZZNA 4OLPA 4C3LA 3OR1A 2YX4A 2ABYA 4A47A 2VZ9A 3U02A 4X4TA 2VUGA 1VQ5S 2OAUA 3ZFVA 3KLGB 2MJUA 2OFHX 3IS9B 2HNDA 2AJQA 4IFYB 5SZTA 1S6QB 4ED7A 3N6NA 4ZPWR 3OXFA 1IKVA 1GTHA 3MM8A 2W9AA 1VMBA 5C5JA 1HD0A 4ETXA 4FF4A 1VQSA 4DSEA 1V3RA 1FJCA 2JX2A 3IXQA 4NLPA 4C7QA 1YIJS 3SSQA 3CC7S 1N5VA 3PW2A 3PKMA 5KFWA 2ZC4A 1X4DA 3OBIA 4PPZA 3OVSA 2RDJA 4IRCA 2XS5A 3KLIB 1RTIB 1HWIA 3GR1A 3M30A 2XI2A 3BO2A 1ZYQA 2PI4A 4FVCA 4TU9A 3M8PA 2Y1IA 1X0FA 3M2UB 3NBPB 2CJ9A 2J9CA 2NXUA 2HHUA 1HBUB 1REVB 3BGRA 1RT2A 5LJ3Y 2B5JA 3MTKA 3THVA 1VQ4S 2DRAA 3IRXB 1U1NA 2ZJRQ 3M6XA 3VZIA 4DBQA 3UQSA 2PO4A 1P1TA 3D0IE 5HMYA 2BANA 3BB5A 4YQWA 2D3ZA 1UVMA 4ES2A 4QR2A 1S76D 4K4UA 2R7TA 4DV0F 2DO0A 3MD3A 3GG0A 3PJWA 1NK4A 3O1LA 2AJ1A 2RH3A 4AL7A 1VIOA 2HS4A 4QWDA 2FHKA 4YDXA 3VAHA 2XB2D 4D3HA 1HQEA 1PGZA 5BYSA 3NWGA 2KZZA 4RNHA 5KG1A 2CQ3A 4IH7A 5F9NA 1H2TZ 3LP1B 3G6ES 4PG6A 1NB7A 1FEEA 3BR8A 2E7WA 1L5UA 4ED3A 1BY9A 3QGIA 3N5FA 1TL1B 4DR2F 4ECVA 4IYQA 1UMJA 2G0CA 5LSLA 3TRGA 1IN0A 2HLUA 3R5CA 5FD1A 4X4UA 2BQRA 2F4VF 1LW2A 3U1LA 2UVVA 5CYQA 3Q22A 4RUAA 1RWUA 4GO7X 3PXGa 1NJYA 3I32A 1UWBB 5J2MB 2RU9A 1BD6A 3BDEA 3CCTA 2E1MC 2IMOA 3LW5C 3MR2A 1FRXA 1IBLF 4F8RA 2IJFA 3H4DA 4O44B 5A6PA 3ZC4A 3MTJA 3WDOA 2RILA 3LWMA 3CJKA 3OL6A 1B7FA 1N34F 2DHSA 2M0GB 2ZOMA 1JXLA 3UCGA 5GMKa 3KHRA 1U24A 3I4PA 1LQ9A 5L9NA 4F2SA 2HAIA 2VASA 4K4TA 1U45A 1S1UB 1NKEA 2ZH4A 1G1XA 2RS2A 4WF9Q 1VRTB 3C6UA 1R8HA 4NWBA 5K8OA 1RQ0A 2CJAA 3DOLB 3FSXA 3DLHA 2OPSA 3DFEA 2NYIA 4C8MA 4A8SA 1WHXA 3B4DA 3SFGA 2AP6A 3V81A 3R5DA 1K73T 1LWEA 2XMMA 4O3PA 4WFYA 5F9LA 5KT3A 1HPZB 4F67A 4NCGA 1HMVA 1WF1A 3SCIE 2KXFA 4WTYA 2UVUA 1HI1A 3DOKA 3TVYA 5A8WA 2DGQA 3MDFA 4FZVA 5EWEA 1WG4A 3PVXA 3EPGA 4EO8A 4FN5A 1VQMS 2QMXA 2HPUA 2RE1A 4QIGA 4QIVA 1NAQA 1U2RA 1BQNA 4R25A 4CTAA 1IQTA 2MDAA 3JSYA 1RTJA 2XLIA 2J0QD 4MIBA 5F0UA 2ZC3A 5HP1B 4X84A 2IVYA 1X5OA 5GADI 5J2PB 1QUVA 2WBRA 1R8PA 4H4KA 4USIA 1MWZA 3H5YA 2BM1A 2F8HA 2HNYA 2VC0A 2KM8B 5K8NA 4W90B 4RUHA 1XNRF 4ELVA 2BW2A 4O0IA 1UA0A 4B9SA 5DJBA 5DM6Q 4LQ9A 2EPIA 4DS5A 4CO1A 1WG5A 3J7A1 1CLFA 4CT9A 3MCSA 3Q8SB 3LGNA 1OS5A 3C8YA 1PILA 2CVIA 1S6PB 3UNGC 4OZ1A 3T1YF 1ZAWA 3SSSA 3O8WA 4FPRA 3K5MA 3GFZA 1QE1B 4QJVA 5D8HB 4ECQA 1JWWA 3DLKB 2LDIA 4HTJA 2W24A 2XI3A 2D9PA 3DLGA 3PY8A 3MMCA 5IM0B 3DRPB 2QSFA 4ZLPA 3G4SS 5KG0A 4QQBA 1HNVB 2ILYA 3MZIA 5B0DA 2Q66A 4O4GA 1XWLA 2D1CA 3KHLA 1WI8A 4O4RA 4IUFA 5A0YA 2WW8A 1C1CB 2V8HA 5GAHU 1H2UX 3DI6A 2E5GA 5KG5A 2J9DA 1UL3A 2HHWA 1VQYA 5K8MA 4PG8A 3BEGB 4YOEA 2DBBA 4OX7A 3CUNA 1U1MA 4F4KA 2ASDA 1H6KX 5IQQA 5KFDA 4O3RA 2XY7A 2KRRA 3QAEA 2E5HA 3CDEA 2MZQA 1GAOA 3TUJC 2I8EA 1JLCA 4LIWA 3CCVS 1YBAA 3QLHB 1FKOB 3CEDA 4IFVA 3AH6A 3W2WA 1V9OA 1HNZF 5E3RA 4OZJA 3KK1B 3IG1B 1HI8A 5B0GA 5KFBA 2RMLA 4A8MP 2CPYA 2V2KA 5KFTA 3RB6A 4XPEA 2OSQA 4MIAA 3NAIA 3HP6A 2MGZA 2R7RA 3GMGA 2E1CA 2M7SA 4U9RA 4OI1A 2NQPA 1IKXA 4I4BA 2V4JB 4Q7AA 3AJ2A 2UXCF 1JLBB 2A2CA 3K57A 1YJUA 1SL1A 4I64A 3R5BA 1X7VA 3CJ2A 3KHGA 5IT0A 1U7LA 4FS1A 2KFYA 4O3SA 4M95A 1K1QA 4JI4F 2YNFA 3NCPA 1DBDA 4I2QA 3CMES 3UE2A 1OQ3A 2JEJA 4WE1B 2H5EA 4RW8A 1PC4A 4U67Q 3J7Z5 3H40A 3DGPA 2XC9A 1I94F 2UVRA 3K0JA 1DLOB 3HVRA 3FRZA 3QJJA 2F9JA 4ECUA 3RRKA 2BUNA 4WXOA 2VFRA 3TAPA 2FJBB 2UZAA 4M1KA 2IAJB 1J5OA 4BC7A 1LFPA 2O66A 1S1VA 4V19X 2UUWA 2HWIA 4A48A 5KFYA 1E6VB 2QA2A 3N6LA 2RVJA 3H5UA 4K5RA 4RW7A 4TU8A 1Y00A 5C25A 2FLOA 4KE5A 1RKIA 3P6YC 2CPHA 3E01A 2P9CA 1VS3A 3POTB 1HBMB 3CJ0A 3OFEA 4MYUA 1AUDA 2RQCA 2XCPA 2MZSA 1FNOA 1T3NA 1SH3A 1KQSR 4TYAA 1JB0C 5AJ3F 3RTVA 1TK5A 3DRRA 4KQZA 2W8KA 5A2QY 1VQ8S 4IDKB 4EO6A 2JH3A 4RW6A 2OO4A 4DV3F 1HBOB 3S7RA 4XIUA 4DV5F 5KG3A 2XEXA 2VB6A 1VHFA 1T8EA 4I2PB 1RKJA 2YY3A 3DN9A 5E33A 2UUCF 3DRYA 1H7XA 4F3QA 1C0TB 4KB7A 2L9NA 1N54B 4WYLA 3UWTA 4H4MB 2ZH7A 3CCMS 4DS4A 5B0EA 4HVZA 1ZETA 1QY7A 4KBIA 3UCUP 3JTOA 2G4BA 4OL8A 2B4VA 3KNGA 3FQLA 4I0WA 5DM7Q 2JDJA 3IR5B 3HPOA 4ZCLA 1MW7A 1HARA 1S9EA 1C1BB 4WFNQ 3M8RA 3JYTA 2GHPA 4PXCA 4NRTA 1FXRA 1FTRA 2DR7A 3HHLA 4PWDA 3QJPA 3DXSX 3MFIA 3F73A 3CDAA 2JZ5A 3IFEA 4KO0B 4QWAA 5HLFB 5T14A 2CRLA 4N5SA 5KFFA 1U26A 4ZPBA 4X4NA 3J7ZT 4DR3F 3UI3A 4RU2A 2UUTA 3EUNA 3OTDA 4MTPA 3V6KA 3IAM9 3O44A 3BN7A 5B0AA 1S99A 2R2SA 4NZ0A 2BYCA 3E2EA 2HMIB 3FVYA 4DLGA 1URNA 1SL0A 1KFDA 4HI1A 3JAMY 2B7BB 4QR1A 1BC6A 2WB4A 2GNKA 4L6V3 4E98A 3RRHA 3BGFA 1HL6A 1UJ4A 3P49B 3DLJA 1N5TA 3VAFA 2Z0GA 4EGLA 2OSRA 1Q86T 3HT3A 4X4QA 1TKTB 2C3YA 2OKQA 1VFJA 3LUYA 1UKUA 4DFMA 1T05B 4C8KA 2OMOA 2RSQA 2PD1A 2DNZA 4OHZA 2P6TA 3NCRA 4IG0A 1Y7PA 3AA8A 4R0EA 1Q8IA 2J9DE 4WFXA 5M2RA 3BDPA 4DL6A 5J2QB 2JLFA 3JTNA 3M2RA 4WKRA 5EUHA 4FNIA 1U6ZA 3DRXA 4CH1A 4F3OA 4C8ZA 4JI8F 3HVWA 1KVJA 1ZPVA 1IKYB 5GAGU 1U1LA 3CF5Q 2YKQA 5CXTA 3IAS9 2VD3A 4P6QA 3ZZ0A 4JOUA 4G1QB 2HGNA 2LQ5A 2D41A 1UVJA 1D3WA 3PIPQ 4LVOP 1TL4A 3T5HA 2COLA 4N41A 1LWCB 1T3OA 4ERDA 1QSSA 2VG5A 4N8NA 3V6JA 3V4IA 3MM6A 4ILRA 2V8GA 3S1TA 2XWYA 2YNIB 4NA2A 4UW2A 5FDLB 4A8OA 2E9RX 2WCXA 2KKHA 1QAIA 3I96A 3LO3A 4CNZA 4ELTA 1R0AB 2O67A 2U1AA 1WTFA 1SV5B 4NLGA 2LA4A 4PUOB 1YITS 2F3JA 1XMQF 2KM8C 2FD2A 2I1RA 2PA8D 3QIPA 3M9OB 2B9YA 1P9QC 4HYKA 2C3PA 1FKPB 1R7IA 2QO3A 1JLQA 4USHA 3SFUA 5A6WA 5D3GA 2BE2B 4BDPA 4J9LA 4CO5A 1S9GB 1TL3A 2DHAA 3MM9B 1LK5A 2W4DA 2L9DA 2J7UA 4GO5X 2ZHAA 4J5OA 3PM9A 2HVIA 3SEOA 3DU5A 3AA9A 4WFZA 3OJUA 3D1QA 4NZ7A 4DR6F 4TLQA 4I68A 3NAHA 1G3OA 2MMYA 2XLKA 5GVQA 1BGXT 3GB0A 3IR6B 4DL7A 1VRUA 2OPQA 3BREA 1Q81T 3KK2B 1NHUA 4TNOA 1VQPS 2ZOFA 1CC8A 2VBZA 3G71S 5EWFA 3MOJB 3NNCA 1BWEA 1ZAXA 4UY8T 3TVKA 3PEHA 2DD8S 2YH0A 3DMJA 5CZVA 4OZ5A 1U4BA 4AQYF 4IG3B 4HL9A 2ZDPA 5E2QA 5GAEU 2PMZD 5HMWA 4FF2A 2YTCA 1LWFB 3K5NA 1Q82T 1SI9A 2YKNA 2J7KA 1N5YA 3RU0A 1RA7A 2W9BA 4AL5A 2NR0A 1SKRA 2WAQD 3A8EA 5B08A 4C11B 3KK3B 3SV4A 1KLNA 2QRRA 5EX3A 2VQFF 4GC6A 4XAKA 4LMZA 1MSWD 3N79A 3EX7B 3MMBA 5A8KB 1VC5A 1HWUA 3HVAA 3BQ0A 2WBMA 2AW0A 3T5LA 4ED5A 2XS7A 1FESA 5MAOA 1WI6A 4FBTA 2DNKA 2IRYA 5SUHA 1C0UA 2FTRA 1FVSA 1HQUA 4Q45A 2M8DB 1KTQA 3PRBA 1GQEA 4FP9A 4DL0C 2CQPA 1R8AA 3EGWB 3RZAA 4K50A 3OXGA 3OSNA 3L3CA 2MQLA 3FEXB 2ZD1A 1TKXA 4OX6A 1R8CA 4NCBA 3PR4A 2J0SD 3TA2A 1D0EA 3DM2B 2GX8A 3R5AA 4EYIB 4Y28C 4IQMA