1JWWA

Nmr characterization of the n-terminal domain of a potential copper-translocating p-type atpase from bacillus subtilis
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
80
structure length
80
Chain Sequence
VTEKAEFDIEGMTCAACANRIEKRLNKIEGVANAPVNFALETVTVEYNPKEASVSDLKEAVDKLGYKLKLKGEQDSIEGR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution structure of the N-terminal domain of a potential copper-translocating P-type ATPase from Bacillus subtilis in the apo and Cu(I) loaded states.
pubmed doi rcsb
source organism Bacillus subtilis
molecule tags Hydrolase
molecule keywords Potential copper-transporting ATPase
total genus 16
structure length 80
sequence length 80
ec nomenclature ec 7.2.2.8: P-type Cu(+) transporter.
pdb deposition date 2001-09-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00403 HMA Heavy-metal-associated domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.100 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1jwwA00
1FD8A 2XMTA 1X0PA 3FGVA 2K1RB 1MWZA 2RSQA 1N5TA 3HHLB 1N5SA 3UDCA 1APSA 3TNVA 5A6WA 2W4CA 2LXFA 2IYIA 2OFGX 4HI2A 3IWLA 2GCFA 3VTIA 1TUVA 4A47A 1SI9A 4A4JA 4F67A 3DXSX 5B0BA 5B0EA 1YJVA 1Y3KA 2GGPA 2XMKA 3F44A 1AW0A 4OJHA 1Q8BA 3CJKA 2KYZA 2VH7A 1WD6A 4DN9A 3HHLC 2RMLA 2VV5A 2N4CA 3KKFA 2ROGA 2HLTA 1AFJA 3KG1A 1P8GA 3BB5A 2KT3A 1KQKA 1R6YA 3LGMA 4QOTA 5B0FA 5B0CA 5B08A 2QYCA 4A46A 1YJTA 4FNIA 4Q2MA 4YEAA 5T7LA 1Q53A 2GO8A 1LQ9A 2BUNA 2OFHX 1ULRA 3CJKB 2FIUA 4EFAC 2PD1A 3HF5A 5F0WA 3TOQA 3KG0A 1YG0A 1K0VA 4YDXA 1W2IA 1FESA 1TL4A 1Y3JA 4OJ3A 2IYGA 2AW0A 2AJ0A 3QMQA 4HH1A 2K7JA 4HH0A 1KVJA 2K1RA 3HHLA 1XBWA 3BF4A 2GA7A 2AJ1A 2W4DA 2FHMA 3TRGA 2BBEA 2BYCA 1FE4A 2AP6A 2ASYA 3WDOA 1Y0HA 2GFFA 2LDIA 3BGUA 2FB0A 1FEEA 2EW9A 2W4PA 2OD6A 1Q8LA 5B09A 5B0DA 1AFIA 3HDSA 3MZIA 3DCAA 2N7YA 1OSDA 1QUPA 2CRLA 2XMJA 3K7RA 5K9FA 2G9OA 2L3MA 2HQIA 1TL5A 2QLXA 5IXUA 1IUJA 4U9RA 2XMVA 1VQSA 2ZDOA 1TZ0A 2HLUA 2BJEA 2JDJA 5B0AA 3BN7A 1CC8A 1OQ6A 2GV1A 4HI1A 1X7VA 4Q2LA 1FE0A 1P6TA 1FVQA 2LQBA 4OIXA 4DL0C 1N5VA 2FTRA 2OD4A 3BM7A 4NL5A 1V3ZA 5B0GA 4A48A 4OJ1A 1YRXA 1X8DA 2ROEA 2K2PA 3IWXA 2ACYA 2IFXA 2BJDA 1JWWA 3E8OA 2RU9A 1YJUA 1OPZA 1N5QA 2HFNA 2HFOA 3HX9A 3LO3A 2XMUA 3FRYA 1OQ3A 1GXUA 4FNHA 1RJJA 1URRA 2K7KA 2ROPA 4ZA1A 4Y2KA 2PGCA 1TR0A 1CC7A 1Y9OA 2QIFA 3HFKA 2OP5A 3T9NA 1MWYA 2XMMA 1U7LA 1Q4RA 5KAKA 2RILA 3KNGA 5A6PA 1KVIA 3MCSA 1S6OA 1SQEA 4HL9A 1FVSA 4Y2IA 2XMWA 1GXTA 1SB6A 3BDEA 2N4DA 2HIQA 2Q3PA 2ZDPA 1VQYA 3I9ZA 4OJGA 5F0UA 3FMBA 1JK9B 1S6UA 4NPOA 5T7LB 2OMOA 2OAUA 2KKHA 2LQ9A 3QGPA 2OKQA 1CPZA 4ZOSA 2QLWA 2GGPB 3GZ7A 3HHLD 3BR8A 4Y2MA 3LGNA 2KT2A 1YJRA 4DPOA
chains in the Genus database with same CATH superfamily
3JQMA 5ETRA 3BBBA 2DBBA 2V4JA 1Z4UA 3D0HE 3P5BP 1JXVA 2ZOFA 4ZITA 2XGPA 1X0PA 4EEYA 4DQQA 3X1LB 2N82B 3GIRA 1OPIA 4ZVRB 1WF0A 5D3GA 2V9KA 1G1XA 2JEIA 2HURA 3PYFA 2WW4A 1M5OC 3K0JA 4GKKF 5KFKA 1UFLA 3TJAA 2R7TA 1YJVA 4LF9J 2FJWA 5HMZA 4FBTA 2CNOB 2IIHA 2OIHA 1YTYA 1XEZA 1R27B 3J7YU 4DV5J 1WD6A 2HHTA 1LW2B 3CCRS 2CPYA 1J5OB 4K4ZA 1X4FA 2M0GB 3GFHA 8ATCB 2BACA 3QNWB 5KFBA 1PC5A 1HPZA 2RMLA 4N5SA 3OUYA 3E2EA 2J76E 1YDLA 2JSXA 4CYUA 3EX7B 3RB0A 4C3MA 1VBYA 1VK3A 2ZH4A 2BRLA 1GT8A 2AV5A 2ZBRA 4M5MA 1NJZA 2RQMA 1SKUB 3QLHA 3TANA 3NLCA 4PXDA 3PR5B 3W61A 4ANDA 2FY8A 3T1YJ 4C0OC 1H74A 2HQGA 4KT0C 4RNOA 2RE1A 3A1YG 3VZIA 2VQFJ 5HP1B 3KG0A 3PYGA 2W7PA 4F02A 4CLYA 3PW7A 4NZ7A 2E7VA 1RAEB 4YDXA 1K0VA 4MJKA 4LJMA 2HGNA 2B7CB 3K5NA 4HT5A 2JVOA 3FBEA 2IRYA 1S99A 4WYWA 1AA1B 5JVHQ 2XY6A 3M1VB 4N76A 1YGYA 3ISNC 4AD6A 4C0HA 1YRTA 2R2UA 3H98A 3H40A 1TFWA 4D3GA 1YZ7A 4AYBD 3F73A 4YR3A 2OLWA 5DG8A 3DLKB 3J81U 4GC7A 3HKZD 5KFSA 2RHQB 3BQ0A 1E6YA 3W66A 3U02A 1QUPA 2XMJA 2WB1D 1R0AB 3G9CA 2MLZA 4OLOA 4CM0A 4ZIWA 4YFUA 1NKCA 1VI7A 3L7OA 1KSPA 4Z37A 4PPZA 3BGFA 1S1UA 1VISA 4I2QB 4DL3A 5IT9Y 4NLPA 1X31C 1VQSA 3J7ZT 2AJQA 3CMQA 4WFZA 4C98A 4C8LA 5ETTA 2ZWPA 3O8WA 4ZJQA 4YR2A 4M5IA 1YBTA 1XC9A 3KK1A 2UUCJ 3W8GA 3VAIA 4QYZK 4OI4A 5KT4A 2VG5B 1GK8A 1P6TA 2IM3A 2OSQA 1QJHA 2J0XA 3DGPB 2VD3A 3GR0A 3GV5B 4O3PA 3ZZZA 1E6VA 4DR4J 2HK2A 3C2PA 3TYTA 4J9PA 3MR2A 2NREA 3UO0A 3LA0A 2MSTA 1RA7A 2DGSA 4DPTA 1N88A 4K2XA 1BC6A 4RW8B 3ILOA 4FBUA 2Z4PA 5IS2A 3TZXA 1QDUB 2XLJA 2OMLA 2G2YA 4P73A 2CG4A 2RQCA 5IC6B 3A8JA 2GQCA 2VDIA 2E1RA 2CVEA 3EZUA 4TQRA 1SL0A 1NJXA 3TR5A 5EGYA 4ED0A 1FWKA 1MMNA 3W63A 1WDDA 1OJ4A 4I6YA 1RT1B 2DHGA 4Q8EA 4YOEA 3SDEB 1RT5A 4NYOA 1YX2A 1SQEA 3GJRB 1RWXB 2P5VA 1HFEL 2WSFC 5EX3A 2OPQB 5KFVA 2LYVA 3AT1B 1FKPA 1BD6A 4K4WA 4B3RJ 1VQYA 1WHXA 3K89A 2D3ZA 1CPZA 2H5IB 4JV2A 3W9HA 3I31A 2RIJA 3AY0A 4KH0B 2MQQA 2PT0A 1JLCB 3MAQA 2KFNA 2I6WA 3KUHA 4DDFA 2MKYA 4ATNA 2P6SA 1R89A 4EO6A 5BYSA 3PYEA 2MQNA 1M5SA 2F8HA 2DHXA 4ZN1A 4A8SA 2HYIB 3OLAA 1HBNB 2AKWB 3FBCA 4RW6A 4C4WA 3IO1A 3R9LA 4A47A 2DEJA 1SIZA 1TUVA 1KQSR 1U0SA 3VGVA 2BDPA 2AU0A 4WWSA 3IRXB 4QU7A 2ZVSA 5DG9A 4NLDA 2C42A 4KYZA 1S9GA 1HWUA 2AJ2A 2BA9A 3DM2B 4WFAQ 2J0WA 1RWPB 2H54B 4USIA 1IBLJ 4O3SA 1V3SA 2VPXB 1YBAA 1VLOA 3IM9A 4OZJA 2XS5A 2VG6B 3JTPA 1I51B 1RBLA 5JUMA 2XSJA 2MKCA 2PE8A 4ZVEA 3BJYA 1L3VA 3SIPB 2FLLA 3MEDA 3RYLA 3TI0A 3RBZA 3Q8PB 3CEDA 4CTAB 1D9FA 1JLFB 2B4UA 2HHUA 2QMXA 5D4PA 1IKXB 3MMCB 3BKTA 4UUWA 4JI4J 5K20B 4QIEA 1HWLA 1URNA 3HP6A 2AYMA 2HBQB 3PKMA 4IFVB 1C0UA 3J7Z5 1OYEA 4Q5VA 4IG0B 1HBMB 3MM5A 4LSLA 1L3SA 4LR7A 1MROB 4Y2AA 4NA2A 2IYGA 3FZBA 3B78A 4KR0B 1KC8T 1QAJA 2XB2D 2DIUA 3G71S 2BE2A 2A0FB 5EHHA 1RTDA 4PQUB 4CLLA 1TAUA 3BGRB 2BYCA 2EXUA 4C8NA 1Q7YT 4DR3J 3WDOA 2XYGB 3KK1B 3A4TA 3ETOA 2R7RA 2XS2A 3L7PA 3BYRA 4EO8A 4Z7YA 3DOKB 1RT7B 2GHWA 5BYRA 2UVRA 2PI5A 2N7YA 5IC4B 2GJIA 4AL5A 1LK7A 1MG7A 3LPYA 4HLBA 2RS8A 2L3MA 3HVTB 5LXRA 2KZZA 3KJFB 4FP9A 2VOOA 2R7SA 2HLUA 4OFZA 3WBZA 3NEKA 2GW8A 4ZN3A 4GRSA 3UCUP 1U45A 2JFKA 4DFKA 4JYAF 2D9OA 3LWLA 1U1LA 1KDNA 4HI1A 3PIOQ 1T03B 2PSZA 2QV6A 5CABA 5D8HB 2MHNA 2YWGA 4DV1F 3THVA 3M9NB 3SQOP 4NLXA 4A48A 1JLCA 3TP2A 1F9FA 1XMOJ 1WTBA 1U24A 4O44A 2RS2A 2QL5B 1D9DA 3VALA 4KGKA 3NCQA 4RBUA 2POKA 4ZLNA 5E0OA 1YQHA 4LRCA 2ZC3A 5H9FJ 4NLSA 1RHJB 4UZCA 4X4RA 3NMAA 4DV6J 3W2VA 2PIIA 4CO5A 2UUCF 3L7UA 1U49A 5D4OA 3O1LA 4DV4J 3N5FA 2CPIA 1IM4A 1WKLA 3OFHA 4WE1B 3TUIC 4BC7A 4IOCQ 3V6KA 2HGLA 4B3TF 3N01A 1UTAA 3MI7X 2XMMA 4FN5A 4ITSA 3JSBA 5H9EJ 4B3OB 1RCOB 3CF5Q 1TL7B 2CPDA 4B3RF 2LA4A 2OEJA 3BBFA 3BZQA 4Y2IA 1GXTA 3N0VA 5HATA 1LW2A 3N6MA 3T41A 3IN5A 1J5OA 3NGTA 4B3SJ 3JSYA 4M94A 2EFGA 4Q45A 2VG6A 2OAUA 2KKHA 3GYNA 3MD3A 1WACA 2OKQA 4Y0FA 5I42A 2E5LF 3T19A 3ETMA 3C3LA 2RH3A 3AAWB 4LUBA 1CG2A 4TLQA 2WSEC 4M5NA 2HWHA 2IRXA 5CYJA 2MZ1A 1EZZB 3QJPA 3DI6A 1U6BA 2GVDA 1E6VB 5LL6d 3PIPQ 4DR2J 3VWSA 1S79A 2HKEA 3DOLA 4ZVGA 4C11A 1G2EA 4HTJA 3UVJA 1K44A 2LMIA 1SJ1A 2XI2A 2XSJB 1SCJB 2IM1A 3DYAB 4ZVUB 5KOWA 1NLKL 1TL3A 2QE5A 2ZOMA 1ZM2A 1RDRA 2QGFB 3J7YI 1UA0A 1ZAWA 3DRSB 3M6VA 3UR3C 2R42A 3AJ2A 1IBCB 2ZBCA 2WONB 1P1TA 4P7VA 3ZZUA 4WIQA 1JMTA 1T0TV 2PFDA 4Y65A 4WF9Q 3IWNC 2C3YA 1BMQB 1X0FA 3KHRA 2J8SA 4ZPVR 1HBUB 2P2CB 4IFYA 3DLKA 3N6LA 4ZJLA 2FVQA 9ATCB 4YY3J 1T94A 2CVIA 1FX2A 2PMHA 2W2OP 1HBNA 2HWIA 5KFDA 1OY8A 5AT1B 1Z2LA 5L1LA 2DRBA 3R1HA 5GADI 5B0CA 1SIWB 4R25A 1QY7A 1WEYA 1YJTA 2W2PP 5CAAA 3KK2B 5BR8J 3IBWA 4PXEA 4UY8T 4LRBA 4JBCA 2CJXB 2YNFA 2B6AA 1X5PA 3FQLA 2KXNB 2R2RA 3ZZRA 2R7OA 3FCHA 3KNAA 4M5DB 4LBHA 3FJ2A 5IWAF 5HJYA 2WVCA 1WSRA 1GX6A 4OJ3A 3WX4A 5HBMB 2AW0A 3LANA 3V2UC 4F0MA 4TU8A 2W8LA 4YQWA 1X9MA 2VQFF 2UUBF 4K4VA 1FJGF 2VL1A 2QZ8A 3OL8A 1JJ2R 1OSCA 3HSZA 3PX6A 3RBEA 2V34A 4PXBA 4DR2F 3HVWA 4LF5F 2AP6A 4S0MA 4X66J 2DNYA 4OHVA 4ZPTR 1Q78A 2X7IA 4MIBA 3SQGA 1D8ZA 3D66A 1T95A 4NEYA 2QSWA 4HACA 4CYUB 5E33A 5KFWA 2W9BA 1FNOA 1UWBB 4DV3J 3DLJA 4CWBA 4ES2A 1QAIA 2EKNA 4CP5A 2CRLA 3HHKA 4CDIA 3HFZB 3ZTOA 4FF3A 3PFOA 2AJ4A 5IXUA 1S0MA 4U8VA 1HW8A 1N52B 5A8RB 2V9WA 1ZS6A 4WU3A 1RT2A 2YKNB 5LSLA 4K0KJ 4A8QA 4WBFA 4ZCMA 4LF5J 2FHOB 3OTOJ 3BSCA 4TU7A 1AZSB 2EG1A 3GU0A 3WIUA 4OX8A 4NYPA 4WFBQ 3NMRA 3N28A 2W24A 3DXBA 1DY3A 1RE1B 2MZJA 3FK4A 3I87A 5CYQB 3K5MA 1N33J 2C2RA 2PEHA 2QA2A 3Q8SB 2WK4A 4ZJOA 4PQAA 4R0EA 2J5AA 1YRXA 1SV5B 2ASDA 3KDNA 2QYGA 1UZDA 3MUTP 1BQXA 5F9LA 2DNQA 2F4VJ 3LO3A 4LMZA 1UWBA 2Y1IA 4NXNF 2NQPA 2GQQA 1GX5A 1VBZA 2GIFA 3ZZTA 4HDGA 1SKWA 1IBKJ 4FF2A 1FFWB 2ZJRQ 3OBIA 3ZC4A 1HNXF 1FRMA 4F3OA 1X4EA 2VG7A 2XI3A 1CS4A 1CVJA 1U25A 2OUGA 2HG4A 3JSRA 4DV1J 3KNGA 2ZE2B 2W2MP 3EWGA 3MCSA 1RAGB 4DG1A 3MMAB 4DLEA 3CDUA 1S9EB 3LP0A 5ETOA 3IM8A 3I4HX 4ECYA 3BDEA 2M7SA 2ZDPA 1T05B 3DLLQ 4JYAJ 4KGVB 4B17A 4F2RA 3P5TL 3MM6A 4KC5A 3D6TB 5D77A 5M2PA 3RRKA 2DVIA 5FDLA 3IR6B 2DXDA 4MKBA 4DV2F 2ASLA 4I7FB 2HHHJ 1RLCL 2P9CA 5HQLA 3DDIA 4KHPJ 3MEEB 4EUVA 1NSAA 2DGTA 1K8AT 2JJ4D 2L9WA 4J90A 5HAOA 3R5CA 3HJFA 3NRBA 2QT7A 3IXQA 1R7IA 3L4BC 4WCEQ 4M8LA 3M8YA 1R6VA 2HNZA 3MWBA 1JJ4A 4KQZA 3VTIA 2IJFA 1UW4A 2CQPA 1GXLA 1Q5YA 3LAKA 3O3LA 4ZK7M 2H9ZA 3HSJA 5L38A 3THTA 2ZHBA 2H51B 4K50A 1W26A 2VH7A 4C8OA 5KFEA 4YP3A 2KO1A 4PZVA 2FLPA 3KUGA 8RUCA 4FF4A 7AT1B 1VQ6S 3IR5B 1IJEB 5F8LA 1HI8A 3UVJB 1YJNS 5D4NA 5BR8F 3I56S 5D3GB 2AEFA 3FVYA 4DPYA 1PJ6A 4NA3A 2C28A 1RHMB 1VIXA 4USUA 1I1GA 4ZDNA 1DTTA 1HYSA 2ILZA 3G8QA 1B7FA 3OTBA 1GMVA 3K5OA 4IH6A 2O5DA 4DL5A 1C4CA 1FD2A 1Q53A 1EKSA 1UP1A 1YRUA 2WSCC 4O4GB 5G0RA 2XHCA 4CH7A 3R5BA 2H3EB 1KTQA 4J37A 4IRCA 4CLFA 2VZ9A 4KRWA 2FQQB 1BQMB 3GCWP 3W2WB 3HHEA 1O6XA 1T9XA 3OSNA 2K06A 1FDDA 3FCWA 3OR2B 2CPXA 2B9EA 2E5IA 5K5MA 5U47A 3KLHB 3PJ9A 2Y9HA 5FIIA 3I5CA 3IP0A 1O8BA 1YJ7A 4RO0A 2GA7A 4FYYB 1CQMA 3CSKA 4CLSA 5GAHU 4QIFA 3IBFB 4B02A 4N7TA 3HM9A 1XNRF 1A6LA 1CULB 1NHUA 1T9WA 2LDIA 3PCOB 2GC8A 4USVA 2XS7A 1S0VA 1BY9A 3CJTA 5B09A 2ERRA 5KG1A 2XCPA 4CO1A 2Z57B 3S01A 1FCAA 4RZRA 3JSMB 2G2ZA 4CCHA 1ZBTA 3TX8A 2VA3A 1RGVA 1DRZA 1TL5A 3I0RA 4OZ2A 1Q81T 2RDDA 3CJ3A 4X62J 2QLBB 1H6KX 1R3NA 3W2WA 3QGGA 3KK2A 1XR7A 3T5KA 2O67A 4ZPWR 5FJ4A 4CNYA 3CJ8A 5I3UB 2EFVA 3VGUA 3NCPA 2AX1A 2F9JA 1TKDA 2CFXA 3G86A 4F4WA 2MXYA 4X4VA 4WP3A 3BO2A 5DGAA 2VJVA 1FF2A 3BO3A 3M6WA 4WKRA 4PWDA 5B0GA 1WI8A 2XNQA 3EYZA 1SUQB 3MM7B 3DLGA 3KJQB 1HMVA 1QE1A 2HW3A 2K2PA 4XAKA 4DQIA 4L72B 3E8OA 1N5QA 1RT2B 1VLYA 4KPCA 4ALZA 3OTDA 1S0NA 3TZZA 3AA9A 2VFTA 4ZVHA 2YTCA 3Q83A 4FNHA 1LEOA 1F5BA 1VCTA 2L48A 2HWTA 2UV8G 5BYQA 2J6UA 2B9WA 4HACB 4P2XA 4CH0S 1TR0A 2YNGA 2FJEB 2LECA 3BR9A 1Y9OA 1S10A 4B08A 3TA0A 5LJ3Y 2A6MA 1VRUA 2FJXA 4RW4B 3R7SB 5EWFA 3JQJA 3R1LA 1Z2ZA 4K5RA 3MFIA 3P8BB 5D4LA 4NZ6A 2MMYA 5A6PA 3QIPB 1RT4B 4HL9A 1UVIA 2WBMA 2YWFA 3OL6A 1BLUA 1RT3B 2MLXA 1EARA 1UWAA 1JK9B 2CPFA 1HNIB 2OI2A 3FQKA 3OL9A 1Q95G 1WG1A 2EWHA 3MOZA 2Q79A 4Y28C 2YH0A 4FYVB 4ZOSA 1VRTB 1OY9A 4M5DA 2R4FA 1BXNA 1RYRA 2YPZA 3AD8C 2KT2A 1YJRA 1REVB 3CDAA 2VDHA 4DPOA 2MKSA 5GADU 1IWAA 4DR5J 3PY8A 3R2DJ 2XMTA 1HKAA 1H2TZ 4RJVA 4KHPF 4ID8A 1YSJA 1O5JA 3Q86A 4K5SA 4WTOB 3CIMA 3M4XA 4QCLA 3UDVA 3ENVA 3MPYA 4OYAA 3R7NB 3H2UB 5HLFB 3HPOA 3LF0A 2OPRB 2QRRA 2J7UA 3PHTA 5GAEI 4OI2A 3GV8B 4DR6J 1U09A 1TAQA 1ZA1B 2V67A 4JI8F 3T1YF 5AE1A 4C8YA 5J2NA 4ED4A 4LF7J 3MCOA 5CZXA 3VVTA 2ZH6A 2C2DA 2Y8YA 4IDKA 4L3NA 5ETQA 5KFAA 2H65B 4F2SA 4USTA 2C3OA 4LT6A 1GMUA 3SYZA 3OV7A 2N4CA 2MTLA 3DOKA 2ROGA 3FRZA 4BBYA 5LMNF 2BJ8A 3CD5A 3H2LA 5SZTA 4IRKA 1B7YB 4K4TA 5E3AA 3DOLB 5F9NA 5DGBA 2FC9A 4B9MA 3K2YA 3N4WA 3PVXA 1FNXH 3AB2B 4ECRA 4FNIA 4J9UE 1P1LA 1EETA 3AHPA 2ZJQQ 2ZH8A 1TKTB 1FEHA 2E44A 2V4RA 1NM2A 4IYQA 2RAQA 4ZP6A 4QQBA 3R2CJ 2NPIA 3H4DA 2PO4A 3C16A 5EX0A 3FBBA 1YJWS 3LQVA 1IBMF 4KH1B 3TA1A 2WHOA 3W3SA 1Q8IA 3M8QA 3RB6A 2FLNA 4NRUA 3TVYA 4HHUA 1SJFA 2BJ7A 4XDDA 1X4HA 2FC8A 1VQKS 4WFXA 1S1WB 3C66A 4I67A 3S1TA 3BYPA 5K14B 4Y34A 2EPIA 1BQNA 4DX7A 2ZKTA 3CVKA 3EVWA 1HBMA 3MM5B 3RG6A 4EGLA 2CJQA 3RAQA 4A8XA 4FDFA 5C2CA 4M5GA 1MU2A 2MKIA 4RW8A 4KAIA 1IR0A 2LEPA 2HVIA 4TY8A 1U48A 1SVDA 4A8YA 1EETB 2DGQA 4A8OA 4PABA 1RLDA 2VA2A 2DT9A 3SSQA 2MKJA 2Y0SD 2Q1LA 2ZDOA 2YNFB 3B4MA 3V6HA 3H42A 4X4SA 5A76A 2JHEA 1L3TA 1RBAA 1NDLA 3MGJA 5RUBA 3R97A 1D1UA 1KFDA 5F8MA 2UVVA 3IAM9 3QT8A 2GAHC 3CJ5A 1RHQB 3DLBA 1SC1B 2XYHB 1AT1B 1HNWF 3P6YC 3H5UA 4NXMJ 2CJYB 4JI7F 3G6VA 2X1BA 2FTRA 4DPWA 1DQ9A 3EUNA 4PWUA 2Z2YB 2VFUA 4F4XA 5F8NA 1N34J 2LVWA 2XLIA 3MPWA 1N32F 2RU9A 3PEJA 1R0AA 3AXMA 3BN4A 1B4SA 3CWJA 4Q8FA 3T5HA 4QYZJ 1RT7A 1NCLA 2NUHA 2WONA 2B3TB 2AYBA 3BQ1A 2VBXA 1RBOB 2XGQA 2ZFHA 1F5CA 1RAHB 2HHPA 2KJVA 3D6HB 3H8YA 4LRDA 1VQ8S 3EXYA 1BQNB 2OPPB 1M90T 3BPDA 1C1CA 4V19X 2ZNZA 3BSAA 1PCAA 1QUVA 2AHOB 3QT6A 2MQLA 3T6BA 2Y1JA 1Z1ZA 1VC6A 2OMOA 3D6MB 3DHXA 1J27A 2YWEA 1UA1A 1NPPA 3TQEA 2J7WA 3GWCA 3J81Y 2E9ZA 3FDSA 4CLTA 4URQU 2NYHA 5DS7A 1DTTB 1RT4A 4F04B 4CTAA 4WFYA 5JXSA 1TKTA 1KR4A 3NXZA 1HPZB 2MZSA 2QTWA 3OUYB 1EQ0A 2A10A 4CLUA 2ZZMA 2MQ8A 2ZKUA 4K4XA 3NGKA 4HKQA 4ECXA 4LFCF 3J7A1 2LXFA 2IYIA 4HI2A 3IWLA 1UCNA 3QBCA 5L9NA 1K73T 2IJRA 4M1KA 3F44A 3MR7A 3MPDA 4OJHA 5T41A 5AXNA 1NPKA 1DTQB 4MFBA 2HK3A 2W7OA 2Y0BB 3O2IA 1IVZA 4QWAA 4ZPDA 3D0GE 2VV5A 1ACMB 3NBPA 1S5ZA 4QWEA 1XMQJ 2UV8A 4LSZB 1B0PA 4DMZA 2BM0A 4GVBA 4I56A 3P96A 2MY7A 2F3JA 5KFNA 2MKKA 2CQ2A 4UZBA 3EPGA 1AW0A 2QA4S 2OFHX 2BUNA 4I6WA 5J2NB 2FHJD 2ZZTA 4QR2A 5EN1A 2VJUA 1I94J 1WOPA 4ZPCA 4AUKA 3C15B 4DV5F 2UXBJ 4LBPA 1GH8A 1PBAA 1FESA 4DFMA 2KVQE 2EC0A 3F0NA 4WK1A 1D0EA 4PG8A 2BABA 2QL7B 3PO4A 4X4UA 1FJ7A 2K1RA 1LFWA 3NG8A 2RJZA 5A0YB 4KV8B 4TN2A 3OR1B 2ZHOA 2BBEA 3TUZC 4X4QA 4EBEA 2KXHA 1FE4A 1U6ZA 4F3QA 3VAMA 2HNYA 1RWOB 2VC1A 4ED3A 2IJNA 3GV7B 1N5YA 2KRRA 2VFSA 2V4QA 2CUYA 2ALZA 4Q0BB 1Q8LA 5B0DA 1ZTTA 1FRIA 2N3OA 1X60A 5JVGQ 1ZETA 2GNKA 4W92B 4B9SA 1UEUA 2VASA 4UY85 1RU2A 4O4GA 5G0RB 3ZTPA 2IPOB 2BM1A 4DS5A 4CQ1A 3HK2A 1PYOB 2ZH3A 3PDNA 1JLEB 1VQ4S 2EC2A 2WBRA 4X4TA 1G6BA 2V8HA 4PR6A 1X9SA 3QLHB 4U96A 4Q43A 4ZCLA 4ZHRA 1NK4A 2HHSA 4RUCA 4EI2A 4RW4A 1PIEA 1WC3A 3M05A 2XZTB 4N8OA 4OV6A 3W62A 5IT0A 1KEKA 2D9PA 2B51A 1N5VA 1EP4A 2FHKA 2I9SA 3C6UA 3OL7A 2E1MC 1KP6A 2ZWOA 4IQMA 4ICLA 4OI6A 2E29A 1EX8A 1XNRJ 4O23A 5H9EK 1RCXB 2KB2A 3IR7B 4IOBA 5KFHA 3G82B 4GKJF 3FC9A 3GIKA 1HNVA 4BCAA 1OPZA 4MKAA 4F4YA 3GP9A 1GQEA 2HFSA 3HO1A 1N54B 1S6PA 1GMWD 3I0RB 2NZCA 3MHYA 1NB7A 5LM7E 2LP4A 1RKIA 3P45B 2N3LA 2EFQA 1CC7A 2BW2A 4IH5A 4P52A 1CSJA 3IMQJ 3W5YA 4DXLA 5HLFA 4ES3A 4ZHRB 1S1VB 4J9VA 3GB0A 5KFLA 2YNIB 2MGZB 2W9BB 1LW0A 2QN6B 4OLPA 2IA6A 2I5JB 3LP1B 2UUAJ 4F4AA 1SH3A 3NGUA 2JOQA 4USMA 4Q7AA 2KXFA 1R8AA 5ETMA 3DLHA 3UN5A 1N32J 4Y2CA 4OYPA 1IKVB 1IR2A 4DEZA 2IBKA 4F4KA 4AFFA 2HAFA 2BZ2A 3I55S 1G7CB 4ZLJA 1VQ5S 2XTJP 2AQ4A 2DH8A 4HDHA 4TNOA 2DR6A 4B9TA 2WVDA 5LMUF 2VG7B 1MW7A 4PEOA 2OPQA 1M1KT 1PYTA 5KG3A 3PW0A 1UAWA 2DR8A 4H4OA 2JEJA 3EGVA 3QGHA 1I5OB 3M8ZA 5A8KB 1R0BG 3EE3A 3NGRA 5DQGA 4KO0A 2MB0B 1VRUB 2GIRA 1WHVA 1P27B 1VOMA 2OFGX 1FNMA 2FZKB 4DOZA 1AROP 3AD9C 3DRPB 2RRNA 2D3OR 2CZVC 5B0EA 1UJ4A 1RTHB 3P4UB 3LUYA 4GO5X 3CW2C 3J80Y 2F8EX 4OX7A 2ATLA 4P9SA 4USKA 4DCJB 3OFFA 2BJ9A 3BPSP 2Z2ZA 4ES1A 1KHVA 2V8DA 4PG6A 3U7JA 5DQHA 3KLGB 2XYPB 1AZSA 3K17A 4PUOA 3EGZA 1Q8KA 4ED5A 2CNLB 2YQ1A 2YX7A 4A46A 5BXIA 2JFDA 1GFWB 1VK8A 2UXDF 2J6SA 1U8WA 4F26A 1FRXA 4RKUC 5KT3A 3M2RB 1H7WA 3QPIA 1JXLA 1L5UA 2H4YB 4JI1J 5HQMA 2DK2A 1RWVB 4ICLB 5KFTA 4K4YA 1AUDA 5KG0A 4F36A 4RBTA 1UVKA 2BEFA 2XEXA 4RNNA 1TKXB 2HNZB 3TJ8A 3KYLA 1TU0B 3FSXA 4JI0J 2KZMA 3BF4A 4BWJA 4KO0B 2AZ1A 3GSDA 1S1XA 3DOMB 5CYMA 4YHHJ 1Q86T 4UOCA 3K59A 3KMQA 1FEEA 3QSIA 4GMKA 3LWMA 2QEXS 1RAFB 3QWPA 1IKYB 4OHXA 1AFIA 3MMBB 4FYWB 1KVKA 4DBQA 3GE9A 4YB5A 2PC6A 3CMAS 3DCAA 2CJ9A 3A3PB 3PFEA 4JI6J 3QRPA 5IV4A 1FWLA 1N8RT 3QFHA 3S6EA 2B6AB 4U9RA 4J9MA 4OYMA 4DR1F 4AQYF 3CT9A 4DJBA 4NEZA 1WKJA 1QTNB 2OPPA 3Q8RB 1V6HA 2HQDA 1G4CA 2ZE2A 3M8WA 4O0NA 3BN7A 4DG1B 6FDRA 2R8GA 4IR9A 3OVBA 2RKIA 4J91A 4X4NA 1RT6A 3CDEA 3W5ZA 1NU4A 3BDPA 2R7QA 1MNEA 2KDOA 5IT9U 3EGNA 4ZLPA 4KSEB 3RB3A 4LR8A 2C22A 3C19A 1Q1KA 2OD4A 2BE9B 1UJ6A 3UW1A 4ECZA 3ZTSA 1D3WA 1DLOA 2KN4A 4KKOB 3IAS9 2ALYB 3IS9B 4V1Ak 3VV2B 4ZVTB 3MM8A 4KIAA 4O3RA 4YUDA 3QT7A 3CJRA 3H5YA 3CO0P 1HWKA 3ADAC 5B7WA 3UCGA 1F3VA 2W9CB 1W2BR 1V9OA 4IOAQ 2KL8A 4MK8A 3POTA 3M2VB 5IWAJ 2K7KA 1WKKA 2M9KA 3D7SB 4JUZA 2EG2A 3SMZA 1WG4A 1H98A 3JTNA 2GO9A 3CCQS 2L41A 4ECQA 4OHYA 2D3UA 2F7VA 2GVDB 2F65A 4DFJA 4IO1A 1EHWA 5E3PA 1N0UA 2DCLA 5HMXA 2UXBF 2RILA 3T5JA 1R8CA 3IGVA 2M5YA 2YKAA 3DI6B 2DPIA 1FVSA 5J1NA 1PJ5A 1NDKA 5KG2A 3FFIA 4WPAA 1PC4A 1RSCA 2Z2MA 4F7VA 1NSKL 2LQ9A 4YY3F 2CQIA 2DHHA 2BV3A 1FJGJ 3ENWA 3TW0A 1B0VA 1RTHA 4W98A 4URGA 2ZUAA 3PTWA 4EYHB 4DL6A 1TL7A 2MHEA 3AOAA 1TVRB 1HQ2A 5KFUA 3ZTRA 5ETLA 3FEYB 1PAUB 3MPUB 4DR3F 2NXNA 3MM9A 1MWZA 2CAJA 2UU9J 3QRQA 2R7XA 5A0YA 3CC7S 3KFWX 3NWGA 1CS4B 5ITHA 4C9DA 4QR0A 1NUEA 2U1AA 5F3ZA 1ZM9A 1C4AA 3WIVA 1Q79A 4I4BA 2J9EA 4F67A 4J9LA 1HIYA 2L9DA 3MR3A 4WFNQ 2VOPA 2V8GA 2WB4A 4P7TA 2VBWA 1HA1A 3TAMB 3ULHA 2FY1A 2RF2B 1NK0A 3CCLS 3DRRA 3VGTA 2MQOA 1N36F 2QX0A 1WC6A 3TARA 2FVSA 3HSGA 1Q7LB 2D7SA 5F41A 4DSEA 5THWA 4FS2A 2HVDA 2W7AA 5KG6A 1TL3B 1XMBA 3D28A 2V0NA 3D3CJ 5B0FA 1KWMA 3JAMY 4LRFA 5IM0A 3NGDA 4JI3J 5DLFA 3AFGA 2CQCA 3HHNB 3T1AA 3HVTA 2UU9F 4H4KA 4DSJA 3CC4S 4B3TJ 2EK1A 4E98A 3EVOA 1YJ9S 1FXDA 5F0WA 3TJ9A 2DPJA 1JJCB 4UF4A 3MTKA 2VONA 2AEMA 3DRSA 3GONA 1L3KA 1JLBB 3HT3A 1T8EA 4O0IA 1RI7A 2AJFE 3RW6A 2JC1A 1NNDA 3RGIA 2ASYA 1PKUA 4FKXA 2ZC4A 1CBKA 5GMDA 4DUYF 1KLNA 4DSIA 2MYFA 2JWNA 3GTYX 4ZPBA 5ETNA 8AT1B 4G1IA 2CNNB 1PILA 4DQRA 2HVZA 2BANA 3PR4A 1K1QA 2KRBA 2V63A 3MMCA 4WIIA 1OWXA 3W2VB 1JLFA 5JMNA 4UQTA 3I82A 4I1TA 3RZAA 2ZH9A 1ZH5A 1S1WA 1Y4ZB 3GSIA 5CD4H 3QSYB 1S4FA 2APOA 3NS7B 4B3OA 2Y1RI 4IR1A 4DV0J 1H72C 4ED7A 1U1QA 1RAIB 2VBZA 5D15A 4MK7A 5T14A 3PJWA 5FLXY 3OR1A 3HI9A 2ZM6J 1VDHA 1O51A 4RW7B 1V3ZA 2GS8A 3QYYA 5L46A 4DV2J 2C1EB 2DH7A 4LVOP 3BQ2A 1R8BA 1BE4A 2WTFA 2AF6A 4N77A 4JI5F 2IFXA 5IV3A 3MOJB 2C2OB 3M32A 4RW9B 1NKBA 1U1PA 2GHPA 2ZD1A 3QFWA 1U8SA 4KFBB 3IRXA 4O3QA 2B8PA 3GPAA 4RW6B 2BJ1A 2B5JB 2DD8S 1JX4A 2G2OA 1HI1A 2D3O1 4Z2XA 1SJRA 3ET6A 3R27A 4DWIA 1HL6A 2ZOGA 3HFVA 3OXFA 4DX6A 3GR1A 1VQOS 5AE2A 1S48A 4KY3A 3K8VA 5F3TA 4DL4A 3V4IB 5HMWA 1S7HA 3DKDA 4U67Q 2XLKA 5KT5A 2PFFB 2FPHX 5HVHA 2HGMA 1NRKA 4FPRA 5HSPA 1JLAA 1S6UA 3KJVA 1N4LA 2XQCA 1WG5A 1KHWA 4DL2A 3EJMA 3UWTA 3NL0A 5J2PA 2GJFA 3HHLD 2V68A 2PDAA 1S57A 3CJQA 3VAJA 3N5BA 2HRYA 4HTIA 4IH7A 4RNFA 4JV0A 5GAEU 1IBLF 2HMIA 2V50A 1UETA 2DXFA 1T9TA 1EJ7L 1RTIB 2V8VA 5SUHA 1YITS 1FTRA 2J9CA 3ILJA 1IKXA 2GHVC 4FVMA 4WXWA 1IN0A 4GC6A 2CZ4A 1VS3A 3GIMA 2CPEA 3CE8A 5DETA 3HZEA 5A6WA 4DCPB 1N33F 1LWCA 5KFGA 2EI5A 1LWXA 3DRYA 3HHDA 3OR2A 3GIIA 1SI9A 4C48A 4U7CA 3IA0A 1GMWA 2V2VA 4UW2A 3DXSX 3MF5A 1NPRA 2DGUA 4P75A 5B0BA 3OTOF 1U6FA 2OO4A 2RVJA 3H59A 4TKTA 4XPEA 2HPUA 3Q8YA 3UE2A 4ILMA 2UXCJ 3K57A 5J2PB 1JLAB 2M4MA 2V8PA 2LQ5A 4AXIA 5HROB 1IJFB 4ZMMA 1F60B 5A8WB 2R7VA 1YKWA 3DMJA 4P2SA 1C1CB 4DV3F 3MAHA 1X4DA 1UJ5A 1PBUA 1FDNA 2V4JB 2DNGA 3LGMA 4QOTA 4MTPA 4KPYA 4F50A 1JLBA 2QYCA 3ICLA 4F0HA 1OYDA 2DCUB 1S1UB 4I2QA 3I5AA 1RWMB 4YEAA 2GO8A 3Q23A 3TWZA 1RTJA 3P49B 5KFZA 2P9GA 1ULRA 4K2JA 2C2KB 1RB0A 2LA6A 5K8OA 4ED8A 3IFEA 1ZZNA 2RF2A 3D2WA 2B56A 3QIDA 2FJDB 3BH6B 3W60A 3Q2SC 3LP2B 1MN9A 1ZA2B 4PG4A 3SV3A 4X65J 2HS0A 1HQUA 1TMMA 3CTRA 1F5AA 1RT6B 2E7WA 4USWA 2LCWA 2CQGA 3PXGa 4LRAA 3PO5A 3D67A 3G6ES 4PKDB 3HLUA 1EQMA 2X51A 3MEGB 4I2PB 2AGOA 3CDBA 4P6QA 4NOHA 3QZ8A 3BGUA 1YI2S 2UUAF 3G8TA 2BW7A 4DUZF 2E1AA 2H1YA 1J5EJ 2JZ5A 4DX5A 4MIWA 3R5AA 4QIGA 3L95X 3V81B 1SH0A 4AXJA 3M6XA 2RT3A 4ED6A 2M2BA 3FSIA 4RU2A 1DQ8A 1ELOA 2C3UA 3JS9A 4J7CA 5D0HA 5HP1A 2DR5A 2FGCA 2BOPA 1HQEB 3IG1B 2YNHB 3W65A 1H2UX 1LW0B 3EGWB 3V6JA 1SQFA 2A1BA 4XPCA 2VBYA 1RT5B 3AA8A 2G0IA 2HIYA 3DGVA 5B0AA 3WC2A 1AXQA 1RT1A 1YVFA 1HI0P 4KBIA 3OQ2A 1TKXA 2NXJA 3KG4A 1WC5A 1SQGA 4NLOA 2F5GA 4BC9A 1FVQA 4OYBA 1XNQJ 2UXCF 4OYXA 1Y7PA 4KTQA 2RHSB 2WVBA 4NL5A 5KFPA 3RB4A 5GAHI 5IOLA 3GMGA 2OEMA 2O66A 2YNGB 2CQDA 5CH7B 3SEOA 3M2RA 4CI0B 1X8DA 2ROEA 5F8JA 4A8MP 2BJDA 4B3SF 2QFIA 3C14A 3C16B 1HD0A 2V2QA 3I0SB 5FLXU 2DISA 5A2QY 2EFOA 1QSLA 1DAXA 4OX9J 3FZ2A 2AWZA 1WF2A 4NA1A 2W01A 4Y2KA 2BQ3A 2DIVA 1HARA 1SUQA 3MM7A 1NZAA 1VFJA 4OYZA 4RPFA 5DDQC 2AGPA 2OP5A 3RAMA 1SJ4P 3Q22A 1U7LA 1Q4RA 3HULA 4X64J 1S6OA 3WHIA 4LSNB 1VR6A 2WZ1A 4Y3CA 2Q3PA 1SXLA 1NB2A 5F8IA 4D3HA 4RU9A 3DRRB 4ZIVA 5T7LB 3A8EA 4WK3A 6AT1B 3QGPA 1TP7A 3AJDA 1D8YA 3NNCA 5I42B 1VYAA 3NY0A 4B9VA 2NXUA 3E3XA 3KLIB 4QPXA 3HD2A 5H9FK 2CQHA 1U0HA 3UDEA 4DU8A 1FD8A 3CC2S 3BS9A 3T6JA 4QYRA 2IC3B 5HQ8A 3KLEA 1F9HA 4A8WA 1X9WA 2F4FA 2K1RB 2X1GA 3DNCA 4EBDA 2ADCA 1N5SA 2CPHA 2FVRA 3FBFA 3CMES 4DX8H 1AYEA 1RHUB 5L1JA 2PA8D 4OX6A 2QL9B 4GVLA 3C15A 3I6PA 2GVZB 2VODA 2GMJA 3AOBA 3KLHA 1JLQB 1SJ3P 5C2GA 1IKVA 1NHKL 3QT5A 4U7UK 1VRTA 1SL2A 4TY9A 1LOUA 4DSLA 1S9EA 3KUEA 2FJAB 3LP0B 1DHMA 2I5JA 1T05A 1TTHB 4KGMA 4J9NA 4XIUA 2XBPA 4H4KC 4NI2B 2CQ1A 1BUXA 1NK6A 4DV0F 1WELA 1QM9A 2DTJA 2HLTA 3W9JA 1AFJA 2HSEB 2IAJB 4Y00A 2C2EA 3GCXP 1BGXT 4NLVA 2EBGA 2ZHAA 1UPPA 4C7QA 2HHVA 2ZBPA 1TV6B 4LFAJ 5DLGA 5E5NA 2YWWA 2HNDB 4HT7A 5T7LA 1HR0J 3AB4B 3QO9B 2VUGA 1B70B 2J7KA 2YX1A 1DURA 3HF5A 4H4MB 4L76A 2DNLA 4NLYA 3OHBA 1HD1A 3CUNA 4J9SA 3CNQP 2DH9A 3D1QA 2MJNA 5GMEA 3ENAA 3MDFA 4IUFA 3MXHP 2CKWA 1S76D 4ILRA 1X5SA 3GJSB 1U1OA 2MZRA 5LSOA 2AJ1A 2HRUA 2WOMB 3SBMA 2LDYA 4E2FB 2DKOB 1OO0B 2Z58B 2V5HG 2I1RA 2YKNA 2ZEJA 1FFSB 4NI2A 4WJBA 2FB0A 2IAJA 3I0SA 4X84A 2R3VA 3RJMB 3DLEB 4ZVFA 3FCVA 5K8MA 2HVEA 3W9IA 3GILA 4ER8A 2M3DA 2RKIB 4QIVA 4YMEA 3MURP 1XN9A 3AQPA 4EWTA 4ECUA 2EBEA 4NLGA 3QJLA 4JI3F 1RUSA 5KFMA 1ZPVA 2W25A 4RUBA 4ANEA 3PW4A 1R8PA 3D54A 5KFFA 2W8KA 4DLGA 3C6TA 4QJVA 3LH2S 1VRQC 2ZITA 2DJWA 2Q43A 1UEKA 1BHNA 3GYXB 4XO0A 3RAXA 1N36J 2DR7A 1CC8A 2HS3A 4PCQA 4RBVA 4EYIB 1B0TA 2MY8A 2O01C 1FE0A 3QRRA 1IKYA 1UEVA 5CCLA 4G6VB 2DNMA 3BKUA 4DL0C 5DQIA 3K5LA 1M5PC 1H3DA 3S7RA 5H1SV 3WQPA 1NH7A 3N79A 2IBOA 2WOMA 3R7BB 4NCGA 4URSA 1MMDA 4ZCIA 1HNWJ 1Q82T 3GFXA 5CQGA 5J2MA 1TL1A 4FF1A 2C2ZB 1HW9A 3FUYA 2Z30B 3A13A 2KFYA 1VBXA 1WHWA 2HFOA 3NS6A 2G13A 2HFVA 3TUPA 1GXUA 2D74B 5C24A 2RU3A 4ED2A 2M8DB 3QGIA 2OH2A 4JI2J 1CJUA 6FD1A 1D09B 1T9UA 2GMLA 1FRKA 3E01A 5ETPA 7FDRA 2OPSB 2DXEA 3LAMA 2PMZD 1PJ7A 5LMUJ 2GJ2A 2HBRB 3PNIA 3OHAA 3FEZA 4PYDA 5J2QA 4WKYA 4PUOB 4MIAA 2XZDB 4NLUA 4DUTA 2IRUA 3TZWA 4ECSA 1K9MT 1CJTB 2FUG9 2XULA 3M6UA 2XNRA 1SB6A 2HIQA 4FPIA 1TMJA 4NMXA 1IWGA 4FYDA 2FDNA 2MLYA 2DY9A 1IR1A 3LPEA 1JLEA 4DSFA 2FVPA 2QO3A 5D0GA 1FKOA 1S4EA 1C0TA 5J1EA 4U95A 4ELVA 5BJRA 3JXOA 5LJ5Y 2Z56B 3M30B 3PX0A 2AD9A 2VPZB 5EWEA 1RADB 2B9XA 3FGVA 2C3PA 3CJSA 1DBDA 2LQ8A 5C25A 2X1AA 3CIZA 1VQLS 1C1BB 1V5VA 1NAQA 2CDRB 2V69A 2KG1A 3AJ1A 1PAEX 2QMUB 1DQAA 5HBMA 4BLGA 1U2RA 1Y3KA 4I7FA 4ELUA 3US5A 1KFSA 3F41A 1T11A 3D6FB 3CJKA 3CCJS 3PW2A 2VB6A 5DG7A 4FVCA 4LF7F 2WAQD 2DNRA 2JNJA 1ZTWA 2ABYA 3G8SA 1H0HB 3KKFA 3MAAB 3BSOA 4NCBA 2F9DA 1RTIA 3MEGA 2SXLA 4OQJA 1X4AA 1KQFB 1S59A 2YNIA 1KQKA 2HRTA 3U1NA 2LLZA 3VVUA 5KOXA 2MGZA 3OXGA 3LP1A 5E3RA 1LWEA 1PGZA 3CCVS 5B08A 2JLEA 2W2NP 4LFCJ 4LFBJ 1V5IB 1CLFA 4EU0A 1Q16B 5C42A 3G87A 1SBRA 5DDRC 2PA3A 4C6AA 4LVNP 4FZVA 1K47A 1RHKB 1SJQA 3KK3B 2YKMA 4I64A 3HZGA 4ETXA 3MMJA 2FLOA 3GFZA 2DRDA 1AUSL 4DR7J 4QWBA 1TL4A 2CYYA 2KJWA 4FXVA 1Q0NA 4P71A 1KVJA 2R2SA 2W2QP 5MLCV 3H4BA 2DNNA 1RU1A 4OZ5A 4CT8A 1MN7A 3Q8VA 5E3CA 4JI0F 4BWMA 3OLBA 2DNZA 2NS1B 3DYAA 4KFBA 2XC9A 2HHXA 4B9LA 1R43A 2OD6A 2PEBA 2DNPA 3ITHA 3VF0B 2DYAA 2DNKA 3VGSA 2DRAA 1NK9A 1KNZA 1FJEB 1GAOA 4QBUA 4YDDB 1S49A 3UN2A 2QG9B 2HQIA 5DDPC 4EZ6A 3K8WA 2YXLA 3RRHA 5L9XA 5DDOC 1RAJA 3GJQB 4I0WA 1REGX 3BGRA 2U2FA 4GKKJ 3PRBA 1X4CA 4NCAA 3N6NA 3WC0A 2VKRA 5ADZA 5KT7A 2HQCA 2YPYA 9RUBA 2Q66A 4OIXA 3L3CA 2QFJA 1VQNS 2NR0A 4N47A 1EB0A 1BWVA 3CCZA 1M1GA 3KXDA 4BHQA 5HN0A 3M9MB 4B3MF 1W7WA 1FK9A 4NXMF 4I2PA 4ED1A 4IRDA 4KV8A 5KTQA 1K1SA 1ZZFA 2MPUA 3I96A 3ZZPA 1QD1A 4CO3A 5C5JA 1T9VA 5KT2A 2MSSA 2P9EA 2A2CA 1HQUB 2ZH5A 2XMUA 1OQ3A 2NUUG 3MECB 2ROPA 3KJVB 4KGZB 1JJHA 3UQSA 1NBEB 2COLA 2OEKA 4IG3A 1YIJS 4EMDA 1WUUA 2EFNA 2I8EA 4O4RA 4JV5J 5J1PA 2B43A 3MR6A 3DU6A 3WX8A 1QAYA 1I3OB 3PV8A 2XO6A 1UVMA 1M5HA 1FRLA 3DDNA 2IVYA 2XMWA 2YY3A 3DM2A 3H90A 4PXCA 4EFAC 3D68A 3I9ZA 2E9RX 2F1FA 1MSWD 1JB0C 1GNKA 4HHHA 4NPOA 3DMJB 2H4WB 4KGXB 3TA2A 2ZD1B 3TAMA 3ZFVA 1MMLA 4MFBB 1F3FA 4J5OA 4ZP8A 2QJ3A 5IZHA 5AXKA 2X3GA 4JI5J 2OELA 2QMWA 1RTJB 4ZVOB 3HVRA 3MFHA 5KG7A 2YBVA 2YWKA 1N48A 4MKYA 2Q6CA 4HEA9 3J80U 4MT1A 2RSQA 5DZ7A 2GIQA 4QWDA 2KFZA 2NSCA 3T1HJ 5DO2A 3CJ0A 2RNEA 4NYZA 4DZDA 2ADBA 4A4JA 3CB4A 3HSDA 4WP9A 4M5KA 1UKUA 4HVZA 1BQMA 3D1OA 3MPVA 3NGSA 3M8QB 3HCXA 1UW9A 5M2RA 1C0UB 4U7UD 4WZMA 2XMKA 1WJ9A 1C2PA 5KFCA 3D4JA 4LSLB 2DGVA 4RLEA 3GG1A 1PO6A 2NLWA 1YZ6A 3AQOA 3PHEA 2XY5A 2A6OA 1FI4A 1NKEA 5C25B 4JI8J 4K59A 5E41A 2IVFB 5L8RC 5CZVA 3R5JB 3RBDA 2FJVA 2CWXA 2UP1A 1RACB 5CA5A 4ETZA 4LFBF 1TK0A 2RQ4A 1KN6A 1C0TB 1F0XA 3HKWA 2MZQA 1U4BA 1FERA 1EAYC 2CG8A 3NAIA 4Q2MA 4CLKA 2UVWA 1FKOB 4WP8A 5J1EB 1DZ5A 2HFZA 3A3NB 2HMIB 1D9AA 2YVSA 3TVZA 2DGOA 4UT4A 1HMVB 2JEFA 3U1MA 5IFMA 3PX4A 2OJ3A 3BGOP 1S9GB 3DHWC 3RUBL 2KM8B 2K8GA 2YKQA 4AT1B 1TK5A 3QQCD 4ZS6A 2O3DA 2EVZA 3M8SA 1FKAF 5DZ6A 3NP5A 3U27A 1IKWA 2AJ0A 2OPRA 1TUWA 5E3QA 1FHTA 5G4DA 2W4DA 2FGOA 4C8MA 2G1HA 2KG0A 3E01B 3M2VA 1Y0HA 4RW7A 5AXLA 2WW8A 4IG3B 2B4PA 5EDWA 2XY7A 3MAAA 3ZZ0A 3LTOA 4C2MA 2YKMB 1WSVA 3QATA 5F8HA 4DR4F 1DLOB 4KKOA 1X5OA 2HQ3A 1H7XA 4PG5A 4FXDA 5LXYA 2RQKA 3DC2A 3SSRA 3MEKA 3W64A 3A8KA 1FKPB 4KHRA 1HHQA 2IM2A 2PN6A 2XMAA 4ERDA 1RXOB 1TZ0A 2F4VF 2HVHA 1TKZB 1ZM3A 4NZ0A 4CO0A 2F8MA 5IT4A 2IMWP 1RYSA 5CYMB 4ZVPB 3IBCB 2GV1A 3T5LA 4MH8A 4Q2LA 3ZZOA 4DR7F 2HHWA 3VAHA 2HS4A 2GQ2A 3BGLA 1WC1A 5EUHA 1TVRA 1VJWA 3RBXA 5KG5A 4X64F 1T3OA 3TAQA 1H2VZ 1WNEA 4ENOA 4FXWA 3H5SA 1NSPA 4DR6F 3SI8A 1JNRB 4XDCA 4P74A 3BEGB 5JJBA 3NAHA 3SFUA 3JB9k 2HFNA 1NDPA 1YJUA 3DLEA 4IG0A 1SH2A 4J9RA 2BANB 2J8AA 4GO7X 4LF1A 4PWWA 1TFYA 2AIRB 4P72A 1NK7A 3FFIB 3K58A 3KHHA 1YWXA 3ENQA 3ZO7A 1ITPA 4NX9A 2VHGA 1ZPWX 2NYIA 2P6TA 3KJNB 3UI3A 3HFKA 1S7IA 4DR1J 4AQYJ 1OS5A 4I6AA 4QZVB 2R2TA 5DM7Q 1A7GE 3I32A 4TLRA 3B4DA 1F1BB 2E5HA 2BOAA 2OSRA 3MCMA 3MCNA 4YB7A 1JNZB 4C3KA 3POTB 5EWGA 1RKJA 2N4DA 5D0EA 4KB7A 3RRGA 4LF4J 2W9CA 2K3KA 4IDKB 2IDLA 1U26A 3ILLA 1IQZA 1P9QC 4LF6F 1GTHA 2OTJS 2CQBA 3DLGB 4DZ6A 3KTQA 2B8QA 4MAKA 2A18A 2YX4A 4USJC 5J2MB 3UNYA 4RUHA 1U02A 3LGNA 5DRKA 3SCLE 2DO0A 3VHQA 5HMYA 4DUZJ 3PM9A 3IC1A 4OI3A 1LXNA 1TK8A 2DHAA 5L1KA 3RR8A 1LWEB 5AXMA 1ICEB 4NASA 1FFGB 1NXIA 3MUVP 1CJUB 4P2FA 1KLMB 4JI1F 1T3NA 4I68A 1KD1T 1SC6A 4EBCA 3OTEA 3M8RA 2ZNYA 1N6QB 1PG5B 1CEZA 3C46A 4M5HA 2KVIA 4MKVA 5IQ6A 2JLFA 2JC0A 1Y10A 1XJWB 2HBYB 2WVFA 3OFEA 5FDLB 2KH9A 3VAKA 1VC5A 4QPTA 1N34F 2KTQA 1S6QB 4NLWA 2KYZA 3TVKA 3Q8QB 4CNZA 3E51A 4DN9A 4JI7J 2R8HA 3HHLC 1X5TA 4ZP9A 5A2QU 4TYBA 4Z7CA 2YWHA 2UUTA 3MD1A 2X3DA 1S1VA 2Z0GA 2GAGC 3SFGA 2I2YA 1FJCA 2IVMA 3BV8A 2BR0A 4JOUA 4JB8B 3QIPA 4RWXA 2YKPA 2HZCA 5AJ3J 2MEWA 1RWNB 2V6AA 2E5JA 3GYGA 4MYTA 3CCMS 2D69A 1WOSA 3H7HB 2B9YA 4G1QA 3ZXWA 3KLVA 4QIWD 2FIUA 4OMFG 3OSPA 1U1NA 1NK5A 1QLNA 2AYGA 4BDPA 4JP8A 1U2CA 4I69A 4OHWA 4LIRA 2MQPA 1NJYA 2NXCA 3H20A 5GAGI 1Y00A 1XK8A 4ZVSB 3C6UB 3H5XA 1A0OB 4C11B 4K4UA 5CYQA 1FO1A 2A3JA 2DB1A 2JH3A 2R8IA 3GFYA 4DF8A 1HNZJ 2IDEA 1Y5LB 4C0BA 3IRWP 4ZVQB 2GFFA 4A8KA 4EZ9A 1JKHB 2VFVA 3Q0AA 4FS1A 3AOCA 3HDSA 5I3QA 2OPSA 2N7CA 4YHHF 3NOGA 3LOUA 4CH1A 3QWUA 5ETVA 3ZNJ1 1IBKF 3TAPA 1IBMJ 3VQTA 4DV4F 2BQUA 1UFWA 1WHYA 1EP4B 4ZCKA 5CD4A 2G1DA 3AD7C 2LXIA 3J81j 1UVLA 1QVFR 5ETKA 4G1QB 3KK3A 4NCGB 4R8UB 4WU2A 4Q0BA 1TL1B 1PYSB 3AH6A 2HBZB 3M7VA 5AE3A 2ZBIA 3EZOA 2XCAA 2HNYB 1VHIA 2YQ0A 3Q24A 4J9OA 4DS4A 3EDQB 4PRFA 4WE1A 3R6LB 1X7VA 1XMOF 1ZYQA 2F63A 1HBOA 2LQJA 2LQBA 3M2UB 2WCXA 3HD1A 3DN9A 3NOCA 3VZHA 1NSQA 3V5RA 4IO9Q 1FRHA 4YR0A 4GKJJ 2ZUGA 4PG7A 2KU7A 1LK5A 5D6GA 2DITA 2VQEF 1SPBP 3R3TA 3UFCX 1F6TA 3BKFA 1HNZF 2EK6A 2UZAA 3C6TB 1HR0F 1UVJA 2LFVA 1JLQA 3OVAA 4DL7A 4NLRA 2KYXA 1HYSB 3MUMP 1UPMB 2RRBA 4DF4A 1N6QA 1T9YA 2M52A 4M63A 3R8YA 4ZPAA 5F8GA 4DCOB 2W9AA 4A8FA 1RJJA 3SV4A 3VR1A 4NE9C 1S97A 1M1HA 4MK9A 2CJAA 1C1BA 2BE7D 2BJ3A 2QC3A 2LEBA 5E2QA 1NZ8A 1S1XB 3DOMA 4YB6A 4X4PA 4LF8J 3KOAA 1NH8A 3Q8UA 2KHCA 1JKHA 2B0GA 3B54A 3PYDA 1RABB 3UD5A 5AJ3F 2ZM6F 5MAOA 1FT8A 1SL1A 3KDOA 2QSFA 3UNGC 4CT9A 2HHHF 1F9EB 3UN3A 4ZKAA 4QWCA 1RK8A 1WC0A 3FSYA 1DTQA 2RD5C 4DV7F 3B8HA 5KFRA 3EVMA 1QVGR 5A8RA 4OI0A 4HR2A 5GAGU 2AZ3A 2QLWA 4L3KA 3GZ7A 4KHMA 4UUXA 3BR8A 4LF2A 2DNOA 4CIOA 2V2ZA 5D0RA 2KHDA 4ZP7A 1CQNA 1UZHA 2B7BB 3CJ2A 4CZCA 3CCES 5A8WA 3PG9A 1EIYB 2DGXA 3A3OB 2J0SD 1TV6A 1RP5A 3KLGA 2R9LA 4DUYJ 2V2KA 4CM2A 4DI6A 5HROA 1KS2A 2QLJB 2XSFA 5HK4A 4K4SA 1HHTP 1DFDA 3ZNUA 1RTZA 3D0IE 3EPIA 3C14B 3TZYA 2CIMA 2VKZG 1KONA 2R7WA 5CCMA 3FNNA 1IXKA 2J6TA 2Q6BA 2VC0A 4U8YA 1XMQF 3CD7A 5HI7A 1LWCB 4V19J 3C8YA 1S1TB 3KWMA 3OJUA 3O44A 2CA9A 1N5YB 3BB5A 5KFOA 1J2VA 1R6YA 3CD0A 2WVEA 2FHJA 3P3DA 4X4OA 3MMAA 2CXEA 4TYAA 1JQGA 4PPDA 5KFIA 5I4MA 2MZTA 4X62F 5DM6Q 2R8KA 1HQEA 2ILYA 1LWFB 1KBRA 3IG1A 3PJXA 4N8NA 2OTLS 1I6JA 2K3IA 4CLWA 1LQ9A 3PACA 3R5DA 4IFYB 1RAOA 2ZH1A 4UOHA 1WEXA 2PD1A 1FWPA 1VIOA 3TOQA 3V81A 1YG0A 4Y6IA 5HL7Q 1CJKA 1TQLA 1W2IA 2CQ4A 2MDAA 2EEYA 1XNQF 1CJVA 4HH1A 1WWHA 1TUGB 1BWEA 2HAIA 3PRDA 3W5XA 4RWWA 2IMOA 1SV5A 4ECWA 4DPUA 2FVCA 4K8RA 4OZNA 2WRMA 3VQSA 5I3PA 4G3IA 1HBUA 2CADA 2W4PA 3TO8A 3CO9A 4RW9A 3LP2A 1U1KA 2QA1A 1M0SA 2CJBA 1QSSA 2HQFA 1S6PB 3OVSA 3EXCX 3M32B 4UTGA 2CZ9A 2LEAA 3N9UC 3TEHB 2IY5B 5K9FA 1UL3A 2G9OA 1SKSA 2QLXA 1J5EF 2VPYB 1RWKB 1UMJA 4CRJA 5LOQA 3OJSA 3M9OB 1NJIT 3B6BA 1GEHA 1FK9B 1KOOA 1T02A 4H4MA 4OYOA 4Q44A 4XK8C 3SDEA 1Y11A 3JYTA 1S9FA 4HHJA 4OZ1A 5K14A 4W90B 1HWJA 2JDJA 5DJBA 2YKOA 3KMSA 2BE2B 5FD1A 1WEZA 3S8SA 2HFUA 4L73A 4X65F 1L3UA 3R6GB 1G3OA 4LF4F 4PQUA 4J9QA 3LW5C 4B9NA 4RUAA 2G0JA 2BKNA 4MMOA 4IFVA 1B3TA 3OXLA 1R31A 5IQQA 2RDIA 5K8PA 2OGUA 3HX9A 3I9V9 3FKBA 3O5TB 1OIAA 4L74A 5CXTA 3G6XA 2YH1A 2W1BA 1U2FA 2BX6A 2V94A 3ITHB 3ELHA 4QW8A 1S0OA 2JEGA 3TEGA 1FA0A 4ZA1A 3RU0A 3PW5A 2CJKA 5KG4A 4LF8F 2F40A 2GVZA 1RAAB 3GG0A 4RL1A 1X4BA 1RWWB 2ZVIA 2QIFA 4DFPA 4NLTA 1M5KC 1A9NB 1KKHA 1NJWA 1MLAA 1YLXA 1T03A 2AEJA 2NZ4A 1OMSA 2J9DA 2XG8A 5E7OB 2MKHA 3UPFA 2NCKL 4WYLA 3UD3P 1LV5A 2UXDJ 5F0UA 1AB8A 1LNQA 1RISA 3SSSA 2E5LJ 2G4BA 2JVRA 3FMBA 3NBPB 4OZ0A 2QLFB 2VICA 1TELA 2CWKA 4L75A 5HANA 2OHDA 4JI6F 4O44B 1H73A 3RTVA 2GGPB 4OV1A 3NS5A 3X3UA 2AGQA 3SCJE 1JXEA 1HNXJ 4ECVA 4LSNA 1Y5NB 1FX4A 3NKYA 4RR5A 1WDTA 3T3FA 1N5TA 3V4MA 3UDCA 5KT6A 1APSA 4R0JA 1VBKA 1CJVB 3TNVA 3MR5A 3MECA 4DV6F 4NXNJ 2W4CA 2GCFA 3GIJA 5C7PA 1XR6A 3T1HF 1RTDB 1B64A 4OHZA 2Z2LA 3Q2TC 2H48B 3D5MA 4DQSA 3M8PB 1VJQA 2GZOA 2HEKA 4DU7A 3ISZA 2M70A 2VFRA 1LWFA 1WF1A 4TY8B 1RT3A 4XTTA 3KHGA 2CQ3A 3QJJA 2EFPA 3SCIE 2VF3A 4F25A 3G96A 3OW2R 3PRVA 2E1CA 2P8IA 2AX0A 4BS2A 3KLFA 1U47A 1REVA 2XWYA 1LFPA 1P8GA 2EKYA 3EM1A 3ISND 3KG1A 3CGIA 1OY6A 2LU2A 2C3MA 3QAEA 3R5GA 4OX9F 3ZZYA 4CLPA 2R7UA 1N0VC 3D9BA 2RRAA 2ASJA 4DV7J 1NEEA 5D78A 3FMWA 2HZVA 4USHA 3UD4P 1HNIA 2JRSA 1S12A 2XWXA 3RR7A 3ZTQA 3HT0A 2IHR1 1T7PA 2CDQA 2NSBA 4DN0A 1B99A 2ZBQA 4KE5A 5KFXA 2BQRA 3M8PA 4NLQA 3CULA 2AYEA 2ZH2A 3I5BA 2GMHA 5ETSA 2DGWA 3HMJG 2B4VA 2K7JA 2Z8QA 3DRXA 4PWDB 4K0KF 3MEDB 3UCZP 2PMWA 3VAFA 2FHMA 2VG5A 2YQ3A 5IM0B 4U6PA 3EDRB 1DARA 3U1LA 2VPWB 3WZ0A 4F8RA 5I3UA 1KRPA 2I38A 2IM0A 3QAUA 2CPJA 1VQ9S 4E0DA 3ET6B 4NWBA 3MZIA 2RUGA 3MM8B 4OI1A 3OT9A 4PAAA 1IKWB 2B5JA 3K7RA 7FD1A 1CJKB 4HYKA 1XERA 5GVQA 5HJXA 2HZAA 3OPKA 4AE5A 4DSKA 5C42B 1IUJA 1MWQA 3RW7A 2E5GA 4OL8A 4C8KA 2BRKA 4O3NA 2BXJA 2FYXA 1XTZA 2IA0A 4M5JA 5KFYA 5GMKa 1FTCA 1PSDA 3VCDA 2D1CA 3A12A 4YN3B 4LR9A 3M1VA 1XR5A 4OZLA 5HO4A 3BM7A 3IGNA 3GLJA 4ELTA 1WC4A 4UQGA 2A2DA 1JIHA 1MROA 2R8JA 2ACYA 3T9ZA 4C3LA 1R8HA 3MMBA 1WTFA 4WTYA 5LMNJ 1IQTA 3ONQA 2ZZNA 2J9DE 1RA6A 2BVZA 4RX6A 1H38A 2XZWA 1MU2B 3TQ1A 2DO4A 4LF6J 1URRA 3PKYA 4CO4A 1NO8A 4CO2A 3H25A 2PGCA 4F3MA 2H5EA 3SCKE 3CXCR 4IKAA 1S1TA 4M95A 3AXKA 1MWYA 1VQPS 4TU9A 5HVFA 3M30A 2KT5A 3DGPA 3LGHA 1ZM4A 4LQ9A 4M5LA 5KAKA 3BSNA 2DNHA 1LXJA 1XWLA 3KLFB 1QTMA 1KVIA 4NRTA 3JYTB 1NDCA 4F4ZA 3JTOA 4OJGA 4ANCA 4G65A 4CLZA 4TVAB 1SC3B 3D1HA 4AL6A 3NNHA 2I0XA 1DJ0A 1FRJA 4TQSA 4DR5F 1XIQA 4K7QA 2LXUA 3ILIA 3UR0A 1X4GA 3KHLA 4WZQA 2RDJA 4EK2A 1QE1B 4NMLA 4RNMA 4LREA 1CJTA 1YK9A 1NK8A 2FZCB 2VU5A 3HHLB 4DPXA 3OTCA 3V4IA 3NWRA 1S72S 2B4OA 2JL9A 3G2XA 3EICA 3W7BA 1N56A 3HJVA 2L9NA 2D41A 5CHCB 2BKPA 4G1PA 4N56A 1XQIA 2E7XA 3H0PA 4QW9A 4LQ3A 3OFGA 3BH7B 1ROFA 1VHFA 2GGPA 2L08A 4MYUA 4PYAA 2JLGA 1Q8BA 2FZGB 3L9ZA 1ZAXA 2NXEA 2XO7A 2RB7A 1I94F 2FD2A 2LKZA 2LU1A 4C8ZA 1WOOA 2E66A 1O0PA 1K0TA 5A8KA 1YHQS 2KI2A 1Q5VA 4C97A 3MEEA 2IC3A 2KT3A 3KLEB 3DDKA 3MM9B 3CCWA 4UOFA 3EMTA 5L1IA 1P9YA 4FYXB 3NNAA 3K5PA 4RNHA 4TXSA 4YS2A 2DEIA 4R8UA 3VAGA 3CJKB 3SXLA 1UVNA 1WORA 4DHVA 4FKYA 3HVAA 1UFKA 2C2MB 2J0QD 1RQ0A 4OYIA 3V6DA 2E1PA 3NCRA 3DFEA 4JI2F 2M8HA 4E8UA 4QR1A 4ZLLA 2KM8C 3GQCA 3O6QA 1Y3JA 4P10A 1KLMA 3W1YC 4O3OA 3QMQA 4HH0A 2CNKB 4ID5A 3BO4A 4JV1A 1FDAA 3CDWA 2ZH7A 3HHLA 1U1MA 1EKRA 1JLGB 1XBWA 3I4PA 4H54A 3TRGA 3QZ7A 1W25A 4YB1P 3EZ5A 1VQMS 4QU6A 1KTVA 2Y3YA 4W4MA 4IQXA 2EW9A 5J2QB 2DHSA 3GJTB 2ZJPQ 3PZPA 1HNVB 2MQMA 3G82A 1S77D 4KJIA 1OSDA 4WXOA 2VQEJ 1VC0A 1QAXA 2AT1B 2BMBA 4LIWA 5LT5A 1QSYA 5C24B 4DQPA 1FXRA 2HNDA 3H2VE 2FJBB 4P2MA 4UOGA 5HVGA 2XMVA 2XHWA 4R5PB 3DU5A 3QO9A 3CPWR 1VMBA 2BKOA 2UUWA 2RUSA 3IS9A 3F56A 3MTJA 3CCSS 5K8NA 4JI4F 2BJEA 1E6YB 5LSRA 4LBIA 2ATCB 3SQGB 3AODA 2G0CA 1WI6A 1OQ6A 4ID5B 4OYWA 3Q89A 2GX8A 4F0KA 2E9TA 5M2UA 3A8IA 1JLGA 2X1FA 3TX0A 1SKRA 1HHSA 2HHQA 2UVUA 3PEHA 3THPA 1VQ7S 2YNHA 3L09A 4JV5F 3J7AN 4OJ1A 1U1RA 4LF9F 1IM6A 3BBCA 3IWXA 3LALA 3OD2A 3V6DB 1JWWA 1F2HA 3DRPA 2VIHA 2PI4A 1HWIA 3UDLA 2CPZA 3JQKA 3MM6B 1ZAVA 3FRYA 3JSMA 3W8PA 3SZ2A 1KOHA 5KFQA 5KFJA 4X2BA 3B82A 2NPFA 2XM3A 4H4OB 3CJ4A 3D3BJ 1HBOB 1YBUA 3M2UA 1HLWA 5L39A 1CULA 1KQGB 4ILLA 3T9NA 1RZMA 2Y1LB 1VGYA 4J9KA 3CCTA 1TKZA 1ZOTA 1GTEA 3BREA 3KLIA 2M88A 3CCUS 4ECTA 4L6V3 4LFAF 3CD6S 1U0HB 4B9UA 1S6QA 2C2NA 1M5VC 2DY1A 2QA4G 2AMCB 1FDBA 1RWUA 2CQ0A 1F2GA 3G6YA 2O1PA 2ACMA 4N41A 2DR9A 3JAMU 4AL7A 1SC4B 3G4SS 1NMEB 1NHVA 4R5PA 2JX2A 2MJUA 1FXLA 4X66F 3FEXB 4B3MJ 4GVBB 1V3RA 3TUJC 4OZ3A 1R0CB 1Y5IB 4Y2MA 2Y8WA 1RHRB 2UUBJ 2H5JB 3HXMA 1LKZA
chains in the Genus database with same CATH topology
2DBBA 2V4JA 1Z4UA 3D0HE 2XGPA 2ZOFA 1X0PA 4EEYA 4DQQA 3X1LB 2N82B 1OPIA 5D3GA 1WF0A 2V9KA 2JEIA 1M5OC 3K0JA 4GKKF 5KFKA 1UFLA 1YJVA 2FJWA 5HMZA 4FBTA 2OIHA 1YTYA 1XEZA 1R27B 3J7YU 2HHTA 1WD6A 1LW2B 3CCRS 2CPYA 1J5OB 4K4ZA 1X4FA 2M0GB 3GFHA 2BACA 5KFBA 4N5SA 1PC5A 1HPZA 2RMLA 3OUYA 3E2EA 2J76E 2JSXA 3EX7B 3RB0A 4C3MA 1VBYA 1VK3A 2ZH4A 2BRLA 1GT8A 2AV5A 1NJZA 1FJCA 2RQMA 3QLHA 3TANA 3NLCA 4PXDA 3PR5B 4C0OC 4KT0C 4RNOA 2RE1A 3A1YG 3VZIA 5HP1B 3KG0A 2W7PA 4F02A 3PW7A 4NZ7A 1K0VA 4YDXA 4MJKA 4LJMA 2HGNA 2B7CB 3K5NA 4HT5A 2JVOA 2XY6A 2IRYA 1S99A 4WYWA 5JVHQ 3M1VB 4N76A 1YGYA 3ISNC 4C0HA 1YRTA 2R2UA 3H98A 3H40A 1TFWA 4D3GA 4AYBD 3F73A 4YR3A 2OLWA 5DG8A 3DLKB 4GC7A 3HKZD 5KFSA 3BQ0A 1E6YA 3U02A 1QUPA 2XMJA 2WB1D 1R0AB 3G9CA 4OLOA 4YFUA 1NKCA 1VI7A 3L7OA 1KSPA 4Z37A 4PPZA 3BGFA 1S1UA 4I2QB 4DL3A 5IT9Y 4NLPA 2AJQA 1VQSA 3J7ZT 4WFZA 4C98A 4C8LA 3O8WA 4YR2A 1XC9A 3KK1A 3VAIA 4OI4A 5KT4A 2VG5B 1P6TA 2IM3A 2OSQA 1QJHA 2J0XA 3GR0A 2VD3A 3GV5B 4O3PA 3ZZZA 1E6VA 3C2PA 3TYTA 4J9PA 3MR2A 2NREA 2MSTA 1RA7A 2DGSA 1N88A 4K2XA 1BC6A 4RW8B 4FBUA 2Z4PA 5IS2A 2XLJA 2OMLA 2CG4A 2RQCA 2GQCA 3EZUA 2E1RA 2CVEA 4TQRA 1SL0A 1NJXA 3TR5A 5EGYA 4ED0A 1MMNA 4I6YA 1RT1B 2DHGA 4Q8EA 4YOEA 3SDEB 1RT5A 4NYOA 1SQEA 2P5VA 2WSFC 1HFEL 5EX3A 5KFVA 2OPQB 2LYVA 1FKPA 1BD6A 4K4WA 1VQYA 1WHXA 2D3ZA 1CPZA 4JV2A 3I31A 2RIJA 3AY0A 2MQQA 2PT0A 1JLCB 3MAQA 2KFNA 4DDFA 4ATNA 4EO6A 2P6SA 1R89A 5BYSA 2MQNA 1M5SA 2F8HA 2DHXA 4A8SA 2HYIB 3OLAA 1HBNB 4RW6A 3IO1A 4A47A 1SIZA 1TUVA 1KQSR 2BDPA 2AU0A 3IRXB 4QU7A 2ZVSA 5DG9A 4NLDA 2C42A 4WFAQ 1S9GA 1HWUA 2BA9A 3DM2B 2J0WA 4USIA 4O3SA 1V3SA 2VPXB 1YBAA 4OZJA 2XS5A 2VG6B 3JTPA 3BJYA 5JUMA 2XSJA 2MKCA 2PE8A 4ZVEA 1L3VA 2FLLA 3MEDA 3RYLA 3TI0A 3Q8PB 3CEDA 4CTAB 1D9FA 1JLFB 2B4UA 2HHUA 2QMXA 5D4PA 1IKXB 3MMCB 4UUWA 1URNA 3HJFA 3PKMA 4QIEA 1HWLA 4HKQA 3HP6A 2AYMA 4IFVB 1C0UA 3J7Z5 4IG0B 1HBMB 3MM5A 4LSLA 1L3SA 1MROB 4Y2AA 4NA2A 2IYGA 3FZBA 3B78A 4KR0B 1KC8T 1QAJA 2XB2D 2DIUA 3G71S 2BE2A 4PQUB 5EHHA 1RTDA 1TAUA 3BGRB 2BYCA 4C8NA 1Q7YT 3WDOA 2R7RA 3KK1B 3ETOA 2XS2A 3L7PA 4EO8A 3DOKB 1RT7B 2GHWA 5BYRA 4AL5A 2PI5A 2N7YA 2GJIA 1LK7A 3LPYA 4HLBA 2RS8A 2L3MA 3HVTB 5LXRA 2KZZA 4FP9A 2VOOA 2R7SA 2HLUA 4OFZA 3WBZA 2GW8A 3UCUP 1U45A 2JFKA 4DFKA 4JYAF 2D9OA 3LWLA 1U1LA 4HI1A 3PIOQ 1T03B 2PSZA 2QV6A 5D8HB 2MHNA 2YWGA 4DV1F 3THVA 3M9NB 4A48A 4NLXA 1JLCA 3TP2A 1F9FA 1WTBA 1U24A 4O44A 2RS2A 1D9DA 3VALA 4KGKA 3NCQA 4RBUA 2POKA 5E0OA 1YQHA 2ZC3A 5H9FJ 4NLSA 4X4RA 3NMAA 3W2VA 2PIIA 4CO5A 2UUCF 1U49A 5D4OA 3O1LA 3N5FA 2CPIA 1IM4A 4WE1B 3OFHA 3TUIC 4BC7A 4IOCQ 3V6KA 2HGLA 4B3TF 3N01A 3MI7X 2XMMA 4FN5A 4ITSA 3JSBA 5H9EJ 4B3OB 3CF5Q 4B3RF 2CPDA 2LA4A 3BZQA 4Y2IA 1GXTA 3N0VA 3IN5A 1LW2A 3N6MA 1J5OA 4M94A 3JSYA 2EFGA 4Q45A 2VG6A 2OAUA 2KKHA 3GYNA 3MD3A 1WACA 2OKQA 4Y0FA 5I42A 2E5LF 3T19A 3C3LA 2RH3A 3AAWB 4LUBA 1CG2A 4TLQA 2HWHA 2IRXA 5CYJA 2MZ1A 3QJPA 3DI6A 1U6BA 1E6VB 5LL6d 3PIPQ 3VWSA 1S79A 3DOLA 4ZVGA 4C11A 1G2EA 4HTJA 2XSJB 2LMIA 1SJ1A 2XI2A 5KOWA 2IM1A 3DYAB 4Q5VA 2VQFF 4J9KA 1TL3A 2ZOMA 2QE5A 4B9UA 1ZM2A 1RDRA 3J7YI 1UA0A 1ZAWA 3DRSB 3M6VA 3UR3C 3AJ2A 2ZBCA 2WONB 1P1TA 4P7VA 3ZZUA 1JMTA 4WF9Q 4Y65A 3IWNC 2C3YA 1X0FA 3KHRA 4ZPVR 1HBUB 4IFYA 3DLKA 3N6LA 2FVQA 1T94A 2CVIA 2PMHA 5KFDA 1HBNA 2HWIA 2DRBA 1Z2LA 5L1LA 3R1HA 5GADI 5B0CA 1SIWB 4R25A 1QY7A 1WEYA 1YJTA 3KK2B 3IBWA 4PXEA 4UY8T 4JBCA 2YNFA 2B6AA 1X5PA 3FQLA 2KXNB 2R2RA 3ZZRA 2R7OA 3FCHA 3KNAA 4M5DB 3FJ2A 5IWAF 1GX6A 4OJ3A 3WX4A 5HBMB 2AW0A 3LANA 3V2UC 4TU8A 2W8LA 1X9MA 4YQWA 4B9TA 2UUBF 4K4VA 1FJGF 2VL1A 2QZ8A 3OL8A 1JJ2R 1OSCA 3PX6A 3RBEA 4LF5F 4PXBA 4DR2F 1HYSB 3HVWA 2AP6A 3Q23A 2DNYA 4OHVA 4ZPTR 1Q78A 4MIBA 3SQGA 1D8ZA 1T95A 2QSWA 5E33A 5KFWA 1FNOA 1UWBB 3DLJA 4ES2A 1QAIA 2CRLA 3HHKA 4FF3A 3PFOA 2AJ4A 5IXUA 1S0MA 1HW8A 1N52B 5A8RB 2V9WA 4WU3A 1RT2A 2YKNB 5LSLA 4A8QA 4ZCMA 2FHOB 3BSCA 4TU7A 2EG1A 4OX8A 4NYPA 4WFBQ 3NMRA 3N28A 2W24A 3DXBA 2MZJA 3I87A 5CYQB 3K5MA 2C2RA 2PEHA 2QA2A 3Q8SB 2WK4A 4PQAA 4R0EA 2J5AA 1YRXA 1SV5B 2ASDA 3MUTP 1BQXA 5F9LA 2DNQA 3LO3A 4LMZA 1UWBA 2Y1IA 4NXNF 2NQPA 2GQQA 1GX5A 1VBZA 3ZZTA 4HDGA 1SKWA 4FF2A 2ZJRQ 3OBIA 3ZC4A 1HNXF 1FRMA 4F3OA 1X4EA 2VG7A 2XI3A 1CVJA 1U25A 2HG4A 3JSRA 3KNGA 2ZE2B 4DG1A 4DLEA 3MCSA 2ASLA 3MMAB 4ECYA 3CDUA 1S9EB 3LP0A 1T05B 3I4HX 3DLLQ 3BDEA 2M7SA 2ZDPA 4B17A 4F2RA 3P5TL 3MM6A 4KC5A 5D77A 5M2PA 3RRKA 2DVIA 5FDLA 3IR6B 4DV2F 4MKBA 4I7FB 2P9CA 3MEEB 4EUVA 1K8AT 2DGTA 2JJ4D 2L9WA 3R5CA 3NRBA 2QT7A 3IXQA 1R7IA 4WCEQ 4M8LA 2HNZA 3MWBA 1JJ4A 4KQZA 3VTIA 2IJFA 1UW4A 2CQPA 1GXLA 3LAKA 3O3LA 4ZK7M 2H9ZA 5L38A 3THTA 2ZHBA 4K50A 2VH7A 4C8OA 5KFEA 4YP3A 2KO1A 2FLPA 4FF4A 1VQ6S 3IR5B 1IJEB 5F8LA 1HI8A 1YJNS 5D4NA 5BR8F 3I56S 5D3GB 2C28A 3FVYA 4NA3A 1VIXA 1I1GA 4ZDNA 1DTTA 1HYSA 2ILZA 3G8QA 1B7FA 3OTBA 3K5OA 4IH6A 2O5DA 4DL5A 1C4CA 1FD2A 1Q53A 1YRUA 1UP1A 2WSCC 4CH7A 4O4GB 5G0RA 3R5BA 1KTQA 4J37A 4IRCA 2VZ9A 4KRWA 1BQMB 3OSNA 3W2WB 3HHEA 1FDDA 3OR2B 3KLHB 2CPXA 2E5IA 5K5MA 5U47A 5FIIA 3I5CA 1O8BA 2GA7A 1CQMA 3CSKA 5GAHU 4QIFA 4B02A 3HM9A 1XNRF 1A6LA 1NHUA 2LDIA 2XS7A 2GC8A 1S0VA 1BY9A 5B09A 2ERRA 5KG1A 2XCPA 4CO1A 3S01A 1FCAA 4RZRA 3JSMB 4CCHA 1ZBTA 3TX8A 2VA3A 1RGVA 1DRZA 1TL5A 3I0RA 1Q81T 3CJ3A 1K9MT 1H6KX 1R3NA 3W2WA 3QGGA 3KK2A 1XR7A 3T5KA 2O67A 4ZPWR 5FJ4A 4CNYA 5I3UB 2EFVA 3NCPA 2AX1A 2F9JA 1TKDA 2CFXA 3G86A 4F4WA 2MXYA 4X4VA 3BO2A 5DGAA 3BO3A 1FF2A 3M6WA 4WKRA 4PWDA 5B0GA 1WI8A 2XNQA 3EYZA 1SUQB 3MM7B 3DLGA 1HMVA 1QE1A 2HW3A 2K2PA 4XAKA 4DQIA 4L72B 3E8OA 1N5QA 1RT2B 1VLYA 4ALZA 3OTDA 1S0NA 3AA9A 2VFTA 4ZVHA 2YTCA 4FNHA 1F5BA 2L48A 2HWTA 2UV8G 5BYQA 2J6UA 2B9WA 4IRKA 4CH0S 1TR0A 2YNGA 2FJEB 2LECA 3BR9A 1Y9OA 1S10A 4B08A 3TA0A 5LJ3Y 2FJXA 1VRUA 4RW4B 5EWFA 3R1LA 1Z2ZA 4K5RA 3MFIA 5D4LA 4NZ6A 2MMYA 5A6PA 3QIPB 1RT4B 4HL9A 1UVIA 2WBMA 2YWFA 3OL6A 1BLUA 1RT3B 1JK9B 2CPFA 1HNIB 3FQKA 3OL9A 1WG1A 2EWHA 3MOZA 2Q79A 4Y28C 2YH0A 4ZOSA 1VRTB 4M5DA 2R4FA 1RYRA 3CDAA 2KT2A 1YJRA 1REVB 5GADU 4DPOA 2MKSA 3PY8A 2XMTA 1H2TZ 4KHPF 4ID8A 1YSJA 1O5JA 4K5SA 3CIMA 3M4XA 4QCLA 3ENVA 3MPYA 3H2UB 5HLFB 3LF0A 2OPRB 2QRRA 2J7UA 5GAEI 3GV8B 4OI2A 1AW0A 1U09A 1TAQA 4JI8F 3T1YF 4C8YA 5AE1A 5J2NA 5CZXA 2ZH6A 2C2DA 4IDKA 4L3NA 5KFAA 4F2SA 2C3OA 4LT6A 3SYZA 3OV7A 2N4CA 3DOKA 3FRZA 2ROGA 4BBYA 5LMNF 3CD5A 3H2LA 5SZTA 4K4TA 5E3AA 3DOLB 5F9NA 5DGBA 2FC9A 3K2YA 3N4WA 3PVXA 1FNXH 3AB2B 4ECRA 4FNIA 1P1LA 1EETA 3AHPA 2ZJQQ 2ZH8A 1TKTB 1FEHA 2E44A 2V4RA 4ZP6A 4IYQA 4QQBA 2NPIA 3H4DA 2PO4A 5EX0A 1YJWS 1IBMF 3LQVA 3TA1A 2WHOA 3W3SA 1Q8IA 3M8QA 3RB6A 2FLNA 4NRUA 3TVYA 1SJFA 4XDDA 1X4HA 2FC8A 1VQKS 4WFXA 1S1WB 3C66A 4I67A 3S1TA 5K14B 4Y34A 2EPIA 1BQNA 2ZKTA 3CVKA 3RAQA 1HBMA 3MM5B 4EGLA 2CJQA 4A8XA 1MU2A 2MKIA 4RW8A 4KAIA 1IR0A 2LEPA 2HVIA 4TY8A 1U48A 4A8YA 1EETB 2DGQA 4A8OA 2VA2A 2DT9A 3SSQA 2MKJA 2Y0SD 2Q1LA 2ZDOA 2YNFB 3B4MA 3V6HA 4X4SA 1L3TA 4C4WA 2JHEA 3MGJA 1D1UA 2UVVA 1KFDA 5F8MA 3IAM9 3CJ5A 3DLBA 1HNWF 3P6YC 3H5UA 4JI7F 3G6VA 2X1BA 2FTRA 1DQ9A 3EUNA 4PWUA 2VFUA 4F4XA 5F8NA 2LVWA 2XLIA 3MPWA 1N32F 2RU9A 3PEJA 1R0AA 3BN4A