1JY2N

Crystal structure of the central region of bovine fibrinogen (e5 fragment) at 1.4 angstroms resolution
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
43
structure length
43
Chain Sequence
GWPFCSDEDWNTKCPSGCRMKGLIDEVDQDFTSRINKLRDSLF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FIBRINOGEN ALPHA CHAIN
publication title Crystal structure of the central region of bovine fibrinogen (E5 fragment) at 1.4-A resolution.
pubmed doi rcsb
molecule tags Blood clotting
total genus 13
structure length 43
sequence length 43
chains with identical sequence Q
ec nomenclature
pdb deposition date 2001-09-10
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.50 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 1jy2N00
2Z4EA 1JY2O 3H32B 2A45H 1M1JA 1RE4A 1LT9A 1N73B 3BVHA 1LWUA 2HODA 1N73C 3E1IA 1RE3C 1FZCB 1FZCC 2H43A 1FZEA 1LTJB 2HPCB 2OYHB 3H32A 1LTJC 2OYHC 1N73A 2OYIB 1W2EA 2Q9IA 2FFDB 1JY3P 1FZGA 1RE3A 2OYIC 1FZAA 2FFDC 1JY2P 1FZCA 1LTJA 2HPCA 2OYHA 2A45I 3GHGC 1FZBA 3GHGB 1RF0C 1RF1B 3HUSB 3HUSC 2OYIA 2A45G 2HLOA 1RF1C 2FFDA 1N86A 1M1JB 1M1JC 1JY3N 1LT9B 1RE4C 1T3UA 1LT9C 1LWUB 2HODB 1JY2N 1RF0A 1JY3O 2XNXA 3GHGA 1LWUC 1FZFA 1RF1A 3HUSA
chains in the Genus database with same CATH superfamily
3L75J 3CX5H 5APXA 1NTMJ 5DJUB 2HPCA 1KMIZ 5EFWB 2E74C 1SQPJ 4RESB 5KKZC 1PZQA 3LW5J 4WY4C 1SFCD 1VQLP 3AEDC 3CCJP 3P8CE 4C7NB 5KLIB 1ZN5A 4L74A 1JM0A 3U59A 3H1HG 1KORA 5AW1B 2H8PD 2UWJE 1YYCA 3UIAA 2Q3IA 3M9QA 3PTZA 3GF7A 2R32A 3RK3E 4U3FD 1Q90D 2WSCJ 4A7PA 1PGQA 3H1KD 1URQB 2O01N 3KDPB 5KTBA 3H1JG 2QJPC 4OGQC 2Q5UA 5CCGA 1BDDA 1BE3D 5B5EH 4GOEA 2KOGA 3G71P 1KYOH 1SQXG 1G1JA 1NTKK 3EFGA 1OVUA 1G2CB 1OFCX 4EI2A 1IFPA 1L0NK 2BEZF 4PJ0H 2H89C 1Q2NA 4U7JA 2FYUK 1VQ4P 4DZOA 3HTKB 3BCCG 4W80A 1T3JA 3KZIE 3C8VA 2QJYC 2V7QJ 2RN0A 4YXWH 4LGDE 4WB4A 3JSVC 4RJTA 1BDCA 4OWFA 1X0TA 2OARA 5GTIE 1NHLA 3LW5H 4DT0A 1A02F 4MN4C 3A0HH 3JCUH 3CCEP 3R4YA 1KILA 2R3SA 2HG5D 1RE4A 4U3FE 2B9BA 3H1KE 1EZVD 1XTCC 4AQRD 1SQBK 2B89A 1BSHA 3RK3B 2E75C 2J59M 2P1JA 3GHGC 1W2BO 1BE3E 1RF0C 1QX8A 1OX3A 2A45G 3MTUE 2OQQA 2Z5HA 5CCHD 1GW4A 1E5WA 1DEBA 2LXBA 3PP5A 2YO2A 4GT1A 4WY4A 5TJHA 1L2PA 1X9VA 3IF4A 2AXTE 2IPPA 2JKVA 1QL2A 1MFTA 4XFJA 1HJBA 2P67A 3I55P 2QEXP 2NPSC 4ZKPA 1LJ2A 2IBZD 1ZXGA 1JMBA 1DEEG 3AE3C 3S4RA 1PP9G 1PFIA 1U7JA 1M1JB 3H1JJ 2PGDA 2WQYC 2V7QH 1EDLA 1NTKD 1EDJA 3RK2B 4JBZA 1NTMK 3GMAA 1L0ND 2LKMA 1VQ8P 2YXRB 1SQXJ 2FYUD 1T2KC 3F5HA 2AEJA 1SQPK 2HLOA 3CX5D 2R5DA 2KZIA 1EZVE 4H44D 3BCCJ 2R44A 3GF3A 1LTJB 3NFQA 2N1TA 4PD4I 1QEXA 3L73G 3JC22 3L71D 1RY3A 3OJAB 4HJGH 4B86A 3SFEC 2OTLP 2A06D 1ZR2A 1RH5B 3H1ID 1S4XA 1OW7A 2WPVB 3E1RA 3FXEA 2R5BA 4XA4A 3KPEA 2IBZE 1SQBD 2KB7P 3U1AA 3L72D 1CI6B 1PPJG 3P8MC 4KT0J 1YJNP 1HUCA 4D6TJ 2MKVA 2GA1A 2W27A 5KAIH 2BCCJ 3H6PA 1NTKE 1GW3A 1H89A 5AW3B 1L0NE 1RF0A 1LP1A 1SVFA 2QJKC 2Z4EA 3RL0C 2WPQA 3HE5A 1L4AB 1KYOD 2JEEA 1GTWA 2KLUA 1KZUB 2OYHB 1QVGO 4EYYQ 3CX5E 1VQ5P 1M1KQ 4OVNF 3BRTB 4PD4H 2HODB 2KIKA 1N73B 3L75D 1NTZG 3CCVP 1Y9BA 1PGPA 1EZVI 2NPSA 3L71E 2OGUA 2OYIB 3L36A 5KLVG 2C9NY 1NTMD 4PV1D 1J1EC 2P10A 3A2AA 1E79H 3HUSC 1PP9J 2A06E 1PL5A 1GK4A 2D2CD 3IN6A 5CCGD 2QA4P 1X79B 3H1IE 1OIPA 1FE6A 3W67A 1KFNA 1SQVG 1SQBE 2VRSA 3L72E 2KS1B 1Y8AA 2WT7A 3SWFA 3MP7B 1URQD 1JOCA 1RQVA 1IFDA 1S5LH 4W7ZA 1ZV8A 5B5EE 3L73J 2FXOA 4ASVA 1LGHB 2GUVA 2R3CA 3FGAD 1KYOE 4H0LC 3HRNA 2J5UA 3B4SA 1HGVA 3L74G 2A45H 1KD1Q 2YIUB 3G9RA 1OW6A 2ZT9C 3V2RA 4PJ0E 1VQ6P 5H2FH 3TGUD 2GUSA 5K5GB 3VMXA 4RKUJ 4I7ZC 2KLVA 1OVVA 1KILD 2KK7A 3L75E 1IFNA 1NTME 1SQXK 4XE5B 3AE5C 3N7NA 1YQ4C 3MIWA 1GK6A 2BASA 1LWUB 1NU1G 1GL2B 3TNUA 4BRYA 1M7LA 3A0HE 1ZRTD 2C0WA 3KHUA 3A7OA 1RE3C 2WSSH 4Y99B 2QSIA 2FFDB 3CI9A 4NPEA 3CC4P 1IFMA 1MUUA 1OVRA 2E5YA 3MUDC 3W68A 1JY3O 1Y47A 2M3BA 2RH0A 1NTZJ 5AVWB 3Q5PA 2HPCB 2C0XA 3CLQA 3AECC 4JQ0D 5KLVJ 5AW0B 2N9YB 5APWA 5AW9B 2AEMA 4UB8H 5TISH 5E79H 2Q3EA 3TGUE 5AVTB 3A5TA 1FBMA 2N9BA 3AE2C 2O1JA 2QG4A 1FJPA 1KILE 1W2EA 2B87B 3KQGA 1GZLA 1HH0A 2ZAEB 3HE4A 4KHXA 4HKZH 2IZ1A 1H8AA 3RK2D 2N1TD 1JMMA 2H43A 4PV1B 4IFFA 1EXJA 1NH4A 4ZMDA 1OMIA 2D2CB 2ZXXA 2WSFH 1ZRTE 2B87A 5KJ7D 3MZWB 1SQQD 1L0LD 3L74J 1JCCA 3C1LA 2W8ZA 4H13C 3G4SP 5M1BA 1FAVA 1FZAA 4PD4D 3RK3C 5KAFH 2HR3A 3CC2P 5APUA 1VF5C 3L70D 2YKQA 1KFMA 1U57A 1OZHA 4WWIA 4RO0A 3M0AA 2Q9IA 2YXQB 4Z1MH 1CSBA 1AJYA 1FZCA 1SP4A 1FZBA 2E75D 1HTLC 4GODA 1NU1J 1R8EA 1KV4A 2CK3H 1G1IA 1IZNB 2E5TA 3V2QA 1LT1A 4U3FG 5CBNA 3H1KG 3M06A 1Q81Q 1RE3A 1IFJA 1KILB 5BVZA 4Y28J 2IDBA 3EFFK 2LXCB 2IFMA 2FYNC 2XDJA 3GG2A 5KAIE 1M1JC 1JY3N 3D6ZA 1BE3G 1GU5A 1N7LA 1SFCC 3MUDA 2NPSD 4WBAA 3IFMA 2FY8A 4D6TD 2XZRA 1L4AD 1FS0E 3H25A 1YITP 4JPZB 1AQTA 1SQQE 1RQUA 1L0LE 2E74B 3H1LG 2BCCD 1HBWA 1W5CE 2IZ0A 3CCLP 3TSIA 3Q5SA 4NPFX 4WY4B 2WVRA 3CCRP 1FDIA 5B66H 4PD4E 3H32A 2HYNA 3RBZA 3L70E 2K1AA 1VQOP 1KQLA 4N78D 2WSCH 4O9BA 3AE9C 5CJ4A 3BASA 1RHZB 2FXPA 2NRGA 3II6A 4N6JA 3FX0A 2JJLA 1J2JB 3VP9A 2YKPA 1NAFA 2QJPB 1NTZK 3AE6C 3H1HJ 4OGQB 3SWKA 3HD7C 4EDFA 1LTSC 3A0BH 5KLVK 1HJ0A 2E42A 1S5LE 1KN7A 4ASWA 1JB0J 1RF1C 4D6TE 2N1TB 4I2LC 1R5SA 2BCCE 4W7YA 2FYZA 2WZ7A 4C46A 1ZMEC 2E76C 5H2FE 3TDKA 4WVZA 2IBZG 1K05A 2YO3A 2W6AA 4I6MC 4U3FJ 2KNCA 1PGOA 1S72P 3VP8A 1CW5A 1HGZA 3MGNA 4N78E 1NKZB 1JY2P 2PAJA 2M0BA 1ZP0C 5CCHC 2FBWC 3B71A 1KQFB 2KSJA 1NTKG 1BE3J 4QMAA 5AVZB 2OYOA 1LT9C 1AVOA 2ITAA 1LTGC 4IFMA 1L0NG 1GL2D 1SFCA 1K9MQ 4IFDK 3USSA 1M8OB 3SWYA 1Q86Q 1DX7A 2E75B 3LIEA 3H1LJ 1LP1B 3HE5B 1GMJA 3VMZA 2M5AA 5AVXB 2O01J 3V2PA 1N7SC 2I1KA 1ZR4A 4EOTA 1LTBC 1T6AA 1BCCD 3E7KA 3CWBD 1NU1K 1NWQA 1LNQA 1KB9I 3VN0A 1S5LX 2NPSB 3GHGA 1JEKA 4UB8E 5E79E 3CL3D 2FYUE 3G3ZA 3GLMA 3Q3DA 2ZVOB 2RMZA 1QGKB 1BGYD 2A45I 4N3YB 3L72G 2I1JA 4H0LD 4H44C 2W90A 1S1CX 3HD7A 2LR2A 3ABVC 1FZEA 2QM8A 2WT7B 1N2DC 3A3YB 2WPRA 1WRGA 1JTHA 1RF1A 2KI7B 1R5LA 1SQPD 3B5NC 2V4HA 3FXDA 2Z5IA 4BWNA 5AVRB 3V6IA 1YJ9P 2KZJA 4AYCA 2KUBA 4HYTB 3T97A 1J1DC 3IAOA 3AE7C 2ZJSE 3AEEC 5KAFE 4LC1A 5DJTB 1HF9A 3AEAC 2WSEJ 1BCCE 1KB9H 3CWBE 2H7HA 2AXTH 3WUUA 2FXMA 4HH2A 3O6QA 2O01H 2CPBA 3VMYA 4IL6H 3CC7P 5AVVB 3LIDA 1T8ZA 5CCHA 1LT9A 2K88A 2W6JH 1BGYE 5APSA 1S3JA 2PFXA 2W6BA 3SSUA 4YXDC 3CPWO 1VPCA 3TNUB 4BRYB 1AVYA 2YNYA 3BATA 3PRJA 3CD6P 2JR8A 2QJKB 3RL0B 2ZVNB 3BRVB 3AEFC 1QVFO 3M9BA 1N7SA 4EIJA 5KLIC 1SQPE 1ZW0A 2YMYA 2E74D 1ZLLA 3RBXA 1SS1A 1AFOA 1VL2A 3AE8C 3JCUE 3TGUG 1P84I 4WY4D 3WUVA 1SLQA 2SPZA 1J1EB 3CCMP 2KXPB 4ZNCA 1URQC 1H0TA 3KXDA 3L72J 2KYVA 3P8CD 4C7RA 1AV1A 2K3RA 3U1CA 3MHVA 2KSEA 2WSEH 3HE4B 3VYIA 3EQ2A 3KYQA 3R2PA 1FDMA 3HUSA 4L73A 1NYHA 1S2EA 1EDKA 4OGQD 1DIPA 2K9YA 3B5NA 1NJIQ 1USEA 1SQVJ 1X8YA 2POHA 4TT3H 1HVVA 1M56D 4H0LB 1RE4C 1Q7YQ 3K5BA 1T3UA 1NOHA 3H1HD 2ZXEB 2Q6QA 2ZT9B 1VQKP 3GW6A 2L5GB 5AW5B 2JWAA 3OA7A 4ZKUA 4I7ZB 2PP6A 1P84H 3D70A 5CJ0A 2K9JA 1OW8A 3H1JD 3PH0A 2QM7A 3PLNA 1GD2E 2L91A 1JUNA 1FZCB 3CXHI 1FZGA 5BU5A 2JP3A 1UIIA 1WT6A 1SQXD 3TK1A 2WWWA 1DD3A 3D6YA 3MD0A 1BSNA 3E1IA 1MV8A 1YTZI 1LTTC 4R4LA 3BCCD 1LTAC 1YHQP 2WITA 1GDTA 1SQQG 1L0LG 2WPSA 4C7NA 1S9KD 1QLED 1IO4A 1EXIA 3V4QA 3VOPA 1VQ9P 2OTKE 4TLFA 1JCDA 3TGUJ 4JYCA 1M90Q 2AXCA 5AW6B 5C39A 5AVQB 3H1HE 3L70G 3H1LD 5GTHH 1URQA 4YTPC 1KB9D 4K3AA 3WMM0 3RK2C 2N1TC 2NZ2A 3H32B 3HD7D 1YI2P 4GOFA 2QVAA 2M3EA 3CCSP 2P58A 1JNMA 3H1JE 5KJ7C 2OTJP 3CXHH 3L35A 2M8RA 4UB6H 5APQA 1G2CA 5KKZB 4R4MA 3AE4C 1VQPP 3OAKA 1U7MA 1SQXE 1LTJC 4L75A 1MZ9A 3HTKA 3CCQP 4L76A 3PHLA 1T2KD 3O8ZA 2YMKA 2ZFCA 2E76D 1IK7A 1IFIA 3PJSK 3IR9A 3Q1MA 1YIJP 5APVA 2P7JA 3BCCE 4D6TG 4H13B 1ZOYC 2BCCG 1S9KE 2J58A 1M57D 2G8YA 3Q2YA 2Y9YA 1VF5B 3L37A 1PP9D 3QWOC 4GIFA 2IYPA 1EZVG 1EC5A 3M0DC 3H1LE 2Q7CA 3WU2H 1GU4A 1YTZT 2ZYDA 1KB9E 4DJGA 1X22A 1PV3A 4IOIH 3D71A 2KNCB 4K35A 2Y9ZA 4IL6E 1L4AC 1SQVK 1N7SD 3VMAA 3EWKA 2P2UA 2OYHC 2XKMA 2QJYB 1XTGB 3CMEP 3B8EB 2CPSA 2IX7C 2Q1KA 1K73Q 1USDA 2FYNB 2WTYA 1SQQJ 3L73D 1L0LJ 2W83C 3FWLA 1FOSF 1FJKA 3CCUP 1SFCB 5APTA 3RL0g 3S9OA 1N73C 3RL0D 1KQGB 2ZYGA 1MFZA 1PGJA 3H1KJ 4GDOA 1NO4A 2XV5A 2OYIC 3L70J 1K8AQ 2XU6A 2M5AB 5AW7B 1VQNP 4I1LA 3ZDMA 1M1JA 1PPJD 3BVHA 2KP8A 3S1KA 1OWAA 2FYUG 1EQ7A 1NGMB 2Y0EA 1P84D 1PP9E 1NKNA 3TF5A 3GHGB 3VTPC 1HWTC 5KJ7A 3I56P 5AVSB 2O1KA 3NXSA 1FU1A 3B5ND 5BU8B 3AEGC 5AW8B 2B88A 2YKOA 1AQ5A 3L71G 1LTJA 2RKLA 4JF7A 2XNDH 1Q82Q 1AA0A 1FC2C 3HD7B 2XNXA 1EDIA 2A06G 3KZIH 2YIUC 5TISE 3H1IG 1Z56A 1NTZD 4IL6X 3L73E 1JTHB 2DW3A 5KLVD 1RF1B 1SQBG 1N86A 2GM4A 2C9LY 3V2NA 3FWNA 5GTIH 1CI6A 1BCCG 2QIWA 3CWBG 2ZT9D 3L4FA 1SQVD 3M0DA 3T97B 2JO1A 2E76B 4BXLA 1IK9A 4YPCA 1PPJE 1MKMA 1LWUC 3QH9A 1GL2C 1JY2O 1IC2A 1OXZA 1P84E 5AW2B 3O6QB 3Q5RA 3N4XA 1FDOA 2IFNA 2H88C 5CHXA 1L4AA 1BGYG 4Y99C 1QL1A 2FFDC 3CXHD 2QE7H 2OYHA 4M3LA 4OH8B 1LT9B 2O3JA 3P32A 2WMMA 3L75G 1KC8Q 4DOJA 2K37A 1KQSO 2E43A 2IYOA 2HODA 3L74D 1YQ3C 3ITKA 2QRXA 1YJWP 1VQ7P 3CMAP 1KTMA 1NTMG 1N73A 2FKWB 1JY3P 4NPDA 3NTNA 4DCKA 2Y0CA 2OYIA 1NTKJ 2IBZI 4JYBA 4GKGA 1VQMP 3C9IA 1SQPG 4AUWA 1NTZE 1N7SB 1L0NJ 2HFED 5KLVE 1NVOA 2FYUJ 3NMDA 2MJZA 1DH3A 2JDIH 1H88A 3AE1C 3WUTA 2G3AA 3OW2O 5L8RJ 1N8RQ 4LLHA 2KS1A 1NU1D 1SQVE 5GTHE 3M91A 1H0TB 1VDFA 4PV1C 1SQQK 1L0LK 3L71J 3CX5I 1D7MA 3TYYA 2D2CC 5AW4B 5CCGC 5CMZA 4H44B 1A02J 1FOSE 3V5BA 4KJMA 1PIXA 2WSFJ 3CXHE 3H1IJ 4HB1A 1FZCC 4UB6E 1CZQA 3F89A 1K04A 2Y0DA 3P7KA 2ZYAA 3SFDC 5B66E 3HUSB 1SQBJ 3AEBC 3L74E 3I5CA 3RGUA 5AVYB 3G6EP 2AEFA 3B5NB 1DD4A 1WMKA 4CPGA 1BCCJ 3CWBJ 4H13D 5CBOA 2PRRA 2BEQD 3RK3D 1NAYA 1JO5A 1IJDB 1J1DB 1JY2N 1VF5D 3M9HA 1TU3F 1LWUA 1GL2A 1BGYJ 2JWDA 1LTIC 3V4WA 1YBKA 1UIXA 5APYA 3A0BE 2K9JB 1KILC 1NU1E 2FFDA 5AVUB 2I8DA 1FZFA 3WU2E 1KYOI
chains in the Genus database with same CATH topology
5APQA 1G2CA 1LTGC 4IFMA 5APXA 1IFDA 1GL2D 1SFCA 4W7ZA 4IFDK 3OAKA 1ZV8A 1LTJC 3SWYA 1DX7A 1MZ9A 3LIEA 3HTKA 2HPCA 1LGHB 2GUVA 1T2KD 3O8ZA 3HE5B 2R3CA 2ZFCA 3VMZA 1IFIA 4RESB 3HRNA 3IR9A 1HGVA 2A45H 5AVXB 4WY4C 3V2PA 1N7SC 1SFCD 2P7JA 5APVA 3V2RA 2I1KA 1ZR4A 4EOTA 1LTBC 2GUSA 3P8CE 3VMXA 1S9KE 4C7NB 2J58A 1NU1K 1ZN5A 1NWQA 2KLVA 1KILD 3L37A 3VN0A 3U59A 2NPSB 3GHGA 5AW1B 2H8PD 3UIAA 1YYCA 1IFNA 4GIFA 2Q3IA 3M9QA 3CL3D 1SQXK 4XE5B 3G3ZA 2R32A 3N7NA 3M0DC 3MIWA 2Q7CA 1GU4A 1YTZT 1URQB 1GK6A 2A45I 4N3YB 3KDPB 5KTBA 2BASA 2I1JA 1LWUB 1GL2B 3TNUA 2Q5UA 5CCGA 1M7LA 2C0WA 3HD7A 1L4AC 1SQVK 1N7SD 3A7OA 1RE3C 2KOGA 1FZEA 2P2UA 2OYHC 4Y99B 2QM8A 2WT7B 2FFDB 2XKMA 1N2DC 3CI9A 1XTGB 3A3YB 2WPRA 3B8EB 1G1JA 2CPSA 1NTKK 1IFMA 2IX7C 3EFGA 2WTYA 1MUUA 1WRGA 1JTHA 1G2CB 1FOSF 1L0NK 1FJKA 1SFCB 1JY3O 5APTA 2M3BA 1RF1A 3B5NC 5AVWB 2FYUK 1N73C 3RL0D 4DZOA 3HTKB 2HPCB 2Z5IA 2C0XA 1MFZA 3CLQA 4W80A 1T3JA 1NO4A 5AVRB 2XV5A 2OYIC 5AW0B 5APWA 5AW9B 4AYCA 2XU6A 5AW7B 4HYTB 4LGDE 4I1LA 4WB4A 3T97A 1J1DC 4LC1A 1M1JA 5AVTB 3A5TA 1FBMA 2N9BA 3BVHA 2H7HA 2KP8A 2O1JA 1FJPA 2FXMA 2OARA 1OWAA 4HH2A 1W2EA 1EQ7A 1NHLA 2O01H 3LW5H 2CPBA 3KQGA 1NKNA 1A02F 3VMYA 1GZLA 3GHGB 1HH0A 5AVVB 3VTPC 1HWTC 1KILA 3LIDA 1T8ZA 3HE4A 4KHXA 5CCHA 5KJ7A 2HG5D 1RE4A 1LT9A 5AVSB 2O1KA 3NXSA 1FU1A 1H8AA 3B5ND 3RK2D 2N1TD 1JMMA 5BU8B 2H43A 5AW8B 5APSA 1XTCC 2W6BA 4IFFA 4AQRD 2YKOA 1SQBK 1AQ5A 1NH4A 1VPCA 3RK3B 1LTJA 2J59M 2P1JA 3GHGC 1RF0C 2YNYA 3TNUB 2WSFH 2A45G 4JF7A 3MTUE 2Z5HA 3BATA 5CCHD 5KJ7D 3HD7B 2XNXA 3RL0B 3BRVB 1GW4A 1JCCA 1E5WA 1DEBA 3PP5A 4GT1A 2YO2A 1Z56A 3M9BA 4WY4A 1N7SA 1JTHB 4EIJA 1FAVA 1FZAA 3RK3C 1X9VA 1RF1B 5APUA 2IPPA 1N86A 2YMYA 1QL2A 2GM4A 1ZLLA 2YKQA 1HJBA 2C9LY 2P67A 3V2NA 1KFMA 2NPSC 4ZKPA 1AFOA 1CI6A 4WY4D 3M0AA 1SLQA 2Q9IA 1CSBA 3L4FA 1J1EB 1FZCA 3M0DA 1SP4A 1FZBA 1URQC 1IK9A 2KYVA 1HTLC 1PFIA 3P8CD 1M1JB 4C7RA 1LWUC 1GL2C 3RK2B 1JY2O 1IC2A 1OXZA 1NTMK 1G1IA 5AW2B 3U1CA 3V2QA 2LKMA 3N4XA 2IFNA 3M06A 5CHXA 1L4AA 4Y99C 1QL1A 1RE3A 1IFJA 2FFDC 1T2KC 1KILB 2WSEH 5BVZA 2OYHA 3HE4B 1SQPK 4M3LA 2IFMA 2HLOA 2XDJA 3VYIA 3EQ2A 3KYQA 4OH8B 1M1JC 1JY3N 1LT9B 2R5DA 3R2PA 1GU5A 1N7LA 3P32A 1FDMA 1SFCC 3HUSA 3MUDA 4DOJA 2NPSD 4WBAA 2E43A 2HODA 3IFMA 1LTJB 3B5NA 2XZRA 2N1TA 3NFQA 1L4AD 1N73A 2FKWB 1JY3P 1X8YA 3NTNA 2POHA 1HVVA 2OYIA 1RE4C 1HBWA 1RY3A 1T3UA 3OJAB 4GKGA 4JYBA 3C9IA 3TSIA 1NOHA 4AUWA 4B86A 4WY4B 1N7SB 2ZXEB 2HFED 1ZR2A 3H32A 2L5GB 3NMDA 2HYNA 5AW5B 2MJZA 3OA7A 4ZKUA 1DH3A 2R5BA 2PP6A 4XA4A 1KQLA 3KPEA 1H88A 4N78D 3U1AA 2KB7P 4LLHA 1CI6B 5CJ0A 2WSCH 4O9BA 3P8MC 2QM7A 5CJ4A 1HUCA 3BASA 1GD2E 1JUNA 1FZCB 3M91A 2W27A 1VDFA 1FZGA 1SQQK 3II6A 1L0LK 5BU5A 3H6PA 3TYYA 1WT6A 4N6JA 1GW3A 2JJLA 1J2JB 5AW3B 5AW4B 2YKPA 3VP9A 5CCGC 1NAFA 1H89A 1NTZK 3TK1A 1RF0A 2WWWA 5CMZA 1A02J 1SVFA 3HD7C 2Z4EA 1FOSE 3RL0C 2WPQA 3HE5A 1LTSC 1L4AB 3V5BA 2JEEA 5KLVK 3MD0A 3E1IA 1GTWA 1MV8A 1FZCC 1KZUB 2OYHB 1YTZI 1LTTC 2E42A 1CZQA 3P7KA 1LTAC 2WITA 3HUSB 1RF1C 1GDTA 3BRTB 2WPSA 4C7NA 1S9KD 1IO4A 3I5CA 2HODB 5AVYB 3V4QA 3VOPA 3B5NB 2N1TB 1N73B 1JCDA 4JYCA 2NPSA 4I2LC 4W7YA 2OYIB 3L36A 5AW6B 2FYZA 2C9NY 2WZ7A 5AVQB 1J1EC 3A2AA 4C46A 3HUSC 3RK3D 1GK4A 1JO5A 1IJDB 5CCGD 1J1DB 1URQA 1JY2N 1X79B 3M9HA 3WMM0 3RK2C 2N1TC 2YO3A 3H32B 3HD7D 2W6AA 1LWUA 1GL2A 4I6MC 1KFNA 3VP8A 1CW5A 1HGZA 3MGNA 1LTIC 4N78E 3V4WA 2VRSA 5APYA 1JNMA 1NKZB 1JY2P 2PAJA 1KILC 5CCHC 5KJ7C 2WT7A 2FFDA 2KSJA 5AVUB 3SWFA 5AVZB 1URQD 3L35A 2M8RA 1LT9C 1JOCA 1FZFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2Z4E A;  1JY2 O;  3H32 B;  2A45 H;  1M1J A;  1RE4 A;  1LT9 A;  1N73 B;  3BVH A;  1LWU A;  2HOD A;  1N73 C;  3E1I A;  1RE3 C;  1FZC B;  1FZC C;  2H43 A;  1FZE A;  1LTJ B;  2HPC B;  2OYH B;  3H32 A;  1LTJ C;  2OYH C;  1N73 A;  2OYI B;  1W2E A;  2Q9I A;  2FFD B;  1JY3 P;  1FZG A;  1RE3 A;  2OYI C;  1FZA A;  2FFD C;  1JY2 P;  1FZC A;  1LTJ A;  2HPC A;  2OYH A;  2A45 I;  3GHG C;  1FZB A;  3GHG B;  1RF0 C;  1RF1 B;  3HUS B;  3HUS C;  2OYI A;  2A45 G;  2HLO A;  1RF1 C;  2FFD A;  1N86 A;  1M1J B;  1M1J C;  1JY3 N;  1LT9 B;  1RE4 C;  1T3U A;  1LT9 C;  1LWU B;  2HOD B;  1JY2 N;  1RF0 A;  1JY3 O;  2XNX A;  3GHG A;  1LWU C;  1FZF A;  1RF1 A;  3HUS A; 
#chains in the Genus database with same CATH topology
 3L75 J;  3CX5 H;  5APX A;  1NTM J;  5DJU B;  2HPC A;  1KMI Z;  5EFW B;  2E74 C;  1SQP J;  4RES B;  5KKZ C;  1PZQ A;  3LW5 J;  4WY4 C;  1SFC D;  1VQL P;  3AED C;  3CCJ P;  3P8C E;  4C7N B;  5KLI B;  1ZN5 A;  4L74 A;  1JM0 A;  3U59 A;  3H1H G;  1KOR A;  5AW1 B;  2H8P D;  2UWJ E;  1YYC A;  3UIA A;  2Q3I A;  3M9Q A;  3PTZ A;  3GF7 A;  2R32 A;  3RK3 E;  4U3F D;  1Q90 D;  2WSC J;  4A7P A;  1PGQ A;  3H1K D;  1URQ B;  2O01 N;  3KDP B;  5KTB A;  3H1J G;  2QJP C;  4OGQ C;  2Q5U A;  5CCG A;  1BDD A;  1BE3 D;  5B5E H;  4GOE A;  2KOG A;  3G71 P;  1KYO H;  1SQX G;  1G1J A;  1NTK K;  3EFG A;  1OVU A;  1G2C B;  1OFC X;  4EI2 A;  1IFP A;  1L0N K;  2BEZ F;  4PJ0 H;  2H89 C;  1Q2N A;  4U7J A;  2FYU K;  1VQ4 P;  4DZO A;  3HTK B;  3BCC G;  4W80 A;  1T3J A;  3KZI E;  3C8V A;  2QJY C;  2V7Q J;  2RN0 A;  4YXW H;  4LGD E;  4WB4 A;  3JSV C;  4RJT A;  1BDC A;  4OWF A;  1X0T A;  2OAR A;  5GTI E;  1NHL A;  3LW5 H;  4DT0 A;  1A02 F;  4MN4 C;  3A0H H;  3JCU H;  3CCE P;  3R4Y A;  1KIL A;  2R3S A;  2HG5 D;  1RE4 A;  4U3F E;  2B9B A;  3H1K E;  1EZV D;  1XTC C;  4AQR D;  1SQB K;  2B89 A;  1BSH A;  3RK3 B;  2E75 C;  2J59 M;  2P1J A;  3GHG C;  1W2B O;  1BE3 E;  1RF0 C;  1QX8 A;  1OX3 A;  2A45 G;  3MTU E;  2OQQ A;  2Z5H A;  5CCH D;  1GW4 A;  1E5W A;  1DEB A;  2LXB A;  3PP5 A;  2YO2 A;  4GT1 A;  4WY4 A;  5TJH A;  1L2P A;  1X9V A;  3IF4 A;  2AXT E;  2IPP A;  2JKV A;  1QL2 A;  1MFT A;  4XFJ A;  1HJB A;  2P67 A;  3I55 P;  2QEX P;  2NPS C;  4ZKP A;  1LJ2 A;  2IBZ D;  1ZXG A;  1JMB A;  1DEE G;  3AE3 C;  3S4R A;  1PP9 G;  1PFI A;  1U7J A;  1M1J B;  3H1J J;  2PGD A;  2WQY C;  2V7Q H;  1EDL A;  1NTK D;  1EDJ A;  3RK2 B;  4JBZ A;  1NTM K;  3GMA A;  1L0N D;  2LKM A;  1VQ8 P;  2YXR B;  1SQX J;  2FYU D;  1T2K C;  3F5H A;  2AEJ A;  1SQP K;  2HLO A;  3CX5 D;  2R5D A;  2KZI A;  1EZV E;  4H44 D;  3BCC J;  2R44 A;  3GF3 A;  1LTJ B;  3NFQ A;  2N1T A;  4PD4 I;  1QEX A;  3L73 G;  3JC2 2;  3L71 D;  1RY3 A;  3OJA B;  4HJG H;  4B86 A;  3SFE C;  2OTL P;  2A06 D;  1ZR2 A;  1RH5 B;  3H1I D;  1S4X A;  1OW7 A;  2WPV B;  3E1R A;  3FXE A;  2R5B A;  4XA4 A;  3KPE A;  2IBZ E;  1SQB D;  2KB7 P;  3U1A A;  3L72 D;  1CI6 B;  1PPJ G;  3P8M C;  4KT0 J;  1YJN P;  1HUC A;  4D6T J;  2MKV A;  2GA1 A;  2W27 A;  5KAI H;  2BCC J;  3H6P A;  1NTK E;  1GW3 A;  1H89 A;  5AW3 B;  1L0N E;  1RF0 A;  1LP1 A;  1SVF A;  2QJK C;  2Z4E A;  3RL0 C;  2WPQ A;  3HE5 A;  1L4A B;  1KYO D;  2JEE A;  1GTW A;  2KLU A;  1KZU B;  2OYH B;  1QVG O;  4EYY Q;  3CX5 E;  1VQ5 P;  1M1K Q;  4OVN F;  3BRT B;  4PD4 H;  2HOD B;  2KIK A;  1N73 B;  3L75 D;  1NTZ G;  3CCV P;  1Y9B A;  1PGP A;  1EZV I;  2NPS A;  3L71 E;  2OGU A;  2OYI B;  3L36 A;  5KLV G;  2C9N Y;  1NTM D;  4PV1 D;  1J1E C;  2P10 A;  3A2A A;  1E79 H;  3HUS C;  1PP9 J;  2A06 E;  1PL5 A;  1GK4 A;  2D2C D;  3IN6 A;  5CCG D;  2QA4 P;  1X79 B;  3H1I E;  1OIP A;  1FE6 A;  3W67 A;  1KFN A;  1SQV G;  1SQB E;  2VRS A;  3L72 E;  2KS1 B;  1Y8A A;  2WT7 A;  3SWF A;  3MP7 B;  1URQ D;  1JOC A;  1RQV A;  1IFD A;  1S5L H;  4W7Z A;  1ZV8 A;  5B5E E;  3L73 J;  2FXO A;  4ASV A;  1LGH B;  2GUV A;  2R3C A;  3FGA D;  1KYO E;  4H0L C;  3HRN A;  2J5U A;  3B4S A;  1HGV A;  3L74 G;  2A45 H;  1KD1 Q;  2YIU B;  3G9R A;  1OW6 A;  2ZT9 C;  3V2R A;  4PJ0 E;  1VQ6 P;  5H2F H;  3TGU D;  2GUS A;  5K5G B;  3VMX A;  4RKU J;  4I7Z C;  2KLV A;  1OVV A;  1KIL D;  2KK7 A;  3L75 E;  1IFN A;  1NTM E;  1SQX K;  4XE5 B;  3AE5 C;  3N7N A;  1YQ4 C;  3MIW A;  1GK6 A;  2BAS A;  1LWU B;  1NU1 G;  1GL2 B;  3TNU A;  4BRY A;  1M7L A;  3A0H E;  1ZRT D;  2C0W A;  3KHU A;  3A7O A;  1RE3 C;  2WSS H;  4Y99 B;  2QSI A;  2FFD B;  3CI9 A;  4NPE A;  3CC4 P;  1IFM A;  1MUU A;  1OVR A;  2E5Y A;  3MUD C;  3W68 A;  1JY3 O;  1Y47 A;  2M3B A;  2RH0 A;  1NTZ J;  5AVW B;  3Q5P A;  2HPC B;  2C0X A;  3CLQ A;  3AEC C;  4JQ0 D;  5KLV J;  5AW0 B;  2N9Y B;  5APW A;  5AW9 B;  2AEM A;  4UB8 H;  5TIS H;  5E79 H;  2Q3E A;  3TGU E;  5AVT B;  3A5T A;  1FBM A;  2N9B A;  3AE2 C;  2O1J A;  2QG4 A;  1FJP A;  1KIL E;  1W2E A;  2B87 B;  3KQG A;  1GZL A;  1HH0 A;  2ZAE B;  3HE4 A;  4KHX A;  4HKZ H;  2IZ1 A;  1H8A A;  3RK2 D;  2N1T D;  1JMM A;  2H43 A;  4PV1 B;  4IFF A;  1EXJ A;  1NH4 A;  4ZMD A;  1OMI A;  2D2C B;  2ZXX A;  2WSF H;  1ZRT E;  2B87 A;  5KJ7 D;  3MZW B;  1SQQ D;  1L0L D;  3L74 J;  1JCC A;  3C1L A;  2W8Z A;  4H13 C;  3G4S P;  5M1B A;  1FAV A;  1FZA A;  4PD4 D;  3RK3 C;  5KAF H;  2HR3 A;  3CC2 P;  5APU A;  1VF5 C;  3L70 D;  2YKQ A;  1KFM A;  1U57 A;  1OZH A;  4WWI A;  4RO0 A;  3M0A A;  2Q9I A;  2YXQ B;  4Z1M H;  1CSB A;  1AJY A;  1FZC A;  1SP4 A;  1FZB A;  2E75 D;  1HTL C;  4GOD A;  1NU1 J;  1R8E A;  1KV4 A;  2CK3 H;  1G1I A;  1IZN B;  2E5T A;  3V2Q A;  1LT1 A;  4U3F G;  5CBN A;  3H1K G;  3M06 A;  1Q81 Q;  1RE3 A;  1IFJ A;  1KIL B;  5BVZ A;  4Y28 J;  2IDB A;  3EFF K;  2LXC B;  2IFM A;  2FYN C;  2XDJ A;  3GG2 A;  5KAI E;  1M1J C;  1JY3 N;  3D6Z A;  1BE3 G;  1GU5 A;  1N7L A;  1SFC C;  3MUD A;  2NPS D;  4WBA A;  3IFM A;  2FY8 A;  4D6T D;  2XZR A;  1L4A D;  1FS0 E;  3H25 A;  1YIT P;  4JPZ B;  1AQT A;  1SQQ E;  1RQU A;  1L0L E;  2E74 B;  3H1L G;  2BCC D;  1HBW A;  1W5C E;  2IZ0 A;  3CCL P;  3TSI A;  3Q5S A;  4NPF X;  4WY4 B;  2WVR A;  3CCR P;  1FDI A;  5B66 H;  4PD4 E;  3H32 A;  2HYN A;  3RBZ A;  3L70 E;  2K1A A;  1VQO P;  1KQL A;  4N78 D;  2WSC H;  4O9B A;  3AE9 C;  5CJ4 A;  3BAS A;  1RHZ B;  2FXP A;  2NRG A;  3II6 A;  4N6J A;  3FX0 A;  2JJL A;  1J2J B;  3VP9 A;  2YKP A;  1NAF A;  2QJP B;  1NTZ K;  3AE6 C;  3H1H J;  4OGQ B;  3SWK A;  3HD7 C;  4EDF A;  1LTS C;  3A0B H;  5KLV K;  1HJ0 A;  2E42 A;  1S5L E;  1KN7 A;  4ASW A;  1JB0 J;  1RF1 C;  4D6T E;  2N1T B;  4I2L C;  1R5S A;  2BCC E;  4W7Y A;  2FYZ A;  2WZ7 A;  4C46 A;  1ZME C;  2E76 C;  5H2F E;  3TDK A;  4WVZ A;  2IBZ G;  1K05 A;  2YO3 A;  2W6A A;  4I6M C;  4U3F J;  2KNC A;  1PGO A;  1S72 P;  3VP8 A;  1CW5 A;  1HGZ A;  3MGN A;  4N78 E;  1NKZ B;  1JY2 P;  2PAJ A;  2M0B A;  1ZP0 C;  5CCH C;  2FBW C;  3B71 A;  1KQF B;  2KSJ A;  1NTK G;  1BE3 J;  4QMA A;  5AVZ B;  2OYO A;  1LT9 C;  1AVO A;  2ITA A;  1LTG C;  4IFM A;  1L0N G;  1GL2 D;  1SFC A;  1K9M Q;  4IFD K;  3USS A;  1M8O B;  3SWY A;  1Q86 Q;  1DX7 A;  2E75 B;  3LIE A;  3H1L J;  1LP1 B;  3HE5 B;  1GMJ A;  3VMZ A;  2M5A A;  5AVX B;  2O01 J;  3V2P A;  1N7S C;  2I1K A;  1ZR4 A;  4EOT A;  1LTB C;  1T6A A;  1BCC D;  3E7K A;  3CWB D;  1NU1 K;  1NWQ A;  1LNQ A;  1KB9 I;  3VN0 A;  1S5L X;  2NPS B;  3GHG A;  1JEK A;  4UB8 E;  5E79 E;  3CL3 D;  2FYU E;  3G3Z A;  3GLM A;  3Q3D A;  2ZVO B;  2RMZ A;  1QGK B;  1BGY D;  2A45 I;  4N3Y B;  3L72 G;  2I1J A;  4H0L D;  4H44 C;  2W90 A;  1S1C X;  3HD7 A;  2LR2 A;  3ABV C;  1FZE A;  2QM8 A;  2WT7 B;  1N2D C;  3A3Y B;  2WPR A;  1WRG A;  1JTH A;  1RF1 A;  2KI7 B;  1R5L A;  1SQP D;  3B5N C;  2V4H A;  3FXD A;  2Z5I A;  4BWN A;  5AVR B;  3V6I A;  1YJ9 P;  2KZJ A;  4AYC A;  2KUB A;  4HYT B;  3T97 A;  1J1D C;  3IAO A;  3AE7 C;  2ZJS E;  3AEE C;  5KAF E;  4LC1 A;  5DJT B;  1HF9 A;  3AEA C;  2WSE J;  1BCC E;  1KB9 H;  3CWB E;  2H7H A;  2AXT H;  3WUU A;  2FXM A;  4HH2 A;  3O6Q A;  2O01 H;  2CPB A;  3VMY A;  4IL6 H;  3CC7 P;  5AVV B;  3LID A;  1T8Z A;  5CCH A;  1LT9 A;  2K88 A;  2W6J H;  1BGY E;  5APS A;  1S3J A;  2PFX A;  2W6B A;  3SSU A;  4YXD C;  3CPW O;  1VPC A;  3TNU B;  4BRY B;  1AVY A;  2YNY A;  3BAT A;  3PRJ A;  3CD6 P;  2JR8 A;  2QJK B;  3RL0 B;  2ZVN B;  3BRV B;  3AEF C;  1QVF O;  3M9B A;  1N7S A;  4EIJ A;  5KLI C;  1SQP E;  1ZW0 A;  2YMY A;  2E74 D;  1ZLL A;  3RBX A;  1SS1 A;  1AFO A;  1VL2 A;  3AE8 C;  3JCU E;  3TGU G;  1P84 I;  4WY4 D;  3WUV A;  1SLQ A;  2SPZ A;  1J1E B;  3CCM P;  2KXP B;  4ZNC A;  1URQ C;  1H0T A;  3KXD A;  3L72 J;  2KYV A;  3P8C D;  4C7R A;  1AV1 A;  2K3R A;  3U1C A;  3MHV A;  2KSE A;  2WSE H;  3HE4 B;  3VYI A;  3EQ2 A;  3KYQ A;  3R2P A;  1FDM A;  3HUS A;  4L73 A;  1NYH A;  1S2E A;  1EDK A;  4OGQ D;  1DIP A;  2K9Y A;  3B5N A;  1NJI Q;  1USE A;  1SQV J;  1X8Y A;  2POH A;  4TT3 H;  1HVV A;  1M56 D;  4H0L B;  1RE4 C;  1Q7Y Q;  3K5B A;  1T3U A;  1NOH A;  3H1H D;  2ZXE B;  2Q6Q A;  2ZT9 B;  1VQK P;  3GW6 A;  2L5G B;  5AW5 B;  2JWA A;  3OA7 A;  4ZKU A;  4I7Z B;  2PP6 A;  1P84 H;  3D70 A;  5CJ0 A;  2K9J A;  1OW8 A;  3H1J D;  3PH0 A;  2QM7 A;  3PLN A;  1GD2 E;  2L91 A;  1JUN A;  1FZC B;  3CXH I;  1FZG A;  5BU5 A;  2JP3 A;  1UII A;  1WT6 A;  1SQX D;  3TK1 A;  2WWW A;  1DD3 A;  3D6Y A;  3MD0 A;  1BSN A;  3E1I A;  1MV8 A;  1YTZ I;  1LTT C;  4R4L A;  3BCC D;  1LTA C;  1YHQ P;  2WIT A;  1GDT A;  1SQQ G;  1L0L G;  2WPS A;  4C7N A;  1S9K D;  1QLE D;  1IO4 A;  1EXI A;  3V4Q A;  3VOP A;  1VQ9 P;  2OTK E;  4TLF A;  1JCD A;  3TGU J;  4JYC A;  1M90 Q;  2AXC A;  5AW6 B;  5C39 A;  5AVQ B;  3H1H E;  3L70 G;  3H1L D;  5GTH H;  1URQ A;  4YTP C;  1KB9 D;  4K3A A;  3WMM 0;  3RK2 C;  2N1T C;  2NZ2 A;  3H32 B;  3HD7 D;  1YI2 P;  4GOF A;  2QVA A;  2M3E A;  3CCS P;  2P58 A;  1JNM A;  3H1J E;  5KJ7 C;  2OTJ P;  3CXH H;  3L35 A;  2M8R A;  4UB6 H;  5APQ A;  1G2C A;  5KKZ B;  4R4M A;  3AE4 C;  1VQP P;  3OAK A;  1U7M A;  1SQX E;  1LTJ C;  4L75 A;  1MZ9 A;  3HTK A;  3CCQ P;  4L76 A;  3PHL A;  1T2K D;  3O8Z A;  2YMK A;  2ZFC A;  2E76 D;  1IK7 A;  1IFI A;  3PJS K;  3IR9 A;  3Q1M A;  1YIJ P;  5APV A;  2P7J A;  3BCC E;  4D6T G;  4H13 B;  1ZOY C;  2BCC G;  1S9K E;  2J58 A;  1M57 D;  2G8Y A;  3Q2Y A;  2Y9Y A;  1VF5 B;  3L37 A;  1PP9 D;  3QWO C;  4GIF A;  2IYP A;  1EZV G;  1EC5 A;  3M0D C;  3H1L E;  2Q7C A;  3WU2 H;  1GU4 A;  1YTZ T;  2ZYD A;  1KB9 E;  4DJG A;  1X22 A;  1PV3 A;  4IOI H;  3D71 A;  2KNC B;  4K35 A;  2Y9Z A;  4IL6 E;  1L4A C;  1SQV K;  1N7S D;  3VMA A;  3EWK A;  2P2U A;  2OYH C;  2XKM A;  2QJY B;  1XTG B;  3CME P;  3B8E B;  2CPS A;  2IX7 C;  2Q1K A;  1K73 Q;  1USD A;  2FYN B;  2WTY A;  1SQQ J;  3L73 D;  1L0L J;  2W83 C;  3FWL A;  1FOS F;  1FJK A;  3CCU P;  1SFC B;  5APT A;  3RL0 g;  3S9O A;  1N73 C;  3RL0 D;  1KQG B;  2ZYG A;  1MFZ A;  1PGJ A;  3H1K J;  4GDO A;  1NO4 A;  2XV5 A;  2OYI C;  3L70 J;  1K8A Q;  2XU6 A;  2M5A B;  5AW7 B;  1VQN P;  4I1L A;  3ZDM A;  1M1J A;  1PPJ D;  3BVH A;  2KP8 A;  3S1K A;  1OWA A;  2FYU G;  1EQ7 A;  1NGM B;  2Y0E A;  1P84 D;  1PP9 E;  1NKN A;  3TF5 A;  3GHG B;  3VTP C;  1HWT C;  5KJ7 A;  3I56 P;  5AVS B;  2O1K A;  3NXS A;  1FU1 A;  3B5N D;  5BU8 B;  3AEG C;  5AW8 B;  2B88 A;  2YKO A;  1AQ5 A;  3L71 G;  1LTJ A;  2RKL A;  4JF7 A;  2XND H;  1Q82 Q;  1AA0 A;  1FC2 C;  3HD7 B;  2XNX A;  1EDI A;  2A06 G;  3KZI H;  2YIU C;  5TIS E;  3H1I G;  1Z56 A;  1NTZ D;  4IL6 X;  3L73 E;  1JTH B;  2DW3 A;  5KLV D;  1RF1 B;  1SQB G;  1N86 A;  2GM4 A;  2C9L Y;  3V2N A;  3FWN A;  5GTI H;  1CI6 A;  1BCC G;  2QIW A;  3CWB G;  2ZT9 D;  3L4F A;  1SQV D;  3M0D A;  3T97 B;  2JO1 A;  2E76 B;  4BXL A;  1IK9 A;  4YPC A;  1PPJ E;  1MKM A;  1LWU C;  3QH9 A;  1GL2 C;  1JY2 O;  1IC2 A;  1OXZ A;  1P84 E;  5AW2 B;  3O6Q B;  3Q5R A;  3N4X A;  1FDO A;  2IFN A;  2H88 C;  5CHX A;  1L4A A;  1BGY G;  4Y99 C;  1QL1 A;  2FFD C;  3CXH D;  2QE7 H;  2OYH A;  4M3L A;  4OH8 B;  1LT9 B;  2O3J A;  3P32 A;  2WMM A;  3L75 G;  1KC8 Q;  4DOJ A;  2K37 A;  1KQS O;  2E43 A;  2IYO A;  2HOD A;  3L74 D;  1YQ3 C;  3ITK A;  2QRX A;  1YJW P;  1VQ7 P;  3CMA P;  1KTM A;  1NTM G;  1N73 A;  2FKW B;  1JY3 P;  4NPD A;  3NTN A;  4DCK A;  2Y0C A;  2OYI A;  1NTK J;  2IBZ I;  4JYB A;  4GKG A;  1VQM P;  3C9I A;  1SQP G;  4AUW A;  1NTZ E;  1N7S B;  1L0N J;  2HFE D;  5KLV E;  1NVO A;  2FYU J;  3NMD A;  2MJZ A;  1DH3 A;  2JDI H;  1H88 A;  3AE1 C;  3WUT A;  2G3A A;  3OW2 O;  5L8R J;  1N8R Q;  4LLH A;  2KS1 A;  1NU1 D;  1SQV E;  5GTH E;  3M91 A;  1H0T B;  1VDF A;  4PV1 C;  1SQQ K;  1L0L K;  3L71 J;  3CX5 I;  1D7M A;  3TYY A;  2D2C C;  5AW4 B;  5CCG C;  5CMZ A;  4H44 B;  1A02 J;  1FOS E;  3V5B A;  4KJM A;  1PIX A;  2WSF J;  3CXH E;  3H1I J;  4HB1 A;  1FZC C;  4UB6 E;  1CZQ A;  3F89 A;  1K04 A;  2Y0D A;  3P7K A;  2ZYA A;  3SFD C;  5B66 E;  3HUS B;  1SQB J;  3AEB C;  3L74 E;  3I5C A;  3RGU A;  5AVY B;  3G6E P;  2AEF A;  3B5N B;  1DD4 A;  1WMK A;  4CPG A;  1BCC J;  3CWB J;  4H13 D;  5CBO A;  2PRR A;  2BEQ D;  3RK3 D;  1NAY A;  1JO5 A;  1IJD B;  1J1D B;  1JY2 N;  1VF5 D;  3M9H A;  1TU3 F;  1LWU A;  1GL2 A;  1BGY J;  2JWD A;  1LTI C;  3V4W A;  1YBK A;  1UIX A;  5APY A;  3A0B E;  2K9J B;  1KIL C;  1NU1 E;  2FFD A;  5AVU B;  2I8D A;  1FZF A;  3WU2 E;  1KYO I; 
#chains in the Genus database with same CATH homology
 5APQ A;  1G2C A;  1LTG C;  4IFM A;  5APX A;  1IFD A;  1GL2 D;  1SFC A;  4W7Z A;  4IFD K;  3OAK A;  1ZV8 A;  1LTJ C;  3SWY A;  1DX7 A;  1MZ9 A;  3LIE A;  3HTK A;  2HPC A;  1LGH B;  2GUV A;  1T2K D;  3O8Z A;  3HE5 B;  2R3C A;  2ZFC A;  3VMZ A;  1IFI A;  4RES B;  3HRN A;  3IR9 A;  1HGV A;  2A45 H;  5AVX B;  4WY4 C;  3V2P A;  1N7S C;  1SFC D;  2P7J A;  5APV A;  3V2R A;  2I1K A;  1ZR4 A;  4EOT A;  1LTB C;  2GUS A;  3P8C E;  3VMX A;  1S9K E;  4C7N B;  2J58 A;  1NU1 K;  1ZN5 A;  1NWQ A;  2KLV A;  1KIL D;  3L37 A;  3VN0 A;  3U59 A;  2NPS B;  3GHG A;  5AW1 B;  2H8P D;  3UIA A;  1YYC A;  1IFN A;  4GIF A;  2Q3I A;  3M9Q A;  3CL3 D;  1SQX K;  4XE5 B;  3G3Z A;  2R32 A;  3N7N A;  3M0D C;  3MIW A;  2Q7C A;  1GU4 A;  1YTZ T;  1URQ B;  1GK6 A;  2A45 I;  4N3Y B;  3KDP B;  5KTB A;  2BAS A;  2I1J A;  1LWU B;  1GL2 B;  3TNU A;  2Q5U A;  5CCG A;  1M7L A;  2C0W A;  3HD7 A;  1L4A C;  1SQV K;  1N7S D;  3A7O A;  1RE3 C;  2KOG A;  1FZE A;  2P2U A;  2OYH C;  4Y99 B;  2QM8 A;  2WT7 B;  2FFD B;  2XKM A;  1N2D C;  3CI9 A;  1XTG B;  3A3Y B;  2WPR A;  3B8E B;  1G1J A;  2CPS A;  1NTK K;  1IFM A;  2IX7 C;  3EFG A;  2WTY A;  1MUU A;  1WRG A;  1JTH A;  1G2C B;  1FOS F;  1L0N K;  1FJK A;  1SFC B;  1JY3 O;  5APT A;  2M3B A;  1RF1 A;  3B5N C;  5AVW B;  2FYU K;  1N73 C;  3RL0 D;  4DZO A;  3HTK B;  2HPC B;  2Z5I A;  2C0X A;  1MFZ A;  3CLQ A;  4W80 A;  1T3J A;  1NO4 A;  5AVR B;  2XV5 A;  2OYI C;  5AW0 B;  5APW A;  5AW9 B;  4AYC A;  2XU6 A;  5AW7 B;  4HYT B;  4LGD E;  4I1L A;  4WB4 A;  3T97 A;  1J1D C;  4LC1 A;  1M1J A;  5AVT B;  3A5T A;  1FBM A;  2N9B A;  3BVH A;  2H7H A;  2KP8 A;  2O1J A;  1FJP A;  2FXM A;  2OAR A;  1OWA A;  4HH2 A;  1W2E A;  1EQ7 A;  1NHL A;  2O01 H;  3LW5 H;  2CPB A;  3KQG A;  1NKN A;  1A02 F;  3VMY A;  1GZL A;  3GHG B;  1HH0 A;  5AVV B;  3VTP C;  1HWT C;  1KIL A;  3LID A;  1T8Z A;  3HE4 A;  4KHX A;  5CCH A;  5KJ7 A;  2HG5 D;  1RE4 A;  1LT9 A;  5AVS B;  2O1K A;  3NXS A;  1FU1 A;  1H8A A;  3B5N D;  3RK2 D;  2N1T D;  1JMM A;  5BU8 B;  2H43 A;  5AW8 B;  5APS A;  1XTC C;  2W6B A;  4IFF A;  4AQR D;  2YKO A;  1SQB K;  1AQ5 A;  1NH4 A;  1VPC A;  3RK3 B;  1LTJ A;  2J59 M;  2P1J A;  3GHG C;  1RF0 C;  2YNY A;  3TNU B;  2WSF H;  2A45 G;  4JF7 A;  3MTU E;  2Z5H A;  3BAT A;  5CCH D;  5KJ7 D;  3HD7 B;  2XNX A;  3RL0 B;  3BRV B;  1GW4 A;  1JCC A;  1E5W A;  1DEB A;  3PP5 A;  4GT1 A;  2YO2 A;  1Z56 A;  3M9B A;  4WY4 A;  1N7S A;  1JTH B;  4EIJ A;  1FAV A;  1FZA A;  3RK3 C;  1X9V A;  1RF1 B;  5APU A;  2IPP A;  1N86 A;  2YMY A;  1QL2 A;  2GM4 A;  1ZLL A;  2YKQ A;  1HJB A;  2C9L Y;  2P67 A;  3V2N A;  1KFM A;  2NPS C;  4ZKP A;  1AFO A;  1CI6 A;  4WY4 D;  3M0A A;  1SLQ A;  2Q9I A;  1CSB A;  3L4F A;  1J1E B;  1FZC A;  3M0D A;  1SP4 A;  1FZB A;  1URQ C;  1IK9 A;  2KYV A;  1HTL C;  1PFI A;  3P8C D;  1M1J B;  4C7R A;  1LWU C;  1GL2 C;  3RK2 B;  1JY2 O;  1IC2 A;  1OXZ A;  1NTM K;  1G1I A;  5AW2 B;  3U1C A;  3V2Q A;  2LKM A;  3N4X A;  2IFN A;  3M06 A;  5CHX A;  1L4A A;  4Y99 C;  1QL1 A;  1RE3 A;  1IFJ A;  2FFD C;  1T2K C;  1KIL B;  2WSE H;  5BVZ A;  2OYH A;  3HE4 B;  1SQP K;  4M3L A;  2IFM A;  2HLO A;  2XDJ A;  3VYI A;  3EQ2 A;  3KYQ A;  4OH8 B;  1M1J C;  1JY3 N;  1LT9 B;  2R5D A;  3R2P A;  1GU5 A;  1N7L A;  3P32 A;  1FDM A;  1SFC C;  3HUS A;  3MUD A;  4DOJ A;  2NPS D;  4WBA A;  2E43 A;  2HOD A;  3IFM A;  1LTJ B;  3B5N A;  2XZR A;  2N1T A;  3NFQ A;  1L4A D;  1N73 A;  2FKW B;  1JY3 P;  1X8Y A;  3NTN A;  2POH A;  1HVV A;  2OYI A;  1RE4 C;  1HBW A;  1RY3 A;  1T3U A;  3OJA B;  4GKG A;  4JYB A;  3C9I A;  3TSI A;  1NOH A;  4AUW A;  4B86 A;  4WY4 B;  1N7S B;  2ZXE B;  2HFE D;  1ZR2 A;  3H32 A;  2L5G B;  3NMD A;  2HYN A;  5AW5 B;  2MJZ A;  3OA7 A;  4ZKU A;  1DH3 A;  2R5B A;  2PP6 A;  4XA4 A;  1KQL A;  3KPE A;  1H88 A;  4N78 D;  3U1A A;  2KB7 P;  4LLH A;  1CI6 B;  5CJ0 A;  2WSC H;  4O9B A;  3P8M C;  2QM7 A;  5CJ4 A;  1HUC A;  3BAS A;  1GD2 E;  1JUN A;  1FZC B;  3M91 A;  2W27 A;  1VDF A;  1FZG A;  1SQQ K;  3II6 A;  1L0L K;  5BU5 A;  3H6P A;  3TYY A;  1WT6 A;  4N6J A;  1GW3 A;  2JJL A;  1J2J B;  5AW3 B;  5AW4 B;  2YKP A;  3VP9 A;  5CCG C;  1NAF A;  1H89 A;  1NTZ K;  3TK1 A;  1RF0 A;  2WWW A;  5CMZ A;  1A02 J;  1SVF A;  3HD7 C;  2Z4E A;  1FOS E;  3RL0 C;  2WPQ A;  3HE5 A;  1LTS C;  1L4A B;  3V5B A;  2JEE A;  5KLV K;  3MD0 A;  3E1I A;  1GTW A;  1MV8 A;  1FZC C;  1KZU B;  2OYH B;  1YTZ I;  1LTT C;  2E42 A;  1CZQ A;  3P7K A;  1LTA C;  2WIT A;  3HUS B;  1RF1 C;  1GDT A;  3BRT B;  2WPS A;  4C7N A;  1S9K D;  1IO4 A;  3I5C A;  2HOD B;  5AVY B;  3V4Q A;  3VOP A;  3B5N B;  2N1T B;  1N73 B;  1JCD A;  4JYC A;  2NPS A;  4I2L C;  4W7Y A;  2OYI B;  3L36 A;  5AW6 B;  2FYZ A;  2C9N Y;  2WZ7 A;  5AVQ B;  1J1E C;  3A2A A;  4C46 A;  3HUS C;  3RK3 D;  1GK4 A;  1JO5 A;  1IJD B;  5CCG D;  1J1D B;  1URQ A;  1JY2 N;  1X79 B;  3M9H A;  3WMM 0;  3RK2 C;  2N1T C;  2YO3 A;  3H32 B;  3HD7 D;  2W6A A;  1LWU A;  1GL2 A;  4I6M C;  1KFN A;  3VP8 A;  1CW5 A;  1HGZ A;  3MGN A;  1LTI C;  4N78 E;  3V4W A;  2VRS A;  5APY A;  1JNM A;  1NKZ B;  1JY2 P;  2PAJ A;  1KIL C;  5CCH C;  5KJ7 C;  2WT7 A;  2FFD A;  2KSJ A;  5AVU B;  3SWF A;  5AVZ B;  1URQ D;  3L35 A;  2M8R A;  1LT9 C;  1JOC A;  1FZF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...