1JY2N

Crystal structure of the central region of bovine fibrinogen (e5 fragment) at 1.4 angstroms resolution
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
43
structure length
43
Chain Sequence
b'GWPFCSDEDWNTKCPSGCRMKGLIDEVDQDFTSRINKLRDSLF'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FIBRINOGEN ALPHA CHAIN
publication title Crystal structure of the central region of bovine fibrinogen (E5 fragment) at 1.4-A resolution.
pubmed doi rcsb
molecule tags Blood clotting
total genus 13
structure length 43
sequence length 43
chains with identical sequence Q
ec nomenclature
pdb deposition date 2001-09-10
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.50 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 1jy2N00
1RF1A 2H43A 1FZBA 1N86A 1RF1B 1FZCC 1JY2P 3GHGC 2OYHC 1W2EA 3H32A 2Q9IA 3H32B 1RE3C 1JY2O 2FFDC 1M1JC 1FZCA 3GHGA 1LTJC 1FZCB 3HUSC 2HODA 1FZGA 1RE4C 2A45G 2A45I 2HODB 2XNXA 1JY2N 3GHGB 1LT9C 1JY3P 3E1IA 2OYHA 2OYHB 2HPCA 2A45H 2FFDA 2HPCB 1M1JA 1RE3A 1N73C 1LWUC 1M1JB 3HUSA 1FZFA 2FFDB 1LTJA 2OYIC 1RE4A 1JY3O 1LTJB 3HUSB 1LT9A 1RF0C 1T3UA 1LT9B 1FZAA 2HLOA 2Z4EA 1FZEA 1N73A 1RF1C 1N73B 1JY3N 1LWUA 2OYIA 1LWUB 2OYIB 3BVHA 1RF0A
chains in the Genus database with same CATH superfamily
4PJ0E 4UB8E 2QG4A 2PGDA 5CBNA 2YKPA 1KB9I 2ZXXA 1G2CB 1QL2A 3SSUA 2N9YB 1SQVE 3Q1MA 1LTSC 2IZ0A 2OYIC 1JO5A 4WB4A 2QRXA 3AE2C 1PFIA 1KQLA 3GF3A 2V7QH 4L74A 3U1AA 2Q9IA 3HRNA 3LIEA 2HFED 4U3FG 2ITAA 3SFEC 2A06E 3M06A 4N3YB 3P8MC 3MGNA 3CMAP 3L70J 1K9MQ 1W5CE 3HE5A 2WPSA 3HE5B 1PL5A 4C7NA 2E74D 1NTMG 2M0BA 3M0DC 1JY2O 1EDLA 1VQ4P 2XU6A 1MV8A 4K35A 1OW6A 1T8ZA 2N1TB 2M5AB 5AW1B 1ZP0C 3H1IE 3IF4A 3L75D 1RH5B 3VTPC 2E43A 1FZCA 4KJMA 3PTZA 2J58A 2A45G 1KILA 2JKVA 2A45H 4OGQC 1URQD 2KSJA 4JPZB 1DIPA 1M1KQ 2YO3A 5AW0B 4TT3H 5APQA 3CCUP 1NU1D 3VP8A 2E75D 3VMXA 2JJLA 5TISE 4CPGA 2POHA 1FOSE 1VQ7P 4XA4A 2E42A 2H7HA 2P1JA 1KB9E 1BCCJ 1ZXGA 2YXQB 1BGYG 2B89A 3H32A 2M8RA 1VQPP 1KILC 2ZT9D 1PGPA 1VDFA 3BRTB 2BEQD 4Y99B 1J1DC 1VQ5P 1AQTA 1MFZA 2YKOA 3H1HJ 2P10A 2E76B 1CI6A 1IFIA 1N7SB 3USSA 1Y8AA 4LLHA 2W90A 2RMZA 3B71A 3RK2D 4KT0J 3PHLA 2HPCA 3P7KA 1RE3A 1VL2A 1WRGA 1LTJA 3WU2E 1T3UA 3I5CA 4OWFA 1E5WA 1S2EA 2K1AA 2BASA 2W6BA 3D70A 4M3LA 1JCCA 3VOPA 3AE6C 1SQXJ 3HD7A 1K8AQ 2BCCE 2WITA 1BDDA 2R3CA 2C0XA 1RHZB 4YTPC 2OQQA 3G6EP 1KC8Q 3V2NA 4NPFX 5AW8B 2XNXA 5AW7B 2WWWA 2KZJA 2V4HA 1JY3N 5KLVJ 1EXIA 1SQXD 1SQXK 1PPJD 2KUBA 1NTME 2R44A 3HD7C 1H8AA 3WUVA 2IYPA 3AE5C 3CCVP 3L74J 3CC2P 4IL6H 1JY3P 3L71E 1HJBA 1EDKA 2GA1A 1W2BO 2M3EA 4WWIA 1L0LJ 1JOCA 3A3YB 1OVUA 5KLVK 1KV4A 1GK6A 1FJKA 3H6PA 1ZRTD 1OIPA 3NXSA 3W67A 3PP5A 1P84H 3L74D 5M1BA 1AJYA 2QEXP 4ZKUA 3FXDA 4AQRD 1X22A 3AEAC 2IFNA 2QJYB 5CHXA 2KIKA 3BATA 2B87A 3O6QB 1T6AA 3L73J 2G8YA 2KZIA 2WVRA 1L0LK 3B4SA 1HH0A 1QVGO 1NH4A 2L91A 1YJWP 1YJNP 3EFFK 1P84I 1DX7A 3AE9C 1M57D 1A02J 3T97A 2W6AA 2Z5IA 2QJYC 1LTIC 2W6JH 4QMAA 2Q6QA 1S72P 3M0AA 5H2FH 3CX5H 1T2KC 3LW5H 4RO0A 1HGVA 4H0LB 1URQA 1SQVG 1PGOA 5AW2B 1NTZG 1M1JB 5E79H 3M91A 1BCCG 3H1JJ 4WY4A 2WPQA 1L0NJ 2WSSH 3A7OA 3PLNA 1ZW0A 4BXLA 1ZR2A 4U3FD 4I7ZB 2JDIH 1QVFO 3H1HG 2RH0A 3C1LA 2A06G 3CX5I 1L4AB 2FYNC 1N7LA 1RF0A 3CCEP 2E76D 1CSBA 1URQC 1H0TB 2L5GB 2PP6A 2H88C 4I2LC 3OA7A 1BDCA 4WY4C 1FZEA 4OVNF 2PRRA 1RF1A 3H1IG 4I7ZC 1OFCX 1EZVD 1SFCA 5KLIC 1SFCB 2YO2A 1KQFB 1RQUA 1IJDB 3G3ZA 2O01H 2E5TA 1NTKJ 1GU4A 2B88A 1OXZA 1P84E 3A2AA 1LP1A 3JSVC 2JWDA 2IFMA 1FJPA 3CCLP 1MFTA 1AQ5A 3AECC 2XKMA 2OYHB 2D2CB 3L70E 1X8YA 5KLVG 1JY3O 1IZNB 3H1LD 3AEFC 2Z4EA 2ZJSE 1RF1C 2WSFJ 1DH3A 2FYUG 4WBAA 1WT6A 2W27A 1BGYD 1SFCC 1VPCA 1KYOD 2ZYGA 1KB9H 3TGUJ 4EOTA 4GODA 1NTKK 1G1JA 3CXHH 2IBZD 3BRVB 1FS0E 5AVZB 4AYCA 1AA0A 1SQQJ 4ZKPA 1Q2NA 3PRJA 1FDMA 1ZOYC 3JCUE 2OARA 1HVVA 4L76A 1DD4A 1FZBA 1J1EB 1L0LG 2HYNA 2D2CC 2BEZF 1DD3A 1FE6A 3WUTA 4DOJA 1D7MA 1FOSF 5AVTB 5H2FE 3CX5E 1USDA 3KZIE 2K37A 3ITKA 3VMZA 3WU2H 3NFQA 4PD4D 4Y28J 3TGUD 1OVRA 5BU8B 1S9KD 1G2CA 3PJSK 2FY8A 2KK7A 4H44B 3CXHI 1OW8A 5E79E 2QE7H 1NTZE 1KQSO 1SQQD 1SQQK 2H89C 3M0DA 2KNCA 2BCCG 4ASVA 1BCCE 2KNCB 3L73G 1GZLA 5AVVB 1VQMP 3SWFA 3CCRP 5AVWB 3H1KJ 3GG2A 1H89A 2H43A 3BCCJ 4UB6E 2Q7CA 2NRGA 4GDOA 1OWAA 3L75J 4IFMA 3L72D 1T2KD 4GT1A 1PIXA 3H1HE 1BE3G 2WQYC 3R4YA 1JTHB 5KTBA 5APYA 1LNQA 4H44C 2GUVA 4W80A 4NPEA 1XTGB 4DJGA 2Z5HA 1FU1A 2KOGA 4GKGA 1NU1J 2N1TA 5CJ4A 2M5AA 2C9LY 3H1KD 3B8EB 3BCCD 3L71G 4R4MA 1JEKA 1NKZB 3RK3E 2O01N 4TLFA 3FGAD 1FZGA 4D6TD 3RGUA 4H0LD 4U7JA 2R5DA 3H1JG 3ABVC 5CBOA 1L0NG 2M3BA 5BU5A 2XDJA 1EDIA 4WY4D 5AVRB 1FBMA 1NU1K 1EQ7A 2XV5A 2N1TC 2NZ2A 1RY3A 3S9OA 5KLVE 2XZRA 3CWBD 2I8DA 2QSIA 2FYUE 3KDPB 1H88A 1L4AD 1SQPJ 2QJPB 3CXHE 1CZQA 3CCSP 2YKQA 1SQBG 2WSCJ 1JB0J 3EWKA 4JYCA 1ZR4A 1SLQA 2AEFA 1L0LE 1N7SA 1GL2B 1M7LA 3M9BA 1OW7A 1SFCD 2MJZA 4R4LA 4RKUJ 2NPSB 3V6IA 1SQPD 1SQPK 3VYIA 1GK4A 2ZYDA 4MN4C 3L4FA 5KAFH 1BSNA 3U1CA 1SQVD 1Q81Q 4Y99C 1KILE 2D2CD 1FZFA 2WSFH 3L73E 4C7RA 2MKVA 3RBZA 2E76C 1N7SC 1CW5A 1UIIA 5CCGA 2KYVA 1NJIQ 3NMDA 4LGDE 2NPSC 1PP9J 1L2PA 3HTKB 1BE3E 2OTJP 1AV1A 2WSEJ 1ZMEC 4HKZH 1N73B 1IFMA 3Q5RA 2KLUA 4Z1MH 3B5NB 1IFPA 2QM8A 2ZAEB 3V2RA 2K9JB 4YXDC 1KFMA 4GIFA 2KB7P 1JUNA 4IFFA 2IDBA 4W7ZA 4RJTA 1HF9A 1IO4A 2HLOA 1KMIZ 4KHXA 5CCGC 5B66H 3M9HA 3CL3D 4WVZA 1PP9D 3V2PA 3D6ZA 4H44D 2HODB 3H1JE 4N78E 1RQVA 1L0NE 2CK3H 3UIAA 3L75G 1YTZT 5KKZB 2AEMA 3VN0A 3AE4C 3L70G 3W68A 4EIJA 4C46A 2YMKA 3TK1A 1HJ0A 3O6QA 1K73Q 2O1KA 1USEA 1HBWA 2IYOA 1PGQA 5AW9B 3G71P 1M56D 5KAIE 1SQBE 4HB1A 2R32A 2N1TD 3D6YA 5GTHH 1LWUB 5KKZC 1N86A 1KYOE 2IPPA 5APWA 5GTIH 3JCUH 1NTKE 5CCHA 1MUUA 2PAJA 1HWTC 5DJTB 4L75A 3QH9A 2OTKE 1KQGB 1DEEG 4U3FJ 3JC22 2AEJA 4IOIH 1XTCC 5AVUB 1IK9A 2E74B 3KZIH 1YI2P 5KAFE 3GW6A 3KYQA 1KN7A 2K88A 2FBWC 2H8PD 2J5UA 1M1JA 2WTYA 1LWUC 3HUSA 1TU3F 2OTLP 3HUSB 3E7KA 3MP7B 1MKMA 3TGUE 2YIUB 1M90Q 4DCKA 5CCHC 3IAOA 1U7JA 4UB6H 1GTWA 1SQQE 1VQ6P 3SFDC 2QJKB 3D71A 1LT9B 3AE8C 1FDIA 1L4AA 1M8OB 3BVHA 1GL2D 4DT0A 4H0LC 1H0TA 1N7SD 1ZN5A 1YITP 5APXA 1NTMD 1NTMK 1M1JC 3GHGA 3MD0A 3HUSC 1R5SA 3GHGB 3E1IA 1IC2A 1EC5A 5B66E 4XFJA 1QL1A 2NPSD 2LKMA 3H1LJ 1SQXG 3I56P 3A0BE 2ZT9B 3RL0B 2JO1A 1BGYJ 3P8CD 2VRSA 2KXPB 2O1JA 2AXCA 1Q86Q 3E1RA 3BASA 1NO4A 1L4AC 3BCCE 1LTGC 2KS1B 1DEBA 3F89A 1YTZI 3L75E 3GHGC 2C0WA 2I1KA 5CCGD 2E5YA 2OYHA 5AW3B 5CJ0A 2P7JA 2AXTE 5APSA 4AUWA 3U59A 3RL0C 1S1CX 1SS1A 1NU1E 3G4SP 1N8RQ 3L74G 2LR2A 2QVAA 4W7YA 1NAYA 5GTHE 5APVA 1NYHA 4ZNCA 5GTIE 3TSIA 3GF7A 3CC7P 2ZVNB 2OYHC 4JF7A 5APUA 2Q5UA 3GMAA 3L72J 2WT7B 2GUSA 2FXOA 5AVYB 2OYIB 3HE4B 1YJ9P 4JQ0D 3RK3B 1JNMA 5CMZA 1Y9BA 3MIWA 3I55P 3TNUA 1KD1Q 3TNUB 1GD2E 1X79B 2O3JA 5AVQB 3G9RA 4GOEA 1LT1A 1LJ2A 2GM4A 1RE4A 1AVOA 2B9BA 2WMMA 1SQPE 2IX7C 1J1EC 2OGUA 5KJ7A 2I1JA 5DJUB 1VQNP 2J59M 1EDJA 3V5BA 3N7NA 3C9IA 4B86A 4ASWA 1NOHA 3OAKA 3CLQA 3RK3C 4D6TJ 1JTHA 2Y9YA 2RKLA 1VQ8P 4EI2A 2K3RA 3CD6P 3S1KA 1Y47A 1RE4C 5CCHD 1UIXA 3FX0A 2JP3A 2G3AA 5KJ7C 1QX8A 2FXPA 4JYBA 1YQ4C 3OW2O 4OGQB 3CWBJ 1SQXE 4JBZA 1PPJE 1KTMA 1YBKA 4C7NB 1EXJA 3FWNA 1LTTC 3R2PA 4I1LA 1K04A 5AW6B 4BWNA 3AEBC 2QM7A 1X0TA 1A02F 2DW3A 3MHVA 1IFDA 1P84D 2KI7B 4BRYA 1PP9E 4BRYB 1JCDA 1VQLP 1GMJA 2JEEA 1YIJP 1EZVG 1NWQA 1FZCB 3Q2YA 3FXEA 4EDFA 4HH2A 1KILB 1JMMA 3L70D 3NTNA 2N9BA 2RN0A 3FWLA 1ZRTE 3MTUE 2PFXA 3A0HH 1J1DB 4H13B 2Q3EA 3L74E 2W8ZA 3LW5J 2K9YA 1KFNA 5KAIH 4RESB 3KQGA 1S5LH 2SPZA 1PZQA 1SQVJ 1X9VA 1R8EA 2QIWA 1NTZJ 3H1LG 1VF5B 2Q1KA 1GL2A 1FZCC 3A5TA 4YXWH 1PV3A 3WMM0 3Q3DA 1NAFA 3H32B 1KYOH 1T3JA 3VMYA 1NTKG 1EZVI 3P32A 1IFNA 2A45I 3RL0D 2IBZG 1WMKA 4OH8B 3CMEP 2NPSA 2FXMA 3CX5D 4H13C 2QJPC 1U57A 1CI6B 1Z56A 5L8RJ 1GW3A 3SWKA 1NGMB 3RL0g 3AEGC 1SQVK 1VF5C 1NTZD 1NTZK 3IR9A 2FFDA 2HPCB 2FFDB 3SWYA 1LTJB 1BCCD 1GL2C 2Q3IA 3MZWB 1OX3A 4LC1A 3TGUG 4PD4H 5TJHA 4PV1B 2CPSA 1KYOI 4O9BA 3H1IJ 1VQOP 4EYYQ 3HTKA 3HD7B 1SQQG 3AE1C 2IBZI 3H1HD 3KPEA 2O01J 2A06D 2ZFCA 1N73A 1FC2C 1AVYA 3B5NA 2YNYA 1Q82Q 3CC4P 3GLMA 2K9JA 1NHLA 1RE3C 2FFDC 4U3FE 1LTJC 1OVVA 3L72G 2P2UA 2WPVB 1S4XA 3AEDC 1KZUB 4PV1C 2KLVA 2WPRA 1HGZA 1Q7YQ 3H1ID 4PD4I 3RK3D 2FYUJ 2XNDH 5AVXB 3A0BH 2HODA 2IZ1A 4NPDA 3S4RA 1GDTA 4L73A 3EFGA 1N73C 1FAVA 3H25A 3EQ2A 2R3SA 3B5NC 3H1KG 1NKNA 3BCCG 1K05A 1E79H 5KJ7D 2KSEA 3V4QA 1EZVE 3F5HA 3P8CE 4ZMDA 4D6TG 1JMBA 5KLVD 1YQ3C 1KORA 2P67A 3TDKA 3A0HE 1U7MA 1QGKB 1VQ9P 2FYUD 2FYUK 2YXRB 2JWAA 1LTBC 2Y9ZA 2AXTH 4A7PA 2Y0EA 3PH0A 1KB9D 2UWJE 3CXHD 1NU1G 3ZDMA 1S5LE 5B5EH 4I6MC 1YYCA 1QEXA 3AE3C 2JR8A 3CWBG 3H1LE 1HTLC 2BCCJ 2Y0DA 1LWUA 4OGQD 2B87B 2QA4P 1BGYE 1L0LD 1J2JB 4GOFA 4HJGH 1Q90D 1QLED 1S5LX 2V7QJ 3CI9A 2IBZE 1GW4A 2ZXEB 1S3JA 1BE3J 1JM0A 1N2DC 1SP4A 3KXDA 3K5BA 1YHQP 5AW4B 3LIDA 3T97B 4PJ0H 1JY2N 4DZOA 1OMIA 1NTMJ 2BCCD 4UB8H 3CCJP 2FYZA 1KILD 3L73D 1SQPG 4PD4E 3L71J 1JY2P 1S9KE 1IFJA 4H13D 4N6JA 1LGHB 1HUCA 2FYNB 3MUDA 2ZYAA 3Q5PA 2WSCH 3OJAB 1URQB 5EFWB 1BE3D 1LT9A 2E74C 1BSHA 1VF5D 4WY4B 2FKWB 3CPWO 3VMAA 2E75B 3IFMA 2C9NY 3TYYA 3L72E 4HYTB 1FDOA 2HR3A 3TF5A 3V4WA 2ZVOB 5KLIB 5K5GB 2YIUC 1FZAA 3AEEC 3L71D 1G1IA 3L37A 2YMYA 3MUDC 1PPJG 4XE5B 4IL6E 1PGJA 2W83C 3C8VA 2QJKC 1LT9C 1LTAC 3O8ZA 3H1JD 4N78D 3IN6A 1SQBJ 3H1KE 1L0ND 1L0NK 2KS1A 3L35A 2E75C 1R5LA 1GU5A 1RF1B 2Y0CA 5APTA 4IL6X 4PV1D 2OYOA 2R5BA 1PP9G 5BVZA 4YPCA 3RK2B 4D6TE 4IFDK 2WSEH 2WZ7A 5AW5B 3HD7D 3N4XA 3AE7C 1RF0C 2ZT9C 1LP1B 3B5ND 5B5EE 3WUUA 1W2EA 1OZHA 1SQBD 1SQBK 5C39A 3L36A 3M9QA 3CWBE 3VP9A 1VQKP 5TISH 1AFOA 3RBXA 3KHUA 3QWOC 3Q5SA 3CCQP 3RK2C 2LXCB 1IK7A 4K3AA 2P58A 1NTKD 1NVOA 5AVSB 2KP8A 1MZ9A 3V2QA 2HG5D 2CPBA 2WT7A 1ZLLA 1ZV8A 2OYIA 2LXBA 3HE4A 3CCMP 1SVFA 3II6A
chains in the Genus database with same CATH topology
3A7OA 3CL3D 1J1DB 1KFNA 3V2PA 1ZR2A 2HODB 4N78E 4RESB 3KQGA 1X9VA 3UIAA 1L4AB 1GL2A 1N7LA 1RF0A 2YKPA 1FZCC 3A5TA 3WMM0 1CSBA 1URQC 1G2CB 1QL2A 2L5GB 1NAFA 2PP6A 3H32B 1YTZT 1T3JA 3VMYA 4I2LC 3VN0A 1LTSC 3OA7A 3P32A 1IFNA 2A45I 3RL0D 4OH8B 2OYIC 1JO5A 4WB4A 2NPSA 4EIJA 4WY4C 2FXMA 1FZEA 4C46A 3TK1A 2O1KA 1HBWA 1RF1A 1PFIA 1KQLA 1CI6B 1Z56A 1GW3A 3U1AA 5AW9B 2Q9IA 1SFCA 3HRNA 3LIEA 1SFCB 2YO2A 1SQVK 2HFED 2R32A 1IJDB 1NTZK 3G3ZA 3IR9A 2O01H 2HPCB 2FFDA 3M06A 2FFDB 3SWYA 1LTJB 4N3YB 2N1TD 3P8MC 1GL2C 2Q3IA 1GU4A 3MGNA 1LWUB 1OXZA 3HE5A 4LC1A 2WPSA 3A2AA 3HE5B 1N86A 2IFMA 4C7NA 2IPPA 5APWA 1FJPA 2CPSA 5CCHA 3M0DC 1JY2O 1MUUA 4O9BA 2PAJA 1HWTC 1AQ5A 2XU6A 1MV8A 3HTKA 3HD7B 2XKMA 2OYHB 1T8ZA 2N1TB 1X8YA 3KPEA 1JY3O 5AW1B 2Z4EA 2ZFCA 1N73A 1RF1C 1DH3A 1XTCC 5AVUB 4WBAA 1WT6A 3B5NA 1IK9A 2W27A 1SFCC 1VPCA 2YNYA 3KYQA 1NHLA 1RE3C 3VTPC 4EOTA 2FFDC 2E43A 1FZCA 1LTJC 1G1JA 1NTKK 2H8PD 2J58A 2A45G 2P2UA 1KILA 3BRVB 2A45H 1URQD 1M1JA 5AVZB 2WTYA 1LWUC 2KSJA 3HUSA 4AYCA 3HUSB 1KZUB 4ZKPA 2KLVA 2WPRA 1FDMA 1HGZA 2OARA 1HVVA 5CCHC 1FZBA 1J1EB 2YO3A 3RK3D 5AW0B 2HYNA 5APQA 3VP8A 3VMXA 5AVXB 4DOJA 1GTWA 2HODA 2JJLA 1GDTA 3EFGA 1N73C 1FOSF 5AVTB 2POHA 1FAVA 1LT9B 3EQ2A 3B5NC 1FOSE 1NKNA 3VMZA 4XA4A 2E42A 2H7HA 1L4AA 3NFQA 2P1JA 3BVHA 5KJ7D 3V4QA 1GL2D 5BU8B 1N7SD 1G2CA 1ZN5A 5APXA 1S9KD 1NTMK 3H32A 2M8RA 1KILC 3P8CE 1M1JC 3GHGA 3MD0A 3HUSC 1VDFA 3GHGB 1SQQK 3E1IA 1IC2A 3M0DA 2P67A 3BRTB 4Y99B 1QL1A 2NPSD 1J1DC 1MFZA 1GZLA 5AVVB 2LKMA 2YKOA 3SWFA 2FYUK 5AVWB 1LTBC 1H89A 1CI6A 1IFIA 1N7SB 2H43A 2Q7CA 1OWAA 4LLHA 3RL0B 4IFMA 3RK2D 3P8CD 1T2KD 2VRSA 4GT1A 4I6MC 2O1JA 1YYCA 2HPCA 3P7KA 1RE3A 1WRGA 3BASA 1LTJA 1NO4A 1HTLC 1L4AC 1LTGC 1T3UA 3I5CA 1DEBA 1E5WA 1LWUA 1JTHB 1YTZI 5KTBA 5APYA 2BASA 2W6BA 2GUVA 4W80A 4M3LA 1J2JB 3GHGC 1JCCA 1XTGB 3VOPA 3CI9A 2C0WA 2I1KA 5CCGD 1GW4A 2Z5HA 3HD7A 1FU1A 2KOGA 4GKGA 2OYHA 2WITA 2N1TA 2R3CA 5CJ4A 5AW3B 2ZXEB 5CJ0A 2P7JA 2C9LY 2C0XA 3B8EB 1N2DC 5APSA 4AUWA 1SP4A 3U59A 1NKZB 3RL0C 5AW4B 3LIDA 3V2NA 1FZGA 5AW8B 2XNXA 4W7YA 5AW7B 1JY2N 4DZOA 2R5DA 2FYZA 1KILD 5APVA 2WWWA 2M3BA 5BU5A 1JY3N 2XDJA 1SQXK 1JY2P 4WY4D 1S9KE 3HD7C 3TSIA 1IFJA 5AVRB 4N6JA 1H8AA 2OYHC 1FBMA 1LGHB 1HUCA 1NU1K 1EQ7A 2XV5A 2N1TC 4JF7A 3MUDA 5APUA 1RY3A 2WSCH 3OJAB 1URQB 1JY3P 2XZRA 2Q5UA 1HJBA 2WT7B 1LT9A 2GUSA 3KDPB 5AVYB 2OYIB 1H88A 3HE4B 4WY4B 2FKWB 3RK3B 1L4AD 1JNMA 5CMZA 3MIWA 3IFMA 3TNUA 1CZQA 3TNUB 2C9NY 3TYYA 2YKQA 4HYTB 1GD2E 1X79B 1JOCA 3A3YB 3V4WA 5AVQB 5KLVK 2GM4A 1RE4A 1GK6A 4JYCA 2IX7C 1FZAA 1J1EC 5KJ7A 1FJKA 2I1JA 3H6PA 1SLQA 1G1IA 1ZR4A 3NXSA 2J59M 3L37A 1N7SA 1GL2B 1M7LA 2YMYA 3V5BA 3PP5A 3N7NA 3C9IA 4XE5B 4B86A 3M9BA 4ZKUA 1NOHA 4AQRD 1LT9C 1LTAC 1SFCD 3O8ZA 3OAKA 3CLQA 4N78D 2MJZA 2IFNA 3RK3C 2NPSB 1L0NK 5CHXA 3BATA 3L35A 1SQPK 1JTHA 3VYIA 1GK4A 1GU5A 1RF1B 5APTA 1L0LK 2R5BA 5BVZA 3L4FA 3RK2B 3U1CA 1HH0A 4IFDK 1RE4C 2WSEH 5CCHD 2WZ7A 5AW5B 4Y99C 3HD7D 1NH4A 5KJ7C 1FZFA 2WSFH 3N4XA 4C7RA 1RF0C 4JYBA 1N7SC 1CW5A 4C7NB 3B5ND 1DX7A 5CCGA 1W2EA 2KYVA 1LTTC 3R2PA 1A02J 3NMDA 3T97A 2W6AA 4LGDE 4I1LA 1SQBK 2Z5IA 2NPSC 1LTIC 3L36A 3HTKB 5AW6B 3M9QA 3VP9A 2QM7A 1AFOA 1A02F 3M0AA 1N73B 1IFMA 3RK2C 1IFDA 1T2KC 3B5NB 3LW5H 1HGVA 2QM8A 1JCDA 3V2RA 2JEEA 1KFMA 1NWQA 1FZCB 1URQA 4GIFA 2KB7P 1JUNA 5AVSB 5AW2B 4HH2A 1KILB 1JMMA 1MZ9A 2KP8A 2HG5D 3V2QA 1M1JB 2CPBA 4IFFA 3NTNA 4W7ZA 2WT7A 3M91A 1IO4A 1ZLLA 2HLOA 2N9BA 1ZV8A 2OYIA 3HE4A 3MTUE 1SVFA 4KHXA 4WY4A 5CCGC 3II6A 3M9HA 2WPQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1RF1 A;  2H43 A;  1FZB A;  1N86 A;  1RF1 B;  1FZC C;  1JY2 P;  3GHG C;  2OYH C;  1W2E A;  3H32 A;  2Q9I A;  3H32 B;  1RE3 C;  1JY2 O;  2FFD C;  1M1J C;  1FZC A;  3GHG A;  1LTJ C;  1FZC B;  3HUS C;  2HOD A;  1FZG A;  1RE4 C;  2A45 G;  2A45 I;  2HOD B;  2XNX A;  1JY2 N;  3GHG B;  1LT9 C;  1JY3 P;  3E1I A;  2OYH A;  2OYH B;  2HPC A;  2A45 H;  2FFD A;  2HPC B;  1M1J A;  1RE3 A;  1N73 C;  1LWU C;  1M1J B;  3HUS A;  1FZF A;  2FFD B;  1LTJ A;  2OYI C;  1RE4 A;  1JY3 O;  1LTJ B;  3HUS B;  1LT9 A;  1RF0 C;  1T3U A;  1LT9 B;  1FZA A;  2HLO A;  2Z4E A;  1FZE A;  1N73 A;  1RF1 C;  1N73 B;  1JY3 N;  1LWU A;  2OYI A;  1LWU B;  2OYI B;  3BVH A;  1RF0 A; 
#chains in the Genus database with same CATH topology
 4PJ0 E;  4UB8 E;  2QG4 A;  2PGD A;  5CBN A;  2YKP A;  1KB9 I;  2ZXX A;  1G2C B;  1QL2 A;  3SSU A;  2N9Y B;  1SQV E;  3Q1M A;  1LTS C;  2IZ0 A;  2OYI C;  1JO5 A;  4WB4 A;  2QRX A;  3AE2 C;  1PFI A;  1KQL A;  3GF3 A;  2V7Q H;  4L74 A;  3U1A A;  2Q9I A;  3HRN A;  3LIE A;  2HFE D;  4U3F G;  2ITA A;  3SFE C;  2A06 E;  3M06 A;  4N3Y B;  3P8M C;  3MGN A;  3CMA P;  3L70 J;  1K9M Q;  1W5C E;  3HE5 A;  2WPS A;  3HE5 B;  1PL5 A;  4C7N A;  2E74 D;  1NTM G;  2M0B A;  3M0D C;  1JY2 O;  1EDL A;  1VQ4 P;  2XU6 A;  1MV8 A;  4K35 A;  1OW6 A;  1T8Z A;  2N1T B;  2M5A B;  5AW1 B;  1ZP0 C;  3H1I E;  3IF4 A;  3L75 D;  1RH5 B;  3VTP C;  2E43 A;  1FZC A;  4KJM A;  3PTZ A;  2J58 A;  2A45 G;  1KIL A;  2JKV A;  2A45 H;  4OGQ C;  1URQ D;  2KSJ A;  4JPZ B;  1DIP A;  1M1K Q;  2YO3 A;  5AW0 B;  4TT3 H;  5APQ A;  3CCU P;  1NU1 D;  3VP8 A;  2E75 D;  3VMX A;  2JJL A;  5TIS E;  4CPG A;  2POH A;  1FOS E;  1VQ7 P;  4XA4 A;  2E42 A;  2H7H A;  2P1J A;  1KB9 E;  1BCC J;  1ZXG A;  2YXQ B;  1BGY G;  2B89 A;  3H32 A;  2M8R A;  1VQP P;  1KIL C;  2ZT9 D;  1PGP A;  1VDF A;  3BRT B;  2BEQ D;  4Y99 B;  1J1D C;  1VQ5 P;  1AQT A;  1MFZ A;  2YKO A;  3H1H J;  2P10 A;  2E76 B;  1CI6 A;  1IFI A;  1N7S B;  3USS A;  1Y8A A;  4LLH A;  2W90 A;  2RMZ A;  3B71 A;  3RK2 D;  4KT0 J;  3PHL A;  2HPC A;  3P7K A;  1RE3 A;  1VL2 A;  1WRG A;  1LTJ A;  3WU2 E;  1T3U A;  3I5C A;  4OWF A;  1E5W A;  1S2E A;  2K1A A;  2BAS A;  2W6B A;  3D70 A;  4M3L A;  1JCC A;  3VOP A;  3AE6 C;  1SQX J;  3HD7 A;  1K8A Q;  2BCC E;  2WIT A;  1BDD A;  2R3C A;  2C0X A;  1RHZ B;  4YTP C;  2OQQ A;  3G6E P;  1KC8 Q;  3V2N A;  4NPF X;  5AW8 B;  2XNX A;  5AW7 B;  2WWW A;  2KZJ A;  2V4H A;  1JY3 N;  5KLV J;  1EXI A;  1SQX D;  1SQX K;  1PPJ D;  2KUB A;  1NTM E;  2R44 A;  3HD7 C;  1H8A A;  3WUV A;  2IYP A;  3AE5 C;  3CCV P;  3L74 J;  3CC2 P;  4IL6 H;  1JY3 P;  3L71 E;  1HJB A;  1EDK A;  2GA1 A;  1W2B O;  2M3E A;  4WWI A;  1L0L J;  1JOC A;  3A3Y B;  1OVU A;  5KLV K;  1KV4 A;  1GK6 A;  1FJK A;  3H6P A;  1ZRT D;  1OIP A;  3NXS A;  3W67 A;  3PP5 A;  1P84 H;  3L74 D;  5M1B A;  1AJY A;  2QEX P;  4ZKU A;  3FXD A;  4AQR D;  1X22 A;  3AEA C;  2IFN A;  2QJY B;  5CHX A;  2KIK A;  3BAT A;  2B87 A;  3O6Q B;  1T6A A;  3L73 J;  2G8Y A;  2KZI A;  2WVR A;  1L0L K;  3B4S A;  1HH0 A;  1QVG O;  1NH4 A;  2L91 A;  1YJW P;  1YJN P;  3EFF K;  1P84 I;  1DX7 A;  3AE9 C;  1M57 D;  1A02 J;  3T97 A;  2W6A A;  2Z5I A;  2QJY C;  1LTI C;  2W6J H;  4QMA A;  2Q6Q A;  1S72 P;  3M0A A;  5H2F H;  3CX5 H;  1T2K C;  3LW5 H;  4RO0 A;  1HGV A;  4H0L B;  1URQ A;  1SQV G;  1PGO A;  5AW2 B;  1NTZ G;  1M1J B;  5E79 H;  3M91 A;  1BCC G;  3H1J J;  4WY4 A;  2WPQ A;  1L0N J;  2WSS H;  3A7O A;  3PLN A;  1ZW0 A;  4BXL A;  1ZR2 A;  4U3F D;  4I7Z B;  2JDI H;  1QVF O;  3H1H G;  2RH0 A;  3C1L A;  2A06 G;  3CX5 I;  1L4A B;  2FYN C;  1N7L A;  1RF0 A;  3CCE P;  2E76 D;  1CSB A;  1URQ C;  1H0T B;  2L5G B;  2PP6 A;  2H88 C;  4I2L C;  3OA7 A;  1BDC A;  4WY4 C;  1FZE A;  4OVN F;  2PRR A;  1RF1 A;  3H1I G;  4I7Z C;  1OFC X;  1EZV D;  1SFC A;  5KLI C;  1SFC B;  2YO2 A;  1KQF B;  1RQU A;  1IJD B;  3G3Z A;  2O01 H;  2E5T A;  1NTK J;  1GU4 A;  2B88 A;  1OXZ A;  1P84 E;  3A2A A;  1LP1 A;  3JSV C;  2JWD A;  2IFM A;  1FJP A;  3CCL P;  1MFT A;  1AQ5 A;  3AEC C;  2XKM A;  2OYH B;  2D2C B;  3L70 E;  1X8Y A;  5KLV G;  1JY3 O;  1IZN B;  3H1L D;  3AEF C;  2Z4E A;  2ZJS E;  1RF1 C;  2WSF J;  1DH3 A;  2FYU G;  4WBA A;  1WT6 A;  2W27 A;  1BGY D;  1SFC C;  1VPC A;  1KYO D;  2ZYG A;  1KB9 H;  3TGU J;  4EOT A;  4GOD A;  1NTK K;  1G1J A;  3CXH H;  2IBZ D;  3BRV B;  1FS0 E;  5AVZ B;  4AYC A;  1AA0 A;  1SQQ J;  4ZKP A;  1Q2N A;  3PRJ A;  1FDM A;  1ZOY C;  3JCU E;  2OAR A;  1HVV A;  4L76 A;  1DD4 A;  1FZB A;  1J1E B;  1L0L G;  2HYN A;  2D2C C;  2BEZ F;  1DD3 A;  1FE6 A;  3WUT A;  4DOJ A;  1D7M A;  1FOS F;  5AVT B;  5H2F E;  3CX5 E;  1USD A;  3KZI E;  2K37 A;  3ITK A;  3VMZ A;  3WU2 H;  3NFQ A;  4PD4 D;  4Y28 J;  3TGU D;  1OVR A;  5BU8 B;  1S9K D;  1G2C A;  3PJS K;  2FY8 A;  2KK7 A;  4H44 B;  3CXH I;  1OW8 A;  5E79 E;  2QE7 H;  1NTZ E;  1KQS O;  1SQQ D;  1SQQ K;  2H89 C;  3M0D A;  2KNC A;  2BCC G;  4ASV A;  1BCC E;  2KNC B;  3L73 G;  1GZL A;  5AVV B;  1VQM P;  3SWF A;  3CCR P;  5AVW B;  3H1K J;  3GG2 A;  1H89 A;  2H43 A;  3BCC J;  4UB6 E;  2Q7C A;  2NRG A;  4GDO A;  1OWA A;  3L75 J;  4IFM A;  3L72 D;  1T2K D;  4GT1 A;  1PIX A;  3H1H E;  1BE3 G;  2WQY C;  3R4Y A;  1JTH B;  5KTB A;  5APY A;  1LNQ A;  4H44 C;  2GUV A;  4W80 A;  4NPE A;  1XTG B;  4DJG A;  2Z5H A;  1FU1 A;  2KOG A;  4GKG A;  1NU1 J;  2N1T A;  5CJ4 A;  2M5A A;  2C9L Y;  3H1K D;  3B8E B;  3BCC D;  3L71 G;  4R4M A;  1JEK A;  1NKZ B;  3RK3 E;  2O01 N;  4TLF A;  3FGA D;  1FZG A;  4D6T D;  3RGU A;  4H0L D;  4U7J A;  2R5D A;  3H1J G;  3ABV C;  5CBO A;  1L0N G;  2M3B A;  5BU5 A;  2XDJ A;  1EDI A;  4WY4 D;  5AVR B;  1FBM A;  1NU1 K;  1EQ7 A;  2XV5 A;  2N1T C;  2NZ2 A;  1RY3 A;  3S9O A;  5KLV E;  2XZR A;  3CWB D;  2I8D A;  2QSI A;  2FYU E;  3KDP B;  1H88 A;  1L4A D;  1SQP J;  2QJP B;  3CXH E;  1CZQ A;  3CCS P;  2YKQ A;  1SQB G;  2WSC J;  1JB0 J;  3EWK A;  4JYC A;  1ZR4 A;  1SLQ A;  2AEF A;  1L0L E;  1N7S A;  1GL2 B;  1M7L A;  3M9B A;  1OW7 A;  1SFC D;  2MJZ A;  4R4L A;  4RKU J;  2NPS B;  3V6I A;  1SQP D;  1SQP K;  3VYI A;  1GK4 A;  2ZYD A;  4MN4 C;  3L4F A;  5KAF H;  1BSN A;  3U1C A;  1SQV D;  1Q81 Q;  4Y99 C;  1KIL E;  2D2C D;  1FZF A;  2WSF H;  3L73 E;  4C7R A;  2MKV A;  3RBZ A;  2E76 C;  1N7S C;  1CW5 A;  1UII A;  5CCG A;  2KYV A;  1NJI Q;  3NMD A;  4LGD E;  2NPS C;  1PP9 J;  1L2P A;  3HTK B;  1BE3 E;  2OTJ P;  1AV1 A;  2WSE J;  1ZME C;  4HKZ H;  1N73 B;  1IFM A;  3Q5R A;  2KLU A;  4Z1M H;  3B5N B;  1IFP A;  2QM8 A;  2ZAE B;  3V2R A;  2K9J B;  4YXD C;  1KFM A;  4GIF A;  2KB7 P;  1JUN A;  4IFF A;  2IDB A;  4W7Z A;  4RJT A;  1HF9 A;  1IO4 A;  2HLO A;  1KMI Z;  4KHX A;  5CCG C;  5B66 H;  3M9H A;  3CL3 D;  4WVZ A;  1PP9 D;  3V2P A;  3D6Z A;  4H44 D;  2HOD B;  3H1J E;  4N78 E;  1RQV A;  1L0N E;  2CK3 H;  3UIA A;  3L75 G;  1YTZ T;  5KKZ B;  2AEM A;  3VN0 A;  3AE4 C;  3L70 G;  3W68 A;  4EIJ A;  4C46 A;  2YMK A;  3TK1 A;  1HJ0 A;  3O6Q A;  1K73 Q;  2O1K A;  1USE A;  1HBW A;  2IYO A;  1PGQ A;  5AW9 B;  3G71 P;  1M56 D;  5KAI E;  1SQB E;  4HB1 A;  2R32 A;  2N1T D;  3D6Y A;  5GTH H;  1LWU B;  5KKZ C;  1N86 A;  1KYO E;  2IPP A;  5APW A;  5GTI H;  3JCU H;  1NTK E;  5CCH A;  1MUU A;  2PAJ A;  1HWT C;  5DJT B;  4L75 A;  3QH9 A;  2OTK E;  1KQG B;  1DEE G;  4U3F J;  3JC2 2;  2AEJ A;  4IOI H;  1XTC C;  5AVU B;  1IK9 A;  2E74 B;  3KZI H;  1YI2 P;  5KAF E;  3GW6 A;  3KYQ A;  1KN7 A;  2K88 A;  2FBW C;  2H8P D;  2J5U A;  1M1J A;  2WTY A;  1LWU C;  3HUS A;  1TU3 F;  2OTL P;  3HUS B;  3E7K A;  3MP7 B;  1MKM A;  3TGU E;  2YIU B;  1M90 Q;  4DCK A;  5CCH C;  3IAO A;  1U7J A;  4UB6 H;  1GTW A;  1SQQ E;  1VQ6 P;  3SFD C;  2QJK B;  3D71 A;  1LT9 B;  3AE8 C;  1FDI A;  1L4A A;  1M8O B;  3BVH A;  1GL2 D;  4DT0 A;  4H0L C;  1H0T A;  1N7S D;  1ZN5 A;  1YIT P;  5APX A;  1NTM D;  1NTM K;  1M1J C;  3GHG A;  3MD0 A;  3HUS C;  1R5S A;  3GHG B;  3E1I A;  1IC2 A;  1EC5 A;  5B66 E;  4XFJ A;  1QL1 A;  2NPS D;  2LKM A;  3H1L J;  1SQX G;  3I56 P;  3A0B E;  2ZT9 B;  3RL0 B;  2JO1 A;  1BGY J;  3P8C D;  2VRS A;  2KXP B;  2O1J A;  2AXC A;  1Q86 Q;  3E1R A;  3BAS A;  1NO4 A;  1L4A C;  3BCC E;  1LTG C;  2KS1 B;  1DEB A;  3F89 A;  1YTZ I;  3L75 E;  3GHG C;  2C0W A;  2I1K A;  5CCG D;  2E5Y A;  2OYH A;  5AW3 B;  5CJ0 A;  2P7J A;  2AXT E;  5APS A;  4AUW A;  3U59 A;  3RL0 C;  1S1C X;  1SS1 A;  1NU1 E;  3G4S P;  1N8R Q;  3L74 G;  2LR2 A;  2QVA A;  4W7Y A;  1NAY A;  5GTH E;  5APV A;  1NYH A;  4ZNC A;  5GTI E;  3TSI A;  3GF7 A;  3CC7 P;  2ZVN B;  2OYH C;  4JF7 A;  5APU A;  2Q5U A;  3GMA A;  3L72 J;  2WT7 B;  2GUS A;  2FXO A;  5AVY B;  2OYI B;  3HE4 B;  1YJ9 P;  4JQ0 D;  3RK3 B;  1JNM A;  5CMZ A;  1Y9B A;  3MIW A;  3I55 P;  3TNU A;  1KD1 Q;  3TNU B;  1GD2 E;  1X79 B;  2O3J A;  5AVQ B;  3G9R A;  4GOE A;  1LT1 A;  1LJ2 A;  2GM4 A;  1RE4 A;  1AVO A;  2B9B A;  2WMM A;  1SQP E;  2IX7 C;  1J1E C;  2OGU A;  5KJ7 A;  2I1J A;  5DJU B;  1VQN P;  2J59 M;  1EDJ A;  3V5B A;  3N7N A;  3C9I A;  4B86 A;  4ASW A;  1NOH A;  3OAK A;  3CLQ A;  3RK3 C;  4D6T J;  1JTH A;  2Y9Y A;  2RKL A;  1VQ8 P;  4EI2 A;  2K3R A;  3CD6 P;  3S1K A;  1Y47 A;  1RE4 C;  5CCH D;  1UIX A;  3FX0 A;  2JP3 A;  2G3A A;  5KJ7 C;  1QX8 A;  2FXP A;  4JYB A;  1YQ4 C;  3OW2 O;  4OGQ B;  3CWB J;  1SQX E;  4JBZ A;  1PPJ E;  1KTM A;  1YBK A;  4C7N B;  1EXJ A;  3FWN A;  1LTT C;  3R2P A;  4I1L A;  1K04 A;  5AW6 B;  4BWN A;  3AEB C;  2QM7 A;  1X0T A;  1A02 F;  2DW3 A;  3MHV A;  1IFD A;  1P84 D;  2KI7 B;  4BRY A;  1PP9 E;  4BRY B;  1JCD A;  1VQL P;  1GMJ A;  2JEE A;  1YIJ P;  1EZV G;  1NWQ A;  1FZC B;  3Q2Y A;  3FXE A;  4EDF A;  4HH2 A;  1KIL B;  1JMM A;  3L70 D;  3NTN A;  2N9B A;  2RN0 A;  3FWL A;  1ZRT E;  3MTU E;  2PFX A;  3A0H H;  1J1D B;  4H13 B;  2Q3E A;  3L74 E;  2W8Z A;  3LW5 J;  2K9Y A;  1KFN A;  5KAI H;  4RES B;  3KQG A;  1S5L H;  2SPZ A;  1PZQ A;  1SQV J;  1X9V A;  1R8E A;  2QIW A;  1NTZ J;  3H1L G;  1VF5 B;  2Q1K A;  1GL2 A;  1FZC C;  3A5T A;  4YXW H;  1PV3 A;  3WMM 0;  3Q3D A;  1NAF A;  3H32 B;  1KYO H;  1T3J A;  3VMY A;  1NTK G;  1EZV I;  3P32 A;  1IFN A;  2A45 I;  3RL0 D;  2IBZ G;  1WMK A;  4OH8 B;  3CME P;  2NPS A;  2FXM A;  3CX5 D;  4H13 C;  2QJP C;  1U57 A;  1CI6 B;  1Z56 A;  5L8R J;  1GW3 A;  3SWK A;  1NGM B;  3RL0 g;  3AEG C;  1SQV K;  1VF5 C;  1NTZ D;  1NTZ K;  3IR9 A;  2FFD A;  2HPC B;  2FFD B;  3SWY A;  1LTJ B;  1BCC D;  1GL2 C;  2Q3I A;  3MZW B;  1OX3 A;  4LC1 A;  3TGU G;  4PD4 H;  5TJH A;  4PV1 B;  2CPS A;  1KYO I;  4O9B A;  3H1I J;  1VQO P;  4EYY Q;  3HTK A;  3HD7 B;  1SQQ G;  3AE1 C;  2IBZ I;  3H1H D;  3KPE A;  2O01 J;  2A06 D;  2ZFC A;  1N73 A;  1FC2 C;  1AVY A;  3B5N A;  2YNY A;  1Q82 Q;  3CC4 P;  3GLM A;  2K9J A;  1NHL A;  1RE3 C;  2FFD C;  4U3F E;  1LTJ C;  1OVV A;  3L72 G;  2P2U A;  2WPV B;  1S4X A;  3AED C;  1KZU B;  4PV1 C;  2KLV A;  2WPR A;  1HGZ A;  1Q7Y Q;  3H1I D;  4PD4 I;  3RK3 D;  2FYU J;  2XND H;  5AVX B;  3A0B H;  2HOD A;  2IZ1 A;  4NPD A;  3S4R A;  1GDT A;  4L73 A;  3EFG A;  1N73 C;  1FAV A;  3H25 A;  3EQ2 A;  2R3S A;  3B5N C;  3H1K G;  1NKN A;  3BCC G;  1K05 A;  1E79 H;  5KJ7 D;  2KSE A;  3V4Q A;  1EZV E;  3F5H A;  3P8C E;  4ZMD A;  4D6T G;  1JMB A;  5KLV D;  1YQ3 C;  1KOR A;  2P67 A;  3TDK A;  3A0H E;  1U7M A;  1QGK B;  1VQ9 P;  2FYU D;  2FYU K;  2YXR B;  2JWA A;  1LTB C;  2Y9Z A;  2AXT H;  4A7P A;  2Y0E A;  3PH0 A;  1KB9 D;  2UWJ E;  3CXH D;  1NU1 G;  3ZDM A;  1S5L E;  5B5E H;  4I6M C;  1YYC A;  1QEX A;  3AE3 C;  2JR8 A;  3CWB G;  3H1L E;  1HTL C;  2BCC J;  2Y0D A;  1LWU A;  4OGQ D;  2B87 B;  2QA4 P;  1BGY E;  1L0L D;  1J2J B;  4GOF A;  4HJG H;  1Q90 D;  1QLE D;  1S5L X;  2V7Q J;  3CI9 A;  2IBZ E;  1GW4 A;  2ZXE B;  1S3J A;  1BE3 J;  1JM0 A;  1N2D C;  1SP4 A;  3KXD A;  3K5B A;  1YHQ P;  5AW4 B;  3LID A;  3T97 B;  4PJ0 H;  1JY2 N;  4DZO A;  1OMI A;  1NTM J;  2BCC D;  4UB8 H;  3CCJ P;  2FYZ A;  1KIL D;  3L73 D;  1SQP G;  4PD4 E;  3L71 J;  1JY2 P;  1S9K E;  1IFJ A;  4H13 D;  4N6J A;  1LGH B;  1HUC A;  2FYN B;  3MUD A;  2ZYA A;  3Q5P A;  2WSC H;  3OJA B;  1URQ B;  5EFW B;  1BE3 D;  1LT9 A;  2E74 C;  1BSH A;  1VF5 D;  4WY4 B;  2FKW B;  3CPW O;  3VMA A;  2E75 B;  3IFM A;  2C9N Y;  3TYY A;  3L72 E;  4HYT B;  1FDO A;  2HR3 A;  3TF5 A;  3V4W A;  2ZVO B;  5KLI B;  5K5G B;  2YIU C;  1FZA A;  3AEE C;  3L71 D;  1G1I A;  3L37 A;  2YMY A;  3MUD C;  1PPJ G;  4XE5 B;  4IL6 E;  1PGJ A;  2W83 C;  3C8V A;  2QJK C;  1LT9 C;  1LTA C;  3O8Z A;  3H1J D;  4N78 D;  3IN6 A;  1SQB J;  3H1K E;  1L0N D;  1L0N K;  2KS1 A;  3L35 A;  2E75 C;  1R5L A;  1GU5 A;  1RF1 B;  2Y0C A;  5APT A;  4IL6 X;  4PV1 D;  2OYO A;  2R5B A;  1PP9 G;  5BVZ A;  4YPC A;  3RK2 B;  4D6T E;  4IFD K;  2WSE H;  2WZ7 A;  5AW5 B;  3HD7 D;  3N4X A;  3AE7 C;  1RF0 C;  2ZT9 C;  1LP1 B;  3B5N D;  5B5E E;  3WUU A;  1W2E A;  1OZH A;  1SQB D;  1SQB K;  5C39 A;  3L36 A;  3M9Q A;  3CWB E;  3VP9 A;  1VQK P;  5TIS H;  1AFO A;  3RBX A;  3KHU A;  3QWO C;  3Q5S A;  3CCQ P;  3RK2 C;  2LXC B;  1IK7 A;  4K3A A;  2P58 A;  1NTK D;  1NVO A;  5AVS B;  2KP8 A;  1MZ9 A;  3V2Q A;  2HG5 D;  2CPB A;  2WT7 A;  1ZLL A;  1ZV8 A;  2OYI A;  2LXB A;  3HE4 A;  3CCM P;  1SVF A;  3II6 A; 
#chains in the Genus database with same CATH homology
 3A7O A;  3CL3 D;  1J1D B;  1KFN A;  3V2P A;  1ZR2 A;  2HOD B;  4N78 E;  4RES B;  3KQG A;  1X9V A;  3UIA A;  1L4A B;  1GL2 A;  1N7L A;  1RF0 A;  2YKP A;  1FZC C;  3A5T A;  3WMM 0;  1CSB A;  1URQ C;  1G2C B;  1QL2 A;  2L5G B;  1NAF A;  2PP6 A;  3H32 B;  1YTZ T;  1T3J A;  3VMY A;  4I2L C;  3VN0 A;  1LTS C;  3OA7 A;  3P32 A;  1IFN A;  2A45 I;  3RL0 D;  4OH8 B;  2OYI C;  1JO5 A;  4WB4 A;  2NPS A;  4EIJ A;  4WY4 C;  2FXM A;  1FZE A;  4C46 A;  3TK1 A;  2O1K A;  1HBW A;  1RF1 A;  1PFI A;  1KQL A;  1CI6 B;  1Z56 A;  1GW3 A;  3U1A A;  5AW9 B;  2Q9I A;  1SFC A;  3HRN A;  3LIE A;  1SFC B;  2YO2 A;  1SQV K;  2HFE D;  2R32 A;  1IJD B;  1NTZ K;  3G3Z A;  3IR9 A;  2O01 H;  2HPC B;  2FFD A;  3M06 A;  2FFD B;  3SWY A;  1LTJ B;  4N3Y B;  2N1T D;  3P8M C;  1GL2 C;  2Q3I A;  1GU4 A;  3MGN A;  1LWU B;  1OXZ A;  3HE5 A;  4LC1 A;  2WPS A;  3A2A A;  3HE5 B;  1N86 A;  2IFM A;  4C7N A;  2IPP A;  5APW A;  1FJP A;  2CPS A;  5CCH A;  3M0D C;  1JY2 O;  1MUU A;  4O9B A;  2PAJ A;  1HWT C;  1AQ5 A;  2XU6 A;  1MV8 A;  3HTK A;  3HD7 B;  2XKM A;  2OYH B;  1T8Z A;  2N1T B;  1X8Y A;  3KPE A;  1JY3 O;  5AW1 B;  2Z4E A;  2ZFC A;  1N73 A;  1RF1 C;  1DH3 A;  1XTC C;  5AVU B;  4WBA A;  1WT6 A;  3B5N A;  1IK9 A;  2W27 A;  1SFC C;  1VPC A;  2YNY A;  3KYQ A;  1NHL A;  1RE3 C;  3VTP C;  4EOT A;  2FFD C;  2E43 A;  1FZC A;  1LTJ C;  1G1J A;  1NTK K;  2H8P D;  2J58 A;  2A45 G;  2P2U A;  1KIL A;  3BRV B;  2A45 H;  1URQ D;  1M1J A;  5AVZ B;  2WTY A;  1LWU C;  2KSJ A;  3HUS A;  4AYC A;  3HUS B;  1KZU B;  4ZKP A;  2KLV A;  2WPR A;  1FDM A;  1HGZ A;  2OAR A;  1HVV A;  5CCH C;  1FZB A;  1J1E B;  2YO3 A;  3RK3 D;  5AW0 B;  2HYN A;  5APQ A;  3VP8 A;  3VMX A;  5AVX B;  4DOJ A;  1GTW A;  2HOD A;  2JJL A;  1GDT A;  3EFG A;  1N73 C;  1FOS F;  5AVT B;  2POH A;  1FAV A;  1LT9 B;  3EQ2 A;  3B5N C;  1FOS E;  1NKN A;  3VMZ A;  4XA4 A;  2E42 A;  2H7H A;  1L4A A;  3NFQ A;  2P1J A;  3BVH A;  5KJ7 D;  3V4Q A;  1GL2 D;  5BU8 B;  1N7S D;  1G2C A;  1ZN5 A;  5APX A;  1S9K D;  1NTM K;  3H32 A;  2M8R A;  1KIL C;  3P8C E;  1M1J C;  3GHG A;  3MD0 A;  3HUS C;  1VDF A;  3GHG B;  1SQQ K;  3E1I A;  1IC2 A;  3M0D A;  2P67 A;  3BRT B;  4Y99 B;  1QL1 A;  2NPS D;  1J1D C;  1MFZ A;  1GZL A;  5AVV B;  2LKM A;  2YKO A;  3SWF A;  2FYU K;  5AVW B;  1LTB C;  1H89 A;  1CI6 A;  1IFI A;  1N7S B;  2H43 A;  2Q7C A;  1OWA A;  4LLH A;  3RL0 B;  4IFM A;  3RK2 D;  3P8C D;  1T2K D;  2VRS A;  4GT1 A;  4I6M C;  2O1J A;  1YYC A;  2HPC A;  3P7K A;  1RE3 A;  1WRG A;  3BAS A;  1LTJ A;  1NO4 A;  1HTL C;  1L4A C;  1LTG C;  1T3U A;  3I5C A;  1DEB A;  1E5W A;  1LWU A;  1JTH B;  1YTZ I;  5KTB A;  5APY A;  2BAS A;  2W6B A;  2GUV A;  4W80 A;  4M3L A;  1J2J B;  3GHG C;  1JCC A;  1XTG B;  3VOP A;  3CI9 A;  2C0W A;  2I1K A;  5CCG D;  1GW4 A;  2Z5H A;  3HD7 A;  1FU1 A;  2KOG A;  4GKG A;  2OYH A;  2WIT A;  2N1T A;  2R3C A;  5CJ4 A;  5AW3 B;  2ZXE B;  5CJ0 A;  2P7J A;  2C9L Y;  2C0X A;  3B8E B;  1N2D C;  5APS A;  4AUW A;  1SP4 A;  3U59 A;  1NKZ B;  3RL0 C;  5AW4 B;  3LID A;  3V2N A;  1FZG A;  5AW8 B;  2XNX A;  4W7Y A;  5AW7 B;  1JY2 N;  4DZO A;  2R5D A;  2FYZ A;  1KIL D;  5APV A;  2WWW A;  2M3B A;  5BU5 A;  1JY3 N;  2XDJ A;  1SQX K;  1JY2 P;  4WY4 D;  1S9K E;  3HD7 C;  3TSI A;  1IFJ A;  5AVR B;  4N6J A;  1H8A A;  2OYH C;  1FBM A;  1LGH B;  1HUC A;  1NU1 K;  1EQ7 A;  2XV5 A;  2N1T C;  4JF7 A;  3MUD A;  5APU A;  1RY3 A;  2WSC H;  3OJA B;  1URQ B;  1JY3 P;  2XZR A;  2Q5U A;  1HJB A;  2WT7 B;  1LT9 A;  2GUS A;  3KDP B;  5AVY B;  2OYI B;  1H88 A;  3HE4 B;  4WY4 B;  2FKW B;  3RK3 B;  1L4A D;  1JNM A;  5CMZ A;  3MIW A;  3IFM A;  3TNU A;  1CZQ A;  3TNU B;  2C9N Y;  3TYY A;  2YKQ A;  4HYT B;  1GD2 E;  1X79 B;  1JOC A;  3A3Y B;  3V4W A;  5AVQ B;  5KLV K;  2GM4 A;  1RE4 A;  1GK6 A;  4JYC A;  2IX7 C;  1FZA A;  1J1E C;  5KJ7 A;  1FJK A;  2I1J A;  3H6P A;  1SLQ A;  1G1I A;  1ZR4 A;  3NXS A;  2J59 M;  3L37 A;  1N7S A;  1GL2 B;  1M7L A;  2YMY A;  3V5B A;  3PP5 A;  3N7N A;  3C9I A;  4XE5 B;  4B86 A;  3M9B A;  4ZKU A;  1NOH A;  4AQR D;  1LT9 C;  1LTA C;  1SFC D;  3O8Z A;  3OAK A;  3CLQ A;  4N78 D;  2MJZ A;  2IFN A;  3RK3 C;  2NPS B;  1L0N K;  5CHX A;  3BAT A;  3L35 A;  1SQP K;  1JTH A;  3VYI A;  1GK4 A;  1GU5 A;  1RF1 B;  5APT A;  1L0L K;  2R5B A;  5BVZ A;  3L4F A;  3RK2 B;  3U1C A;  1HH0 A;  4IFD K;  1RE4 C;  2WSE H;  5CCH D;  2WZ7 A;  5AW5 B;  4Y99 C;  3HD7 D;  1NH4 A;  5KJ7 C;  1FZF A;  2WSF H;  3N4X A;  4C7R A;  1RF0 C;  4JYB A;  1N7S C;  1CW5 A;  4C7N B;  3B5N D;  1DX7 A;  5CCG A;  1W2E A;  2KYV A;  1LTT C;  3R2P A;  1A02 J;  3NMD A;  3T97 A;  2W6A A;  4LGD E;  4I1L A;  1SQB K;  2Z5I A;  2NPS C;  1LTI C;  3L36 A;  3HTK B;  5AW6 B;  3M9Q A;  3VP9 A;  2QM7 A;  1AFO A;  1A02 F;  3M0A A;  1N73 B;  1IFM A;  3RK2 C;  1IFD A;  1T2K C;  3B5N B;  3LW5 H;  1HGV A;  2QM8 A;  1JCD A;  3V2R A;  2JEE A;  1KFM A;  1NWQ A;  1FZC B;  1URQ A;  4GIF A;  2KB7 P;  1JUN A;  5AVS B;  5AW2 B;  4HH2 A;  1KIL B;  1JMM A;  1MZ9 A;  2KP8 A;  2HG5 D;  3V2Q A;  1M1J B;  2CPB A;  4IFF A;  3NTN A;  4W7Z A;  2WT7 A;  3M91 A;  1IO4 A;  1ZLL A;  2HLO A;  2N9B A;  1ZV8 A;  2OYI A;  3HE4 A;  3MTU E;  1SVF A;  4KHX A;  4WY4 A;  5CCG C;  3II6 A;  3M9H A;  2WPQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...