1JY2N

Crystal structure of the central region of bovine fibrinogen (e5 fragment) at 1.4 angstroms resolution
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
43
structure length
43
Chain Sequence
GWPFCSDEDWNTKCPSGCRMKGLIDEVDQDFTSRINKLRDSLF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of the central region of bovine fibrinogen (E5 fragment) at 1.4-A resolution.
pubmed doi rcsb
molecule keywords FIBRINOGEN ALPHA CHAIN
molecule tags Blood clotting
total genus 13
structure length 43
sequence length 43
chains with identical sequence Q
ec nomenclature
pdb deposition date 2001-09-10
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.50 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 1jy2N00
1N73A 1T3UA 3GHGA 1FZBA 3HUSA 1FZGA 2HPCA 1JY2O 1M1JB 1LWUA 2A45I 2OYHA 1LT9C 1FZEA 1FZCC 1LTJB 2FFDA 2FFDB 1JY3P 2Z4EA 1N86A 1RF0A 1JY3O 1RE3C 2OYIC 2HODB 1W2EA 1RF1B 1M1JA 2XNXA 1FZFA 1RE4A 1LTJA 1N73C 1JY2N 3GHGC 3H32B 1LT9B 3HUSC 2OYHC 1FZAA 1LWUC 3E1IA 1FZCB 2HODA 1RF1A 2HLOA 2A45G 2FFDC 1JY3N 1LT9A 2Q9IA 1RF0C 2OYIB 3H32A 1N73B 3GHGB 1FZCA 2A45H 1M1JC 3HUSB 2OYHB 1LWUB 1LTJC 1RE4C 2HPCB 1RE3A 2OYIA 2H43A 3BVHA 1JY2P 1RF1C
chains in the Genus database with same CATH superfamily
2E76D 3U59A 3S9OA 1SQXE 1IFMA 5APQA 1KORA 3WU2H 1SFCB 3NMDA 1OW8A 3CC2P 3BCCE 2FYNB 1CSBA 1FOSF 1SQBG 4L75A 1GL2B 1X9VA 5B5EE 1NKNA 4PV1B 3H1KG 1FC2C 2JWDA 3RK3C 3AE4C 4GT1A 2P7JA 3P8MC 1JY3O 2NZ2A 4NPDA 3L74J 1DIPA 3H32B 3AECC 2OYHC 2ZT9C 2H89C 1FOSE 1NTKK 4ASWA 1J1DC 1FJKA 1XTGB 3RK2D 1BGYJ 1SQVE 2QA4P 1T2KD 3V2PA 1LWUA 3VN0A 4AQRD 1K9MQ 1LTJA 1RH5B 3BCCJ 1GW3A 5AW1B 1FBMA 1RY3A 3VYIA 1PGOA 3AEGC 3AE5C 1KB9H 3A0HE 1EXJA 2V4HA 4RJTA 4H44D 2B87B 1NTKG 1JB0J 1JMBA 2NPSD 2OYOA 3C1LA 3CCUP 3CL3D 3USSA 1KILB 1NU1E 3SWFA 1JO5A 1SQVJ 1IFPA 4I1LA 2QJYC 3CXHH 1NTMD 2YKQA 4AYCA 2MKVA 2JKVA 4XE5B 1KILE 1SQXD 3TSIA 3HD7D 1ZR2A 1FZCA 3BCCD 1VF5B 1N7SA 2IX7C 5AVSB 5GTIH 3JCUH 2V7QH 3U1CA 3VOPA 1JY2O 2WITA 3L74G 3L73E 3S1KA 1KB9I 2OARA 4R4MA 3MUDA 3L71E 2GA1A 1EDJA 1BGYG 4K3AA 3HTKA 1NU1J 1SQXG 1QL1A 1T3UA 1SQVK 4L74A 2ZJSE 4EI2A 3BCCG 1SQVD 2XNXA 3N4XA 1AVOA 3CXHI 2KNCA 1MKMA 1LWUC 3EFGA 1LTJC 5GTHE 2J59M 1QGKB 4UB6E 5CHXA 3L73J 2PAJA 4L73A 2IDBA 4I7ZB 3CI9A 1S2EA 2XV5A 2M3EA 5AVQB 3L71J 2R5DA 1GMJA 2CPSA 1SQVG 3GHGB 3SFEC 3NTNA 1BSNA 1NU1K 1NU1D 2GUVA 1LT1A 5APUA 3RL0B 1VQ8P 2WMMA 3CCSP 1SFCA 1J1EC 1KILD 1N73B 2JR8A 3GMAA 1GL2A 3PLNA 5KAIH 5E79H 2H8PD 2HG5D 2IBZI 2YKPA 1FZCC 2R5BA 5KLIC 3E1RA 1N7SC 3L73D 2WSFH 1NAFA 1NU1G 5KAFE 1S4XA 1MV8A 2O01H 3MUDC 3UIAA 3L71D 3NFQA 5C39A 1VF5D 1U57A 2RN0A 4B86A 3AEAC 4NPFX 1M1KQ 3ITKA 2HPCB 3L73G 1USDA 2E75C 2YIUB 3AEBC 1RQVA 1PP9J 2W6AA 2BCCE 1BDDA 1JCDA 1NTZE 4YPCA 2OTKE 2QM7A 3H1LE 3L71G 4KHXA 5AW2B 1JNMA 2ZYDA 2JEEA 2KYVA 2AEJA 2IYPA 5KJ7A 2N1TD 2JO1A 2FFDB 3HUSA 1PV3A 3B4SA 3TF5A 1X22A 3JSVC 3PJSK 3H1JE 1DEBA 2P2UA 4OGQB 3PP5A 1L0NE 2PGDA 5KKZB 1R5SA 3V4WA 1SFCC 2NRGA 2ZVOB 2WSCJ 3PTZA 2FYNC 1LTGC 3KPEA 3H1LJ 4HJGH 1GL2C 4RO0A 1FZFA 3TDKA 1U7JA 1ZV8A 5APXA 3A5TA 4PV1C 1SP4A 1DH3A 1Q86Q 1QLED 2B89A 1GZLA 1LTBC 4A7PA 1NKZB 4HYTB 4XA4A 1K05A 5APWA 3LIEA 3WU2E 2IYOA 2M3BA 4H13B 1L0NJ 1Q2NA 1HF9A 1PP9G 3FX0A 4UB8H 4Y28J 3OJAB 2VRSA 3LW5J 2K88A 1VQLP 2BCCD 2YO2A 1URQB 2HODB 1H0TB 1NTZD 3R4YA 2G8YA 3H1LD 2WVRA 1BE3J 1L0LE 2QVAA 3U1AA 3P8CE 3L70E 2YMYA 4IFFA 1K8AQ 5H2FH 5KJ7C 5TISH 1A02J 2KSEA 2IPPA 1X0TA 2PFXA 3HUSC 3M06A 1YTZI 3CMAP 5CCGA 3CCLP 3H1JD 2E74B 2C0XA 1L0NK 4M3LA 2JP3A 3H1LG 1L0ND 1KB9E 1T6AA 5AW9B 2E43A 1AJYA 1LP1A 2KSJA 2W6BA 1NHLA 1RF1B 2FYZA 3AE7C 1USEA 1H88A 5AVVB 4QMAA 1L0LJ 2YO3A 5DJTB 5AVZB 3RK2B 3IAOA 2K37A 3MD0A 1ZP0C 3L70J 4LLHA 1KYOH 3CXHE 4Y99B 1YHQP 1L0NG 1SQQE 5APYA 1D7MA 1YTZT 3AE1C 4HB1A 3T97B 2N9YB 3OW2O 2HPCA 1M1JB 5GTIE 3JCUE 4H44B 2KS1B 3L72E 2NPSB 3WMM0 1L4AB 3HE5B 1BE3G 2LXBA 1IZNB 1BDCA 4H13D 1YJ9P 4R4LA 1IJDB 2OYIB 3M9BA 2LR2A 3BRTB 1L0LK 2H43A 1VQ4P 4ZKUA 3KDPB 2OGUA 1H8AA 3D6YA 2FFDA 3P8CD 3L70D 2Z5IA 5APVA 3CWBE 1URQD 1W2BO 1P84H 3B8EB 2H7HA 2OTLP 2K3RA 5AW3B 4D6TE 3QWOC 3H25A 1PZQA 2IBZE 3KZIH 2LXCB 2QJKB 5CCGC 2Q5UA 5L8RJ 1Y9BA 1ZLLA 5CMZA 1CI6B 1N86A 1ZN5A 1KB9D 3M9QA 1L0LG 5CCHD 4ZKPA 2D2CB 3OAKA 3L70G 2WSEJ 2E74D 1SS1A 3CCQP 1PGQA 2Y9YA 3VMAA 3IR9A 3CWBJ 2HFED 2Z5HA 1IFJA 2RMZA 3E1IA 3CXHD 3B5NB 3GLMA 1JM0A 2FBWC 1SQQD 1YBKA 4OVNF 1P84I 3A3YB 4IL6X 1NTMJ 3BVHA 1SQXJ 2LKMA 1LT9B 5M1BA 3L72D 4EYYQ 2YIUC 2HODA 1H0TA 4WY4B 1Q90D 1LTTC 3TGUE 2KUBA 1EDLA 2M0BA 5AVXB 3I5CA 1L4AD 4YXDC 1HJ0A 3OA7A 3CWBD 1GW4A 1ZOYC 2WZ7A 1NH4A 4C7NA 1GU4A 1IO4A 4D6TD 2P1JA 1NTMK 1FJPA 5AW5B 1G2CB 1N7LA 2FXOA 2IBZD 4OGQC 1IFNA 1SQXK 1W2EA 5BU8B 1PPJE 4H0LB 1AA0A 1RF1A 3CC7P 2ZYAA 3TGUJ 2A45H 2POHA 1OX3A 3PH0A 2KB7P 3P32A 3WUVA 3CWBG 3TNUB 4JPZB 1NGMB 1RE4A 2Y0CA 1KFNA 1NTMG 2D2CD 2W8ZA 1VQMP 2N9BA 2C0WA 4WBAA 2QG4A 2KLUA 4N6JA 3O6QA 4IFMA 3AE2C 4KJMA 1DD4A 5APTA 1EDIA 2NPSA 3HE4A 3B5ND 1RHZB 3L75D 3P7KA 2N1TB 2ZVNB 1S5LX 2OYIA 2A45I 3TGUD 3F89A 4RESB 1PIXA 4DOJA 1JUNA 2QJPB 4WY4D 1TU3F 2E76C 2AXTE 3HD7A 1QVGO 2GM4A 3G6EP 2QM8A 2GUSA 2YXRB 4W80A 2Z4EA 4HH2A 3SSUA 1DD3A 2W27A 4W7ZA 1CI6A 1M56D 3TGUG 3AEFC 5B5EH 1NOHA 1PPJD 4GIFA 1RF1C 2XZRA 5B66E 1KC8Q 5AW8B 4YTPC 5TISE 2KK7A 3Q5RA 2L5GB 4H0LD 3RK2C 1HGVA 2K9JB 1VDFA 2KIKA 1JEKA 3H32A 1VQOP 2E5TA 3FXEA 1SVFA 1RE4C 3BASA 1X79B 1FZBA 4PD4H 2WT7B 2PP6A 2R3SA 5APSA 3A2AA 3RK3B 3D71A 1LTAC 3M91A 4JYBA 1FU1A 1LT9A 5AW0B 4H44C 2OYHB 2ZT9B 3I56P 3C8VA 2NPSC 1AV1A 5KTBA 3D6ZA 1FZGA 4DJGA 3RK3E 1KYOE 2OYIC 3H1IE 2O1JA 2B87A 1HVVA 1OVUA 4GDOA 2H88C 1KQGB 1L2PA 4TT3H 1KILA 1AFOA 3G71P 1OWAA 1S3JA 3HD7C 4JF7A 1CW5A 1KZUB 2XNDH 4PD4I 2J58A 2WSSH 2QE7H 2P67A 2WPSA 4TLFA 2BCCJ 2R32A 4BRYB 1NTZJ 3W68A 1BCCE 2CPBA 4CPGA 2R3CA 4JQ0D 1EZVE 2MJZA 2RH0A 2QJYB 4MN4C 4IL6H 1P84E 1HUCA 3TYYA 1U7MA 2O01N 1ZXGA 2UWJE 5DJUB 3R2PA 1SLQA 2W83C 3H1JJ 3H1HE 2B88A 3VMXA 5GTHH 3FWLA 1S9KE 3V4QA 2WWWA 4NPEA 1X8YA 2BEQD 2FKWB 2YXQB 1T3JA 2N1TA 3V2NA 2OQQA 1Z56A 1PL5A 1NTZK 1LGHB 4U3FE 1ZMEC 3GW6A 3L37A 3RK3D 1KYOD 3G3ZA 3H6PA 3H1ID 3AE8C 2G3AA 1LWUB 2ZT9D 2IZ1A 1MFTA 3GHGA 5CBNA 3NXSA 2L91A 1VL2A 2QRXA 1KILC 2R44A 1PGPA 2YMKA 1JY3N 2Q9IA 3BRVB 1FDMA 1IFDA 2BCCG 3GF7A 2WPRA 5KLVD 1NTZG 4IFDK 1SQBE 2FYUE 2Q3EA 1HGZA 2DW3A 1N73A 1AQTA 1ZW0A 4DT0A 2AEFA 3O8ZA 1BCCD 2Y0DA 1VF5C 1IFIA 1EZVD 2KOGA 3A0BH 1P84D 2O3JA 1J1EB 1FE6A 3H1JG 4GOFA 4L76A 1S5LH 3VP9A 3Q3DA 3CX5H 5KLIB 4KT0J 3Q5SA 1N7SB 1FS0E 2FYUJ 3H1HD 1QEXA 2WSCH 1M8OB 4DZOA 1T8ZA 1S9KD 3Q2YA 1VQ7P 2ZFCA 1NTKE 1SQPD 2JJLA 2N1TC 3FXDA 3RBZA 4ASVA 4U3FD 4I6MC 2C9LY 1JOCA 4I7ZC 5AVUB 4EIJA 1XTCC 2E75B 1ZR4A 3TK1A 1SQQJ 1JY2N 3GHGC 4BWNA 4ZMDA 3M9HA 4OWFA 1KYOI 4EDFA 3MHVA 2M8RA 2HR3A 3LW5H 3RL0C 2FYUK 2IFMA 1SQBD 2FYUD 2V7QJ 1NVOA 3L72J 3G4SP 3ABVC 1OVRA 1N73C 2K9YA 4BXLA 1Y8AA 2Q1KA 2JDIH 1BGYE 1G1JA 1NYHA 5CJ0A 3Q1MA 4GOEA 3PHLA 3EWKA 2AEMA 2XU6A 1EZVI 2FYUG 3MTUE 1SQQK 2KZJA 2W6JH 4D6TJ 2HYNA 1IC2A 4LC1A 1MUUA 3M0DA 4W7YA 3VTPC 1NWQA 5KAIE 5E79E 2CK3H 4PJ0H 3VMZA 2WQYC 3L75E 1URQA 1N7SD 1DX7A 3MIWA 1GDTA 1WMKA 2XKMA 1NTKD 3PRJA 3VMYA 1S72P 1JY2P 3RBXA 1SQQG 3IN6A 3CPWO 4PD4E 2P10A 1NAYA 2XDJA 2M5AB 3V2RA 3RL0g 2A45G 2FFDC 2IFNA 1N8RQ 2WTYA 5CCHA 1OVVA 3L72G 1M57D 3V5BA 2Q3IA 1Q82Q 4JYCA 2E75D 1VQPP 5CJ4A 1YJWP 5KKZC 3L75J 3CMEP 3CCVP 3EQ2A 2QIWA 1KTMA 2WSFJ 3L74D 1KFMA 3HUSB 3CCRP 1NJIQ 4OH8B 2O01J 1VQ9P 1EQ7A 2FXPA 2SPZA 1BGYD 3SWYA 3QH9A 3I55P 2KZIA 1JMMA 4D6TG 2JWAA 2IBZG 3CCMP 5CBOA 1RE3A 3T97A 1YYCA 1CZQA 4H13C 1SFCD 3M0DC 1M1JA 2KS1A 1K73Q 1MFZA 2WSEH 4IL6E 5AW4B 1GL2D 1L4AA 3HE5A 1RQUA 3AE3C 2FY8A 4PV1D 1JCCA 1URQC 1OMIA 1QL2A 2I1JA 3SWKA 1E79H 1AVYA 3MGNA 3EFFK 2ZAEB 2QEXP 3M0AA 2A06E 4PD4D 1FDOA 3IF4A 4O9BA 1EDKA 2Y9ZA 4UB8E 2IZ0A 1GU5A 5CCHC 4IOIH 3L75G 4K35A 5TJHA 2E74C 3SFDC 2J5UA 3N7NA 5AVWB 2WPQA 5EFWB 1IK7A 2AXCA 1UIIA 3VP8A 2PRRA 1DEEG 4C7RA 1KQFB 2YKOA 1YIJP 4DCKA 1W5CE 5H2FE 4Z1MH 1H89A 3F5HA 3IFMA 3MP7B 5KJ7D 1T2KC 3KHUA 3Q5PA 3B5NA 1PFIA 3V2QA 1PP9E 1M90Q 4Y99C 1LP1B 3LIDA 4N78E 1PPJG 3KYQA 1UIXA 2B9BA 1RE3C 1KN7A 1HTLC 3B71A 1VQ5P 1OZHA 1WRGA 1M1JC 2Q6QA 1WT6A 3A0HH 4WY4A 2O1KA 3A0BE 2ITAA 3S4RA 1L4AC 1J1DB 3FGAD 3WUUA 1G1IA 3JC22 1S5LE 3CX5E 1J2JB 3A7OA 5BU5A 2M5AA 1LJ2A 4JBZA 2KLVA 1PGJA 2ZYGA 2A06D 2E5YA 1ZRTE 4GKGA 1NO4A 2P58A 2KP8A 1OFCX 3AE9C 3WUTA 1JTHB 1G2CA 4I2LC 3CLQA 5KLVE 1OXZA 5K5GB 5AVYB 1GTWA 2Y0EA 2QJKC 1YQ3C 1OW7A 1FZEA 1VPCA 1LNQA 2D2CC 2A06G 2WPVB 3TNUA 3H1IJ 1N2DC 1OIPA 1LTSC 4HKZH 1K04A 1M7LA 2BASA 1A02F 1PP9D 3KZIE 3RL0D 3B5NC 2ZXXA 3D70A 4N78D 5CCGD 5KLVJ 1KD1Q 1BE3E 3E7KA 4UB6H 3BATA 1MZ9A 3L36A 1LT9C 1BCCJ 1SQPE 4ZNCA 4WY4C 4GODA 4LGDE 3RGUA 2OTJP 3ZDMA 1FZAA 2ZXEB 2AXTH 4RKUJ 5AW6B 2HLOA 1FAVA 1KMIZ 3GF3A 2E42A 4EOTA 3CX5D 4YXWH 2K1AA 5AW7B 1LTJB 1RF0A 1ZRTD 1EXIA 4N3YB 4U7JA 4PJ0E 2C9NY 3H1HJ 1R5LA 3AE6C 3L35A 5KLVK 3W67A 1HBWA 3AEEC 5B66H 2E76B 1LTIC 1KQLA 4H0LC 4C46A 1SQPJ 3H1IG 1IK9A 3H1KE 4U3FJ 1GK6A 1OW6A 5KAFH 2Q7CA 3AEDC 1FDIA 2FXMA 4C7NB 1EC5A 4WB4A 3HRNA 1VQNP 2YNYA 2K9JA 1HH0A 2QSIA 2RKLA 1HWTC 3MZWB 2KI7B 2I1KA 1Y47A 5KLVG 1YQ4C 1Q81Q 3V6IA 2WT7A 3CCJP 1HJBA 1FZCB 4OGQD 1YITP 1QVFO 1YI2P 1SQBJ 1S1CX 1BCCG 1BE3D 2W90A 5AVRB 2OYHA 1EZVG 3K5BA 3H1KJ 1E5WA 1SQPK 3HTKB 3L4FA 2KXPB 1Q7YQ 1GK4A 3O6QB 3CCEP 2BEZF 3KQGA 2QJPC 2KNCB 1JY3P 3II6A 4XFJA 3H1HG 1GD2E 3HE4B 3CC4P 3G9RA 1YJNP 5AVTB 3C9IA 1KQSO 1JTHA 1RF0C 5BVZA 1VQKP 1VQ6P 2I8DA 3CX5I 1SQPG 1L0LD 4WVZA 1BSHA 1SQBK 4U3FG 3FWNA 3CD6P 1KV4A 4BRYA 4WWIA 3L74E 1NTKJ 3HD7B 3KXDA 3H1KD 1AQ5A 1R8EA 3GG2A 1QX8A 4AUWA 1NTME
chains in the Genus database with same CATH topology
1YYCA 3U59A 1FZGA 1CZQA 4IFFA 1IFMA 5KJ7C 1A02J 2IPPA 5APQA 1SFCD 1SFCB 3NMDA 3M0DC 2OYIC 1M1JA 2O1JA 3HUSC 1HVVA 1CSBA 1FOSF 1MFZA 2WSEH 5AW4B 3M06A 1YTZI 1GL2D 5CCGA 1GL2B 1L4AA 3HE5A 1X9VA 2C0XA 1NKNA 1L0NK 4M3LA 1KILA 1JCCA 1AFOA 1URQC 1QL2A 5AW9B 3RK3C 2E43A 1OWAA 4GT1A 3HD7C 4JF7A 2P7JA 3P8MC 2KSJA 2W6BA 2I1JA 1NHLA 1JY3O 1RF1B 1CW5A 2FYZA 1KZUB 3MGNA 3H32B 1H88A 2OYHC 3M0AA 1FOSE 5AVVB 2J58A 1NTKK 2YO3A 5AVZB 1J1DC 1FJKA 1XTGB 2P67A 3RK2B 3RK2D 4O9BA 2WPSA 3MD0A 1T2KD 2R32A 4LLHA 3V2PA 1LWUA 1GU5A 3VN0A 4AQRD 2CPBA 5CCHC 4Y99B 2R3CA 2MJZA 1LTJA 5APYA 1GW3A 5AW1B 3N7NA 1YTZT 5AVWB 2WPQA 1HUCA 3TYYA 1FBMA 1RY3A 3VYIA 3VP8A 2HPCA 4C7RA 1M1JB 3R2PA 1SLQA 2YKOA 2NPSD 2NPSB 3WMM0 1H89A 1L4AB 3HE5B 3IFMA 5KJ7D 3CL3D 3VMXA 1T2KC 1IJDB 1KILB 2OYIB 3M9BA 1S9KE 3BRTB 3V4QA 3SWFA 1JO5A 3B5NA 1PFIA 1L0LK 3V2QA 2WWWA 2H43A 4Y99C 4ZKUA 1X8YA 4I1LA 2FKWB 3KDPB 3LIDA 1T3JA 4N78E 1H8AA 2N1TA 3V2NA 1Z56A 3KYQA 2FFDA 2YKQA 4AYCA 3P8CD 1NTZK 1LGHB 2Z5IA 1RE3C 5APVA 1URQD 4XE5B 1HTLC 3L37A 3B8EB 3RK3D 2H7HA 3TSIA 3HD7D 1ZR2A 5AW3B 3G3ZA 3H6PA 1WRGA 1FZCA 1M1JC 1LWUB 1WT6A 4WY4A 1N7SA 2O1KA 2IX7C 5AVSB 3GHGA 3U1CA 3VOPA 1JY2O 2WITA 5CCGC 2Q5UA 1L4AC 3NXSA 1J1DB 1ZLLA 5CMZA 1CI6B 2OARA 1N86A 1ZN5A 3MUDA 1KILC 3M9QA 1G1IA 5CCHD 4ZKPA 1JY3N 3OAKA 1J2JB 2Q9IA 3A7OA 3BRVB 3HTKA 1FDMA 1IFDA 5BU5A 2WPRA 4IFDK 2KLVA 1HGZA 1N73A 1QL1A 1T3UA 1SQVK 4GKGA 1NO4A 2KP8A 3IR9A 2XNXA 3N4XA 3O8ZA 2HFED 1JTHB 2Z5HA 1G2CA 1IFJA 4I2LC 3CLQA 1LWUC 3E1IA 1OXZA 5AVYB 1IFIA 3B5NB 1GTWA 3EFGA 2KOGA 3A3YB 1LTJC 2J59M 3BVHA 1J1EB 5CHXA 2PAJA 1FZEA 1VPCA 3CI9A 2XV5A 5AVQB 3TNUA 2LKMA 1LT9B 3VP9A 2R5DA 2HODA 2CPSA 4WY4B 1N7SB 1LTTC 3GHGB 1N2DC 3NTNA 1LTSC 2WSCH 1M7LA 1NU1K 4DZOA 1T8ZA 1S9KD 2BASA 1A02F 2GUVA 5APUA 3RL0D 3B5NC 3RL0B 5AVXB 3I5CA 4N78D 2ZFCA 5CCGD 1L4AD 2JJLA 2N1TC 1SFCA 3OA7A 1J1EC 1GW4A 1KILD 1N73B 4I6MC 2C9LY 2WZ7A 1JOCA 1NH4A 4C7NA 1GL2A 1GU4A 1IO4A 3BATA 2H8PD 2HG5D 2P1JA 1MZ9A 1NTMK 1FJPA 3L36A 5AVUB 2YKPA 1LT9C 5AW5B 1G2CB 1N7LA 1XTCC 2R5BA 4EIJA 1ZR4A 1FZCC 3T97A 4WY4C 1IFNA 1N7SC 3TK1A 1SQXK 1W2EA 4LGDE 5BU8B 1JY2N 3GHGC 2WSFH 1NAFA 1FZAA 2ZXEB 3M9HA 1RF1A 5AW6B 2HLOA 1FAVA 2M8RA 2A45H 1MV8A 2O01H 3UIAA 4EOTA 2E42A 2POHA 3NFQA 2KB7P 3P32A 3LW5H 3RL0C 2FYUK 2IFMA 3TNUB 5AW7B 1LTJB 4B86A 1RF0A 1RE4A 4N3YB 1N73C 2C9NY 1KFNA 3L35A 5KLVK 1HBWA 1G1JA 2HPCB 2N9BA 2C0WA 4WBAA 2W6AA 1JCDA 5CJ0A 1LTIC 1KQLA 4N6JA 4C46A 2QM7A 4IFMA 1IK9A 1GK6A 4KHXA 5AW2B 2Q7CA 1JNMA 2XU6A 5APTA 2JEEA 2NPSA 2KYVA 2FXMA 3MTUE 4C7NB 1SQQK 3HE4A 3B5ND 4WB4A 3HRNA 5KJ7A 2HYNA 1IC2A 3P7KA 2N1TD 2N1TB 4LC1A 2YNYA 2OYIA 1MUUA 3M0DA 4W7YA 2FFDB 1HH0A 3VTPC 1HWTC 1NWQA 3HUSA 2A45I 2I1KA 4RESB 3VMZA 4DOJA 2WT7A 1JUNA 1HJBA 1DEBA 1FZCB 2P2UA 1URQA 3PP5A 4WY4D 1N7SD 1DX7A 3MIWA 1GDTA 2XKMA 3HD7A 3VMYA 3V4WA 2GM4A 1SFCC 1JY2P 2QM8A 5AVRB 2OYHA 2GUSA 1LTGC 3KPEA 4W80A 1E5WA 2Z4EA 1GL2C 4HH2A 1SQPK 2W27A 4W7ZA 1FZFA 1CI6A 2XDJA 3HTKB 3L4FA 1ZV8A 5APXA 3A5TA 3V2RA 1SP4A 2A45G 2FFDC 1NOHA 2IFNA 1DH3A 2WTYA 5CCHA 4GIFA 1GK4A 1GZLA 1LTBC 1NKZB 1RF1C 2XZRA 3V5BA 4HYTB 3KQGA 2Q3IA 4XA4A 5AW8B 4JYCA 1JY3P 3II6A 5APWA 3LIEA 1GD2E 3HE4B 5CJ4A 2L5GB 5AVTB 3RK2C 1HGVA 3EQ2A 3C9IA 2M3BA 1JTHA 1KFMA 1RF0C 1VDFA 3H32A 5BVZA 3HUSB 1SVFA 1RE4C 3BASA 4OH8B 1EQ7A 3OJAB 1X79B 1FZBA 2VRSA 1SQBK 3SWYA 2WT7B 2PP6A 2YO2A 1URQB 2HODB 1JMMA 5APSA 3A2AA 3RK3B 3HD7B 1LTAC 1AQ5A 3M91A 4JYBA 1FU1A 1LT9A 5AW0B 4AUWA 3U1AA 2OYHB 1RE3A 3P8CE 2NPSC 2YMYA 5KTBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1N73 A;  1T3U A;  3GHG A;  1FZB A;  3HUS A;  1FZG A;  2HPC A;  1JY2 O;  1M1J B;  1LWU A;  2A45 I;  2OYH A;  1LT9 C;  1FZE A;  1FZC C;  1LTJ B;  2FFD A;  2FFD B;  1JY3 P;  2Z4E A;  1N86 A;  1RF0 A;  1JY3 O;  1RE3 C;  2OYI C;  2HOD B;  1W2E A;  1RF1 B;  1M1J A;  2XNX A;  1FZF A;  1RE4 A;  1LTJ A;  1N73 C;  1JY2 N;  3GHG C;  3H32 B;  1LT9 B;  3HUS C;  2OYH C;  1FZA A;  1LWU C;  3E1I A;  1FZC B;  2HOD A;  1RF1 A;  2HLO A;  2A45 G;  2FFD C;  1JY3 N;  1LT9 A;  2Q9I A;  1RF0 C;  2OYI B;  3H32 A;  1N73 B;  3GHG B;  1FZC A;  2A45 H;  1M1J C;  3HUS B;  2OYH B;  1LWU B;  1LTJ C;  1RE4 C;  2HPC B;  1RE3 A;  2OYI A;  2H43 A;  3BVH A;  1JY2 P;  1RF1 C; 
#chains in the Genus database with same CATH topology
 2E76 D;  3U59 A;  3S9O A;  1SQX E;  1IFM A;  5APQ A;  1KOR A;  3WU2 H;  1SFC B;  3NMD A;  1OW8 A;  3CC2 P;  3BCC E;  2FYN B;  1CSB A;  1FOS F;  1SQB G;  4L75 A;  1GL2 B;  1X9V A;  5B5E E;  1NKN A;  4PV1 B;  3H1K G;  1FC2 C;  2JWD A;  3RK3 C;  3AE4 C;  4GT1 A;  2P7J A;  3P8M C;  1JY3 O;  2NZ2 A;  4NPD A;  3L74 J;  1DIP A;  3H32 B;  3AEC C;  2OYH C;  2ZT9 C;  2H89 C;  1FOS E;  1NTK K;  4ASW A;  1J1D C;  1FJK A;  1XTG B;  3RK2 D;  1BGY J;  1SQV E;  2QA4 P;  1T2K D;  3V2P A;  1LWU A;  3VN0 A;  4AQR D;  1K9M Q;  1LTJ A;  1RH5 B;  3BCC J;  1GW3 A;  5AW1 B;  1FBM A;  1RY3 A;  3VYI A;  1PGO A;  3AEG C;  3AE5 C;  1KB9 H;  3A0H E;  1EXJ A;  2V4H A;  4RJT A;  4H44 D;  2B87 B;  1NTK G;  1JB0 J;  1JMB A;  2NPS D;  2OYO A;  3C1L A;  3CCU P;  3CL3 D;  3USS A;  1KIL B;  1NU1 E;  3SWF A;  1JO5 A;  1SQV J;  1IFP A;  4I1L A;  2QJY C;  3CXH H;  1NTM D;  2YKQ A;  4AYC A;  2MKV A;  2JKV A;  4XE5 B;  1KIL E;  1SQX D;  3TSI A;  3HD7 D;  1ZR2 A;  1FZC A;  3BCC D;  1VF5 B;  1N7S A;  2IX7 C;  5AVS B;  5GTI H;  3JCU H;  2V7Q H;  3U1C A;  3VOP A;  1JY2 O;  2WIT A;  3L74 G;  3L73 E;  3S1K A;  1KB9 I;  2OAR A;  4R4M A;  3MUD A;  3L71 E;  2GA1 A;  1EDJ A;  1BGY G;  4K3A A;  3HTK A;  1NU1 J;  1SQX G;  1QL1 A;  1T3U A;  1SQV K;  4L74 A;  2ZJS E;  4EI2 A;  3BCC G;  1SQV D;  2XNX A;  3N4X A;  1AVO A;  3CXH I;  2KNC A;  1MKM A;  1LWU C;  3EFG A;  1LTJ C;  5GTH E;  2J59 M;  1QGK B;  4UB6 E;  5CHX A;  3L73 J;  2PAJ A;  4L73 A;  2IDB A;  4I7Z B;  3CI9 A;  1S2E A;  2XV5 A;  2M3E A;  5AVQ B;  3L71 J;  2R5D A;  1GMJ A;  2CPS A;  1SQV G;  3GHG B;  3SFE C;  3NTN A;  1BSN A;  1NU1 K;  1NU1 D;  2GUV A;  1LT1 A;  5APU A;  3RL0 B;  1VQ8 P;  2WMM A;  3CCS P;  1SFC A;  1J1E C;  1KIL D;  1N73 B;  2JR8 A;  3GMA A;  1GL2 A;  3PLN A;  5KAI H;  5E79 H;  2H8P D;  2HG5 D;  2IBZ I;  2YKP A;  1FZC C;  2R5B A;  5KLI C;  3E1R A;  1N7S C;  3L73 D;  2WSF H;  1NAF A;  1NU1 G;  5KAF E;  1S4X A;  1MV8 A;  2O01 H;  3MUD C;  3UIA A;  3L71 D;  3NFQ A;  5C39 A;  1VF5 D;  1U57 A;  2RN0 A;  4B86 A;  3AEA C;  4NPF X;  1M1K Q;  3ITK A;  2HPC B;  3L73 G;  1USD A;  2E75 C;  2YIU B;  3AEB C;  1RQV A;  1PP9 J;  2W6A A;  2BCC E;  1BDD A;  1JCD A;  1NTZ E;  4YPC A;  2OTK E;  2QM7 A;  3H1L E;  3L71 G;  4KHX A;  5AW2 B;  1JNM A;  2ZYD A;  2JEE A;  2KYV A;  2AEJ A;  2IYP A;  5KJ7 A;  2N1T D;  2JO1 A;  2FFD B;  3HUS A;  1PV3 A;  3B4S A;  3TF5 A;  1X22 A;  3JSV C;  3PJS K;  3H1J E;  1DEB A;  2P2U A;  4OGQ B;  3PP5 A;  1L0N E;  2PGD A;  5KKZ B;  1R5S A;  3V4W A;  1SFC C;  2NRG A;  2ZVO B;  2WSC J;  3PTZ A;  2FYN C;  1LTG C;  3KPE A;  3H1L J;  4HJG H;  1GL2 C;  4RO0 A;  1FZF A;  3TDK A;  1U7J A;  1ZV8 A;  5APX A;  3A5T A;  4PV1 C;  1SP4 A;  1DH3 A;  1Q86 Q;  1QLE D;  2B89 A;  1GZL A;  1LTB C;  4A7P A;  1NKZ B;  4HYT B;  4XA4 A;  1K05 A;  5APW A;  3LIE A;  3WU2 E;  2IYO A;  2M3B A;  4H13 B;  1L0N J;  1Q2N A;  1HF9 A;  1PP9 G;  3FX0 A;  4UB8 H;  4Y28 J;  3OJA B;  2VRS A;  3LW5 J;  2K88 A;  1VQL P;  2BCC D;  2YO2 A;  1URQ B;  2HOD B;  1H0T B;  1NTZ D;  3R4Y A;  2G8Y A;  3H1L D;  2WVR A;  1BE3 J;  1L0L E;  2QVA A;  3U1A A;  3P8C E;  3L70 E;  2YMY A;  4IFF A;  1K8A Q;  5H2F H;  5KJ7 C;  5TIS H;  1A02 J;  2KSE A;  2IPP A;  1X0T A;  2PFX A;  3HUS C;  3M06 A;  1YTZ I;  3CMA P;  5CCG A;  3CCL P;  3H1J D;  2E74 B;  2C0X A;  1L0N K;  4M3L A;  2JP3 A;  3H1L G;  1L0N D;  1KB9 E;  1T6A A;  5AW9 B;  2E43 A;  1AJY A;  1LP1 A;  2KSJ A;  2W6B A;  1NHL A;  1RF1 B;  2FYZ A;  3AE7 C;  1USE A;  1H88 A;  5AVV B;  4QMA A;  1L0L J;  2YO3 A;  5DJT B;  5AVZ B;  3RK2 B;  3IAO A;  2K37 A;  3MD0 A;  1ZP0 C;  3L70 J;  4LLH A;  1KYO H;  3CXH E;  4Y99 B;  1YHQ P;  1L0N G;  1SQQ E;  5APY A;  1D7M A;  1YTZ T;  3AE1 C;  4HB1 A;  3T97 B;  2N9Y B;  3OW2 O;  2HPC A;  1M1J B;  5GTI E;  3JCU E;  4H44 B;  2KS1 B;  3L72 E;  2NPS B;  3WMM 0;  1L4A B;  3HE5 B;  1BE3 G;  2LXB A;  1IZN B;  1BDC A;  4H13 D;  1YJ9 P;  4R4L A;  1IJD B;  2OYI B;  3M9B A;  2LR2 A;  3BRT B;  1L0L K;  2H43 A;  1VQ4 P;  4ZKU A;  3KDP B;  2OGU A;  1H8A A;  3D6Y A;  2FFD A;  3P8C D;  3L70 D;  2Z5I A;  5APV A;  3CWB E;  1URQ D;  1W2B O;  1P84 H;  3B8E B;  2H7H A;  2OTL P;  2K3R A;  5AW3 B;  4D6T E;  3QWO C;  3H25 A;  1PZQ A;  2IBZ E;  3KZI H;  2LXC B;  2QJK B;  5CCG C;  2Q5U A;  5L8R J;  1Y9B A;  1ZLL A;  5CMZ A;  1CI6 B;  1N86 A;  1ZN5 A;  1KB9 D;  3M9Q A;  1L0L G;  5CCH D;  4ZKP A;  2D2C B;  3OAK A;  3L70 G;  2WSE J;  2E74 D;  1SS1 A;  3CCQ P;  1PGQ A;  2Y9Y A;  3VMA A;  3IR9 A;  3CWB J;  2HFE D;  2Z5H A;  1IFJ A;  2RMZ A;  3E1I A;  3CXH D;  3B5N B;  3GLM A;  1JM0 A;  2FBW C;  1SQQ D;  1YBK A;  4OVN F;  1P84 I;  3A3Y B;  4IL6 X;  1NTM J;  3BVH A;  1SQX J;  2LKM A;  1LT9 B;  5M1B A;  3L72 D;  4EYY Q;  2YIU C;  2HOD A;  1H0T A;  4WY4 B;  1Q90 D;  1LTT C;  3TGU E;  2KUB A;  1EDL A;  2M0B A;  5AVX B;  3I5C A;  1L4A D;  4YXD C;  1HJ0 A;  3OA7 A;  3CWB D;  1GW4 A;  1ZOY C;  2WZ7 A;  1NH4 A;  4C7N A;  1GU4 A;  1IO4 A;  4D6T D;  2P1J A;  1NTM K;  1FJP A;  5AW5 B;  1G2C B;  1N7L A;  2FXO A;  2IBZ D;  4OGQ C;  1IFN A;  1SQX K;  1W2E A;  5BU8 B;  1PPJ E;  4H0L B;  1AA0 A;  1RF1 A;  3CC7 P;  2ZYA A;  3TGU J;  2A45 H;  2POH A;  1OX3 A;  3PH0 A;  2KB7 P;  3P32 A;  3WUV A;  3CWB G;  3TNU B;  4JPZ B;  1NGM B;  1RE4 A;  2Y0C A;  1KFN A;  1NTM G;  2D2C D;  2W8Z A;  1VQM P;  2N9B A;  2C0W A;  4WBA A;  2QG4 A;  2KLU A;  4N6J A;  3O6Q A;  4IFM A;  3AE2 C;  4KJM A;  1DD4 A;  5APT A;  1EDI A;  2NPS A;  3HE4 A;  3B5N D;  1RHZ B;  3L75 D;  3P7K A;  2N1T B;  2ZVN B;  1S5L X;  2OYI A;  2A45 I;  3TGU D;  3F89 A;  4RES B;  1PIX A;  4DOJ A;  1JUN A;  2QJP B;  4WY4 D;  1TU3 F;  2E76 C;  2AXT E;  3HD7 A;  1QVG O;  2GM4 A;  3G6E P;  2QM8 A;  2GUS A;  2YXR B;  4W80 A;  2Z4E A;  4HH2 A;  3SSU A;  1DD3 A;  2W27 A;  4W7Z A;  1CI6 A;  1M56 D;  3TGU G;  3AEF C;  5B5E H;  1NOH A;  1PPJ D;  4GIF A;  1RF1 C;  2XZR A;  5B66 E;  1KC8 Q;  5AW8 B;  4YTP C;  5TIS E;  2KK7 A;  3Q5R A;  2L5G B;  4H0L D;  3RK2 C;  1HGV A;  2K9J B;  1VDF A;  2KIK A;  1JEK A;  3H32 A;  1VQO P;  2E5T A;  3FXE A;  1SVF A;  1RE4 C;  3BAS A;  1X79 B;  1FZB A;  4PD4 H;  2WT7 B;  2PP6 A;  2R3S A;  5APS A;  3A2A A;  3RK3 B;  3D71 A;  1LTA C;  3M91 A;  4JYB A;  1FU1 A;  1LT9 A;  5AW0 B;  4H44 C;  2OYH B;  2ZT9 B;  3I56 P;  3C8V A;  2NPS C;  1AV1 A;  5KTB A;  3D6Z A;  1FZG A;  4DJG A;  3RK3 E;  1KYO E;  2OYI C;  3H1I E;  2O1J A;  2B87 A;  1HVV A;  1OVU A;  4GDO A;  2H88 C;  1KQG B;  1L2P A;  4TT3 H;  1KIL A;  1AFO A;  3G71 P;  1OWA A;  1S3J A;  3HD7 C;  4JF7 A;  1CW5 A;  1KZU B;  2XND H;  4PD4 I;  2J58 A;  2WSS H;  2QE7 H;  2P67 A;  2WPS A;  4TLF A;  2BCC J;  2R32 A;  4BRY B;  1NTZ J;  3W68 A;  1BCC E;  2CPB A;  4CPG A;  2R3C A;  4JQ0 D;  1EZV E;  2MJZ A;  2RH0 A;  2QJY B;  4MN4 C;  4IL6 H;  1P84 E;  1HUC A;  3TYY A;  1U7M A;  2O01 N;  1ZXG A;  2UWJ E;  5DJU B;  3R2P A;  1SLQ A;  2W83 C;  3H1J J;  3H1H E;  2B88 A;  3VMX A;  5GTH H;  3FWL A;  1S9K E;  3V4Q A;  2WWW A;  4NPE A;  1X8Y A;  2BEQ D;  2FKW B;  2YXQ B;  1T3J A;  2N1T A;  3V2N A;  2OQQ A;  1Z56 A;  1PL5 A;  1NTZ K;  1LGH B;  4U3F E;  1ZME C;  3GW6 A;  3L37 A;  3RK3 D;  1KYO D;  3G3Z A;  3H6P A;  3H1I D;  3AE8 C;  2G3A A;  1LWU B;  2ZT9 D;  2IZ1 A;  1MFT A;  3GHG A;  5CBN A;  3NXS A;  2L91 A;  1VL2 A;  2QRX A;  1KIL C;  2R44 A;  1PGP A;  2YMK A;  1JY3 N;  2Q9I A;  3BRV B;  1FDM A;  1IFD A;  2BCC G;  3GF7 A;  2WPR A;  5KLV D;  1NTZ G;  4IFD K;  1SQB E;  2FYU E;  2Q3E A;  1HGZ A;  2DW3 A;  1N73 A;  1AQT A;  1ZW0 A;  4DT0 A;  2AEF A;  3O8Z A;  1BCC D;  2Y0D A;  1VF5 C;  1IFI A;  1EZV D;  2KOG A;  3A0B H;  1P84 D;  2O3J A;  1J1E B;  1FE6 A;  3H1J G;  4GOF A;  4L76 A;  1S5L H;  3VP9 A;  3Q3D A;  3CX5 H;  5KLI B;  4KT0 J;  3Q5S A;  1N7S B;  1FS0 E;  2FYU J;  3H1H D;  1QEX A;  2WSC H;  1M8O B;  4DZO A;  1T8Z A;  1S9K D;  3Q2Y A;  1VQ7 P;  2ZFC A;  1NTK E;  1SQP D;  2JJL A;  2N1T C;  3FXD A;  3RBZ A;  4ASV A;  4U3F D;  4I6M C;  2C9L Y;  1JOC A;  4I7Z C;  5AVU B;  4EIJ A;  1XTC C;  2E75 B;  1ZR4 A;  3TK1 A;  1SQQ J;  1JY2 N;  3GHG C;  4BWN A;  4ZMD A;  3M9H A;  4OWF A;  1KYO I;  4EDF A;  3MHV A;  2M8R A;  2HR3 A;  3LW5 H;  3RL0 C;  2FYU K;  2IFM A;  1SQB D;  2FYU D;  2V7Q J;  1NVO A;  3L72 J;  3G4S P;  3ABV C;  1OVR A;  1N73 C;  2K9Y A;  4BXL A;  1Y8A A;  2Q1K A;  2JDI H;  1BGY E;  1G1J A;  1NYH A;  5CJ0 A;  3Q1M A;  4GOE A;  3PHL A;  3EWK A;  2AEM A;  2XU6 A;  1EZV I;  2FYU G;  3MTU E;  1SQQ K;  2KZJ A;  2W6J H;  4D6T J;  2HYN A;  1IC2 A;  4LC1 A;  1MUU A;  3M0D A;  4W7Y A;  3VTP C;  1NWQ A;  5KAI E;  5E79 E;  2CK3 H;  4PJ0 H;  3VMZ A;  2WQY C;  3L75 E;  1URQ A;  1N7S D;  1DX7 A;  3MIW A;  1GDT A;  1WMK A;  2XKM A;  1NTK D;  3PRJ A;  3VMY A;  1S72 P;  1JY2 P;  3RBX A;  1SQQ G;  3IN6 A;  3CPW O;  4PD4 E;  2P10 A;  1NAY A;  2XDJ A;  2M5A B;  3V2R A;  3RL0 g;  2A45 G;  2FFD C;  2IFN A;  1N8R Q;  2WTY A;  5CCH A;  1OVV A;  3L72 G;  1M57 D;  3V5B A;  2Q3I A;  1Q82 Q;  4JYC A;  2E75 D;  1VQP P;  5CJ4 A;  1YJW P;  5KKZ C;  3L75 J;  3CME P;  3CCV P;  3EQ2 A;  2QIW A;  1KTM A;  2WSF J;  3L74 D;  1KFM A;  3HUS B;  3CCR P;  1NJI Q;  4OH8 B;  2O01 J;  1VQ9 P;  1EQ7 A;  2FXP A;  2SPZ A;  1BGY D;  3SWY A;  3QH9 A;  3I55 P;  2KZI A;  1JMM A;  4D6T G;  2JWA A;  2IBZ G;  3CCM P;  5CBO A;  1RE3 A;  3T97 A;  1YYC A;  1CZQ A;  4H13 C;  1SFC D;  3M0D C;  1M1J A;  2KS1 A;  1K73 Q;  1MFZ A;  2WSE H;  4IL6 E;  5AW4 B;  1GL2 D;  1L4A A;  3HE5 A;  1RQU A;  3AE3 C;  2FY8 A;  4PV1 D;  1JCC A;  1URQ C;  1OMI A;  1QL2 A;  2I1J A;  3SWK A;  1E79 H;  1AVY A;  3MGN A;  3EFF K;  2ZAE B;  2QEX P;  3M0A A;  2A06 E;  4PD4 D;  1FDO A;  3IF4 A;  4O9B A;  1EDK A;  2Y9Z A;  4UB8 E;  2IZ0 A;  1GU5 A;  5CCH C;  4IOI H;  3L75 G;  4K35 A;  5TJH A;  2E74 C;  3SFD C;  2J5U A;  3N7N A;  5AVW B;  2WPQ A;  5EFW B;  1IK7 A;  2AXC A;  1UII A;  3VP8 A;  2PRR A;  1DEE G;  4C7R A;  1KQF B;  2YKO A;  1YIJ P;  4DCK A;  1W5C E;  5H2F E;  4Z1M H;  1H89 A;  3F5H A;  3IFM A;  3MP7 B;  5KJ7 D;  1T2K C;  3KHU A;  3Q5P A;  3B5N A;  1PFI A;  3V2Q A;  1PP9 E;  1M90 Q;  4Y99 C;  1LP1 B;  3LID A;  4N78 E;  1PPJ G;  3KYQ A;  1UIX A;  2B9B A;  1RE3 C;  1KN7 A;  1HTL C;  3B71 A;  1VQ5 P;  1OZH A;  1WRG A;  1M1J C;  2Q6Q A;  1WT6 A;  3A0H H;  4WY4 A;  2O1K A;  3A0B E;  2ITA A;  3S4R A;  1L4A C;  1J1D B;  3FGA D;  3WUU A;  1G1I A;  3JC2 2;  1S5L E;  3CX5 E;  1J2J B;  3A7O A;  5BU5 A;  2M5A A;  1LJ2 A;  4JBZ A;  2KLV A;  1PGJ A;  2ZYG A;  2A06 D;  2E5Y A;  1ZRT E;  4GKG A;  1NO4 A;  2P58 A;  2KP8 A;  1OFC X;  3AE9 C;  3WUT A;  1JTH B;  1G2C A;  4I2L C;  3CLQ A;  5KLV E;  1OXZ A;  5K5G B;  5AVY B;  1GTW A;  2Y0E A;  2QJK C;  1YQ3 C;  1OW7 A;  1FZE A;  1VPC A;  1LNQ A;  2D2C C;  2A06 G;  2WPV B;  3TNU A;  3H1I J;  1N2D C;  1OIP A;  1LTS C;  4HKZ H;  1K04 A;  1M7L A;  2BAS A;  1A02 F;  1PP9 D;  3KZI E;  3RL0 D;  3B5N C;  2ZXX A;  3D70 A;  4N78 D;  5CCG D;  5KLV J;  1KD1 Q;  1BE3 E;  3E7K A;  4UB6 H;  3BAT A;  1MZ9 A;  3L36 A;  1LT9 C;  1BCC J;  1SQP E;  4ZNC A;  4WY4 C;  4GOD A;  4LGD E;  3RGU A;  2OTJ P;  3ZDM A;  1FZA A;  2ZXE B;  2AXT H;  4RKU J;  5AW6 B;  2HLO A;  1FAV A;  1KMI Z;  3GF3 A;  2E42 A;  4EOT A;  3CX5 D;  4YXW H;  2K1A A;  5AW7 B;  1LTJ B;  1RF0 A;  1ZRT D;  1EXI A;  4N3Y B;  4U7J A;  4PJ0 E;  2C9N Y;  3H1H J;  1R5L A;  3AE6 C;  3L35 A;  5KLV K;  3W67 A;  1HBW A;  3AEE C;  5B66 H;  2E76 B;  1LTI C;  1KQL A;  4H0L C;  4C46 A;  1SQP J;  3H1I G;  1IK9 A;  3H1K E;  4U3F J;  1GK6 A;  1OW6 A;  5KAF H;  2Q7C A;  3AED C;  1FDI A;  2FXM A;  4C7N B;  1EC5 A;  4WB4 A;  3HRN A;  1VQN P;  2YNY A;  2K9J A;  1HH0 A;  2QSI A;  2RKL A;  1HWT C;  3MZW B;  2KI7 B;  2I1K A;  1Y47 A;  5KLV G;  1YQ4 C;  1Q81 Q;  3V6I A;  2WT7 A;  3CCJ P;  1HJB A;  1FZC B;  4OGQ D;  1YIT P;  1QVF O;  1YI2 P;  1SQB J;  1S1C X;  1BCC G;  1BE3 D;  2W90 A;  5AVR B;  2OYH A;  1EZV G;  3K5B A;  3H1K J;  1E5W A;  1SQP K;  3HTK B;  3L4F A;  2KXP B;  1Q7Y Q;  1GK4 A;  3O6Q B;  3CCE P;  2BEZ F;  3KQG A;  2QJP C;  2KNC B;  1JY3 P;  3II6 A;  4XFJ A;  3H1H G;  1GD2 E;  3HE4 B;  3CC4 P;  3G9R A;  1YJN P;  5AVT B;  3C9I A;  1KQS O;  1JTH A;  1RF0 C;  5BVZ A;  1VQK P;  1VQ6 P;  2I8D A;  3CX5 I;  1SQP G;  1L0L D;  4WVZ A;  1BSH A;  1SQB K;  4U3F G;  3FWN A;  3CD6 P;  1KV4 A;  4BRY A;  4WWI A;  3L74 E;  1NTK J;  3HD7 B;  3KXD A;  3H1K D;  1AQ5 A;  1R8E A;  3GG2 A;  1QX8 A;  4AUW A;  1NTM E; 
#chains in the Genus database with same CATH homology
 1YYC A;  3U59 A;  1FZG A;  1CZQ A;  4IFF A;  1IFM A;  5KJ7 C;  1A02 J;  2IPP A;  5APQ A;  1SFC D;  1SFC B;  3NMD A;  3M0D C;  2OYI C;  1M1J A;  2O1J A;  3HUS C;  1HVV A;  1CSB A;  1FOS F;  1MFZ A;  2WSE H;  5AW4 B;  3M06 A;  1YTZ I;  1GL2 D;  5CCG A;  1GL2 B;  1L4A A;  3HE5 A;  1X9V A;  2C0X A;  1NKN A;  1L0N K;  4M3L A;  1KIL A;  1JCC A;  1AFO A;  1URQ C;  1QL2 A;  5AW9 B;  3RK3 C;  2E43 A;  1OWA A;  4GT1 A;  3HD7 C;  4JF7 A;  2P7J A;  3P8M C;  2KSJ A;  2W6B A;  2I1J A;  1NHL A;  1JY3 O;  1RF1 B;  1CW5 A;  2FYZ A;  1KZU B;  3MGN A;  3H32 B;  1H88 A;  2OYH C;  3M0A A;  1FOS E;  5AVV B;  2J58 A;  1NTK K;  2YO3 A;  5AVZ B;  1J1D C;  1FJK A;  1XTG B;  2P67 A;  3RK2 B;  3RK2 D;  4O9B A;  2WPS A;  3MD0 A;  1T2K D;  2R32 A;  4LLH A;  3V2P A;  1LWU A;  1GU5 A;  3VN0 A;  4AQR D;  2CPB A;  5CCH C;  4Y99 B;  2R3C A;  2MJZ A;  1LTJ A;  5APY A;  1GW3 A;  5AW1 B;  3N7N A;  1YTZ T;  5AVW B;  2WPQ A;  1HUC A;  3TYY A;  1FBM A;  1RY3 A;  3VYI A;  3VP8 A;  2HPC A;  4C7R A;  1M1J B;  3R2P A;  1SLQ A;  2YKO A;  2NPS D;  2NPS B;  3WMM 0;  1H89 A;  1L4A B;  3HE5 B;  3IFM A;  5KJ7 D;  3CL3 D;  3VMX A;  1T2K C;  1IJD B;  1KIL B;  2OYI B;  3M9B A;  1S9K E;  3BRT B;  3V4Q A;  3SWF A;  1JO5 A;  3B5N A;  1PFI A;  1L0L K;  3V2Q A;  2WWW A;  2H43 A;  4Y99 C;  4ZKU A;  1X8Y A;  4I1L A;  2FKW B;  3KDP B;  3LID A;  1T3J A;  4N78 E;  1H8A A;  2N1T A;  3V2N A;  1Z56 A;  3KYQ A;  2FFD A;  2YKQ A;  4AYC A;  3P8C D;  1NTZ K;  1LGH B;  2Z5I A;  1RE3 C;  5APV A;  1URQ D;  4XE5 B;  1HTL C;  3L37 A;  3B8E B;  3RK3 D;  2H7H A;  3TSI A;  3HD7 D;  1ZR2 A;  5AW3 B;  3G3Z A;  3H6P A;  1WRG A;  1FZC A;  1M1J C;  1LWU B;  1WT6 A;  4WY4 A;  1N7S A;  2O1K A;  2IX7 C;  5AVS B;  3GHG A;  3U1C A;  3VOP A;  1JY2 O;  2WIT A;  5CCG C;  2Q5U A;  1L4A C;  3NXS A;  1J1D B;  1ZLL A;  5CMZ A;  1CI6 B;  2OAR A;  1N86 A;  1ZN5 A;  3MUD A;  1KIL C;  3M9Q A;  1G1I A;  5CCH D;  4ZKP A;  1JY3 N;  3OAK A;  1J2J B;  2Q9I A;  3A7O A;  3BRV B;  3HTK A;  1FDM A;  1IFD A;  5BU5 A;  2WPR A;  4IFD K;  2KLV A;  1HGZ A;  1N73 A;  1QL1 A;  1T3U A;  1SQV K;  4GKG A;  1NO4 A;  2KP8 A;  3IR9 A;  2XNX A;  3N4X A;  3O8Z A;  2HFE D;  1JTH B;  2Z5H A;  1G2C A;  1IFJ A;  4I2L C;  3CLQ A;  1LWU C;  3E1I A;  1OXZ A;  5AVY B;  1IFI A;  3B5N B;  1GTW A;  3EFG A;  2KOG A;  3A3Y B;  1LTJ C;  2J59 M;  3BVH A;  1J1E B;  5CHX A;  2PAJ A;  1FZE A;  1VPC A;  3CI9 A;  2XV5 A;  5AVQ B;  3TNU A;  2LKM A;  1LT9 B;  3VP9 A;  2R5D A;  2HOD A;  2CPS A;  4WY4 B;  1N7S B;  1LTT C;  3GHG B;  1N2D C;  3NTN A;  1LTS C;  2WSC H;  1M7L A;  1NU1 K;  4DZO A;  1T8Z A;  1S9K D;  2BAS A;  1A02 F;  2GUV A;  5APU A;  3RL0 D;  3B5N C;  3RL0 B;  5AVX B;  3I5C A;  4N78 D;  2ZFC A;  5CCG D;  1L4A D;  2JJL A;  2N1T C;  1SFC A;  3OA7 A;  1J1E C;  1GW4 A;  1KIL D;  1N73 B;  4I6M C;  2C9L Y;  2WZ7 A;  1JOC A;  1NH4 A;  4C7N A;  1GL2 A;  1GU4 A;  1IO4 A;  3BAT A;  2H8P D;  2HG5 D;  2P1J A;  1MZ9 A;  1NTM K;  1FJP A;  3L36 A;  5AVU B;  2YKP A;  1LT9 C;  5AW5 B;  1G2C B;  1N7L A;  1XTC C;  2R5B A;  4EIJ A;  1ZR4 A;  1FZC C;  3T97 A;  4WY4 C;  1IFN A;  1N7S C;  3TK1 A;  1SQX K;  1W2E A;  4LGD E;  5BU8 B;  1JY2 N;  3GHG C;  2WSF H;  1NAF A;  1FZA A;  2ZXE B;  3M9H A;  1RF1 A;  5AW6 B;  2HLO A;  1FAV A;  2M8R A;  2A45 H;  1MV8 A;  2O01 H;  3UIA A;  4EOT A;  2E42 A;  2POH A;  3NFQ A;  2KB7 P;  3P32 A;  3LW5 H;  3RL0 C;  2FYU K;  2IFM A;  3TNU B;  5AW7 B;  1LTJ B;  4B86 A;  1RF0 A;  1RE4 A;  4N3Y B;  1N73 C;  2C9N Y;  1KFN A;  3L35 A;  5KLV K;  1HBW A;  1G1J A;  2HPC B;  2N9B A;  2C0W A;  4WBA A;  2W6A A;  1JCD A;  5CJ0 A;  1LTI C;  1KQL A;  4N6J A;  4C46 A;  2QM7 A;  4IFM A;  1IK9 A;  1GK6 A;  4KHX A;  5AW2 B;  2Q7C A;  1JNM A;  2XU6 A;  5APT A;  2JEE A;  2NPS A;  2KYV A;  2FXM A;  3MTU E;  4C7N B;  1SQQ K;  3HE4 A;  3B5N D;  4WB4 A;  3HRN A;  5KJ7 A;  2HYN A;  1IC2 A;  3P7K A;  2N1T D;  2N1T B;  4LC1 A;  2YNY A;  2OYI A;  1MUU A;  3M0D A;  4W7Y A;  2FFD B;  1HH0 A;  3VTP C;  1HWT C;  1NWQ A;  3HUS A;  2A45 I;  2I1K A;  4RES B;  3VMZ A;  4DOJ A;  2WT7 A;  1JUN A;  1HJB A;  1DEB A;  1FZC B;  2P2U A;  1URQ A;  3PP5 A;  4WY4 D;  1N7S D;  1DX7 A;  3MIW A;  1GDT A;  2XKM A;  3HD7 A;  3VMY A;  3V4W A;  2GM4 A;  1SFC C;  1JY2 P;  2QM8 A;  5AVR B;  2OYH A;  2GUS A;  1LTG C;  3KPE A;  4W80 A;  1E5W A;  2Z4E A;  1GL2 C;  4HH2 A;  1SQP K;  2W27 A;  4W7Z A;  1FZF A;  1CI6 A;  2XDJ A;  3HTK B;  3L4F A;  1ZV8 A;  5APX A;  3A5T A;  3V2R A;  1SP4 A;  2A45 G;  2FFD C;  1NOH A;  2IFN A;  1DH3 A;  2WTY A;  5CCH A;  4GIF A;  1GK4 A;  1GZL A;  1LTB C;  1NKZ B;  1RF1 C;  2XZR A;  3V5B A;  4HYT B;  3KQG A;  2Q3I A;  4XA4 A;  5AW8 B;  4JYC A;  1JY3 P;  3II6 A;  5APW A;  3LIE A;  1GD2 E;  3HE4 B;  5CJ4 A;  2L5G B;  5AVT B;  3RK2 C;  1HGV A;  3EQ2 A;  3C9I A;  2M3B A;  1JTH A;  1KFM A;  1RF0 C;  1VDF A;  3H32 A;  5BVZ A;  3HUS B;  1SVF A;  1RE4 C;  3BAS A;  4OH8 B;  1EQ7 A;  3OJA B;  1X79 B;  1FZB A;  2VRS A;  1SQB K;  3SWY A;  2WT7 B;  2PP6 A;  2YO2 A;  1URQ B;  2HOD B;  1JMM A;  5APS A;  3A2A A;  3RK3 B;  3HD7 B;  1LTA C;  1AQ5 A;  3M91 A;  4JYB A;  1FU1 A;  1LT9 A;  5AW0 B;  4AUW A;  3U1A A;  2OYH B;  1RE3 A;  3P8C E;  2NPS C;  2YMY A;  5KTB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...