1JYKA

Catalytic mechanism of ctp:phosphocholine cytidylyltransferase from streptococcus pneumoniae (licc)
Total Genus 74
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
74
sequence length
229
structure length
229
Chain Sequence
EIRVKAIILAAGLGTRLRPLTENTPKALVQVNQKPLIEYQIEFLKEKGINDIIIIVGYLKEQFDYLKEKYGVRLVFNDKYADYNNFYSLYLVKEELANSYVIDADNYLFKNMFRNDLTRSTYFSVYREDCTNEWFLVYGDDYKVQDIIVDSKAGRILSGVSFWDAPTAEKIVSFIDKAYVSGEFVDLYWDNMVKDNIKELDVYVEELEGNSIYEIDSVQDYRKLEEILK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CTP:phosphocholine Cytidylyltransferase
publication title Structure and mechanism of CTP:phosphocholine cytidylyltransferase (LicC) from Streptococcus pneumoniae.
pubmed doi rcsb
source organism Streptococcus pneumoniae
molecule tags Transferase
total genus 74
structure length 229
sequence length 229
ec nomenclature
pdb deposition date 2001-09-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12804 NTP_transf_3 MobA-like NTP transferase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.550.10 Alpha Beta Alpha-Beta Complex Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 1jykA00
4FQWA 1H4DA 1W57A 1GA8A 4BMAA 1H5SD 5C1HA 2WEEA 4NALA 4P02A 1NWGB 1FR8A 4DE7A 4B2XA 3T7NA 2E8BA 1H7HA 2PGYA 2QH5A 1KWSA 4FCEA 3SXGA 4MNDA 1R80A 4FRBA 4KXOA 2OI6A 3CGXA 4G3SA 4L41C 2Y6PA 1R7XA 3U0YA 4AC3A 3FOQA 1S4NA 4P00A 1VPAA 1OMXA 4E1KA 1VM8A 5CMJA 4Y7TA 5IDTA 2ZU9A 4IRPA 2X5SA 4NAIA 3V0MA 2W0VA 1XHBA 4KRVA 1VICA 4M2BA 4CJBA 1O23B 3SX5A 4D11C 2NXVA 4HO4A 3IOHA 2AGDA 4MYBA 1WVCA 5EJ1A 3CKVA 4FREA 1H5TB 2V0HA 2RJ5A 3F1CA 5CQMX 2FYCB 1FXOA 2ICYA 4B4MA 3O3PA 3ZGFA 5C49A 2Y4MA 4FRMA 3U0XA 4B3UA 4HO0A 4G87A 4KNRA 2FY7A 1G23A 2P72A 3PKQA 4HOCA 3E26A 1FG5N 2WGZA 2BO7A 1G95A 2YQHA 2BO6A 4CJCA 4KC4A 1FGGA 1LL3A 4Y7FA 2VD4A 4HO9A 4Y6NA 1FOAA 3OAMA 1H5TA 4DECA 1ZCUA 2FYDB 2Y4KA 1FR9A 3V0NA 3POLA 2O1FA 4XWIA 4EVWA 3OH2A 3GUEA 1LZIA 1E5KA 2VS5A 3SXBA 1NF5B 3V8YA 4Y63A 4M28A 1VZTA 3Q4SA 1WT0A 4ARWA 1ZJ3A 1R7VA 2JCKA 5IFYA 1NHEB 1INIA 4B5BA 1EYRA 1H5SB 1ON8A 2BO4A 1YP2A 1MP3A 3CU0A 3R3IA 5CMHA 4D48A 4FCUA 4EEOA 3ZF8A 4B4BA 2A8UA 4Y7VA 4ECMA 1K4VA 1R7TA 1H7GA 2GGQA 2WVLA 3U2TA 2AH9A 3D8VA 4Y64A 1VGUA 4FRDA 3U2UA 1JYLA 1R7YA 2YQCA 4EEAA 1G9RA 2UX8A 2D7IA 5EIYA 3I0CA 1H5SA 4Y7GA 4AYJA 1ON6A 1ZJOA 2GGOA 1H7FA 2X5ZA 3OH3A 3TZTA 4B42A 5C38A 3CKOA 3R2WA 2Y7AA 3V8ZA 2VS4A 2Y4LA 2ICXA 5C4BA 4D0ZA 3I0HA 4LW6A 1IIMA 5BXCA 2FYBA 1G0RA 3JUKA 1GWWA 1NQIB 4GBPA 5I1FA 1YROB 3PNNA 4Y62A 1ZJ1A 3N9WA 2RJ9A 4YS8A 5FUHA 3HL3A 3SX3A 1I52A 5C4CA 2O1GA 5C4EA 2FYAA 3D5NA 4ASJA 3EE5A 3I0LA 4FRQA 1FRWA 3U2XA 3I0IX 3U2WA 3TQDA 1HM9A 3V90A 3I0EA 3OH1A 1V82A 4FRAA 1GX4A 1WT3A 1VH3A 4EEGA 2AM5A 2I5KA 2XMHA 4J18A 3F1YA 2VS3A 4DDZA 2XWLA 4HO3A 2V0JA 2WAWA 3Q7UA 3V91A 1HV9A 2D7RA 1SS9A 5HS2A 4D0TA 4D11A 2A8WA 1NMMB 1GQ9A 5L6SA 3JTJA 1TW1A 4KPXA 2YQJA 1R82A 5C1GA 2OI5A 5C36A 3QVBA 1VGWA 1ZI4A 4M4KA 2YC3A 1H7EA 3OGZA 2RIXA 4Y9XA 4HO5A 2ZU8A 3V0OA 1JV1A 3RMVA 3T7MA 3USQA 4EEMA 5L6VA 5CMGX 5C47A 5C3AA 3V0PA 2PX7A 1HM8A 4M2AA 5J49A 2X60A 1H7LA 4KC2A 3OC9A 2V0IA 3SXDA 1TZFA 4C2SA 4HCQA 1FO9A 4KNXA 3SX7A 5EJZA 1O0RA 5FTVA 4K6RA 1WT2A 4KT7A 1O7OA 1ZI3A 2P6WA 5AJOA 4AAWA 4HO8A 1H7QA 2PGVA 1GWVA 4CVHA 1FXJA 3U2VA 2YC5A 3DJ4A 3BRKX 2X65A 5DDVA 3LW6A 1ZCTA 2DPWA 1W55A 4B4GA 2WVKA 1GQCA 1ZI5A 1LZ0A 2RIYA 5CMFX 4JISA 3OH0A 1ZI1A 1FGXA 2Q4JA 2RJ1A 1R7UA 1EZIA 1GX0A 2Z87A 2I7BA 1TVYA 2AECA 1H4EA 4Y6UA 1ZDGA 2APCA 1G3LA 3CKJA 1H7TA 2OEFA 2AESA 1MP5A 3NGWA 1H5SC 4UEGA 4JD0A 4BQHA 5FV9A 2XWMA 3E25A 2W0WA 2YCMA 3ZGGA 4FRLA 1Z90A 3OH4A 5FU8A 2Z86A 3ST8A 4FROA 4G3PA 1QGQA 4KPZA 1QGSA 1ZCYA 4B2WA 1G1LA 2AM3A 5FYEA 3T7OA 3V0QA 5C48A 3I0FA 3Q80A 1H5RA 3SXEA 1H3MA 3K8DA 5C4DA 1YP3A 2BO8A 3RSBA 5C3BA 4R7PA 4NAKA 1VZUA 3RMWA 2RIZA 3I0GA 1JYKA 1R81A 1VZXA 1PZTA 3CKNA 4LW3A 1V84A 3USRA 1HJJA 2RITA 1LZJA 3KIAA 4G3QA 5CQNX 1G2VA 3V0LA 1ZJ0A 2JCOA 1IINA 3IOIA 1JV3A 4AYLA 3SXAA 1WSZA 2YESA 2RJ4A 5DDTA 1VGTA 2E3DA 3CKQA 2AM4A 1FZWA 2PA4A 3DK5A 4HG6A 1ZIZA 1OQMB 2WE9A 5JQQA 4EE3A 4KQLA 2JCLA 2VSIA 2Y4JA 2RJ7A 2VXLA 2YQSA 1HJLA 3D98A 1VH1A 1OMZA 2FFUA 2QGIA 3I0KA 4IRQA 3SPTA 3JUJA 4KC1A 4CJ8A 1JVDA 3OKRA 1LVWA 4EE4A 2FFVA 2I5EA 3DUVA 2ZU7A 5C8RA 1VGZA 2OI7A 1PZYB 3BCVA 1FO8A 1JVGA 2RJ0A 2VFZA 1G93A 1MP4A 2RJ6A 1W77A 4NANA 1INJA 3SX8A 3SXCA 2JCJA 5IDSA 1WT1A 4HO6A 1LL0A 2QKXA 3ZLLA 3I0DA 4HO2A 2V0KA 1NKHB 4EE5A 3K8EA 1ZHJA 1LZ7A 3IOJA 5AJNA 4ASYA 2V0LA 1O7QA 2VSHA 5FTSA 5CQLX 4ZDQA 1MC3A 2D0JA 3PKPA 1G97A 1ZCVA 1ZJ2A 1G8OA 1LL2A 1TW5A 1YP4A 2P73A 1QG8A 3ZLKA 1QWJA 2XWNA 3FWWA 1S4PA 5FU0A 5CMIA 1ZDFA 1V83A 2MZBA 5C1LA 1HM0A 4FRHA 2AE7A 2O1HA 1S4OA 4Y7UA 4FRPA 1H5RB 2WVMA 5AJPA 2XMEA 5C4FA 2RJ8A 2VXMA 3I0JA 5C3DA 1XZ6A 2OEGA 1FWYA 5CQOA 5CQPA 1ZJPA 1H4CA 2CU2A
chains in the Genus database with same CATH superfamily
4FQWA 1H4DA 1W57A 1GA8A 4BMAA 1H5SD 5C1HA 2WEEA 4NALA 4P02A 1NWGB 1FR8A 4DE7A 4B2XA 3T7NA 2E8BA 1H7HA 2PGYA 2QH5A 1KWSA 4FCEA 3SXGA 4MNDA 1R80A 4FRBA 4KXOA 2OI6A 3CGXA 4G3SA 4L41C 2Y6PA 2J0BA 1R7XA 3U0YA 4AC3A 3FOQA 1S4NA 4P00A 1VPAA 1OMXA 4E1KA 1VM8A 5CMJA 4Y7TA 5IDTA 2ZU9A 4IRPA 2X5SA 4NAIA 3V0MA 2W0VA 1XHBA 4KRVA 1VICA 4M2BA 4CJBA 1O23B 3SX5A 4D11C 2NXVA 4HO4A 3IOHA 2AGDA 4MYBA 1WVCA 5EJ1A 3CKVA 4FREA 1H5TB 2V0HA 2RJ5A 3F1CA 5CQMX 2FYCB 1FXOA 2ICYA 4B4MA 3O3PA 3ZGFA 5C49A 2Y4MA 4FRMA 3U0XA 4B3UA 4HO0A 4G87A 4KNRA 2FY7A 1G23A 2P72A 3PKQA 4HOCA 3E26A 1FG5N 2WGZA 2BO7A 1G95A 2YQHA 2BO6A 4CJCA 4KC4A 1FGGA 1LL3A 4Y7FA 2VD4A 4HO9A 4Y6NA 1FOAA 3OAMA 1H5TA 4DECA 1ZCUA 2FYDB 2Y4KA 1FR9A 3V0NA 3POLA 2O1FA 4XWIA 4EVWA 3OH2A 3GUEA 1LZIA 1E5KA 2VS5A 3SXBA 1NF5B 3V8YA 4Y63A 4M28A 1VZTA 3Q4SA 1WT0A 4ARWA 1ZJ3A 1R7VA 2JCKA 5IFYA 1NHEB 1INIA 4B5BA 1EYRA 1H5SB 1ON8A 2BO4A 1YP2A 1MP3A 3CU0A 3R3IA 5CMHA 4D48A 4FCUA 4EEOA 3ZF8A 4B4BA 2A8UA 4Y7VA 4ECMA 1K4VA 1R7TA 1H7GA 2GGQA 2WVLA 3U2TA 2AH9A 3D8VA 4Y64A 1VGUA 4FRDA 3U2UA 1JYLA 1R7YA 2YQCA 4EEAA 1G9RA 2UX8A 2D7IA 5EIYA 3I0CA 1H5SA 4Y7GA 4AYJA 1ON6A 1ZJOA 2GGOA 1H7FA 2VK9A 2X5ZA 3OH3A 3TZTA 4B42A 5C38A 3CKOA 3R2WA 2Y7AA 3V8ZA 2VS4A 2Y4LA 2ICXA 5C4BA 4D0ZA 3I0HA 4LW6A 1IIMA 5BXCA 2FYBA 1G0RA 3JUKA 1GWWA 1NQIB 4GBPA 5I1FA 1YROB 3PNNA 4Y62A 1ZJ1A 3N9WA 2RJ9A 4YS8A 5FUHA 3HL3A 3SX3A 1I52A 5C4CA 2C0NA 2O1GA 5C4EA 2FYAA 3D5NA 4ASJA 3EE5A 3I0LA 4FRQA 1FRWA 3U2XA 3I0IX 3U2WA 3TQDA 1HM9A 3V90A 3I0EA 3OH1A 1V82A 4FRAA 1GX4A 1WT3A 1VH3A 4EEGA 2AM5A 2I5KA 2XMHA 4J18A 3F1YA 2VS3A 4DDZA 2XWLA 4HO3A 2V0JA 2WAWA 3Q7UA 3V91A 1HV9A 2D7RA 1SS9A 5HS2A 4D0TA 4D11A 2A8WA 1NMMB 1GQ9A 5L6SA 3JTJA 1TW1A 4KPXA 2YQJA 1R82A 5C1GA 2OI5A 5C36A 3QVBA 1VGWA 1ZI4A 4M4KA 2YC3A 1H7EA 3OGZA 2RIXA 4Y9XA 4HO5A 2ZU8A 3V0OA 1JV1A 3RMVA 3T7MA 3USQA 4EEMA 5L6VA 5CMGX 5C47A 5C3AA 3V0PA 2PX7A 1HM8A 4M2AA 5J49A 4MIXA 2X60A 1H7LA 4KC2A 3OC9A 2V0IA 3SXDA 1TZFA 4C2SA 4HCQA 1FO9A 4KNXA 3SX7A 5EJZA 1O0RA 5FTVA 4K6RA 1WT2A 4KT7A 1O7OA 1ZI3A 2P6WA 5AJOA 4AAWA 4HO8A 1H7QA 2PGVA 1GWVA 4CVHA 1FXJA 3U2VA 2YC5A 3DJ4A 3BRKX 2X65A 5DDVA 3LW6A 1ZCTA 2DPWA 1W55A 4B4GA 4Q7CA 2WVKA 1GQCA 1ZI5A 1LZ0A 2RIYA 5CMFX 4JISA 3OH0A 1ZI1A 1FGXA 2Q4JA 2RJ1A 1R7UA 1EZIA 1GX0A 2Z87A 2I7BA 1TVYA 2AECA 4O6NA 1H4EA 4Y6UA 1ZDGA 2APCA 1G3LA 3CKJA 1H7TA 2OEFA 2AESA 1MP5A 3NGWA 1H5SC 4UEGA 4JD0A 4BQHA 5FV9A 2XWMA 3E25A 2W0WA 2YCMA 3ZGGA 4FRLA 1Z90A 3OH4A 5FU8A 2Z86A 3ST8A 4FROA 4G3PA 1QGQA 4KPZA 1QGSA 1ZCYA 4B2WA 1G1LA 2AM3A 5FYEA 3T7OA 3V0QA 5C48A 3I0FA 3Q80A 1H5RA 3SXEA 1H3MA 3K8DA 5C4DA 1YP3A 2BO8A 3RSBA 5C3BA 4R7PA 4NAKA 1VZUA 3RMWA 2RIZA 4FIXA 3I0GA 1JYKA 1R81A 1VZXA 1PZTA 3CKNA 4LW3A 1V84A 3USRA 1HJJA 2RITA 1LZJA 3KIAA 4G3QA 5CQNX 1G2VA 3V0LA 1ZJ0A 2JCOA 1IINA 3IOIA 1JV3A 4AYLA 3SXAA 1WSZA 2YESA 2RJ4A 2J0AA 5DDTA 1VGTA 2E3DA 3CKQA 2AM4A 1FZWA 2PA4A 3DK5A 4HG6A 1ZIZA 1OQMB 2WE9A 5JQQA 4EE3A 4KQLA 2JCLA 2VSIA 2Y4JA 2RJ7A 2VXLA 2YQSA 1HJLA 3D98A 1VH1A 1OMZA 2FFUA 2QGIA 3I0KA 4IRQA 3SPTA 3JUJA 4KC1A 4CJ8A 1JVDA 3OKRA 1LVWA 4EE4A 2FFVA 2I5EA 3DUVA 2ZU7A 5C8RA 1VGZA 2OI7A 1PZYB 3BCVA 1FO8A 1JVGA 2RJ0A 2VFZA 1G93A 1MP4A 2RJ6A 5D92A 1W77A 4NANA 1INJA 3SX8A 3SXCA 2JCJA 5IDSA 1WT1A 4HO6A 1LL0A 2QKXA 3ZLLA 5D91A 3I0DA 4HO2A 2V0KA 1NKHB 4EE5A 3K8EA 1ZHJA 1LZ7A 3IOJA 5AJNA 4ASYA 2V0LA 1O7QA 2VSHA 5FTSA 5CQLX 4ZDQA 1MC3A 2D0JA 3PKPA 1G97A 1ZCVA 1ZJ2A 1G8OA 1LL2A 1TW5A 1YP4A 2P73A 1QG8A 3ZLKA 1QWJA 2XWNA 3FWWA 1S4PA 5FU0A 5CMIA 1ZDFA 1V83A 2MZBA 5C1LA 1HM0A 4FRHA 2AE7A 2O1HA 1S4OA 4Y7UA 4FRPA 1H5RB 2WVMA 4FIYA 5AJPA 2XMEA 5C4FA 2RJ8A 2VXMA 3I0JA 5C3DA 1XZ6A 2OEGA 1FWYA 5CQOA 5CQPA 1ZJPA 4O6MA 1H4CA 2CU2A
chains in the Genus database with same CATH topology
4FQWA 1H4DA 1W57A 1GA8A 4BMAA 1H5SD 5C1HA 2WEEA 4NALA 4P02A 1NWGB 1FR8A 4DE7A 4B2XA 3T7NA 2E8BA 1H7HA 2PGYA 2QH5A 1KWSA 4FCEA 3SXGA 4MNDA 1R80A 4FRBA 4KXOA 2OI6A 3CGXA 4G3SA 4L41C 2Y6PA 2J0BA 1R7XA 3U0YA 4AC3A 3FOQA 1S4NA 4P00A 1VPAA 1OMXA 4E1KA 1VM8A 5CMJA 4Y7TA 5IDTA 2ZU9A 4IRPA 2X5SA 4NAIA 3V0MA 2W0VA 1XHBA 4KRVA 1VICA 4M2BA 4CJBA 1O23B 3SX5A 4D11C 2NXVA 4HO4A 3IOHA 2AGDA 4MYBA 1WVCA 5EJ1A 3CKVA 4FREA 1H5TB 2V0HA 2RJ5A 3F1CA 5CQMX 2FYCB 1FXOA 2ICYA 4B4MA 3O3PA 3ZGFA 5C49A 2Y4MA 4FRMA 3U0XA 4B3UA 4HO0A 4G87A 4KNRA 2FY7A 1G23A 2P72A 3PKQA 4HOCA 3E26A 1FG5N 2WGZA 2BO7A 1G95A 2YQHA 2BO6A 4CJCA 4KC4A 1FGGA 1LL3A 4Y7FA 2VD4A 4HO9A 4Y6NA 1FOAA 3OAMA 1H5TA 4DECA 1ZCUA 2FYDB 2Y4KA 1FR9A 3V0NA 3POLA 2O1FA 4XWIA 4EVWA 3OH2A 3GUEA 1LZIA 1E5KA 2VS5A 3SXBA 1NF5B 3V8YA 4Y63A 4M28A 1VZTA 3Q4SA 1WT0A 4ARWA 1ZJ3A 1R7VA 2JCKA 5IFYA 1NHEB 1INIA 4B5BA 1EYRA 1H5SB 1ON8A 2BO4A 1YP2A 1MP3A 3CU0A 3R3IA 5CMHA 4D48A 4FCUA 4EEOA 3ZF8A 4B4BA 2A8UA 4Y7VA 4ECMA 1K4VA 1R7TA 1H7GA 2GGQA 2WVLA 3U2TA 2AH9A 3D8VA 4Y64A 1VGUA 4FRDA 3U2UA 1JYLA 1R7YA 2YQCA 4EEAA 1G9RA 2UX8A 2D7IA 5EIYA 3I0CA 1H5SA 4Y7GA 4AYJA 1ON6A 1ZJOA 2GGOA 1H7FA 2VK9A 2X5ZA 3OH3A 3TZTA 4B42A 5C38A 3CKOA 3R2WA 2Y7AA 3V8ZA 2VS4A 2Y4LA 2ICXA 5C4BA 4D0ZA 3I0HA 4LW6A 1IIMA 5BXCA 2FYBA 1G0RA 3JUKA 1GWWA 1NQIB 4GBPA 5I1FA 1YROB 3PNNA 4Y62A 1ZJ1A 3N9WA 2RJ9A 4YS8A 5FUHA 3HL3A 3SX3A 1I52A 5C4CA 2C0NA 2O1GA 5C4EA 2FYAA 3D5NA 4ASJA 3EE5A 3I0LA 4FRQA 1FRWA 3U2XA 3I0IX 3U2WA 3TQDA 1HM9A 3V90A 3I0EA 3OH1A 1V82A 4FRAA 1GX4A 1WT3A 1VH3A 4EEGA 2AM5A 2I5KA 2XMHA 4J18A 3F1YA 2VS3A 4DDZA 2XWLA 4HO3A 2V0JA 2WAWA 3Q7UA 3V91A 1HV9A 2D7RA 1SS9A 5HS2A 4D0TA 4D11A 2A8WA 1NMMB 1GQ9A 5L6SA 3JTJA 1TW1A 4KPXA 2YQJA 1R82A 5C1GA 2OI5A 5C36A 3QVBA 1VGWA 1ZI4A 4M4KA 2YC3A 1H7EA 3OGZA 2RIXA 4Y9XA 4HO5A 2ZU8A 3V0OA 1JV1A 3RMVA 3T7MA 3USQA 4EEMA 5L6VA 5CMGX 5C47A 5C3AA 3V0PA 2PX7A 1HM8A 4M2AA 5J49A 4MIXA 2X60A 1H7LA 4KC2A 3OC9A 2V0IA 3SXDA 1TZFA 4C2SA 4HCQA 1FO9A 4KNXA 3SX7A 5EJZA 1O0RA 5FTVA 4K6RA 1WT2A 4KT7A 1O7OA 1ZI3A 2P6WA 5AJOA 4AAWA 4HO8A 1H7QA 2PGVA 1GWVA 4CVHA 1FXJA 3U2VA 2YC5A 3DJ4A 3BRKX 2X65A 5DDVA 3LW6A 1ZCTA 2DPWA 1W55A 4B4GA 4Q7CA 2WVKA 1GQCA 1ZI5A 1LZ0A 2RIYA 5CMFX 4JISA 3OH0A 1ZI1A 1FGXA 2Q4JA 2RJ1A 1R7UA 1EZIA 1GX0A 2Z87A 2I7BA 1TVYA 2AECA 4O6NA 1H4EA 4Y6UA 1ZDGA 2APCA 1G3LA 3CKJA 1H7TA 2OEFA 2AESA 1MP5A 3NGWA 1H5SC 4UEGA 4JD0A 4BQHA 5FV9A 2XWMA 3E25A 2W0WA 2YCMA 3ZGGA 4FRLA 1Z90A 3OH4A 5FU8A 2Z86A 3ST8A 4FROA 4G3PA 1QGQA 4KPZA 1QGSA 1ZCYA 4B2WA 1G1LA 2AM3A 5FYEA 3T7OA 3V0QA 5C48A 3I0FA 3Q80A 1H5RA 3SXEA 1H3MA 3K8DA 5C4DA 1YP3A 2BO8A 3RSBA 5C3BA 4R7PA 4NAKA 1VZUA 3RMWA 2RIZA 4FIXA 3I0GA 1JYKA 1R81A 1VZXA 1PZTA 3CKNA 4LW3A 1V84A 3USRA 1HJJA 2RITA 1LZJA 3KIAA 4G3QA 5CQNX 1G2VA 3V0LA 1ZJ0A 2JCOA 1IINA 3IOIA 1JV3A 4AYLA 3SXAA 1WSZA 2YESA 2RJ4A 2J0AA 5DDTA 1VGTA 2E3DA 3CKQA 2AM4A 1FZWA 2PA4A 3DK5A 4HG6A 1ZIZA 1OQMB 2WE9A 5JQQA 4EE3A 4KQLA 2JCLA 2VSIA 2Y4JA 2RJ7A 2VXLA 2YQSA 1HJLA 3D98A 1VH1A 1OMZA 2FFUA 2QGIA 3I0KA 4IRQA 3SPTA 3JUJA 4KC1A 4CJ8A 1JVDA 3OKRA 1LVWA 4EE4A 2FFVA 2I5EA 3DUVA 2ZU7A 5C8RA 1VGZA 2OI7A 1PZYB 3BCVA 1FO8A 1JVGA 2RJ0A 2VFZA 1G93A 1MP4A 2RJ6A 5D92A 1W77A 4NANA 1INJA 3SX8A 3SXCA 2JCJA 5IDSA 1WT1A 4HO6A 1LL0A 2QKXA 3ZLLA 5D91A 3I0DA 4HO2A 2V0KA 1NKHB 4EE5A 3K8EA 1ZHJA 1LZ7A 3IOJA 5AJNA 4ASYA 2V0LA 1O7QA 2VSHA 5FTSA 5CQLX 4ZDQA 1MC3A 2D0JA 3PKPA 1G97A 1ZCVA 1ZJ2A 1G8OA 1LL2A 1TW5A 1YP4A 2P73A 1QG8A 3ZLKA 1QWJA 2XWNA 3FWWA 1S4PA 5FU0A 5CMIA 1ZDFA 1V83A 2MZBA 5C1LA 1HM0A 4FRHA 2AE7A 2O1HA 1S4OA 4Y7UA 4FRPA 1H5RB 2WVMA 4FIYA 5AJPA 2XMEA 5C4FA 2RJ8A 2VXMA 3I0JA 5C3DA 1XZ6A 2OEGA 1FWYA 5CQOA 5CQPA 1ZJPA 4O6MA 1H4CA 2CU2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4FQW A;  1H4D A;  1W57 A;  1GA8 A;  4BMA A;  1H5S D;  5C1H A;  2WEE A;  4NAL A;  4P02 A;  1NWG B;  1FR8 A;  4DE7 A;  4B2X A;  3T7N A;  2E8B A;  1H7H A;  2PGY A;  2QH5 A;  1KWS A;  4FCE A;  3SXG A;  4MND A;  1R80 A;  4FRB A;  4KXO A;  2OI6 A;  3CGX A;  4G3S A;  4L41 C;  2Y6P A;  1R7X A;  3U0Y A;  4AC3 A;  3FOQ A;  1S4N A;  4P00 A;  1VPA A;  1OMX A;  4E1K A;  1VM8 A;  5CMJ A;  4Y7T A;  5IDT A;  2ZU9 A;  4IRP A;  2X5S A;  4NAI A;  3V0M A;  2W0V A;  1XHB A;  4KRV A;  1VIC A;  4M2B A;  4CJB A;  1O23 B;  3SX5 A;  4D11 C;  2NXV A;  4HO4 A;  3IOH A;  2AGD A;  4MYB A;  1WVC A;  5EJ1 A;  3CKV A;  4FRE A;  1H5T B;  2V0H A;  2RJ5 A;  3F1C A;  5CQM X;  2FYC B;  1FXO A;  2ICY A;  4B4M A;  3O3P A;  3ZGF A;  5C49 A;  2Y4M A;  4FRM A;  3U0X A;  4B3U A;  4HO0 A;  4G87 A;  4KNR A;  2FY7 A;  1G23 A;  2P72 A;  3PKQ A;  4HOC A;  3E26 A;  1FG5 N;  2WGZ A;  2BO7 A;  1G95 A;  2YQH A;  2BO6 A;  4CJC A;  4KC4 A;  1FGG A;  1LL3 A;  4Y7F A;  2VD4 A;  4HO9 A;  4Y6N A;  1FOA A;  3OAM A;  1H5T A;  4DEC A;  1ZCU A;  2FYD B;  2Y4K A;  1FR9 A;  3V0N A;  3POL A;  2O1F A;  4XWI A;  4EVW A;  3OH2 A;  3GUE A;  1LZI A;  1E5K A;  2VS5 A;  3SXB A;  1NF5 B;  3V8Y A;  4Y63 A;  4M28 A;  1VZT A;  3Q4S A;  1WT0 A;  4ARW A;  1ZJ3 A;  1R7V A;  2JCK A;  5IFY A;  1NHE B;  1INI A;  4B5B A;  1EYR A;  1H5S B;  1ON8 A;  2BO4 A;  1YP2 A;  1MP3 A;  3CU0 A;  3R3I A;  5CMH A;  4D48 A;  4FCU A;  4EEO A;  3ZF8 A;  4B4B A;  2A8U A;  4Y7V A;  4ECM A;  1K4V A;  1R7T A;  1H7G A;  2GGQ A;  2WVL A;  3U2T A;  2AH9 A;  3D8V A;  4Y64 A;  1VGU A;  4FRD A;  3U2U A;  1JYL A;  1R7Y A;  2YQC A;  4EEA A;  1G9R A;  2UX8 A;  2D7I A;  5EIY A;  3I0C A;  1H5S A;  4Y7G A;  4AYJ A;  1ON6 A;  1ZJO A;  2GGO A;  1H7F A;  2X5Z A;  3OH3 A;  3TZT A;  4B42 A;  5C38 A;  3CKO A;  3R2W A;  2Y7A A;  3V8Z A;  2VS4 A;  2Y4L A;  2ICX A;  5C4B A;  4D0Z A;  3I0H A;  4LW6 A;  1IIM A;  5BXC A;  2FYB A;  1G0R A;  3JUK A;  1GWW A;  1NQI B;  4GBP A;  5I1F A;  1YRO B;  3PNN A;  4Y62 A;  1ZJ1 A;  3N9W A;  2RJ9 A;  4YS8 A;  5FUH A;  3HL3 A;  3SX3 A;  1I52 A;  5C4C A;  2O1G A;  5C4E A;  2FYA A;  3D5N A;  4ASJ A;  3EE5 A;  3I0L A;  4FRQ A;  1FRW A;  3U2X A;  3I0I X;  3U2W A;  3TQD A;  1HM9 A;  3V90 A;  3I0E A;  3OH1 A;  1V82 A;  4FRA A;  1GX4 A;  1WT3 A;  1VH3 A;  4EEG A;  2AM5 A;  2I5K A;  2XMH A;  4J18 A;  3F1Y A;  2VS3 A;  4DDZ A;  2XWL A;  4HO3 A;  2V0J A;  2WAW A;  3Q7U A;  3V91 A;  1HV9 A;  2D7R A;  1SS9 A;  5HS2 A;  4D0T A;  4D11 A;  2A8W A;  1NMM B;  1GQ9 A;  5L6S A;  3JTJ A;  1TW1 A;  4KPX A;  2YQJ A;  1R82 A;  5C1G A;  2OI5 A;  5C36 A;  3QVB A;  1VGW A;  1ZI4 A;  4M4K A;  2YC3 A;  1H7E A;  3OGZ A;  2RIX A;  4Y9X A;  4HO5 A;  2ZU8 A;  3V0O A;  1JV1 A;  3RMV A;  3T7M A;  3USQ A;  4EEM A;  5L6V A;  5CMG X;  5C47 A;  5C3A A;  3V0P A;  2PX7 A;  1HM8 A;  4M2A A;  5J49 A;  2X60 A;  1H7L A;  4KC2 A;  3OC9 A;  2V0I A;  3SXD A;  1TZF A;  4C2S A;  4HCQ A;  1FO9 A;  4KNX A;  3SX7 A;  5EJZ A;  1O0R A;  5FTV A;  4K6R A;  1WT2 A;  4KT7 A;  1O7O A;  1ZI3 A;  2P6W A;  5AJO A;  4AAW A;  4HO8 A;  1H7Q A;  2PGV A;  1GWV A;  4CVH A;  1FXJ A;  3U2V A;  2YC5 A;  3DJ4 A;  3BRK X;  2X65 A;  5DDV A;  3LW6 A;  1ZCT A;  2DPW A;  1W55 A;  4B4G A;  2WVK A;  1GQC A;  1ZI5 A;  1LZ0 A;  2RIY A;  5CMF X;  4JIS A;  3OH0 A;  1ZI1 A;  1FGX A;  2Q4J A;  2RJ1 A;  1R7U A;  1EZI A;  1GX0 A;  2Z87 A;  2I7B A;  1TVY A;  2AEC A;  1H4E A;  4Y6U A;  1ZDG A;  2APC A;  1G3L A;  3CKJ A;  1H7T A;  2OEF A;  2AES A;  1MP5 A;  3NGW A;  1H5S C;  4UEG A;  4JD0 A;  4BQH A;  5FV9 A;  2XWM A;  3E25 A;  2W0W A;  2YCM A;  3ZGG A;  4FRL A;  1Z90 A;  3OH4 A;  5FU8 A;  2Z86 A;  3ST8 A;  4FRO A;  4G3P A;  1QGQ A;  4KPZ A;  1QGS A;  1ZCY A;  4B2W A;  1G1L A;  2AM3 A;  5FYE A;  3T7O A;  3V0Q A;  5C48 A;  3I0F A;  3Q80 A;  1H5R A;  3SXE A;  1H3M A;  3K8D A;  5C4D A;  1YP3 A;  2BO8 A;  3RSB A;  5C3B A;  4R7P A;  4NAK A;  1VZU A;  3RMW A;  2RIZ A;  3I0G A;  1JYK A;  1R81 A;  1VZX A;  1PZT A;  3CKN A;  4LW3 A;  1V84 A;  3USR A;  1HJJ A;  2RIT A;  1LZJ A;  3KIA A;  4G3Q A;  5CQN X;  1G2V A;  3V0L A;  1ZJ0 A;  2JCO A;  1IIN A;  3IOI A;  1JV3 A;  4AYL A;  3SXA A;  1WSZ A;  2YES A;  2RJ4 A;  5DDT A;  1VGT A;  2E3D A;  3CKQ A;  2AM4 A;  1FZW A;  2PA4 A;  3DK5 A;  4HG6 A;  1ZIZ A;  1OQM B;  2WE9 A;  5JQQ A;  4EE3 A;  4KQL A;  2JCL A;  2VSI A;  2Y4J A;  2RJ7 A;  2VXL A;  2YQS A;  1HJL A;  3D98 A;  1VH1 A;  1OMZ A;  2FFU A;  2QGI A;  3I0K A;  4IRQ A;  3SPT A;  3JUJ A;  4KC1 A;  4CJ8 A;  1JVD A;  3OKR A;  1LVW A;  4EE4 A;  2FFV A;  2I5E A;  3DUV A;  2ZU7 A;  5C8R A;  1VGZ A;  2OI7 A;  1PZY B;  3BCV A;  1FO8 A;  1JVG A;  2RJ0 A;  2VFZ A;  1G93 A;  1MP4 A;  2RJ6 A;  1W77 A;  4NAN A;  1INJ A;  3SX8 A;  3SXC A;  2JCJ A;  5IDS A;  1WT1 A;  4HO6 A;  1LL0 A;  2QKX A;  3ZLL A;  3I0D A;  4HO2 A;  2V0K A;  1NKH B;  4EE5 A;  3K8E A;  1ZHJ A;  1LZ7 A;  3IOJ A;  5AJN A;  4ASY A;  2V0L A;  1O7Q A;  2VSH A;  5FTS A;  5CQL X;  4ZDQ A;  1MC3 A;  2D0J A;  3PKP A;  1G97 A;  1ZCV A;  1ZJ2 A;  1G8O A;  1LL2 A;  1TW5 A;  1YP4 A;  2P73 A;  1QG8 A;  3ZLK A;  1QWJ A;  2XWN A;  3FWW A;  1S4P A;  5FU0 A;  5CMI A;  1ZDF A;  1V83 A;  2MZB A;  5C1L A;  1HM0 A;  4FRH A;  2AE7 A;  2O1H A;  1S4O A;  4Y7U A;  4FRP A;  1H5R B;  2WVM A;  5AJP A;  2XME A;  5C4F A;  2RJ8 A;  2VXM A;  3I0J A;  5C3D A;  1XZ6 A;  2OEG A;  1FWY A;  5CQO A;  5CQP A;  1ZJP A;  1H4C A;  2CU2 A; 
#chains in the Genus database with same CATH topology
 4FQW A;  1H4D A;  1W57 A;  1GA8 A;  4BMA A;  1H5S D;  5C1H A;  2WEE A;  4NAL A;  4P02 A;  1NWG B;  1FR8 A;  4DE7 A;  4B2X A;  3T7N A;  2E8B A;  1H7H A;  2PGY A;  2QH5 A;  1KWS A;  4FCE A;  3SXG A;  4MND A;  1R80 A;  4FRB A;  4KXO A;  2OI6 A;  3CGX A;  4G3S A;  4L41 C;  2Y6P A;  2J0B A;  1R7X A;  3U0Y A;  4AC3 A;  3FOQ A;  1S4N A;  4P00 A;  1VPA A;  1OMX A;  4E1K A;  1VM8 A;  5CMJ A;  4Y7T A;  5IDT A;  2ZU9 A;  4IRP A;  2X5S A;  4NAI A;  3V0M A;  2W0V A;  1XHB A;  4KRV A;  1VIC A;  4M2B A;  4CJB A;  1O23 B;  3SX5 A;  4D11 C;  2NXV A;  4HO4 A;  3IOH A;  2AGD A;  4MYB A;  1WVC A;  5EJ1 A;  3CKV A;  4FRE A;  1H5T B;  2V0H A;  2RJ5 A;  3F1C A;  5CQM X;  2FYC B;  1FXO A;  2ICY A;  4B4M A;  3O3P A;  3ZGF A;  5C49 A;  2Y4M A;  4FRM A;  3U0X A;  4B3U A;  4HO0 A;  4G87 A;  4KNR A;  2FY7 A;  1G23 A;  2P72 A;  3PKQ A;  4HOC A;  3E26 A;  1FG5 N;  2WGZ A;  2BO7 A;  1G95 A;  2YQH A;  2BO6 A;  4CJC A;  4KC4 A;  1FGG A;  1LL3 A;  4Y7F A;  2VD4 A;  4HO9 A;  4Y6N A;  1FOA A;  3OAM A;  1H5T A;  4DEC A;  1ZCU A;  2FYD B;  2Y4K A;  1FR9 A;  3V0N A;  3POL A;  2O1F A;  4XWI A;  4EVW A;  3OH2 A;  3GUE A;  1LZI A;  1E5K A;  2VS5 A;  3SXB A;  1NF5 B;  3V8Y A;  4Y63 A;  4M28 A;  1VZT A;  3Q4S A;  1WT0 A;  4ARW A;  1ZJ3 A;  1R7V A;  2JCK A;  5IFY A;  1NHE B;  1INI A;  4B5B A;  1EYR A;  1H5S B;  1ON8 A;  2BO4 A;  1YP2 A;  1MP3 A;  3CU0 A;  3R3I A;  5CMH A;  4D48 A;  4FCU A;  4EEO A;  3ZF8 A;  4B4B A;  2A8U A;  4Y7V A;  4ECM A;  1K4V A;  1R7T A;  1H7G A;  2GGQ A;  2WVL A;  3U2T A;  2AH9 A;  3D8V A;  4Y64 A;  1VGU A;  4FRD A;  3U2U A;  1JYL A;  1R7Y A;  2YQC A;  4EEA A;  1G9R A;  2UX8 A;  2D7I A;  5EIY A;  3I0C A;  1H5S A;  4Y7G A;  4AYJ A;  1ON6 A;  1ZJO A;  2GGO A;  1H7F A;  2VK9 A;  2X5Z A;  3OH3 A;  3TZT A;  4B42 A;  5C38 A;  3CKO A;  3R2W A;  2Y7A A;  3V8Z A;  2VS4 A;  2Y4L A;  2ICX A;  5C4B A;  4D0Z A;  3I0H A;  4LW6 A;  1IIM A;  5BXC A;  2FYB A;  1G0R A;  3JUK A;  1GWW A;  1NQI B;  4GBP A;  5I1F A;  1YRO B;  3PNN A;  4Y62 A;  1ZJ1 A;  3N9W A;  2RJ9 A;  4YS8 A;  5FUH A;  3HL3 A;  3SX3 A;  1I52 A;  5C4C A;  2C0N A;  2O1G A;  5C4E A;  2FYA A;  3D5N A;  4ASJ A;  3EE5 A;  3I0L A;  4FRQ A;  1FRW A;  3U2X A;  3I0I X;  3U2W A;  3TQD A;  1HM9 A;  3V90 A;  3I0E A;  3OH1 A;  1V82 A;  4FRA A;  1GX4 A;  1WT3 A;  1VH3 A;  4EEG A;  2AM5 A;  2I5K A;  2XMH A;  4J18 A;  3F1Y A;  2VS3 A;  4DDZ A;  2XWL A;  4HO3 A;  2V0J A;  2WAW A;  3Q7U A;  3V91 A;  1HV9 A;  2D7R A;  1SS9 A;  5HS2 A;  4D0T A;  4D11 A;  2A8W A;  1NMM B;  1GQ9 A;  5L6S A;  3JTJ A;  1TW1 A;  4KPX A;  2YQJ A;  1R82 A;  5C1G A;  2OI5 A;  5C36 A;  3QVB A;  1VGW A;  1ZI4 A;  4M4K A;  2YC3 A;  1H7E A;  3OGZ A;  2RIX A;  4Y9X A;  4HO5 A;  2ZU8 A;  3V0O A;  1JV1 A;  3RMV A;  3T7M A;  3USQ A;  4EEM A;  5L6V A;  5CMG X;  5C47 A;  5C3A A;  3V0P A;  2PX7 A;  1HM8 A;  4M2A A;  5J49 A;  4MIX A;  2X60 A;  1H7L A;  4KC2 A;  3OC9 A;  2V0I A;  3SXD A;  1TZF A;  4C2S A;  4HCQ A;  1FO9 A;  4KNX A;  3SX7 A;  5EJZ A;  1O0R A;  5FTV A;  4K6R A;  1WT2 A;  4KT7 A;  1O7O A;  1ZI3 A;  2P6W A;  5AJO A;  4AAW A;  4HO8 A;  1H7Q A;  2PGV A;  1GWV A;  4CVH A;  1FXJ A;  3U2V A;  2YC5 A;  3DJ4 A;  3BRK X;  2X65 A;  5DDV A;  3LW6 A;  1ZCT A;  2DPW A;  1W55 A;  4B4G A;  4Q7C A;  2WVK A;  1GQC A;  1ZI5 A;  1LZ0 A;  2RIY A;  5CMF X;  4JIS A;  3OH0 A;  1ZI1 A;  1FGX A;  2Q4J A;  2RJ1 A;  1R7U A;  1EZI A;  1GX0 A;  2Z87 A;  2I7B A;  1TVY A;  2AEC A;  4O6N A;  1H4E A;  4Y6U A;  1ZDG A;  2APC A;  1G3L A;  3CKJ A;  1H7T A;  2OEF A;  2AES A;  1MP5 A;  3NGW A;  1H5S C;  4UEG A;  4JD0 A;  4BQH A;  5FV9 A;  2XWM A;  3E25 A;  2W0W A;  2YCM A;  3ZGG A;  4FRL A;  1Z90 A;  3OH4 A;  5FU8 A;  2Z86 A;  3ST8 A;  4FRO A;  4G3P A;  1QGQ A;  4KPZ A;  1QGS A;  1ZCY A;  4B2W A;  1G1L A;  2AM3 A;  5FYE A;  3T7O A;  3V0Q A;  5C48 A;  3I0F A;  3Q80 A;  1H5R A;  3SXE A;  1H3M A;  3K8D A;  5C4D A;  1YP3 A;  2BO8 A;  3RSB A;  5C3B A;  4R7P A;  4NAK A;  1VZU A;  3RMW A;  2RIZ A;  4FIX A;  3I0G A;  1JYK A;  1R81 A;  1VZX A;  1PZT A;  3CKN A;  4LW3 A;  1V84 A;  3USR A;  1HJJ A;  2RIT A;  1LZJ A;  3KIA A;  4G3Q A;  5CQN X;  1G2V A;  3V0L A;  1ZJ0 A;  2JCO A;  1IIN A;  3IOI A;  1JV3 A;  4AYL A;  3SXA A;  1WSZ A;  2YES A;  2RJ4 A;  2J0A A;  5DDT A;  1VGT A;  2E3D A;  3CKQ A;  2AM4 A;  1FZW A;  2PA4 A;  3DK5 A;  4HG6 A;  1ZIZ A;  1OQM B;  2WE9 A;  5JQQ A;  4EE3 A;  4KQL A;  2JCL A;  2VSI A;  2Y4J A;  2RJ7 A;  2VXL A;  2YQS A;  1HJL A;  3D98 A;  1VH1 A;  1OMZ A;  2FFU A;  2QGI A;  3I0K A;  4IRQ A;  3SPT A;  3JUJ A;  4KC1 A;  4CJ8 A;  1JVD A;  3OKR A;  1LVW A;  4EE4 A;  2FFV A;  2I5E A;  3DUV A;  2ZU7 A;  5C8R A;  1VGZ A;  2OI7 A;  1PZY B;  3BCV A;  1FO8 A;  1JVG A;  2RJ0 A;  2VFZ A;  1G93 A;  1MP4 A;  2RJ6 A;  5D92 A;  1W77 A;  4NAN A;  1INJ A;  3SX8 A;  3SXC A;  2JCJ A;  5IDS A;  1WT1 A;  4HO6 A;  1LL0 A;  2QKX A;  3ZLL A;  5D91 A;  3I0D A;  4HO2 A;  2V0K A;  1NKH B;  4EE5 A;  3K8E A;  1ZHJ A;  1LZ7 A;  3IOJ A;  5AJN A;  4ASY A;  2V0L A;  1O7Q A;  2VSH A;  5FTS A;  5CQL X;  4ZDQ A;  1MC3 A;  2D0J A;  3PKP A;  1G97 A;  1ZCV A;  1ZJ2 A;  1G8O A;  1LL2 A;  1TW5 A;  1YP4 A;  2P73 A;  1QG8 A;  3ZLK A;  1QWJ A;  2XWN A;  3FWW A;  1S4P A;  5FU0 A;  5CMI A;  1ZDF A;  1V83 A;  2MZB A;  5C1L A;  1HM0 A;  4FRH A;  2AE7 A;  2O1H A;  1S4O A;  4Y7U A;  4FRP A;  1H5R B;  2WVM A;  4FIY A;  5AJP A;  2XME A;  5C4F A;  2RJ8 A;  2VXM A;  3I0J A;  5C3D A;  1XZ6 A;  2OEG A;  1FWY A;  5CQO A;  5CQP A;  1ZJP A;  4O6M A;  1H4C A;  2CU2 A; 
#chains in the Genus database with same CATH homology
 4FQW A;  1H4D A;  1W57 A;  1GA8 A;  4BMA A;  1H5S D;  5C1H A;  2WEE A;  4NAL A;  4P02 A;  1NWG B;  1FR8 A;  4DE7 A;  4B2X A;  3T7N A;  2E8B A;  1H7H A;  2PGY A;  2QH5 A;  1KWS A;  4FCE A;  3SXG A;  4MND A;  1R80 A;  4FRB A;  4KXO A;  2OI6 A;  3CGX A;  4G3S A;  4L41 C;  2Y6P A;  2J0B A;  1R7X A;  3U0Y A;  4AC3 A;  3FOQ A;  1S4N A;  4P00 A;  1VPA A;  1OMX A;  4E1K A;  1VM8 A;  5CMJ A;  4Y7T A;  5IDT A;  2ZU9 A;  4IRP A;  2X5S A;  4NAI A;  3V0M A;  2W0V A;  1XHB A;  4KRV A;  1VIC A;  4M2B A;  4CJB A;  1O23 B;  3SX5 A;  4D11 C;  2NXV A;  4HO4 A;  3IOH A;  2AGD A;  4MYB A;  1WVC A;  5EJ1 A;  3CKV A;  4FRE A;  1H5T B;  2V0H A;  2RJ5 A;  3F1C A;  5CQM X;  2FYC B;  1FXO A;  2ICY A;  4B4M A;  3O3P A;  3ZGF A;  5C49 A;  2Y4M A;  4FRM A;  3U0X A;  4B3U A;  4HO0 A;  4G87 A;  4KNR A;  2FY7 A;  1G23 A;  2P72 A;  3PKQ A;  4HOC A;  3E26 A;  1FG5 N;  2WGZ A;  2BO7 A;  1G95 A;  2YQH A;  2BO6 A;  4CJC A;  4KC4 A;  1FGG A;  1LL3 A;  4Y7F A;  2VD4 A;  4HO9 A;  4Y6N A;  1FOA A;  3OAM A;  1H5T A;  4DEC A;  1ZCU A;  2FYD B;  2Y4K A;  1FR9 A;  3V0N A;  3POL A;  2O1F A;  4XWI A;  4EVW A;  3OH2 A;  3GUE A;  1LZI A;  1E5K A;  2VS5 A;  3SXB A;  1NF5 B;  3V8Y A;  4Y63 A;  4M28 A;  1VZT A;  3Q4S A;  1WT0 A;  4ARW A;  1ZJ3 A;  1R7V A;  2JCK A;  5IFY A;  1NHE B;  1INI A;  4B5B A;  1EYR A;  1H5S B;  1ON8 A;  2BO4 A;  1YP2 A;  1MP3 A;  3CU0 A;  3R3I A;  5CMH A;  4D48 A;  4FCU A;  4EEO A;  3ZF8 A;  4B4B A;  2A8U A;  4Y7V A;  4ECM A;  1K4V A;  1R7T A;  1H7G A;  2GGQ A;  2WVL A;  3U2T A;  2AH9 A;  3D8V A;  4Y64 A;  1VGU A;  4FRD A;  3U2U A;  1JYL A;  1R7Y A;  2YQC A;  4EEA A;  1G9R A;  2UX8 A;  2D7I A;  5EIY A;  3I0C A;  1H5S A;  4Y7G A;  4AYJ A;  1ON6 A;  1ZJO A;  2GGO A;  1H7F A;  2VK9 A;  2X5Z A;  3OH3 A;  3TZT A;  4B42 A;  5C38 A;  3CKO A;  3R2W A;  2Y7A A;  3V8Z A;  2VS4 A;  2Y4L A;  2ICX A;  5C4B A;  4D0Z A;  3I0H A;  4LW6 A;  1IIM A;  5BXC A;  2FYB A;  1G0R A;  3JUK A;  1GWW A;  1NQI B;  4GBP A;  5I1F A;  1YRO B;  3PNN A;  4Y62 A;  1ZJ1 A;  3N9W A;  2RJ9 A;  4YS8 A;  5FUH A;  3HL3 A;  3SX3 A;  1I52 A;  5C4C A;  2C0N A;  2O1G A;  5C4E A;  2FYA A;  3D5N A;  4ASJ A;  3EE5 A;  3I0L A;  4FRQ A;  1FRW A;  3U2X A;  3I0I X;  3U2W A;  3TQD A;  1HM9 A;  3V90 A;  3I0E A;  3OH1 A;  1V82 A;  4FRA A;  1GX4 A;  1WT3 A;  1VH3 A;  4EEG A;  2AM5 A;  2I5K A;  2XMH A;  4J18 A;  3F1Y A;  2VS3 A;  4DDZ A;  2XWL A;  4HO3 A;  2V0J A;  2WAW A;  3Q7U A;  3V91 A;  1HV9 A;  2D7R A;  1SS9 A;  5HS2 A;  4D0T A;  4D11 A;  2A8W A;  1NMM B;  1GQ9 A;  5L6S A;  3JTJ A;  1TW1 A;  4KPX A;  2YQJ A;  1R82 A;  5C1G A;  2OI5 A;  5C36 A;  3QVB A;  1VGW A;  1ZI4 A;  4M4K A;  2YC3 A;  1H7E A;  3OGZ A;  2RIX A;  4Y9X A;  4HO5 A;  2ZU8 A;  3V0O A;  1JV1 A;  3RMV A;  3T7M A;  3USQ A;  4EEM A;  5L6V A;  5CMG X;  5C47 A;  5C3A A;  3V0P A;  2PX7 A;  1HM8 A;  4M2A A;  5J49 A;  4MIX A;  2X60 A;  1H7L A;  4KC2 A;  3OC9 A;  2V0I A;  3SXD A;  1TZF A;  4C2S A;  4HCQ A;  1FO9 A;  4KNX A;  3SX7 A;  5EJZ A;  1O0R A;  5FTV A;  4K6R A;  1WT2 A;  4KT7 A;  1O7O A;  1ZI3 A;  2P6W A;  5AJO A;  4AAW A;  4HO8 A;  1H7Q A;  2PGV A;  1GWV A;  4CVH A;  1FXJ A;  3U2V A;  2YC5 A;  3DJ4 A;  3BRK X;  2X65 A;  5DDV A;  3LW6 A;  1ZCT A;  2DPW A;  1W55 A;  4B4G A;  4Q7C A;  2WVK A;  1GQC A;  1ZI5 A;  1LZ0 A;  2RIY A;  5CMF X;  4JIS A;  3OH0 A;  1ZI1 A;  1FGX A;  2Q4J A;  2RJ1 A;  1R7U A;  1EZI A;  1GX0 A;  2Z87 A;  2I7B A;  1TVY A;  2AEC A;  4O6N A;  1H4E A;  4Y6U A;  1ZDG A;  2APC A;  1G3L A;  3CKJ A;  1H7T A;  2OEF A;  2AES A;  1MP5 A;  3NGW A;  1H5S C;  4UEG A;  4JD0 A;  4BQH A;  5FV9 A;  2XWM A;  3E25 A;  2W0W A;  2YCM A;  3ZGG A;  4FRL A;  1Z90 A;  3OH4 A;  5FU8 A;  2Z86 A;  3ST8 A;  4FRO A;  4G3P A;  1QGQ A;  4KPZ A;  1QGS A;  1ZCY A;  4B2W A;  1G1L A;  2AM3 A;  5FYE A;  3T7O A;  3V0Q A;  5C48 A;  3I0F A;  3Q80 A;  1H5R A;  3SXE A;  1H3M A;  3K8D A;  5C4D A;  1YP3 A;  2BO8 A;  3RSB A;  5C3B A;  4R7P A;  4NAK A;  1VZU A;  3RMW A;  2RIZ A;  4FIX A;  3I0G A;  1JYK A;  1R81 A;  1VZX A;  1PZT A;  3CKN A;  4LW3 A;  1V84 A;  3USR A;  1HJJ A;  2RIT A;  1LZJ A;  3KIA A;  4G3Q A;  5CQN X;  1G2V A;  3V0L A;  1ZJ0 A;  2JCO A;  1IIN A;  3IOI A;  1JV3 A;  4AYL A;  3SXA A;  1WSZ A;  2YES A;  2RJ4 A;  2J0A A;  5DDT A;  1VGT A;  2E3D A;  3CKQ A;  2AM4 A;  1FZW A;  2PA4 A;  3DK5 A;  4HG6 A;  1ZIZ A;  1OQM B;  2WE9 A;  5JQQ A;  4EE3 A;  4KQL A;  2JCL A;  2VSI A;  2Y4J A;  2RJ7 A;  2VXL A;  2YQS A;  1HJL A;  3D98 A;  1VH1 A;  1OMZ A;  2FFU A;  2QGI A;  3I0K A;  4IRQ A;  3SPT A;  3JUJ A;  4KC1 A;  4CJ8 A;  1JVD A;  3OKR A;  1LVW A;  4EE4 A;  2FFV A;  2I5E A;  3DUV A;  2ZU7 A;  5C8R A;  1VGZ A;  2OI7 A;  1PZY B;  3BCV A;  1FO8 A;  1JVG A;  2RJ0 A;  2VFZ A;  1G93 A;  1MP4 A;  2RJ6 A;  5D92 A;  1W77 A;  4NAN A;  1INJ A;  3SX8 A;  3SXC A;  2JCJ A;  5IDS A;  1WT1 A;  4HO6 A;  1LL0 A;  2QKX A;  3ZLL A;  5D91 A;  3I0D A;  4HO2 A;  2V0K A;  1NKH B;  4EE5 A;  3K8E A;  1ZHJ A;  1LZ7 A;  3IOJ A;  5AJN A;  4ASY A;  2V0L A;  1O7Q A;  2VSH A;  5FTS A;  5CQL X;  4ZDQ A;  1MC3 A;  2D0J A;  3PKP A;  1G97 A;  1ZCV A;  1ZJ2 A;  1G8O A;  1LL2 A;  1TW5 A;  1YP4 A;  2P73 A;  1QG8 A;  3ZLK A;  1QWJ A;  2XWN A;  3FWW A;  1S4P A;  5FU0 A;  5CMI A;  1ZDF A;  1V83 A;  2MZB A;  5C1L A;  1HM0 A;  4FRH A;  2AE7 A;  2O1H A;  1S4O A;  4Y7U A;  4FRP A;  1H5R B;  2WVM A;  4FIY A;  5AJP A;  2XME A;  5C4F A;  2RJ8 A;  2VXM A;  3I0J A;  5C3D A;  1XZ6 A;  2OEG A;  1FWY A;  5CQO A;  5CQP A;  1ZJP A;  4O6M A;  1H4C A;  2CU2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...