1JZEA

Pseudomonas aeruginosa azurin ru(bpy)2(im)(his83)
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
128
structure length
128
Chain Sequence
AECSVDIQGNDQMQFNTNAITVDKSCKQFTVNLSHPGNLPKNVMGHNWVLSTAADMQGVVTDGMASGLDKDYLKPDDSRVIAHTKLIGSGEKDSVTFDVSKLKEGEQYMFFCTFPGHSALMKGTLTLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Electron tunneling in single crystals of Pseudomonas aeruginosa azurins.
pubmed doi rcsb
molecule keywords azurin
source organism Pseudomonas aeruginosa
molecule tags Electron transport
total genus 32
structure length 128
sequence length 128
ec nomenclature
pdb deposition date 2001-09-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00127 Copper-bind Copper binding proteins, plastocyanin/azurin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 1jzeA00
3RYMA 3X1GA 1NICA 2QPDB 3WKPA 4W1TA 5B7MA 2Y1AA 4RH4A 4L0PB 3FT0A 1SFHA 3T6XA 3TA4D 1L9RA 1V54B 3PAZA 3CG8A 1NPJA 2GHZA 3WG7B 3N55A 4DP9X 3FQYA 2Q9OA 2X87A 3CVBA 1XB3A 4HZ1A 3ERXA 3X1FA 1ZDSA 3X1EA 1PMYA 1ASPA 3FU9A 1OE1A 3WI9A 5B1JA 2AZUA 4CSZA 4FAAB 4WKXA 4YL4A 4GP4B 4GY4A 1PLAA 3IE9A 1NIEA 5EHFA 1ASQA 3ABKB 3CVCA 1CC3A 1NZRA 3N2JA 2ZOOA 4UAHA 4A66A 4E9SA 1XMEB 4BDVB 2JXMA 4QLWA 3ABGA 3S8GB 3QJTB 3AW5A 1OCCB 4DP8X 1YLBB 1MG2C 5B1JC 3HB3B 4HCFA 4YSEA 3H4FA 3FSZA 4KNTA 6PAZA 3PXLA 2PP7A 1BXVA 3AG1B 2YAOA 1A4BA 4DP1X 1BYOA 1MDAA 2CJ3A 3ZIYA 3NT0A 3G5WA 2IDUA 2XXFA 2YAQA 1TKWA 2PCFA 1SDDB 1AG6A 1IBZA 1XB8A 5D4IA 3S3DB 3ABMB 2BWIA 3AY2A 3QQXA 5I6OA 2FWLB 5I26A 1SNRA 2EIKB 3KW8A 2Q5BA 1AAJA 2FT6A 2IWEA 4WTQA 3NP4A 2UXGA 4DP7X 3UABA 2BO0A 4HHGA 1J5CA 1AZBA 2VW6A 1FFTB 3PPSA 4AI7A 2PPEA 1RZPA 1EHKB 2FTAA 1OCZB 5F7BA 1F56A 1N68A 1AZUA 2W88A 1IUZA 4AKPA 2EINB 5E9NA 2GI0A 3H56A 1BQKA 4NAJA 1UATA 2XV0A 1V10A 1J5DA 2NRDA 1RCYA 4E9QA 2B08A 3TASA 4UANA 1GS8A 3WKQA 5TK2A 1OCRB 2BZCA 2HX7A 2P80D 3FU7B 2R7EB 3T6ZA 1JOIA 1HFUA 4AZUA 1KBWA 2P80A 4KO9A 5PCYA 1N70A 2I7SA 3ASOB 3CZUB 4A2GA 2XXGA 5A7EA 2UXTA 4W9ZA 4BWWA 4YSPA 4GXFA 5AFAA 3NJFA 4KOCA 1AIZA 1A4CA 1NTDA 4G71B 1W6WA 3AG3B 3FPYA 3ZBMA 1MZZA 1XB6A 1DYZA 2J55A 3FQ1A 1ILUA 2XUWA 3SQRA 2CCWA 3MX0B 3NSFA 2UXFA 3NSCA 3FYEB 2FT8A 2GBAA 4KO7A 2YAFA 2ZONA 1L9OA 4QKTA 4ZK8A 3IN2A 5F7AA 1AOZA 3SBRA 4F2FA 2XYBA 2MRYA 1NPNA 2DWSA 2Y69B 2W8CA 1VLXA 1L9QA 1GY2A 1IBYA 4E9YA 1ADWA 2XV2A 2YAPA 2J5WA 1PZBA 2PPFA 5B1AB 4Q8BA 4BWTA 3S3CB 2IDQA 3PAUA 3OMAB 1KYAA 1BQRA 1WS8A 3WNIA 1QLEB 2AZAA 1KV7A 3T6WA 1J9RA 4TXVB 5FC9A 5D4JA 4HHWA 1J9TA 4G72B 2VN3A 5B3SB 1A4AA 2YXWA 3CDZA 3TBBA 1EZLA 1E67A 2IWKA 3NJMA 3NSYA 3SBPA 3TBCA 1KBVA 2RACA 1JZEA 3DTUB 4YSAA 3EH5B 1MG3C 3PAVA 2BWDA 1OV8A 1ET5A 1PNDA 1AANA 2GC4C 3UGEA 1OOWA 2CBPA 5I5MA 4Q89A 2IDFA 1M56B 2YAEA 3ASNB 4KNUA 2I7OA 4A2FA 3FS9A 5B7FA 2VW4A 4JHUA 4N4YB 4NB7A 3T9WA 3X1NA 1A8ZA 1CUOA 1L9PA 1JZFA 1SJMA 4DP5X 1OCOB 3AZUA 1A3ZA 4YSCA 2IWFA 1SFDA 3ZX1A 1RZQA 3SBQA 2OJ1A 1WA1X 5B7EA 9PCYA 1JZHA 4N8UA 2CAKA 1W6LA 3NJJA 4JHVA 3CVDA 3GXUB 4DP2X 4KNSA 2LLNA 3OD3A 3OQRA 2BP8A 1PZCA 2FJSA 4NERA 1URIA 2VW7A 4KO5A 3NJLA 1GW0A 1GSKA 4F2EA 2WO3B 2IDTA 1ID2A 1ILSA 2HX9A 3FYIB 4YSRA 4BXSV 1GS7A 2OV0A 2GIMA 2FQEA 1OF0A 4X4KA 4DP4X 4HALA 3KW7A 2JFCA 3L45A 4G7QB 2HZHA 1AZCA 1L9TA 2XVBA 3NJKA 4P5RA 2AFNA 4CSPA 5I6NA 3HEIB 1J9SA 1ASOA 1B3IA 1T5KA 3ZDWA 2VMJA 3GDCA 1KDJA 2XU9A 3FSAA 3JT2A 1E65A 1JXDA 4HAKA 4KO6A 1WS7A 4EF3A 4FA7B 1BQ5A 2UX6A 5IY5B 5I6LA 8PAZA 2XX0A 4P5SA 2DYSB 1KCBA 4E9RA 1IKOP 2OCCB 5ANHA 2H5UA 1PCSA 2XWZA 2QDVA 2QT6A 2GSMB 3QJVB 1JZJA 1NIFA 3IBOA 3X1BA 3EH3B 2EILB 2PPCA 1SF3A 2CALA 3FU8A 4BWUA 1PLBA 2XLLA 1ETJA 4ENZA 1CYWA 1NIDA 1AS8A 2TSAA 4HIPA 4M4RB 1PAZA 2BW5A 3BVDB 3V9EA 1BXUA 1M9WA 5I28A 1PLCA 2HLEB 7PCYA 4HCGA 3V9CA 2VSMB 3IN0A 2AANA 3C75A 2XV3A 1E5ZA 1ZIAA 3NJNA 3MBWB 2QDWA 1ET7A 2ZWNA 4GYBA 1KCWA 2I85A 3BQVA 1JVLA 2IH9A 4E9WA 5I6KA 2HX8A 4BDVA 3QJQB 1RKRA 3NSDA 2B3IA 3T71A 1NWOA 4BXVA 4E9XA 4GP5B 3AG2B 2CUAA 1SHXA 3EF4A 5LDUA 2TSBA 2E86A 4E9TA 6PCYA 1AS6A 2YXVA 2EIJB 4A2HA 3UAEA 3S3BB 2BP0A 1X9RA 2H47C 2X88A 1JVOA 2PCYA 3WIAA 2UX7A 4PAZA 4YSOA 1NWPA 1SDDA 1I53A 4A2DA 1PY0A 4YVUA 2GC7C 3S8FB 2DY2A 1WA0X 3QPKA 2YAHA 3WNJA 1ZPUA 3AG4B 1JERA 1E5YA 2H3XC 2IAAC 4JKNA 1PNCA 1QNIA 2VM4A 4DPBX 4YSUA 3EH4B 4F7KA 4K9JA 1AR1B 2QPEB 1AZNA 1JXGA 1AG0A 3QJUB 1FA4A 3NJGA 2MTAA 1WA2X 2YQBA 3FSVA 1BXAA 2IDSA 1JXFA 4BK5C 4UF7C 5I6MA 1QHQA 2PPDA 5I5JA 4AKQA 5B1KA 1V55B 1OE2A 4DP6X 3FQ2A 1GYCA 3NYKA 5D4HA 3TU6A 1L9SA 2J57A 5B1BB 1TU2A 3ABLB 2GB2A 2VM3A 3OMIB 1NIBA 2BP0B 3FU7A 1SF5A 1HAUA 2R7EA 5AZUA 1BEXA 3CDZB 1IC0A 4DPAX 1BYPA 2DYRB 2UXVA 3QJRB 2FT7A 2J56A 2PPAA 3JTBA 2DWTA 4E9VA 3UAAA 4PCYA 1AS7A 1SHWA 1W8EA 2HXAA 5I6PA 1OE3A 3NJHA 1NIAA 7PAZA 2PP8A 5AKRA 5I5IA 2FQGA 1GS6X 1JZGA 1ZV2A 2PLTA 3D12B 1CYXA 2HRHA 2JKWA 3H4HA 3U25A 4HCIA 4A2EA 4MFHA 1M57B 1KDIA 3FPXA 1MZYA 4M3HA 1AZRA 1E30A 1ZIBA 2AVFA 3NJIA 2FQFA 3GYRA 2A3TA 1J9QA 2DV6A 3DKHA 3UACA 1CURA 2VSKB 3NP3A 4G7SB 3X2QB 3DIVA 2WO2B 4A68A 2YAMA 4AX3A 1JZIA 2YARA 4YSQA 1TEFA 4GP8B 1AACA 2BP8B 1FWXA 4YSDA 2BHFA 1ET8A 1NINA 2BW4A 2WSDA 2ZXWB 2PP9A 2BZ7A 3PLYA 1GR7A 2N0MA 1NDTA 3UADA 3EHBB 4DP0X 1TEGA 3PCYA 2HRGA 4KOBA 4AKOA 4A67A 4DPCX 3FSWA 1X9UA 5PAZA 1BAWA 2FQDA 5TK4A 1PZAA 4G70B 4G7RB 1KGYE 3T6VA 1R1CA 1WAEA 4YSTA 1AQ8A 4YSSA 3OMNB 3IEAA 3QJSB 1ZDQA 2EIMB 2XX1A 2FNWA 3OM3B 1DZ0A 1PF3A 1A65A 1GY1A 1HAWA 4YVNA 2IH8A
chains in the Genus database with same CATH superfamily
1XF4B 2J25A 2EDWA 2R2BB 4X6FB 1TF4A 2MHAB 5FO7A 3WDIA 5CJQL 2YPLD 1R33A 4HHAA 4RH4A 3B37A 5I76B 1WE5A 4QIRA 3PJSA 3DO3A 4YPGA 4WHTB 5AWNH 4LEEA 2IG2L 2DEWX 1U8LB 3CN1A 1DBML 4W9EC 4K07A 3BYTA 3RRQA 3RPKA 2Q9OA 2UUDK 3F7RA 4PB9H 1EK3A 2PCXA 4B95C 1H8NA 4HWBA 3CHXA 2W60A 1IGCH 2F54B 5BMFH 1I3UA 1GOGA 3CSYA 1H19A 4YNYA 4LVNC 4FAAB 3TA3A 1NUDA 2Q3ZA 4HJSA 1E4WH 3FU3A 3ZR5A 4M7KH 4UV4L 5T5FL 4FFTA 4NPYA 3CSBA 1NIEA 1OTUC 4P4KD 5C9JA 3LZQA 4M9PA 4MKMA 1B4RA 4LASH 4NUPA 3RB5A 3SOBH 3PDOA 3TNNB 5LGJB 3HHRB 3O9WD 5CIPH 2A6IB 3KLDA 1JZ3A 2BS71 1MCLA 3VM5A 1W15A 5DMGC 2CE6A 2Y24A 3BQUD 1A1OB 5CBAB 4EN3B 3ESMA 2CR0A 3GBML 3LEVH 1UB6B 3ES6B 4LKXA 5IVZB 4MSWB 3DPDA 4PVLA 4N2EA 2X05A 12E8L 3FH5A 1E4KC 1KPVA 3OF6D 4PTTA 3L9RA 2FWLB 3GTVA 4UNTA 3GMOA 1QW9A 2ALWA 2JJVA 3KW8A 1GSMA 3IRPX 3GK8H 4L3EA 1X7QB 1DSWA 1V3MA 2A1WH 2ICWI 4NWUH 3CPLB 1NCBH 4IHOA 3DUHA 4NS0A 4R4BA 4KUCD 5ILTL 3E8UL 5T3ZH 1AZUA 1KJ3L 1IUZA 3GLZA 1MVUA 1YN6A 2O5YH 3M1CA 4HWBH 3R19A 3U30B 2VDMB 3WJJA 3DX6A 4QRRB 4NQCA 4NQVA 4Q52A 2WLHA 2WXJA 3O41A 2BJMH 5JPMA 1IGYB 1JGUL 4KAQH 3UMNA 5IV2B 4DGYH 3AU1B 3NCXA 2JKNA 4U4IA 3EJQA 3TURA 4E0RA 3MTRA 5ERWB 2X4UA 1T1WB 4FXGC 3GB7A 4Z95L 1LXMA 3LNHA 3GI8H 2OMZB 3GSQB 1WEJH 3S97C 4GAYA 4HFUH 4J2QA 1SXBA 3B4NA 1NQBA 4GS7B 4FLHA 4KRMB 1LHZA 4PJFA 1NEZA 1ORSB 4YXHL 3SDXF 4D0DA 4L1SA 4KGJA 4HPHA 3WBDA 3STLB 1ZXKA 5FK9B 1UJ3C 5AENA 4PIBA 3KBPA 2VO8A 1EDQA 3CH1B 3IU4L 3IXAB 3JWNE 2PR9A 3F84A 2A73A 2CCWA 4GUQA 2A77H 3Q3GA 4YHPB 5C86A 5M94B 4K23H 1MNNA 2SODB 4UBDC 5T1LD 2WLIB 3E6FA 3QO1A 4NEHB 3DOIA 5CCKH 1IBHA 3F6IA 4XP1H 3SE4C 2R1XA 1OM9A 1XGUA 2N1TE 5FFGA 4QY8B 1P2CB 2PWDA 5GRUL 5IVXB 2OTPA 3NK3A 4TYUA 3WMQA 2PXYB 4HP5A 4BUGA 1GCYA 3TH3T 2NTSP 3KPPA 3DURA 3IU3A 3V8CA 2WYHA 5LNGA 3JXAA 1XTLA 1B0GA 4NQQA 4BWTA 4KZEL 3HN3A 3GSOB 5JDSA 3LTVA 3PAUA 4JM2D 1CLVA 3WNIA 2DQTL 3VXSB 1TQBB 2R15A 3UYPA 4YQXH 5I8OL 4LIQE 2HCZX 2EIZB 1RJZB 2Z1KA 2VMFA 3C08L 4KVPA 4P4KA 1EZLA 1EXUA 2ALAA 1MRCH 5KBDA 3M17A 3DJ9A 3WTXA 3O3DB 3QZLA 4U31A 1RZGA 3KPMA 3B83A 5CCGE 4LPVA 3HRZB 4HD9A 5CMAA 1A4KB 3WEXA 4G8FA 4XNYH 1JP5A 3SKJH 1DTUA 3QH3B 4WI6A 4PB0L 1A14H 5K9QI 3MLTB 1B0RA 2Y7LA 5CZKA 5FHAH 2BS8A 4L4TD 2MPAH 3TPUA 1EMTL 3QUKA 5ADOH 3FS9A 4OIBA 3X1NA 1FJ1A 1FFOB 1TIUA 1I1FB 1A8ZA 3QUZB 3HC4H 1QO3B 1I1YB 1TQTA 3C09C 3VGEA 4JX0A 2OL3B 5F1SA 4XZUB 4R97C 3CU7A 3WS6C 3SBQA 4MCNA 3KL0A 1NM4A 1BQHA 4Y4FD 5AZEL 5KVEE 3NJJA 3KPTA 4QWWD 5D6CB 1BHGA 1IO4C 3CVDA 1E27B 1A6PA 3E80A 4PMFA 4V2BA 1YMMB 2LR4A 4NERA 4LIQL 1FIGH 3BZFA 2YQGA 3WNNA 3ZK0A 2OCJA 3BCDA 4RQQB 1LO5B 3LNEA 4I0PA 3FYIB 2CKBA 4GOSA 3NACL 1T83A 3CHRA 3RGVB 1A7NL 4AYDC 5E6ZA 5F7WC 1F1GA 4FZ8L 2HLAB 5JXED 2LV4A 1GCFA 5ACZB 1NGZA 1ZD6A 2AQNA 1H3PL 3NJKA 3CFDB 2XQBH 3EGDA 4MA1C 1KIPA 1BQSA 1DJZA 1NAMA 4HH9B 2OXGB 1XGTB 4OT1L 4KKZA 1T4KA 1N64L 4YHYB 5JR1L 3GDBA 2DKMA 1DVSA 4XCFL 4C57C 3TVMD 4HXBH 2XRAL 1I3GL 3DX4A 4KO6A 4LHQB 5DUPH 5F7NC 5KVEL 1TO4A 5IOKA 5GGVL 4NFCA 2O5ZH 2HFFB 4IKLA 1JK9A 3JWNC 2GSGB 4HZLB 4KTDL 2IPUG 1B2WL 1I9IL 1RZFL 1MH5A 2F1EA 2X41A 3S96B 2Z4QA 3QJVB 2GSMB 1DEDA 3VGHA 2R39A 2ZSVA 4U6XB 5C0BA 1GKOA 1CE1L 4C56A 4EQ2A 4JFQA 5D71H 3PGCA 4PRID 3QORB 3I74A 1JVKA 2AJSL 1F1AA 4DQOH 3R8BB 1ES0A 1BXUA 1ZGLP 2BVUA 2VLRD 1G43A 4R96B 2E47A 3JWOH 7TAAA 1P7HL 2AQ1A 2ZOWA 1L6ZA 2J1ZA 3LXCA 4TNVF 2W07B 4YK4C 2AGJH 1V5JA 2Y4SA 4WSJA 1JNLH 2PO6C 4E9WA 4Q9RL 3LD8C 3CFEA 4RA0C 1EEZB 2Y2WA 4U0RB 3FF8A 1HI6A 4XPHL 3BEWA 2CKBH 2W0FB 5EOTB 4OZGB 4MAYC 4A2LA 4QDGA 2NCEA 3VM7A 1BQUA 3UAFA 4X6CB 3AG2B 1CXIA 2AEQH 2X6UA 2YUZA 1U3YA 1E43A 4J12A 5D1ZC 2O6PA 4E9TA 5GGSA 1XV8A 1JRHI 4DJMA 3BGFB 3VRIA 2EP6A 1IAMA 1JXKA 1QEWA 4GSRA 4IBUA 1NAMH 4C54A 2CSPA 4B9JA 2E9BA 2PCPA 4YAQA 2AMGA 1HCZA 3UPRB 3LN4B 4H1LA 5I8KL 4YVUA 1BVKB 4M3KB 3F58L 5FYKD 2AQQA 1E8XA 4CN4A 5T5NG 4MA7L 4X4ME 4GMSH 1U3HC 5HDRA 5JUEL 2CMRH 3T0ED 1AMYA 3VXTB 2DWYA 1PNCA 3MLZH 4H8HA 4J28A 5EU6E 1YQVL 2HTLC 1HTYA 2HWZH 2Y9RT 1OP3K 4HUUB 4FKKA 1CWVA 2OJEA 1KB3A 1BMZA 1ZT4B 2WQ8A 1FH5L 1JXFA 2B0SH 4NKIL 4Q4EA 2PF6A 3JVGC 3MLUH 4NBXB 4NWTL 5F9OH 4JW3A 5HI3C 3VXMB 3P0YL 5HHME 2DQJL 2HRPL 1E4KA 5SV3A 5C92A 4OD2B 4EOWL 3AT9A 2ICEB 3ARBD 1OD9A 4YMPA 5FDWA 2J57A 4HJGB 4LL4A 4JFYA 1VPOL 3GSXA 1SF5A 3GMNA 5D2NB 3SDAB 4F93B 4YHNB 1NKOA 1RURH 2BCKB 2VSDA 1ZEAH 3UEQA 2ZOLA 3QDMD 4KC3B 1V3KA 5D7SL 1XSOA 2CIIB 5E8EA 5DFWH 4R7NA 2RQEA 3GHEL 5F7DA 1CFSA 3G04B 1WLHA 1M71B 1MCSA 1YNLH 2DJUA 4OFVA 5DVOA 5I82A 3UTSE 4YDLB 4KXDA 3UAAA 1K4CB 1NKRA 4UILL 4UOQA 1N59B 4X8JA 5L2JA 3FONA 1L4IA 3SKOA 1GGIL 5LWYH 5LO7A 4NM8H 1VDGA 3T8XA 3ZKXB 1AQHA 1Q1PA 4PJ7F 2K9FB 1FVCB 3IGAB 1H9VA 1MVFA 5D7JC 1U95B 4FD0A 4H1LH 3WFCL 3IXTB 5GHWH 3MNWB 4HIJB 1OSPH 3UACA 1I7ZA 2XFGB 3MNZA 2ZF9A 5DRZB 3X2QB 3DIVA 2NT1A 2FWOA 3RIFF 2KC0A 3QUXB 4P05A 2ITDB 1V05A 3T2QA 3H9YA 3ZL4H 2BHFA 5K93A 4UQEA 4XXCA 4ZUWA 2DQHL 2XA8L 3AS2A 4TQPA 3GKWL 3OPZH 3D33A 4OTXH 5L2KB 3CXHK 2G75B 3FFCE 3L5WA 1NAKH 3RPBA 1KGCE 1UJ3A 3TCXA 2FO4A 1KCLA 3KDPB 3KWTA 2FYYA 3AWFA 4XP5H 1UVQA 4RWYH 4GW5A 5DO2D 3VX0A 2EQDA 2UV3A 3H9SE 1F5WA 1LO2L 1A7PL 4LDCA 4GO9A 1QUPA 1C5DB 1GGCL 3PV6A 4AZ8A 1OTTC 4MA8L 5D7IF 5JW3L 3B7UX 4MXWH 4I1NB 2XX1A 1FYTE 4YHZH 3OM3B 2D31A 3BSZL 4LBEA 4WNJA 3SE4A 3VFVB 4GSXA 4V1DE 1RD6A 4ILDA 3QRFM 2X4OB 2WNKA 4CMHB 2H32A 4NJ9L 2BY2A 4WI7A 1DBAH 2OJZL 1Y0LA 5FLUA 5L9DL 5KSVB 3VQMA 4G9DA 1DBMH 1JPEA 2XDHA 1SVCP 1BFOA 3ECUA 3HC3L 3UTQA 4HF5L 1T7VA 1H3VA 3EO0A 1SQMA 2FEEL 2QZ5A 2QZQA 1ED3B 2XWJA 2WINA 5EO1A 2IAMC 1WWCA 4OIFA 4FRWA 3CVBA 3BUDA 3VI3A 3WE6B 1XGRA 3UCRA 1KN4L 2ZP9A 3UAJD 1T2QL 4KY1H 1R3JB 4FQ1L 3FUMA 5AVYB 1AY1L 1PMYA 5EEWA 3W0WA 1U8IB 3RJDA 3RHWF 2VLLB 4UV4H 1G94A 3FCUB 4WHYH 4IMLA 4IBWA 2ZSWA 4GBXC 5LLIC 3LEYH 3QDHA 3JBG7 4PJ7E 4X7TA 1R3HB 2EXYC 5ANMA 4AM0B 3NUKA 3VXRB 1MRFL 3FQ4A 1O9ZA 4XPTL 4IOSD 1N5YH 4OD1L 3SOTA 3ESNA 3WAKA 3TEYA 2A6DB 4Y5VC 3D2UB 3WS6A 5BZDA 2IFFH 1RP9A 3A6BH 2VABA 4H8VA 3GSWA 1YYML 1INQB 2ZXCA 4KK5C 5BJTB 3FB6B 1A4BA 4AMKH 4N2GA 5BQDA 1X4YA 5F7FA 5F7KC 2IDUA 4HKXA 5CHNB 3ZY7A 1VFAA 1MCNA 4HIIB 5D4IA 5JHDE 1J7VR 1V27A 2A6JB 3GSNB 4WUUD 1JTOA 1QUNA 2H7WA 4DKDC 4W4OA 2H32H 4KQ4H 2JKLA 5AQ0A 5C0AB 4FFVC 3DRQA 5E1AB 3NP4A 4PYHA 4LKCA 4N26A 4PY7B 2I5YH 3T08A 5F1NA 2NDGA 1R19A 1WRFA 4N2IA 4U6YB 4Y1AE 5D7IE 1PYWA 3MJ9L 4YH6A 1GYUA 5F7BA 1ZE3C 4MMXC 3PWNB 2VXVL 1UACH 2Y07L 2Y1YA 3MMEA 2P7TA 1TETH 4N0CC 3P30H 3ARPA 4KROB 3QG6B 1YO4A 4GO6B 3JTSA 1BQKA 3GJFB 2X4NA 4ZXBC 3BUPA 4KK6C 1RCYA 3NFSL 4JL2A 3APFA 2OULB 5GISH 2O6FA 3MRFA 1TU2B 1ZHLB 2FAUA 2VDNL 3Q8FA 3JUZA 4O51B 3UCQA 3HE6C 2QFPA 5SWSA 4MBOA 5HDWA 3E38A 3RUGF 3BSGA 2ZWKA 4BH7A 4D8PB 5D1XB 3CZLA 5DR5H 1JK8B 2DJSA 4Z1PA 3UTTE 2UWEF 5A7EA 3ROOB 4PWJA 5LAXA 3DI2B 4Y4KD 2HJLB 3AB0C 5DJ2B 2AJ3A 5JW4Q 4GXFA 1T03H 2IANE 5IB3A 4G8IA 1FFPB 2CHWA 2VB5A 3E0GA 2EDEA 4N0UB 3GPSA 2E46A 3WV0A 3LX9A 1AZVA 4X9HA 2P48B 4JG1H 5HYFA 2GG1A 2QPSA 3GZQA 2OP4L 3IU4H 4KK9C 2IPKB 4NNYB 5ITFB 4KH9A 1UFGA 4PP1C 2IALB 4P3CH 1FL5A 4G6JL 3HKFA 3O6FD 2GITA 3AREC 4UMSA 4Y0GA 3ZL1A 4YDJB 3ATAA 4KZDL 4CILA 2JJTC 2Z7UA 5I1EL 2JKRM 4MAYA 4PMEA 1B3JA 3QJHA 2IXQA 1MWAB 4NKDA 1OB0A 1GIGL 5KYNA 1JSYA 2ADJA 1W0YT 4I87A 4ZK8A 5IF0A 3SBRA 1ZK9A 1F1DA 5E6IB 3UBXG 4IYKA 3RL1B 4L1LA 4YIQB 5LJYH 2Y69B 1Q8MA 3OBAA 3QO0B 1LE5A 3L7FB 1IBYA 5DI8A 2DB8A 4KZEH 3IJ7A 1OPGL 4UV7L 3PYCA 4LLDB 2DQTH 3ME0A 4UIKL 3R06B 1QEXA 2WLYA 4YBLB 5B8CC 2QADD 4G9FB 5TDOA 1TTUA 4Y19B 2NY0D 2X0UA 1I4FA 3EYUL 2BLFA 1U3HA 3PWLB 3O8XD 3CDGA 5LCVL 4PRDB 1WCBB 4FLRA 1WD9A 4LSSH 4I9XA 3FZUD 1IKNC 3WLBA 3P2TA 3RWEB 3VG9C 4MNGE 2X7LB 3HZVB 5GGRB 5ESVA 3ZUCA 4NM4L 4IRJD 1C08B 3SDXA 2CO2A 3FAXA 4U1GB 5A2AA 1DLFL 2WV3A 3PREA 1LEIA 4LFHG 3SE6A 3FCGA 1EMTH 5HHOD 4PJGB 1WFNA 4OFYA 1QRND 4LVNB 4GKOA 3RY6C 3H0TB 2R8SL 2O72A 3VGFA 5B7FA 3RUGE 4N4YB 3VFOB 3K72A 5E8PB 3T9WA 4XP4L 8CGTA 5F96L 4K5NA 4X4ZA 3VD1A 2CRMA 2UWEE 2VIRA 1BIHA 1D6EB 5DZ9A 5JZ7C 1YC7A 1BG1A 3OZLA 4WCYL 5G5DB 2D0GA 43CAB 4JK0D 3DDGA 2LOEA 2NXYC 1QPXA 3BDYH 4G8GE 1SEBA 4U1NB 4WHCA 2WBWB 3V10A 4LIQH 4MWFA 1T5XB 3DPBB 3F01A 1PBYA 3ARDB 1ZHKA 3MRKB 4X0KA 3ZYJA 1K8DB 2ZKMX 3CH8A 2B9BA 2Y7OA 4YXLL 3IFLL 2QVKA 2RFXA 4N5EC 4CC4C 2EYTA 4DOHE 3FULA 5C3LD 5ITBL 5CLWA 2WANA 2BIQA 2R59A 3A67L 4HKZA 4M4RA 4L8CB 1H8SA 5JA8B 4EI6A 1VGKA 1IJNA 3VH8B 1C5CL 3E8VA 4XMVA 4UM8A 4W9LC 5F93C 4XMZA 4L4VD 5B38G 5I30H 1PLGH 4XCFH 3FOLA 3L4XA 5LAPA 4M5SA 5MENB 3SYPA 4ZUSB 5GRJL 4NO3A 3SZKC 4HS3A 3GXPA 5EFIA 4KKLD 3L16A 3MRNB 4LT7A 4HAGA 1ZS2A 4EDWH 4EF3A 4KTDH 3VXNB 4DAGH 1B2WH 3MUGA 1I9IH 2XA3A 3FNKA 4NRZA 4MS8C 4A7QA 4AGPA 3FOMA 1SLXA 1E2WA 3PXJA 4HU8A 2OCCB 1Z5LA 3EGSB 1F11A 3QUYD 5HHPA 2AEPL 4M7LT 5AW3B 4NQDA 3Q8CA 1ZANL 1NGQL 4ZS6D 1RHHB 1I8KA 1MAML 1U8JB 3LVTA 4EVNA 4OCRL 4UT7H 4NYLB 4U0QB 1EUTA 2RD0A 5E5RB 3RWCA 2F54D 2NNAA 4FXGB 4JFFB 1GGYA 2P5EA 3BAWA 1AS8A 2CDGA 1RFDL 4HIPA 3M7OA 4CU7A 3P11H 3VG0L 1Z9NA 4FQPA 1O75A 1YEJL 3MKGA 2Z8VC 3ZYZA 3ULUC 3IBEA 2VSMB 2G9HB 1KG0B 3BGMB 2ZWNA 2VQ4A 4XPHH 3INUH 2YRZA 4P5TA 4LHJB 3OB0H 3H9HA 1TZAA 4R83A 3ZKSD 4XC3L 2JCWA 3REWB 3FTGA 2IAMA 4X4MA 5KVMC 4NRYA 4LMQE 3QZOA 5HGHA 3RKDD 1JFQL 3ROLA 2AXFB 4ANXA 4D0BB 4EN3D 3DV6A 3WFHA 2YUXA 5DK0A 3GJEA 1EJFA 1XCQB 4FKHA 3UAEA 4ZO9A 1XH3A 3IKKA 4XWOC 3S3BB 1YEHH 4N3TA 2P5WA 4M61A 1X9RA 1IU1A 2X88A 2XWBB 5A2BA 4TLUA 1BGXL 3BVUA 4GBXA 5JW5A 4PRBA 5CJOL 1NJ9A 3ARVA 4QF1A 5FO9A 2CGYA 3PWPE 2X89A 1XL4A 2KUTA 2CO7B 2NTFA 3QDGE 5HYSA 3AG4B 3KYOB 4W9FC 1YQVH 2BY3A 5DUBA 3VD2A 4Z76B 4WEBL 4NAQA 2NX5B 4ZX4A 1QNIA 2R2HB 1Q9OA 3DIFB 4F7KA 1KTKE 4AGQA 5J11C 2XWTB 5DJZB 5BPPA 1AZNA 1G1OA 4NKIH 3EZJB 3CSTA 1LO0L 3P0YH 1P6WA 1X4XA 4IW4C 4OLWH 2OZ4A 3VXOB 3IVKB 3EJSA 2VDQH 4QRRD 5FDYA 3SGJC 1G4RA 3ZMEA 4P5KB 2FSEA 3CTTA 4NP4L 5LBSA 4Z3JA 3JV0A 5JO5A 1N3NB 4NCC2 3LXUX 5E24E 3BSZA 3OMIB 1HZLA 3Q6GH 2P43B 1PJWA 2ZCKL 4HMEA 3CCHA 2BIHA 3SGKA 1FNSH 5I0VA 32C2B 1BYPA 4GUPA 2V2XB 2Y7NA 4JQXC 5IW6B 1P1ZA 2ZJSL 2J2ZB 3RPIA 4UILH 3C09B 1BBDL 4MD0B 4YJZL 1ACYH 4R97B 1GGIH 4JHWL 4GUOA 2AQRA 1NIAA 3NGBC 3SYQA 5C7XH 1GXEA 4L0YA 1IGTB 4HKBA 2O5XL 4IRSB 4Y2OB 5FOBA 4UM9B 4JGJA 5LBVA 1YY9C 3ETTA 2DWXA 5LN4A 4RIRA 3B2XA 2ITCA 3CLFL 3QARA 5DT1H 3HE6A 2XN9E 4UDUA 5DQDL 4M48H 1G6VK 3O3EA 5HHQB 2R2BA 1MHPL 2F7RA 2FQFA 3QIBB 2H9GA 1N2RB 4Z78A 4CVZA 1QD0A 2JJSC 5HPMB 4XCEB 3T8VA 4DETA 1N8OE 4HCRA 4UI2A 1YY8A 1XEDA 5CZVH 4YDKH 4OKVA 4Y1TA 1TJIL 4P2RE 2PXYD 4XCCH 5CF3A 5C9KA 3O2WL 4RZKA 1MIEL 2OZ4H 3QR2A 4IBQA 1BX2B 2F74A 4AKOA 4ZZKA 3UJTH 4A67A 5BXFA 1UZ8B 3H3KA 5TK4A 2E7LC 1DJXA 3J07A 2C26A 5EN3A 3HZMB 4MA8H 4YHLL 1G7QA 2JJTA 2WBJB 5LBSH 1ODAA 5ETUB 3RWDA 4AYEC 1HZKA 1G7LA 5EWIH 4Z3GA 3BSZH 5FS5A 3RZWA 1M2VA 4QJ3B 4TTGA 5ISZE 1HL5A 4BGLA 1NANI 1UD4A 2NY4C 4ZPTA 1EO7A 3PAYA 5AG9A 4HSCX 4L3FA 2OR8A 2OJZH 4ODSH 2NZ1A 4U3SB 3G3LA 3HC3H 3II2A 5T1MB 1KTLA 1CF8L 3FT0A 4HF5H 5DS2A 4UUJB 3MJ9A 4PJ7A 5E51A 4K55A 3RVUD 4P9MH 4F58H 3NZHL 5F70A 4BYHA 5HHVL 3E6HB 2IVFC 5B8CA 3QUZD 3UJJH 1TQWA 3FT3A 4FQ1H 2DYPA 4YK4B 4ODWA 5CLXA 1D5XA 2P24A 3MRQB 3FU0A 2PO6B 4MAUL 3T0WA 3LD8B 1N19A 2JH2A 4IMKA 4EI5C 3UG3A 3HG5A 5KVGE 1OE1A 1IKNA 1SXCA 5AOLA 3EGXB 2FECL 1FC2D 4GQZA 3MRMA 4QEGA 1OB1B 1YMMD 1X7QA 4H0HB 3PPEA 4HCRH 2H26A 1F4YH 5MEOA 5IHHA 5EHFA 1PLAA 4X7SH 2EEDA 1MRFH 1G7IA 4WY7L 4WI3A 4XPTH 4XP6L 4Y16A 3WO4C 2DM2A 2WQWA 2WXNA 4OD1H 1BVLA 1QSZA 4F9LA 3IDXL 3WAJA 3TFBA 3RGVD 3MO1A 3HB3B 4XOEA 4KX8A 2JCCF 1HYSD 3CV5A 2BNRA 2VWEE 2ZUXA 3O11B 3WY4A 4H88L 3BAYA 1E4XH 2ROXA 3NOIA 2ZOTA 5CLZA 4L29A 2JQZA 3QBTB 2PP7A 3TBSA 4AEHL 5EORL 4OF3A 3MA9L 3ISWA 5IUCA 4DP1X 1ZVSB 4JFPB 3EOAA 3MODL 4OIIL 1CVRA 2KKQA 1Z0NA 3I02A 1DHKA 1DL7H 1IBZA 1T1WA 2XG5A 3F6LA 3MROB 4JO1L 5C0CB 3RILA 3U0WL 3TS8A 3HG0A 5HVWA 3QZMA 3DVGB 1PCXA 3KGTA 5KVGL 4WFGD 2JV6A 1I3RB 2IWEA 2F7IA 4QHLA 1W16A 4I3SL 3U6XS 4DP7X 5ICXA 1J5CA 4HHGA 2ATPB 1C7SA 2A99A 1CDUA 3MJ9H 4LLWA 2VW6A 4FP8L 3WYRA 1RK7A 3OKLB 2Y07H 4M6NH 3LKSB 3O4LE 5FK9A 1N68A 1A1NA 4G7VL 4GXUM 1NCJA 3TIEA 3QORD 3BRDA 3NFSH 4RFEB 5TF1L 1MQKL 2X0VA 2FK9A 2WO4A 5BZXA 4QHKI 1DEEB 1UFUA 5B21A 1JWMB 3HNSL 1ZA6B 4PBWD 2IGFL 3H55A 2N7SA 2JI1A 2EDOA 4LOFA 3MBWA 1HT6A 2Y5TA 2Q76B 1F4WL 2ZWYA 5HYJE 2EC9U 4QY8A 4YFLI 1P2CA 1QR4A 3O3UN 2HUEA 4FCHA 1EZSA 3B5GA 4M7LL 2VZVA 5B39B 1MJ7L 2IGLA 2F7QA 5D7JB 4LF3B 2JB6B 5AFAA 5KVDE 3H2WA 4TQHA 5LGHL 3VQ2C 1P84J 1WG3A 3Q8AA 2FD6L 4IBSA 1DFXA 2OTUA 3DHJA 3P3SA 3NQKA 4PJCA 3VXSA 2YEZA 2XBTA 4BSWB 4NQUA 1E2VA 2Y36L 2EIZA 1D5BB 1RJZA 5I16A 2CPCA 4KXCA 3TJEL 4KZDH 3FQ1A 3FTVA 3X11A 2JCCE 4HSQA 4WTXA 4PJBF 3ARGA 1PEWA 4DN4L 1GZPA 4QPEA 1A4KA 3BUTA 5J6SA 4BQ6A 4P2QE 4F92B 3GUTB 2XICA 5D96C 4OF5A 2DTML 3GS0A 4L9LC 4LLMB 2OYPA 4GKNB 4K3EL 1AOZA 1U8OB 4E36A 2HMIC 3VFSB 3V52L 1CLOH 1KCVH 1MF2H 3PGDA 2NMSA 5DJDA 3VJ6A 1DUZA 1OPGH 1L9QA 1Q72H 4LHUB 4O9HH 4OLZL 4UV7H 2QVFB 4L8BB 5KANG 3VXMD 4QJ4B 3P2DA 5FA3B 1CD1A 1XSIA 3RTQC 3W1ZA 4BCXA 2YD3A 5KVDL 2OMUB 2XPZA 4RISL 4FMVA 2PW1A 3WHXB 2XN2A 3CZNA 5D6CA 3KM2A 1KYAA 4RMTA 3RUGA 3V7MA 1WS8A 4TOYL 3SDAD 1KIRA 1KV7A 1T21B 2BVOA 2VWEC 2GQHA 3ML8A 3VMOA 4CDHA 3OX8B 2AK4B 1DZBA 3B9EA 3A22A 2YXWA 4TQEL 5FOJA 2QKIA 2TAAA 1KBVA 3WNPA 2YXFA 1DLFH 4M8RA 5JLZB 4HH8A 4DWHA 1OV8A 4JDZA 4LCCC 4R84A 2L7UA 4X9IA 3T77A 2P5PA 3A4EA 4IGBC 1IX2A 4FNRA 3V4LA 1UXMA 2WVVA 4K7FB 5F96H 4ZG1A 4JZJB 4HH9A 2YLHA 2XVGA 1JZFA 1E5BA 2BVYA 5HHMB 4WCYH 3MRCB 4W9JC 4AK1A 2VN7A 3ILPB 4MXWL 3TCLB 3ZTCC 4DZBA 3V0AC 4WU5B 1E4XI 2GSIA 3OR7B 5H37G 3L2MA 3GNMH 3KLSA 2D7NA 3CMGA 3RGBA 5ENWB 1UXWB 3HS8A 4JL1A 4Y5VB 4PJ8A 4XODA 5BS0B 1YEFL 1AIFA 5DLML 2AXWA 3LSOA 4N0RA 4QO1B 5L2KD 3I9GH 3WO3B 4PJEF 2L4OA 2ZX9A 3TGXA 3AJ7A 4LGPB 4ANKA 5C07B 3UTSB 5LXGL 1ILSA 4PLJD 5FWRA 5MHSE 1L7TL 4GPVA 4BXSV 2FYVA 2LE9A 3EUUA 4RDQG 2Y25A 2FQEA 4PJBE 4XT1C 1OO2A 4MJIE 3AABA 5FHBH 4HALA 1JF5A 1YJDH 1UH3A 3V4VA 5DRWB 2R9HD 3BKYL 3BP6A 5DJAA 2EH7H 3SPVB 4KY2A 4NC2B 4JDVB 4KKCC 3EJZD 5EO9B 5T1KB 4ZODA 4XB8A 5EB9A 5GRJH 4O5LH 4PG2C 2VE6B 5ABZA 1DBBL 1BF2A 1L9MA 1HILA 3QDJA 5EOTA 2BRRH 1P9MC 5FYKU 3U2SB 2G2RA 1JXDA 2MCMA 2PWEA 3OKNB 2FR4B 4JRWA 4EUPG 1EPFA 5IK3A 5IB4B 2RAMA 1RZIB 3F12A 3IRCA 1G7HB 2AEPH 2XX0A 2E7LA 1NGWA 4G2AA 4I4WB 4PTUA 1IKOP 1E6OH 1ZANH 2Z0UA 3FFCB 4LNVA 5DQ9B 4K94L 4N20A 1VA9A 2HRLA 2QDVA 4P23C 4IDJL 2NDFA 1Q0EA 4ZW6A 3V0FA 1OCWL 1MW1A 3IMBA 1BOGA 1OY3B 5D8JL 3ZSSA 1SBSL 1SYVB 2AJZA 2AVGA 1XAKA 5KBMA 1NIDA 4HJIA 3UYRL 3JYCA 2CA3A 4DKEL 1PAZA 2E6JA 5D55A 2EDHA 4YUEL 5BQ7B 7PCYA 1FYTB 3AB0B 4KRPC 3QI9B 4NJAL 3VXTA 3DGCR 3KJ4B 1I1CA 1FN4A 1U8QA 4TUJB 5BNXD 3F83A 1SDAB 4J3OG 3VXRD 3G5ZB 2EE0A 3Q6FA 5C0FA 1CI5A 4GRWF 2E5EA 4ODUB 5AG8A 3S6CA 2B9AA 3FHEA 3MRRA 3POHA 3P73B 1JIBA 4N0YL 3D2UD 2AKRA 3KH3A 4K7PX 4OZFA 3AREB 5IW1A 5F88B 1GL4B 1KFAH 5IOPA 4OD2A 1FO0A 4ETQA 3V4VH 4MLIA 2ICEA 5KW9H 5JA9A 4JO4L 4NHUA 2DJMA 4JZNA 5A3ID 3S3SA 2V9RA 1RIVH 3V5HB 4WWID 4PJEE 4YHNA 3DBSA 1RJLB 3ARSA 1E2ZA 5IQ9B 3H7BA 3V2AR 2VQ1A 2YGQA 4YSOA 4OJEH 4BFGA 1SDDA 5FKAB 5AW6B 5CBEA 1JHLL 2K4AA 3S2CA 2GC7C 3D4YA 5C0AD 4ZQTA 5GSRA 3QG7L 2B4CL 4J3UA 1TITA 3VD5A 2BFVL 2MWCA 1KIUB 2VDOL 2NUTB 1FV1B 1PKQA 2OBGA 1TQCC 4XTRD 2ZUTA 3DLQR 4CKVX 4KROD 4XXWA 2LGNA 2GJRA 3SKUD 2D7OA 4JFHE 3MGAA 4NZTL 2BXZA 3NIGF 2YO3A 4R5TA 4K94C 3MOAH 1H5BC 2ZP8A 4NP4H 5F7LB 1TPXC 3VG9B 2PNDA 3BH9B 4PS4H 3JV6A 2MMXA 1QPPA 2IH1B 4OD3H 4P59L 3QUXA 2ZCKH 5BRZA 4GKLA 2AMUA 3TBVB 4RGMB 2XIIA 5FF6B 4XPFL 2HPOA 4WNSA 5D1XD 3QAZC 2YIHA 4XB7A 2X4SA 4XVJH 5A6IA 2BSSA 3QJRB 1AP2B 3VB8A 4OQTL 5BOJA 3GIVB 4OV5B 4XNQB 2MQ0A 4MRCA 4OZFH 3B7TA 1R3LB 4HLEA 4Y1AB 5D7IB 2NNXA 1DJGA 2WAHA 3L1EA 1EV2E 1AS7A 2IFGA 3RY5A 5EPMA 1FO0H 1XR8A 3VQ1C 3VMPA 3IFPB 4Z3TA 2YKKA 3U4EB 3MLSH 1QFWI 4PIRF 4W9CC 5FECA 3QCTH 4GKZB 1MHPH 3DX2A 4GRWE 1AGBB 3KNBB 1JD9A 2C4FU 3OXRA 5CEZE 1NC2B 1FZKA 1M2OA 1GJIA 2UY7B 3HMWH 4FTVA 4LOUD 1DQML 4JUSA 3GMLB 1CURA 3HN8A 2J1XA 5GGVY 4XOCA 4IJTA 2BIOA 3BAEL 1RLBA 4ZSOA 3J27A 5ISZA 1NLBL 2M1KA 2BP8B 3HI6H 3MPCA 3UTTB 7FABH 4XN5A 1LO3H 2B4CC 5E6ID 5HJ3B 5SWQA 2EYSA 1DJHA 1J05B 1ED3A 5F9WC 3B9VA 4OCNC 1KLUA 2N0MA 3UJIH 4ZFQA 3S3PA 3TZVB 1I7TB 1TEGA 3II1A 5EF0A 1DDHB 1X9UA 5ICUA 1R5VA 3KWWB 4H25B 5JMOC 3CAFA 4GSDH 3DV4B 4HC1A 4YHLH 4F15C 4G9FD 1FDLH 3D0AA 3BUIA 2JB5H 3T6VA 1BD2E 4Y19D 5AD0A 3ZHKA 1S7TA 1G6RA 3U1SL 3DJTA 2FJHA 3HZKB 4AXWA 1FBIH 1AQKH 5EMYA 4YSSA 4G11A 4YGVB 4PJIB 1A2YB 1RIUL 1UA6H 5K1JA 1MJ8L 2BNQE 3FQTB 4APQC 4Z7VF 3ATFA 2IO5A 2QVMA 1NGYA 3P4NA 4KJQC 4W70A 2BK8A 4WIQA 5CEZL 3KPSA 4L9LA 1HXMA 3NIGE 1ONQA 3RVTC 3X1GA 2GUOA 4RRPA 2CLVA 4BFIB 4BZYA 3FO9A 1CF8H 3O6MH 2DMCA 1WHPA 5EUOF 4Y89A 1A64A 3GMQB 3DX9B 4R4FL 4XCYA 2VJ0A 3BT2L 3NZHH 1J8KA 2FEDD 5IHZB 4QXVA 2A9CA 4BFBD 2C8NA 1AO7D 5JW4M 4ZFZB 1I8LA 3CG8A 3UIYA 5DSCA 2PWHA 5IESL 2QSTA 1KLFA 1E28B 4MAUH 2X6BA 1CFNA 1SOKA 3RIAK 4U7KA 2Z35A 5FCUH 5C0IA 4XVUC 3QFGA 2ENYA 2A6JA 4M1CD 5IQNA 2W1NA 1N5AA 1SJVA 2QKSA 1CZ8H 4NLHA 4QXUL 5D5MF 3MV8E 5AW0B 5DMGD 1H8OA 4EZLA 2AP2A 3VXUA 1AHWC 4LCCA 3CVIL 4F7MB 2Y06L 4WY7H 3ARDD 3BFWA 4OZHA 1PKOA 3NH7H 4U6YA 3CVCA 3IDXH 4MNGB 3X3FL 4LNRA 1MCWW 4U1HA 4LU5L 4LQFH 4BDVB 3EYQC 4QLWA 3S8GB 4XRCA 3MRLB 4M1DH 4H88H 1U92A 3QG6A 3IPBA 3S36L 3L5IA 4ZMOA 3ZRFC 1JMXA 1DQIA 3GJFA 4AEHH 2R1YA 4HC1H 2FLBT 4QRBA 4UDTB 2DOCA 3Q2LA 2X9WA 1T1YA 4JFVA 1IGJB 3O4LA 1G6RH 3TT3L 3SGEI 1XSKA 3ASWA 4MAZA 1X5HA 2UWEB 4JO1H 3WXVH 5GZNC 5EO0A 5MEND 1OAUL 3KLQA 3FO0L 5EBMA 2YSSA 2PCFA 5J11B 2AJXH 3NSXA 4KKBC 4NN7B 3S98A 4NC1C 4ENEC 2X53A 4G8GB 4LGSB 4XAKE 1FZJA 2D2OA 3ROOA 3K2IA 4I3SH 1KLGA 1SNRA 3X13B 1WYJA 2YC1A 3DHPA 3LKPB 4B3VA 4FP8H 3A6CH 2BMKA 2JMRA 5FGBC 1FFPA 3ZTJG 3C60A 4FFZA 4N0UA 1E9PA 1R24B 1G1KA 4RETB 1H6EA 4XCNB 1UWGL 2UZXA 3G6DH 5D70L 4NNYA 4Z7VE 3GSUB 1KJ2B 4FQXC 5TF1H 3O3BA 1MQKH 4Z0BH 1LDPL 4PG2A 4P2OC 2V3DA 2HJKB 3IJEA 1F13A 2AK1H 1N7ML 2R4RL 1YCSA 2AITA 1ZK5A 3DXAA 3LQZB 4U6HB 2Y23A 1V3LA 5EUOE 1NCNA 3BP4B 4LPWA 3E7JA 3ZIMA 4ZMWA 1LK3H 3VNYA 2AJVL 1MWAA 2A6KB 2HB0A 1OCRB 1ERNA 3T6ZA 1OWRM 5CILH 3NGBB 2VAAA 4FLSA 1HFUA 5DS8A 3SDCB 2YRLA 4L2YA 2W9EH 2EO1A 3I6GA 2WLLB 2WCSA 3PWJA 1DJIA 3CZUB 3DX0A 3QSKB 1ZV9A 4PW9A 5D9SB 2CD0A 4YSPA 5DZLA 3DX8B 3GJFH 3CFBB 5D5ME 4B9PA 5CN3A 1PX4A 1S7VA 3HIZA 1A4CA 4HK0A 3ZXAC 4QHNA 4UBDD 4MXQD 3DGGB 4XN1A 3D0LB 3VTTA 3WU1A 5KAQG 1W6WA 2LFGA 3C6SB 3CZJA 1FNFA 4WI2A 5TE4H 3TJEH 6FABH 1TZIA 5GS1A 1KY7A 4HJJL 3T4YB 4E9LA 3A5VA 5DUJA 4J3VA 4NNPL 4DN4H 3VGAB 1S7UA 1IB5A 2ZUUA 2A9NL 3NSCA 1JI2A 3CPUA 2NX5D 2YN3A 4MHHI 1AGFB 1FNGB 3DSFL 1I8MB 5E8OA 3WKML 4FFZH 4PJGA 4ZYKB 4K2UH 3V52H 5DHVA 3M1OA 5EV7A 4JFWA 4GNKB 3K2UH 3I85A 4QYAA 4OLZH 1ML0A 1USQA 3L54A 3FB8B 5E8PA 2DWSA 5EU5A 2JKJA 4N2AA 4C4KO 1YQ2A 4H26B 4M43H 3OQ3B 4MQXC 2TRYA 2VC2L 5C0JB 3F7YA 1GY2A 1D6EA 4OJFH 2NY4B 1W72L 2XV2A 4RAVA 1UASA 5B1AB 1KXQE 3T8MA 3KPRE 3KLHD 4OUOA 3RU8L 4BCZA 3CVHL 1Z3GL 4TOYH 2JSFA 2EDKA 4R7DB 5BO0D 4UTAL 1S7RA 4BZ1A 5GS0L 2CK0L 3EOYG 1JHKL 1J8SA 4Z77B 1MWAH 1AGCB 1JXJA 1UCBH 2QLVB 4QRFA 4M6OL 3PWPB 5B3SB 1KCSH 3TLRA 3PQYE 3QDGB 4OZ4B 3MFGB 3SJVA 4AQAA 1T66D 1CU4H 3OZKA 3TN0C 2ZCLL 3ZDYF 1M9SA 3FL7A 3QIWC 4EI5B 4P57B 1D7CA 2P3YA 2PTUA 4UM9D 3GGWA 4XP9H 3FF7A 1CLZH 3QEGL 2E9WA 3P4OB 1X44A 3D48R 3K7UA 1UD5A 1BVOA 4XMPL 1SOQA 5F3FA 1L9PA 4MJIA 1S8DB 4NQSB 3BT0A 4PHZA 5K9KA 4PR5B 3QIBD 1AD9B 1QSFE 4QI3A 3ZX1A 5DK2B 4KJWC 1WA1X 3P3YA 4LCWE 1HIML 5TDPB 4Q74A 5DLMH 3PP4H 5BVJA 3GXUB 4U4BA 1PZCA 1XGYH 5DJYB 5LXGH 5DHVH 3CN4A 3K80A 4ZMXA 4PCTA 4GIAA 4KDTC 1IAOB 1L7TH 4F2EA 1HHHB 1UM6H 2ESVB 2IBZX 3L7EB 3OZ9H 3UC0H 4HUMB 4KTYA 4YSRA 1S7SA 3MGTB 1DN2A 5BV7B 4JFFA 4QOKA 3TIDB 5KG9A 1FVDB 3BWUF 3F7VA 3LMJH 4X4KA 4UIMB 3BKYH 2WBJD 1J1PH 3RVXC 5JYMA 4BZ1H 4QGTA 4AE1A 1RZ7L 5AVZB 3U9PH 1AR2A 3KZ8A 1KG0A 3GTTA 4CSPA 1RU9L 5MP6L 3N1PC 4U6VL 1MI5B 1A6UL 4PJXF 5GS0C 2WTOA 1MCWM 3V0VA 1OF2A 2XU9A 1MJUL 3D18B 4YHML 3REWA 5EDSA 2ZAGA 4U6TA 1KYDA 3TM6A 3IDUA 3DO7A 2VAJA 5DJ0A 5C6TL 3KLLA 4K94H 4P2RB 4D0BA 4UU9A 2Y72A 4X7FC 4AYGA 4IDJH 4L2LA 1UT1A 3P9LB 4I48A 4RGOL 1OCWH 1A6ZB 1CTNA 3C5ZA 3MNVA 3G08A 4NP9A 5CKGA 5D8JH 4E5XB 1OQXA 1SBSH 2PO6D 4XPGL 3S3JA 2FZ3B 4Z7OF 1SF3A 2F58L 3KYMA 4MJHA 4DKEH 3TEWA 3IETB 5FYLE 1A9BB 1FL3A 5FUCE 3ZDYE 2CO7A 2VITB 3V9EA 1U8KB 4CVUA 1M9WA 5KUMA 1WF5A 4HCGA 5D1ZD 1EJOH 4XX1E 3NJNA 2P52A 3UEZA 1G5GA 4KKQA 4B7LA 3NDYE 4LOVA 1OGTB 1ZA3B 4N3UA 4OQTA 3HB3D 2J1KA 1C12A 3OAZH 1I8IB 4HZAA 3EXJA 3WL9A 3DUSA 5GZOD 4JY4A 1GZHC 4G43A 1SJXA 1SHMA 4BE5A 4P5KA 3CFUA 4MCYB 3GEWB 2VR6A 1XGPB 1OAYL 3QXDA 2E86A 1DFBH 5JIKA 3QIUA 4IDLA 3RLSA 3G5XA 3UOAB 2P9RA 5C2BH 2HTLD 3ZKMC 5AW5B 1JHLH 3ILEA 4JRXB 3K5SA 2CKNA 3WTWA 3CXFA 4AYBA 5EIIA 4IBTA 4N2CA 5IREA 5DZPA 4LVHC 4FMFA 4QGYA 5FYLL 3QPKA 3MACH 5HI3D 1QMUA 2LTQB 2X2UA 1SGKA 5CGBA 1TENA 1PY9A 3RTQB 1XSJA 3KAAA 2VCOA 3FW6A 1IGTA 2EVIA 4IRSA 2QQNL 2ZICA 4S0TD 5C09B 2QPEB 1T0NA 4Z7QF 4PJXE 4PPTA 5GZNA 3II3A 2UZPA 3LPOA 2QL1A 3VW3L 2WJ5A 1KACB 5HHQA 1VB9A 2DMKA 1NCHA 3HS0A 4QYOA 4DP6X 1FORL 2HTKC 1OM3L 3SGDH 3JTTB 2J44A 3MRPA 4LRNL 1T2JA 2XACC 3SB3A 3QQDB 1S9WA 1MN4A 3NTCL 4Y4HB 2V3EA 3G5YA 4AMWA 2FDBP 4HA1A 1X5ZA 4BEIA 5KYYB 3SE9L 2R7EA 1MHHB 3G6AA 4JKMA 5L6YL 4OQTH 3UG4A 1BIIB 2X42A 4J8RB 4POZC 2X6CA 4XZ4A 2MPVA 1KGWA 3TFKC 5D7JD 1GVIA 3AGWA 4JFEA 1BX2A 2EEBA 1E5UI 1QVOB 5FYJE 5IKCB 1SN2A 4BD4A 4ELMF 1C8QA 3WIFA 4E9VA 2W38A 1IBFA 1WWAX 2OM5A 1PDKB 3QEHB 5DYOB 2Y0SA 4GB9A 4G6MH 3ZHFA 3NJHA 4AQ8C 3HHSA 2FQGA 3IDYC 4OCYL 5EC1B 4LZKA 5F9AC 2HRHA 2WZPD 4KI5F 3K6IA 2EE2A 3B2VH 1XTMA 2KT6A 5HYQA 5FLVA 4GKSA 1PX8A 4Z7WB 4LLUB 4QXTB 1DQMH 5ACLA 2O6DA 2GFBB 3W9DA 1M1XA 3S9DB 4MNHA 3MBXL 2E7CA 3NBNA 1J9QA 1L7IL 3BAEH 4UNVA 1NLBH 3NP3A 5E5MA 4PGCA 5AW2B 5T1MA 1ZLUH 4ERSL 5IZ7A 3M45A 1QBML 1T3FA 2V5RA 2K7QA 3T6QC 4ZW8A 2F18A 5J6HB 1NINA 4QRQB 5FUCC 4AQOA 5J5EA 4QR7A 1CICC 1NUGA 1A1MA 4LHUD 4TNVK 3W11C 2J88H 3KBFA 4BFJA 3TO2A 5D93C 3OLEA 3DYOA 1CS6A 5TPWL 5FYJL 3FSWA 1OXYA 1BAWA 3OPUA 1PX3A 4G70B 5AOMA 4AQ1B 5JPNC 4N8VA 1QBAA 4NZRL 1JGLL 1RIUH 3BPNB 4FLQA 4NLAA 4D9LL 2WJ7A 2P8PB 1MJ8H 4UNIA 5E2UH 5I18H 1AQ8A 2ZPKH 1Z0MA 3RWFB 3QJSB 5DLLA 4F7PB 4NHCH 3VXQA 2CDEA 1YUHA 4Z7QE 5FB8B 5E8DL 3VXPB 2H0JA 4WEEA 4YVNA 5F89B 3MV8A 4WNQB 5A2IH 3C2SA 4R4FH 5EU6D 5IJKC 5DHEA 4YO0A 25C8H 3TF7C 1KNOB 1KB9K 3I6KA 2YBRB 3T0DA 3GRWA 3BPCA 3IDNA 2NR6A 2WSKA 4DUVA 3M07A 3TA4D 5TJWK 5IESH 3RTLA 3DRTB 3FJTA 2FJGB 2CK2A 2Z8RA 3BWUC 1TZGL 3U7WH 3N55A 5HHMD 2E9IA 2B14A 4DP9X 3AMKA 2EXYD 2VDPL 3QZPA 3SDDC 1KV3A 3PNWB 1XF2B 1DUYA 2CQVA 5E2VL 4YLCA 1R3IL 5C0CA 4PJAF 2W9DL 1E42A 2E3VA 3DVGA 4O2EA 1EDHA 2JIXA 4WSKA 2X4RB 4B97A 4ELME 2AZUA 2Y06H 5AVQB 1TTGA 2V17L 4AH2A 1R5WB 3D3VE 3ZOAA 2F7OA 3QIWA 4KK5D 3EOTL 4LU5H 5IJVB 3OKLA 3QXAA 1GHFH 3S37L 3UTSD 4KI5E 4HIXH 4MJ5B 2G3MA 2A83A 3AY4C 4MYPA 2UYLB 5I73C 1D5MA 2APFA 3AW5A 1PZDA 5DVNA 4AQEA 2P8LB 1DQQA 3I6LE 1N6QL 2X10A 1OAZL 5IVNA 1K5NA 5LGKA 4DVRH 3TT3H 1HINL 5E2WL 4XGZB 4XMLL 2ZCHH 3BKJL 1ZA6A 5T1KD 1LL1A 2BP3A 2C9AA 1SXAA 3MBEB 2F53A 3MR9A 3NA9L 4KK8C 3FO0H 4K3HA 4KMTL 1DLHA 4Z7VA 3PHSA 3ETSA 2VXTL 4YPJA 3QUMA 5KYXA 1S7XB 3KL5A 4C83B 1TQCB 2PTTB 2CXKA 1AXTL 2NZIA 4FL4C 1UYWL 1J48A 3OSKA 5DDHB 5I6OA 5EA0H 2QHRH 5KSUA 5I26A 2F61A 1S9XB 4U1MB 1CDGA 3GHBH 4ZXBD 3OKEB 3LKRB 4M62H 5KEZA 3SGDI 1I1RA 5TE6H 3GRWH 3FFCD 3WD5L 1TPXB 3S4SG 3WENA 4NKMB 1KGCD 5DVLA 3QB7C 1DQVA 2DQ6A 5D70H 3PPSA 5C8JA 1A9EB 3RIFK 1OGAB 1WAAF 2PW2B 1INDL 4OI8A 4PJBB 3WN5C 1CGXA 2JE8A 1F0LA 3ILQC 5E0FA 4FEMA 3PV7A 1NLDH 1UXLA 2BP5M 3NFNA 3QAZB 4PJ9C 4ZJ9A 2O93L 2DM4A 2W91A 4P46A 4UTBA 1UATA 4DO5A 1FYTD 3QI9D 1U8MB 5A16A 1V7NH 1NCAH 4V1DD 1LEGA 2JELL 3AACA 4UQCA 4Z5RA 3C2AH 4POYA 3GUTA 3RZCC 1UD3A 2P80D 1URLA 1IFGA 1SXNA 1MEXL 3IKCA 3MXVL 4YX2H 5I17B 2BOCB 4GKNA 2NXZC 5EH1A 1U8OA 4PP1D 2NSXA 4ZAKB 3U36B 4B60A 1S2EA 2ZT9C 1JYNA 4PJAE 4GH7B 1CF1A 3ARED 4HDIA 5EDXA 4IBZA 2APVA 4C8XA 2YRBA 1X5LA 1HDMB 4ES9A 5IBTH 3UBGA 1WISA 4MS6A 2OXHB 4NNXA 5CM1A 3FUKA 2V7HB 4IJ3C 3MZGB 4JM0A 3TYFB 2VLKE 2V5MA 3BKMH 2AK4A 3WKYA 3QUMH 4JFUA 3VFNA 2XTJE 4TNFA 4FQLL 1HQRA 4PRNB 2IDCA 2QQKL 2VDOB 2ZQKA 4XBEH 4QHUA 5JLZA 3DSFH 3HG2A 1PQZB 3ZO0A 4WFHE 2FT8A 3MREB 1P7QB 1EAPA 3MV9B 4R8WH 2B20A 2YMXH 4JLRA 2K8QA 4AC4A 4F15B 4MB5A 4ATWA 3SKNA 3RHWK 3SCMB 1DSFL 1S7QA 3D30A 3CN2A 1EH9A 5CLTA 5F9JB 4K7FA 1IVLA 1QSEB 3VWKC 3QQ9C 1Y18B 2V33A 2LU3A 3PWVA 2C4XA 1P7KA 3P9MA 1K2DB 4OF0A 4APQB 4JR9H 1YUKB 3V0IA 3RU8H 1MW3A 4UTAH 1Z3GH 2YAPA 2J5WA 2CK0H 3B9KB 4KI5C 4NOBA 4GIPD 4UTBH 2HN7B 3VUAA 5JHLA 3P3TA 4A04A 4WTWA 3D25A 2H8PA 5D7KD 5IROA 4PJEB 1AR1C 3BLPX 5ENWA 1IQWL 4NUMA 4M1GH 3B5HA 1HZHH 4GMTL 3FT2B 5BS0A 2IGTA 1WAAE 4NX0A 3T0AA 2DQDH 2XVKA 5C07A 3NSYA 2EEXA 3ZQXA 3DTXB 2YD8A 3DWTA 3IFNL 2NY2B 3KCPB 2X6MA 5JZ7D 1MG3C 4FHJA 4Y1AD 3M1BA 4GRLC 5DC4B 3AMLA 3QEGH 2GC4C 2AC0A 4K8RH 4LEXL 3A3YB 3RWJB 3W2DL 2IDFA 5CEYB 4Y9GA 4DHLA 4KNUA 1WICA 4A2FA 1DVFC 1QKZL 1AHWB 4UQIM 4G7YL 1M7IA 2P47B 3QFDA 1RJYB 4NB7A 1NC2D 4J7RA 4KXBA 1SRDA 5LG6A 2FL5A 4KDVA 1CDJA 3ELAT 3K91A 5IIEB 1HIMH 1IAII 3W3BA 2WWMD 3LCYA 5E5LA 3MV7E 5E1GA 5FV1L 3V5KB 1AI1L 2WTPA 2FR4A 3L3GA 2ZXAA 3PNRB 5LN8A 3UTTD 3K46A 1NBYA 2B7DT 3FCTA 5CINH 3OQRA 3QW9A 2OZNA 4GAAA 2Y3NA 4B9KC 3DOSB 5IMOA 1FGNL 3TZVD 2Q2EB 2KLRA 4R0LA 1WDAA 3TT1L 5IG7A 1JGVH 2CDFA 1GS7A 3A0OA 5E8NA 2K0RA 2AV1A 2ZX5A 3IMVA 2H1PL 1RZ7H 3L95B 1DO5A 1QFUH 2Z93B 3FAWA 4DTGL 4ZFOL 5JHLH 2NYKA 3BX7C 4MJJA 5FGSA 5BQ7A 5MP6H 1RU9H 4R4NC 4RZCA 4FXKA 4MS8D 4GRWB 4ONFH 4IU3B 2QFRA 2E9GA 4ONHB 2GEEA 4XNXL 2J8HA 3RKPA 1B0IA 1J9SA 3ULVF 5DJ6A 2QR0B 4YHMH 3KXFE 3RVVC 2X9XA 1D5RA 2XPGB 5E99L 1YAIA 1YMHB 3BLKA 1U8HA 2OKMA 4L48A 5DD0H 3UP6A 3KPNB 3Q01A 2J6WA 4FQXB 3X12B 5C6TH 3MA7A 4FA7B 1EXHA 4P2OB 5BRPA 2UX6A 5F88A 2XTJC 1VEOA 4XMKL 2I25N 3DYPA 2GTZB 5JPNA 2ZCZA 4X6DF 1A6WH 1MREH 3KS0H 2N59A 4KKAC 4BV1A 3V5HA 2GIXA 3F65A 5LB1A 3ARWA 3MSPA 3UZEA 1BD2B 3CIQA 1BZDA 1VJSA 4LLYA 2DIBA 3LS4L 4HUXA 4WO4A 1VKXB 1JNHA 1ICTA 2X1QA 4FERA 3AAZB 3B8SA 4I8DA 4A38A 3DVNB 4LLAA 1JWSA 1CE6A 2BNQB 2VMEA 3BE1L 4OLYL 4AIZB 4MB4A 2NW3B 4OAWA 2XV3A 3WE1A 5I74C 2VOTA 1U8CA 3BYYA 5FAAA 1M42A 3JSSA 3ARRA 2QDWA 3NIGB 4GYBA 2XZCL 1JVLA 3JV4B 4YBQC 3VTMA 4DW2L 2NOYA 3RNQB 2GAZB 2YKLH 3BJLA 3BH8A 4EN2A 3BVVA 1GAFH 4E42B 1F3JA 5C97A 4PLKD 2KLSA 4LCYB 3QWOB 4GFXA 3SYAA 3ZZ1A 5AB0A 3QUHA 5AW4B 3L5XH 3VFGL 1PAMA 2BNUA 3CZFB 3MI6A 1KTBA 1T20A 2QTVA 3QNZA 3REVB 4PRAB 2Y2TA 5F1IA 4CNIA 1BJ1H 1LO4L 5TFSL 2XXCB 3SPCA 5BOZG 5GRWA 4ODTL 5HVHB 4G8GD 4HWUA 1AKJA 2AJUL 3I75B 5FYLH 1IM3B 3S8FB 1IFRA 2HT4C 4WLCA 2CLRB 5GGQL 4J23A 1PD1A 2YQ2A 4ZTEA 1RZ8A 1JERA 2DQFA 3WFZA 2QQNH 3GBNL 4ZD3H 3L4WA 2R29L 5F72S 1VRSA 2H0PA 5TH2A 2A9MH 3N85H 1ZGLM 3IFPA 4M9OA 5H4ZA 4ONGH 3EBAA 1QTYT 1UOWA 2AABH 2X4TB 1AGEA 1AG0A 1U3JA 2H3NA 2YFOA 5BCAA 3ULVE 4NCC1 3NJGA 3C12A 4GXUN 2Q2LA 2B39A 2IDSA 4PRHE 1A7QL 2DPKA 1FORH 1OM3H 1KGUA 5AUMA 4G1EB 4LRNH 2VR9A 1V55B 5EZLB 2OCFD 5IT2L 3UL4A 3MLXH 1WHOA 2I60H 5D4HA 5JOFB 1JUFA 3AS1A 3TN0B 5FW8A 1L9SA 3ALWA 3QWRD 3QZNA 4HX1B 4IIQC 4IOIB 3SDCD 3SQOL 1KSRA 1NIBA 4X6DE 3ZO9A 5DFTA 1YY9D 4UQ3A 3HAEG 5SWZE 2BC4B 3QEUA 3UTPE 3DBXB 5EEZA 2MQ3A 1O0VA 1I82A 1FCCA 1DDHA 2FT7A 1LE9B 4ZMVA 2GBTA 2YK1L 4F7TA 5E1HB 2HLFC 3OKOA 4RX4D 4OCYH 1CGWA 1V3JA 1XH1A 2OQJB 1ETB1 4J27A 1U21A 3HZKA 3MRIB 4WU7A 1GS6X 4LL9A 4OGAC 4PJ5E 3ULVL 1O7VA 1Q4NX 3ZTEA 3FQTA 1G5AA 3RZCA 3OHXC 3L9YA 5EUOB 1WVZA 4GXVL 3MBXH 3GI9H 1L7IH 1CGUA 3UERA 1AZRA 1BJ8A 1UOLA 2A3TA 3EFDL 1G7MA 4OCMC 2WO2B 3N40F 2YARA 4QRTA 2EVFA 1FVEA 1OW0C 4R7LA 1A6VL 4B9YA 1HEJC 1CL7L 2V7NA 4WGWB 4TRPH 4UQ2B 1IC4L 2VC2B 4M6ML 1W72B 2DLGA 3P0VL 2ZWLT 5FYJH 3ESVF 5HD8C 1F97A 3KPQB 2NY4D 1S9KC 3CVHB 1T5WA 5PAZA 4NZRH 2FQDA 4HXAH 1JGLH 4RGNB 4D9LH 3IGKA 3FT4A 3QWQB 4Y5XA 1GGTA 4OJCA 1G1CA 3NESA 2FX7L 5GRYA 4G80B 4W9GC 4XNUL 2RIKA 2WNGA 4QT5B 4F7MA 3EFOA 1D3CA 3PWPD 3D5OF 3QDGD 5DQJB 1AD0A 1MFUA 4FQIL 1PFOA 1NFDF 3FB7B 4Z7UA 3QRGH 3QISA 3MRLA 2GY7B 2OYKA 2IWGA 3HBZA 4EI5D 4UQBA 3RFZC 3RWIA 5DC0A 3SE3C 4OCXL 1HHGB 4LP8A 4NIKB 3APMA 3TX4A 1TJHH 1TVBB 4A7GA 4LEOB 1MFCH 1J5OL 4LPUA 1UT2A 2FEEI 3O2VL 3O6LH 2YHGA 3IAPA 1WV7T 3FQYA 4ZPVA 4OSUH 3RWGB 3QJFB 3A4DA 2ADIB 1XB3A 2FHCA 1KPRB 1RHFA 4X6BB 1PZ2A 1YDPB 1C1EL 3EJJX 3ULVC 2KH2B 4O2FB 2QQLH 3RB7A 1X7SA 1WZLA 2XXMB 5AVSB 4F2MA 3MCYA 4RBPK 3RNKA 4GRLA 4IU2A 5E1IA 3PQYB 2IQ9H 2M8XA 4NUQA 4RNRA 3D85B 3VFUB 2ESVD 1UKSA 2WW8A 1NZRA 5DHYA 3HCVB 1H6FA 3PL6B 1FP5A 3GSUA 1KJ2A 1OAZH 2EDNA 2G9KA 1IGMH 3ETBJ 3QJTB 4DP8X 3QPXH 1JV5A 4F7CB 1Z9OA 1HINH 2ATKB 3MJ7A 1NM9A 3UO1H 4HMDA 3NA9H 4U6HA 4Y9CA 1U33A 2XN9D 1A6TA 4HKJA 2YPLB 1LP9A 1X5XA 1DQJA 4MNQE 3U4BL 5J89A 1C9SA 2VDRB 3AFLA 2VNCA 1ADQL 3QFJA 1QLEH 3UZVA 3ZIYA 1QSFB 4LFHD 1T0MA 3KYKL 3PS6A 3BPLB 4D0CB 2BIPA 1JZDC 5IQMA 2PYFB 3ABMB 4LCWB 3DARA 4LL1A 2OAAA 4HPYL 3V6ZB 4DVBB 2L7EA 5HGAB 2Q5BA 5I1GL 4P2RD 4X9GA 3HI1A 3DX8A 5ALBH 1CGSH 1MCHA 3UABA 1MPAL 5HDBF 1AZBA 1BZ9A 1INDH 3QEQA 1DJSA 2X0WA 3IJYA 1OCZB 4PJAA 3V0WL 1OEZW 2P8MB 3E2HB 1NFDE 3T4YA 3V95A 5DHMC 4FNLH 1JMZA 1YNKH 2EINB 5E9NA 3STZB 1UD2A 1S4IA 4ELKA 1D2OA 5CP3A 3N91A 2JELH 2OMVB 3HFFA 4G3YL 1ZWIB 4UANA 1GS8A 1SYSB 2AQ2A 2CGRL 3MXVH 4FEIA 1MCPL 2WIIB 1MCDA 1GYAA 1ZV5A 3EBHA 3FQXB 3OGCB 4AV0A 3WNLA 5PCYA 3DHUA 3D69B 3K8MA 4TNGA 5ICZB 1X5KA 1S9YB 1HH6A 5DWUL 3EDEA 5AW9B 2MTPA 3OAYH 1H8LA 1O9WA 4PSPA 5EUKA 3SSGA 1HSAB 3BUQA 1JTTA 5I8EA 3VVVA 4U1KB 5T3XH 3N1FC 3U6RB 2YPVA 3GXDA 2ERJB 5FGCE 5EEVA 4M7ZB 5CO1A 3BVNB 1C16A 2XVLA 4RFOL 4XNZB 1UM5H 3HZYA 2IF7A 5TTRA 1WFJA 2HMID 2QQKH 3S35L 3EJYC 4R7VA 3FQNA 4DGWC 1OHQA 3F62A 3P4MA 1CICB 1Q94A 4A7SA 3GMRB 4X4YA 4QRPE 1K9TA 3K0YA 2X6AA 3QZWA 4RCAA 2GEQA 4EBQL 4L8SC 2ADFH 1KWGA 2ILLA 5D93B 3RTQD 2I9TB 3LS5L 4PRPE 4P57A 5LBGA 1WAAA 2ZONA 4P5MA 5C3IA 1JPFB 5E9DE 4OCWH 4ZTOH 3P4OA 4YN3A 1I1AB 1U30A 3IN2A 1WUNT 3ARFC 3MOBH 4F7EB 4N2BA 4WJKB 1SN0A 3F7KA 3VYOA 3L3JB 2W8CA 4PP2B 3NIFB 4GFTB 1SOSA 1OTSD 3HPLB 4UINL 5DK2A 3DVFA 2W5PA 5CP3H 3BAJA 1N0XL 2I27N 3MJ8A 4JRLA 3S3CB 4N5UA 3UBXA 1V7ML 1BQRA 4KTEH 5HDBE 1NEPA 1EVTC 5FEBA 2FE0A 3I3BA 2W81C 4FQQA 4IGBD 5MEPB 2AEIT 3U7YL 5DJYA 4Z0XA 1FPTL 1UUNA 1W0VB 2QSCL 3IFNH 3MV7A 2QMJA 5I1CH 1E67A 3NJMA 2ZWZA 3WSQL 1WBYB 3DJSA 4X4XB 5CGYC 4U1LB 2W65B 3K8KA 2QMKA 3GINA 2Z7WA 3W2DH 4JFXB 4WJ5A 1AE6H 4D9RE 2EXWD 3L1FA 3DROA 2CBPA 5EOCJ 2Z31C 1MSPA 3KLAA 2YPVH 4PJXB 2DIAA 5CU9A 4EAEA 4ZFGL 5KVFH 1JPGA 5L0QC 5FPIA 5I9QB 1MI5A 4IIQA 3CHPA 1QFWM 2PWGA 5AAWC 4I0KA 5BW7C 3RJQB 4X5LA 5DWPA 3TL5A 5HJGA 1G9NL 4CN1A 5HSFA 4Y7OC 5HYJD 4G83A 1W2KT 3L3KB 1A7RH 1KYOK 4JM2B 4KBPA 4G6KL 1BFVL 3TT1H 2E56A 4FYTA 1PG7W 1AMXA 2FH6A 5C08B 3OGOE 4PGDB 3AM8C 3B1TA 5DJXA 2H1PH 3L48A 3LNFA 5F3HB 9CGTA 1FFNB 2LLGA 1KXTB 4FL4B 1FZMA 4XVOA 3MRDA 4DP4X 1LEKB 1O6SB 2ARJA 3C6LC 3CNKA 1SMAA 1HSBB 1SMDA 1U8KA 4XOBA 1AZCA 1FCGA 4YE0A 1A5FL 3I9AA 4XNXH 2J8UA 3EYVB 1FG9C 2Q3XA 2ZG3A 5K9JH 2BSBA 1OLZA 3FUFA 3HEIB 1BZ8A 1OW0A 5DXWA 3GQFA 4P23D 1NEZG 4UZSA 4WK2B 4P2QD 1KDJA 3QNXB 1YEKL 1CG9B 4J4PA 4KVNL 1E65A 1A3RL 1ZJAA 1H3WM 4PJ9B 5B38A 1NC4A 5GJSH 5AKSA 3RDTA 4O02A 3ULUF 4HWZA 1LJMA 4NZFA 5EBLA 1XGPA 4S2SB 3F2LA 3ZSTA 4FQCL 4O58L 5ESQB 2EZ0D 3EF7A 3MCG1 3WTSA 1IQDA 1BSIA 5IR1A 3KVDD 5GS2H 1ZVHA 3G5VB 3LKNB 3VRJB 5JW4N 4M93C 4NO0D 3DUUB 4TKWA 2XWZA 1O6TA 4AVKA 5L8KB 1MFNA 4JRXA 4I2XA 4O4YH 4PGZA 5J9PA 1CBVH 1A22B 3KPLB 5JHAA 2BSCA 1UQSA 1OARH 2P4AB 3VVWA 1YSOA 3MAWA 1F3RB 1BZQK 5F7UA 4B27A 2HG5B 3V9CA 3RFZA 3OB8A 3SE3A 3C75A 4H20L 4BFNA 4Z7QB 1PIFA 4ZUUB 1XGZA 3ZE0B 2XZCH 5C0EB 3INOA 2VZOA 5J13B 1G9NC 3GMMB 4KQ3L 1ESOA 4EO5A 5C09A 1KCWA 3I3EA 3NAAH 1ZHNA 4FQHB 3DDFA 5JQIB 1WZ1H 1XCTB 2R23A 5ADPH 5IB1B 4XMWA 3BO8A 2QLYA 2H6PB 2FBJL 4KJYA 4D9QE 5AAPA 3TO4D 5IJDC 3MBED 3JTTA 3ESUF 2AXGA 1Q9KA 3FUDA 3K71B 1AS6A 3U0PA 1UD6A 1GZQB 4Y4HA 1XIWC 4I18C 4A2HA 1X6NA 2AJUH 4PRHA 3WKNA 2XY1A 5AWNL 3TTSA 1MHHA 2H47C 2IQAB 4LLVA 4JFDE 2XWCA 4JKLA 1NWPA 5GGQH 1I8UA 3VWKB 3T2NH 2M2DA 3D3VB 3OKDA 1HXKA 3C8KA 1JZ4A 2GJ6A 4JN2A 4O02H 4Q2ZB 3QEHA 1WUZA 5IJBC 5MHSD 1DE4B 5BMFL 2K7PA 2VLRB 3WEOA 4IS6A 2GT9B 4PEEA 3JT0A 3FQUB 3IDJA 1AR1B 1KEMH 3NG5A 4M7KL 4DERA 3L6FB 5EEUA 4JCWA 3QJUB 5JXAL 4JM4H 3ZKNC 1BEYH 4L3AA 5FGRA 5IT2H 4Z7WA 4IRZL 4PY8J 1K4DB 1CPUA 4LASL 3DK2A 5I5JA 1SJHA 1WIPA 3SOBL 5T3ZE 1M1SA 5DJ8B 4DQAA 2VR3A 5JIQA 1F00I 1ETZB 3FQ2A 1KTRL 5CGMA 3ULUE 3CK0L 4PJ5A 5HVFB 2ODIA 4EDXB 3LNGA 3V9FA 3W5NA 4OFDA 4OF7A 5IB2B 1H15B 2WUCL 4K73A 1XHHA 4QRQA 3BWAB 3G6JB 4WFFE 4Y2LA 4MKTA 1BG9A 1QZNA 3LEVL 3W39B 4Y9EA 4F1ZA 2EDDA 2VN6A 1P5VB 4AJWA 1UWXH 3FO2A 4N28A 1A21A 3VWJC 1YZZA 4YXKH 4XVTH 3BP5B 4AQ1A 1JF1B 4JKWA 4PCKA 4Q9BA 2PP8A 3SN6N 1TVHA 2P8PA 3LH2H 5J1AA 3GK8L 3T0EB 2CRZA 3BAKA 4QRSB 1I7UB 3D12B 4GXVH 2A1WL 3LV3A 4NWUL 1ANUA 3BW9A 1NCBL 1KDIA 4HUVB 1ZLUK 3VXPA 4OV6F 2ISDA 4P3DB 1MZYA 1E30A 5T3ZL 4MDRA 3NJIA 1P7QD 2FRGP 1XAUA 4TVPL 4FF9A 1JG9A 2V5TA 2O5YL 3ULUL 4MJ6A 5KYWA 4HWBL 2H2SC 3SCMD 1U36A 2WVUA 3UBFA 4M6MH 3WCYA 3ARBB 3DRTA 2FJGA 3P0VH 5ID0A 2BJML 4L3EE 4MDJB 4XHJC 2YOCA 4APQD 1P4LB 2KI6A 2LT9A 5CAYB 3VFRA 1D5ZA 3QDMB 4KJQD 4QRUB 1GMIA 2CR3A 3B9KD 2EE9A 4FTDA 3RVTD 4NT6A 3GI8L 3DMMC 3U2JA 3FUJA 3BGAA 2FX7H 4G7RB 2QEJA 1VF5C 2VLKB 5JNYA 4HFUL 2F15A 4L8SA 5FUOH 4PLNC 4MZIA 1XF3B 1JZ6A 1AQDA 4FGMA 3OMNB 4NQCE 2BOBA 2XTJB 4WI4A 4AOFA 1IL1B 3Q5OA 3UFIA 4TQIA 3R8QA 2AEWA 2WVSA 4WDIB 1TQUA 3MYZA 3E9TA 4QHPA 2NY2D 5HY9A 4IQHA 3CSFA 4XVUD 2ZG2A 5HHNA 3D39E 8FABA 1CFTA 2JK5A 1FE8H 5EU3A 3ZDXE 4NPKA 3O2VH 1Q1JH 1MWOA 4H1LG 1ZS8A 2ZXQA 4XGZA 4JFHD 5M7QA 2VLMD 3C5SB 3O45A 4FG6D 4K23L 2Z8WC 2R0ZH 1VFBA 4KFMA 3N1MC 3QGVA 4R6UA 3ABZA 2R2EB 5CCKL 4P2CG 4XP1L 4N2HA 3P02A 2BIMA 5C0DB 4O2CB 1YEWA 3CHOA 3SO3C 3FU9A 5ECGA 4ZQKB 3IDGA 2OPCA 3LOWA 1S9XA 2RGSA 3KJ6L 3NFPA 4KUCF 3C6EA 3ZT7A 1CQYA 4KITB 4YL4A 2ZXEB 2QV4A 1XGQB 3FB5A 5KSAA 1BBJA 3HJEA 5I2IB 1YPZF 1EHLL 1OGAA 3N2JA 2PW2A 4L1DA 4PVMA 5CUSH 3OC5A 1D7BA 5CU5A 5K39B 2WN2A 2JXMA 1N8ZA 2DRUA 2HJFB 3L3DB 1N26A 4N8CH 4KKBD 1CFQB 3OXSB 4TS6A 1KN2L 3TA3C 5AAWA 3U4BH 5JIIA 5BW7A 1ADQH 3B9AA 4B41A 3QCUH 1JZ8A 3Q2NA 5HBBA 5CEZD 4X5XA 1GPOH 4PYGA 4EZKA 3CZGA 3KYKH 1NFDA 1QHPA 4XNYL 3SKJL 4ODXB 2YAQA 4U1IA 5FHAL 2BVPB 3UIZA 3KM1A 5ADOL 1M05A 2QBWA 2MPAL 2PETA 3Q7JA 4ZAKA 3T0VA 4FQXD 4HEME 5E7FA 5JYLA 3VD7A 4P2OD 3HC4L 3LVEA 4K71C 4YDVB 5IEHB 2I24N 3MRJB 2KZKA 5E94B 1XF5B 4ABWA 1L0QA 2CIKB 1FHGA 3BMWA 4H13C 3C6LA 3GEFA 4G6AC 4KUZH 1INEH 2E8YA 2DMGA 3C5JA 2XCMC 1BD2D 1GC1L 4Q6IC 1ND0A 2GW5A 1QFHA 1FIGL 2WWNA 1UEMA 4NAJA 5EZJB 1Z5YD 2BNQD 2NRDA 2EDLA 2VDLB 2B08A 2GJZA 4AJVA 3MV9A 5BUGA 5L4IA 1OGSA 3KXFB 1VCBC 1HCFX 3Q9PA 5FR3A 3AXLA 2HFEB 3LDBC 1GTFA 3F6JA 4AGLA 1UXSA 1TZHB 1QSEA 5IM7A 2XQBL 3OKMB 2J4WH 3FMGH 1IIKA 2WOBA 3OHXB 2X1PA 4RWHA 2YUWA 4YL9A 1Y07A 4NOFA 1Z32X 3WGVB 5E9DA 1M7DB 3SY6A 3S36X 3NZ8B 4XWGH 1S7WA 4HXBL 4FFYA 1AIZA 1W0WB 3CHQA 3N50A 4RFOH 3BIKB 5I5RA 1XXDC 1OT1A 2WLNA 2O61A 2O5ZL 2EXSA 4MA3B 4PVNA 3OTTA 3P9WB 1YPZE 5ABDE 1T22A 2WNWA 1IM3D 4PGEB 2X1OA 4HIEA 3HFML 4GQ9H 3S4SB 1X5IA 1ILUA 2YGOA 4MQXD 3QA3B 2CNZA 5D71L 4EKJA 4HISA 3KYNB 4V2CB 1D9KA 4AG4L 4KO7A 4FJZA 4DQOL 4N68A 4ICWA 3BESR 4AYFA 2YUVA 1L9OA 4LSQH 3JWOL 4TTDC 1F6FB 5C0RL 1QLFB 4TF4A 4I18A 4JB9H 4QTHB 2AGJL 1IZJA 3I2CH 3U0TA 4UINH 1F6AB 3C87A 1JNLL 4ODVH 2OYLA 3BD4A 4J3OD 4C56E 1U8NA 2CKBL 2WNXA 5E6YA 3TN0D 3ZE1F 3LZLA 4XX5A 5JOPD 3X14A 1GC1C 1RH8A 3VTAA 1MFVA 2AEQL 4HFWA 3U7YH 2ZKHH 4N6QA 1WCQA 2ZYIA 1FGVL 3GIZH 4XAKD 1J0IA 1MELA 3DTDA 1QFOA 1QLRA 1G7JB 5G2NA 1J88A 1T7WA 1KGXA 2IH3B 3DOSA 3Q1EA 5MI0B 3BD3A 3NCCB 5J57B 3BZEA 1NAML 1YNTA 2YMOA 1KCUH 4WWKB 3FUHA 1EVUA 1K8IA 4KJWD 3V79C 5CJ8A 1NDMB 5AW7B 4ZFGH 2DQUH 4UQDA 4FFYH 4LAQH 5CN1A 3VFMA 2L0DA 2YWYA 1CXEA 4JANA 1TOXA 2IADA 4NC0B 1S6NA 5KN5A 5EEYA 5GJTH 4P4KC