1JZEA

Pseudomonas aeruginosa azurin ru(bpy)2(im)(his83)
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
128
structure length
128
Chain Sequence
AECSVDIQGNDQMQFNTNAITVDKSCKQFTVNLSHPGNLPKNVMGHNWVLSTAADMQGVVTDGMASGLDKDYLKPDDSRVIAHTKLIGSGEKDSVTFDVSKLKEGEQYMFFCTFPGHSALMKGTLTLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords azurin
publication title Electron tunneling in single crystals of Pseudomonas aeruginosa azurins.
pubmed doi rcsb
source organism Pseudomonas aeruginosa
molecule tags Electron transport
total genus 32
structure length 128
sequence length 128
ec nomenclature
pdb deposition date 2001-09-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00127 Copper-bind Copper binding proteins, plastocyanin/azurin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 1jzeA00
7PCYA 2EIJB 2H47C 1PCSA 2UXTA 3AY2A 4HCGA 4DP9X 1SJMA 4A66A 1JZHA 1PLCA 1JZJA 3FSAA 3TASA 4E9TA 4BXVA 2PPAA 4N4YB 4EF3A 3QJUB 1ASOA 1WA2X 5F7AA 1J9SA 4PCYA 2MTAA 1PLAA 2YAQA 2IDUA 3FPYA 2ZONA 5EHFA 4ZK8A 4HHGA 9PCYA 2CJ3A 2VM3A 2PPFA 1AZNA 3QJVB 1M56B 1ASQA 3QJTB 1PZCA 3BQVA 3IE9A 1B3IA 3FYEB 4KO7A 1AZBA 3N2JA 1OCRB 3D12B 2VSMB 5B1AB 1SNRA 2HZHA 2ZOOA 2W8CA 2XXFA 3OMAB 1J5DA 3GXUB 3FPXA 1GR7A 2HX9A 2IWEA 3AG4B 1HAWA 3N55A 1A3ZA 3CZUB 3SBPA 5B7MA 4BDVA 1QNIA 2UXVA 3GYRA 3FU7B 3NP3A 1NICA 2QPDB 4DP8X 4ENZA 3MBWB 3ASNB 3PPSA 4HAKA 4AZUA 4DP4X 4F2EA 1VLXA 1GW0A 2Y1AA 1L9QA 2YAOA 2LLNA 2HRHA 2HX8A 2J5WA 3T6WA 4YSTA 1AACA 3UACA 2CAKA 2FQDA 4DPCX 5D4IA 4A2GA 3NJNA 2FNWA 4DPAX 1OE1A 1OOWA 2IH8A 3UAEA 3WKPA 3ZX1A 4L0PB 4BWUA 1AIZA 1AZCA 4YSOA 1WAEA 2AANA 1X9UA 3EF4A 3S3DB 4CSZA 2IDTA 3KW8A 3PAVA 1ILUA 5FC9A 4A68A 3ABMB 1FA4A 2AZUA 4F7KA 5TK4A 2VM4A 2UX7A 1BQ5A 1URIA 2YARA 1E30A 1F56A 1WA1X 1A8ZA 1AS8A 2TSBA 2QT6A 3FSVA 5I5JA 1PAZA 3DIVA 2I85A 3FQYA 5B7EA 1CYXA 3FU7A 1RZQA 1SHXA 3S8FB 3U25A 1AR1B 3AG3B 1NPJA 1NIFA 1PLBA 1OE2A 2AZAA 1A4BA 1KDIA 1BXUA 2IH9A 3WKQA 1JZFA 2BP0B 3QJQB 4A2EA 4GXFA 3AW5A 2ZXWB 4DPBX 3EH4B 2P80A 1UATA 3QQXA 5E9NA 1KGYE 2JXMA 2VW4A 4F2FA 3NJFA 2YAEA 4E9XA 4MFHA 2I7OA 3CDZB 3WNJA 4YVNA 1ET7A 1NIDA 2FT7A 5B1BB 4AX3A 4K9JA 1ID2A 1XB3A 1AZRA 3NSYA 4UANA 2AVFA 2PPCA 2QDWA 1W6LA 1RCYA 2XU9A 2CUAA 1KCWA 3AG1B 2VW7A 3JT2A 2MRYA 1ADWA 6PAZA 5I28A 3ASOB 3NJHA 4N8UA 2FTAA 2R7EB 1L9PA 1IBYA 2IAAC 1OV8A 1PZBA 2EIMB 2IWKA 2N0MA 1QLEB 3IN2A 3UAAA 1AZUA 4A2DA 1ZDQA 4YL4A 3PCYA 4GP8B 2VW6A 2DWSA 5I6MA 3X1BA 4DP6X 1JERA 4Q8BA 3T6VA 4RH4A 1ZIBA 1NWPA 1R1CA 4BWWA 1BYOA 1RZPA 4YSUA 3QPKA 4KOCA 5D4JA 3NJLA 2A3TA 3IBOA 3NT0A 4G7RB 4QLWA 2BP0A 3JTBA 1J5CA 1PNCA 2YAFA 1ET8A 4KO5A 4AKQA 2XV3A 3EH3B 4YSSA 7PAZA 4UAHA 1M57B 4BXSV 4JHVA 1KYAA 1JOIA 5IY5B 1ZDSA 3G5WA 1GS6X 3CVBA 4KNTA 2BHFA 2BW5A 3ZIYA 1E65A 1L9OA 2GIMA 2YQBA 4YSEA 2PPDA 1OCCB 3DTUB 3GDCA 5I5MA 3NSFA 5AZUA 3FSWA 1ETJA 4YVUA 1A4CA 2BZCA 2GI0A 1TEGA 1V10A 4WTQA 1TEFA 4QKTA 4DP2X 4JKNA 3WI9A 2P80D 3IEAA 3AZUA 2JFCA 4AKPA 1NTDA 2HX7A 2Y69B 4KO6A 1J9TA 2DY2A 4G71B 1N68A 1TU2A 4HCIA 1BQRA 5I6LA 1CC3A 3H56A 1HFUA 5PAZA 1AANA 1QHQA 4YSPA 4YSRA 4E9YA 1NIEA 2XX0A 3SQRA 1JXDA 2H3XC 5D4HA 2PP9A 3WG7B 1L9SA 3OQRA 4P5SA 5AFAA 1AG0A 5PCYA 3QJRB 2XV0A 2YXVA 1AQ8A 2I7SA 4GP4B 1RKRA 2HLEB 3FYIB 1JXFA 1ZV2A 2Q9OA 3TA4D 1YLBB 2W88A 2B3IA 2IDSA 1PF3A 3WIAA 2HRGA 2ZWNA 4DP7X 1J9QA 2H5UA 3ABKB 2YAMA 3EHBB 4P5RA 4WKXA 3UABA 1A65A 5B1KA 1GSKA 4KNSA 2GC7C 3CG8A 2QDVA 3FU8A 2XWZA 1WS8A 1JVLA 2WO2B 3UGEA 2DV6A 2VMJA 5I6KA 1HAUA 2XLLA 3PLYA 3ZBMA 5I6OA 2PCYA 3C75A 1SF5A 3KW7A 4YSAA 1AG6A 2QPEB 3V9EA 1A4AA 1CUOA 1NPNA 1OCOB 1WA0X 1AS6A 4UF7C 8PAZA 2DWTA 4HZ1A 3V9CA 2UX6A 1IBZA 1WS7A 4BK5C 2EIKB 4BWTA 3ABGA 1CURA 2GB2A 3T6ZA 2FT6A 5ANHA 1NDTA 4GY4A 2HXAA 1E5ZA 1L9TA 3BVDB 1GS7A 3FS9A 2BZ7A 3NYKA 3NJIA 1BQKA 1BXAA 5I6PA 3NJGA 2IDFA 3DKHA 4AI7A 1PY0A 1KBVA 2AFNA 3OMNB 1DZ0A 2OCCB 2XUWA 3NJKA 3NP4A 1NZRA 1SFHA 1ZIAA 3FT0A 1MG2C 4JHUA 4W1TA 4AKOA 2NRDA 4A2HA 3S3BB 1CYWA 3OD3A 3NSDA 4X4KA 2CBPA 1W6WA 4HHWA 3NJJA 2BWDA 3FSZA 4PAZA 2FQGA 4G7QB 4BDVB 1E67A 2BWIA 2J55A 2EINB 3HB3B 2YXWA 3FQ2A 1AS7A 3QJSB 1X9RA 1FWXA 1NIAA 3S8GB 4M4RB 4M3HA 4NERA 1BYPA 3X1EA 1XB6A 3T9WA 2EILB 1I53A 2GC4C 2CCWA 1JZIA 1GYCA 2XYBA 5F7BA 3NSCA 4G70B 4DP1X 3CDZA 1FFTB 2OV0A 3PXLA 2WO3B 2WSDA 1GY2A 2DYSB 3NJMA 4HIPA 3ABLB 4HALA 5B1JC 3SBRA 1M9WA 2XX1A 3X1FA 3H4HA 4YSQA 3FQ1A 2FT8A 1JZGA 4KO9A 1MG3C 2R7EA 3FU9A 3TBBA 2J56A 5B3SB 2E86A 4YSDA 1AAJA 5AKRA 2PLTA 2XXGA 3EH5B 4DP0X 1J9RA 1XMEB 1IKOP 3S3CB 2FQEA 3HEIB 1NWOA 5I6NA 2X88A 6PCYA 1AOZA 2FJSA 2XVBA 4GP5B 1MZZA 3IN0A 1SHWA 2GHZA 2BP8B 5B7FA 1IC0A 3PAZA 2FQFA 1SDDB 4FAAB 2UXGA 2X87A 2BO0A 2YAPA 3OMIB 3T6XA 1ASPA 1MDAA 1MZYA 4E9SA 1SFDA 2JKWA 3H4FA 1EZLA 5A7EA 4E9WA 1TKWA 4DP5X 1PMYA 2VSKB 4G7SB 3OM3B 4YSCA 1KV7A 2CALA 3WNIA 2IDQA 2IWFA 4W9ZA 1ZPUA 1BAWA 4E9QA 4KNUA 2PPEA 4TXVB 1OF0A 1GY1A 1JZEA 1KCBA 1PZAA 5I26A 1V55B 1JVOA 3SBQA 2TSAA 3ERXA 4KOBA 4E9RA 2UXFA 4G72B 3PAUA 4CSPA 1OE3A 2OJ1A 2J57A 1PNDA 4FA7B 3CVCA 1L9RA 5I5IA 1JXGA 2XV2A 2BP8A 1ET5A 3L45A 2DYRB 1SDDA 2PP7A 1BXVA 3TBCA 2B08A 1OCZB 1V54B 2BW4A 3AG2B 4HCFA 1T5KA 3RYMA 1ILSA 3TU6A 1KBWA 2Q5BA 2GSMB 1N70A 2GBAA 3UADA 3MX0B 4NAJA 3T71A 1SF3A 2YAHA 4A2FA 5B1JA 1DYZA 1IUZA 4NB7A 2PP8A 1NIBA 1BEXA 4E9VA 2VN3A 1EHKB 1W8EA 4Q89A 4A67A 2PCFA 3X1NA 1KDJA 5TK2A 1E5YA 1NINA 2RACA 3CVDA 4GYBA 3X2QB 1XB8A 2FWLB 3ZDWA 1GS8A 3X1GA 5LDUA
chains in the Genus database with same CATH superfamily
1RIHH 3RRQA 3RWGB 3C5JA 3IDXH 2ENSA 3FN3A 3JWDC 1IAIL 4FKHA 3MLRL 3SHSA 4ACPA 5J6GB 1JDAA 1PLCA 3VU2A 1GOFA 2NNCA 3RIFK 5BO0D 1X4YA 3UGUA 4KRLB 1JPGA 4Q14A 4BXVA 4CJ0A 2YRLA 2WCGA 1JK9A 3CFBB 4LEEA 2I9TA 1WA2X 2VJ0A 2ZXEB 4P23A 5H35B 5AVRB 4R7VA 2NY7H 1QSZA 3VD3A 5LJYH 4K3DL 5I8KL 4JFUA 4ZK8A 2WC7A 2XZQH 3VNZA 4LCIH 1JZ8A 4S10A 2MSPA 1YYLL 2O6FA 5CMAA 4HGWB 4JHWH 4OM0H 4RMQA 3RTQC 2G75A 2PPFA 5IFHL 3PQYE 4G9DA 2RR3A 5T8IA 4BRJA 3VH8A 4BFKA 5MP6L 2X44D 1ED3A 1X5MA 3LN4B 4PWIA 3DX3A 2ZOKB 3RTLA 5IT2L 2NZ1A 2EVFA 2ERJC 4RA3A 5DRNA 4A7VA 3GXUB 1FNGB 1HE8A 2BIOA 2EDYA 3IRCA 2HX9A 3UTPE 4BCZA 3CXFA 3HS0B 2V2XA 1KIRA 3D07A 4YC2B 2WWKT 3OBAA 5GRUH 1PZ3A 3FB5A 1INEH 1AR2A 3NCWA 1XT5A 4LSSH 3V7AE 5IJVB 1MREH 1KULA 4AYDC 4JFEA 4DP8X 4ENZA 4LHUA 3QWRD 4WO4B 4YLQT 4Z7IA 12E8L 3H9HB 3H7LA 1KN4H 4JRFA 5C0GB 4KZDL 2PR9A 2E5EA 1FV1B 2FLMA 1R3JA 2NTSP 1CFSA 3ARDD 3PUUA 4ODXB 4U1GB 1H9DA 3DWTA 4G6JH 1DBBL 1GGUA 1ITBB 1QAWA 1WBZB 1ZHNB 3MKKA 4BWUA 3MJ9A 4A63A 1UQSA 3EO1A 2DH3A 4U1NA 1A6WH 1AIZA 3H8NA 1AZCA 1GGBL 1FBIL 2YIHA 5IOPB 3VDCA 4OTXH 2X9XA 4JRXD 1DVXA 1M6OB 5JXEA 2BFGA 1BQLH 2HJKA 5TK4A 2PWGA 4XMUA 5JLZA 1WC7B 5L2KE 3PHOB 4KH2A 3L3IB 1UWYA 1IM9D 2V37A 4TKWA 5FYKU 2KERA 1PKOA 2MOVA 1A4KA 4IK7A 3CDYA 3WNOA 3U9UA 4NKMA 2G5BA 4B3VA 3CFKA 1RZKL 2VR6A 3TNNA 5GZNC 1PLBA 4U1HA 4FG0A 1KFGA 2EVHA 5KYYA 2WXRA 3X13B 1KDIA 4MB4A 4UT9A 3BWAA 4HOMA 1NBQA 5FGSA 1PDKB 3SDYL 3HPLA 4NC0B 4MXVF 4Z7QB 2OI9B 2X89D 5IBUB 4HPHA 1ZPLA 4GRWF 1FZJB 2HTKD 5FA3A 4IYKA 3P4MA 1KGUA 5KVEE 4MQ7A 4JDZA 1YNKH 4N0RA 2LVEA 3QIWB 4L3FA 4BELD 4J5VA 2R0WL 4PS4H 2F19H 1KTDB 5EOQH 4NN6B 3K3QA 3RE0A 1XB3A 3LV3B 1IT9H 4OCRL 5C0RH 5CJ5A 4KZCA 2ZZUT 2QPFA 3CFCL 3H2WA 3O9WB 1TLMA 1DCEA 1EH9A 3G5XB 3U4EA 3HAEA 3QFJB 5B8CA 1D5ZB 1KIPB 4XP9H 4K23H 4WV1A 4XNDA 3PF2A 2KKQA 1A4JB 5AYTA 4R7DB 2H45A 4P3WA 3RU8L 2R1WA 5HGBA 2Y6TE 3TN0D 4AIZA 3U0PB 1BQUA 1AZUA 1MELA 4HC1H 4JY4A 3UO1L 2B2XH 4GP8B 5KSBF 5TGBA 3HVDA 5DA4A 5IP4A 2X6VA 4Y4KA 1EO5A 4F8NA 1EFQA 2H0JA 1GYUA 1X6NA 2AJUH 3GS7A 1HXMB 5D4JA 1MJJA 4FMVA 2KPNA 3AREC 4YHMH 2GW5A 4O51B 3DJRA 1NSNH 2BRQA 1E9OB 5FA4B 3LB6D 1IQWL 3HG3A 1NAMB 3V55A 3UTQA 2WIIB 3GJFH 3MCLH 2MFNA 3SDXE 1B4JH 3NZSA 5ID1B 1F5WA 4JUSA 5F93C 3QORD 2F74A 3F58L 4Q9CA 4MJ5B 4RAVB 4XXCC 2V8LA 5EZIH 3P73A 3U6XA 4JQIA 4X8JB 2W65A 3T65A 4TNEA 3FCGA 4NI6A 2JSFA 2EUXA 4CRPA 2Y69B 1E43A 1DDTA 1HC1A 3H3PL 3I9GH 3TYFB 3PRZA 1FPTH 1TOXA 5F21B 2DLEA 5DJXB 3NQKA 5EZOL 4BV1A 4MDJA 4PVNA 4KITB 1ESOA 2D7OA 1CDUA 1AANA 4CC4A 1XAUA 1X9LA 2ZXGA 5KVEL 2P49B 3HAEG 5G5DB 3MXWH 1ZV9A 5BOJA 1L9SA 1SHSA 4KXDA 3SE6A 5DEGB 4A6YH 1E6OL 5CD5C 4P2OA 5AVXB 1TUPA 2YXVA 3DROA 3KPNB 1IVLA 4MBRA 4U3SA 4AYEC 4C4KT 3B2UD 1T7VA 3QUMA 5F0PB 3UTPD 3JV0A 1GAFL 2AEPL 3MRRA 3WIAA 3B9VA 5D96C 1MHHA 3FQWA 4DTGH 3HHSB 4OGYL 2OMYA 1G6VK 1WAAE 2I9LA 3FMGH 5DRXB 4WFHD 1ZJBA 1KSRA 2GK0B 3VFOA 4PRPB 5EOCH 3GZOA 3SJVE 2DWDA 4YFLF 4URKA 1KJVB 4OUUA 1DSWA 4G6FB 1QQDA 3T77A 2XZAH 1SJEB 2IPTH 3C6EA 2YGVA 4ADJA 4HK0B 1F4WH 4X6CF 3ZRSA 2CWRA 4DGVL 5GS3A 5FEBA 5LGJB 8PAZA 5IB1A 1CF8L 4N22A 3ARFC 5I0WA 5C9KA 2V17H 3BSZH 1G9EA 5E6UB 4QYOB 2WQUA 3QEGL 3SQBA 1E4XL 5I23A 2XV6B 4JZJC 3IRZA 1N0XL 1GVIA 1OM3H 1B0WA 5F6IB 3G5ZA 1YRKA 1IC1A 4WWKC 1SEQH 1A6AB 2ZE0A 4WUUB 3V6OA 3ALPA 3W3BA 2OMUA 1NDTA 5F7UA 4ZDHB 1SM3H 5F7YC 3BISA 3O41B 1P7QB 2MIZA 5KOMC 3I74A 4DZ8B 3RURA 4PJEF 3E6FB 4UQAA 2ITCA 3VA2C 5IUCA 1CFTB 5A2BA 2R69H 4GBXA 1F4XL 3LQAH 1IBHA 5DZOA 1YNTF 1U8LA 4PJHF 1LE5B 2VQ1B 3TLRA 1I8IB 4XRCA 3QUYA 2EH7L 4FKEA 1NMCC 3L3KB 5GRVK 1KGWA 1UGNA 1A6ZA 2YUZA 5BS0A 1N0LA 1J87A 3MMEB 5L2KB 3ZKSD 4GIPD 3MAWA 1RZIA 3CQFA 4FI8A 2JJTC 3MREB 1LO5A 3GXMA 3U9WA 1QRNA 1RP9A 2E7HA 2DOCA 4XBPA 3ZQXA 4AQ8A 1S9XA 1IAIH 4OLZH 1G1OA 4OY9A 3MLRH 4BFNA 2Q0ZX 4GW5B 5ILTL 1KENL 2TRYA 3FU5A 2VDNL 1UACL 1BZ8A 1XXFC 1OTUC 3QRLA 2WYTA 4FABL 2DEYX 4G59C 5SWZB 3HR5A 4KJYA 2WTOA 3GKWL 2H32H 5IBLD 3C5SA 1GYCA 1J0YA 2JK5A 3PWUB 3F7PC 1NBZB 3RL1B 4DP1X 5C0ND 3E6HB 1YYLH 4PJXE 2VLJA 5IFHH 4ZUVA 2XPYA 3APCA 5JOFA 5MP6H 1IL1B 3PP3H 3RB5A 3WFBL 3T4AC 1AGCA 5FDYA 5JOEA 5IT2H 3SOTA 2EDBA 3HE6C 4QHUB 3QDAA 1QBMH 4TOYL 5KG9B 5F7KC 3TBBA 4AW7A 4PJAF 4ELMF 1UENA 2PMZA 4OF8A 4J6RL 1HL8A 3DUSA 5DC0A 3SY0A 4BFIB 3PPEA 3EH5B 2X4PB 2OYPA 4DP0X 1R5VA 4PJ5B 4WHYH 1TPXC 4ETQA 3LY6A 5C6TL 3TCLA 4JJOA 4M8UA 3WN5B 5CBEA 2P5WD 4M43H 1UXSB 4GRMA 4PWEA 4ZUSB 3U83A 5ICYA 5KBLA 5C6WH 2P3YA 2FIRT 1PZ2A 43C9A 4UT6L 2AXGA 2WIMA 3OKEA 3QT2A 1CD1A 4OGXH 1OY3B 3OMIB 3K2MC 1N59A 3L4WA 4M6AA 2X2IA 2W92A 2YC1B 3FCTA 1ZLUH 3VGAB 1RUAL 2BNQD 2VSKB 3RWJB 1DBBH 2JWYA 2UUDH 3JT0A 4YDMA 4O02B 1S7VA 1NDGB 1OSYA 4MRCA 1G1KA 2CO2A 3AWGA 4F8OA 1G7PB 5AUMB 3Q8CA 1FRGL 2QZQA 1U8QA 1GGBH 1FBIH 3O8XB 3VFTB 1OF0A 3CFIC 3QCVL 2VDKH 1OQOA 1BOGA 1F1DA 1JZEA 2WUCL 4JFYA 4L4TB 2AKRA 1V55B 3IAQA 2FSEA 1KTLA 1BCIA 1MY5A 4JFEE 5MI0C 5C0AB 4WNSA 1HWGB 1C16A 5D6DC 2ICWB 4UM9B 1NBVL 3T0EA 4Z7OF 5KSAB 1BZ7B 4OFPA 1ZE3C 1WZ1H 1GZHA 2B59B 2YS4A 3QG7L 3GSXB 3JV6B 1O9WA 4Y1AD 5B21A 1QWUA 2X05A 4GQ9L 3P4OA 2J6WA 3MYJB 4K5MA 1BGXL 1RZKH 3OLEA 5D7KE 4F2MB 5KZCB 3PGDB 2OR9H 4CGUB 2BVEA 2X4QB 2N59A 3GBML 1OCZB 2BW4A 4XPTH 2XWRA 5GGSB 4XPHH 2A4EA 3NFPA 3POHA 5ERWB 2VABB 3CFJA 2PO6B 3GHBL 1X5YA 2GSMB 5DHVB 5FO9A 4JFXB 3UH8A 4AH2B 2OMNA 4GAYB 5E4EB 3O2DL 2CD0A 1HT6A 1MXDA 2R2HB 3D3VB 3P2DA 4V11A 1XMWA 4UNVA 3D39B 4Q89A 3C5ZC 4KBPA 4XE5B 2CLVA 2CK2A 2XG5A 2R0WH 4NNYB 5J4MA 2ITDA 5MEOB 1UOWA 3K4AA 3BUIA 4I1NB 2HRLA 3ZDZB 4JDTL 1MNUL 2UVFA 2WCSA 5EEWA 4JMNA 1U3JA 4RLDA 2AABL 4F91B 2BH0A 5C92A 4MNHA 3VSQA 5DJYA 5EUKB 4JGNA 4F7EB 3ARRA 3RU8H 4TRPL 5DC9B 1DL7H 4FQXD 5C9JB 3UO1H 3LKPB 2HPOA 1MCWW 4D3CL 4C4BA 3PXJA 4LVNB 1XZ0A 2I5YH 1BX2A 2IDUA 5F71A 3ULAB 3RVTD 4P3DB 4LKXB 2F54B 3DECA 3MPCA 2H9GB 2XFXA 4IRSC 3F05A 4PJCA 2X4RB 4NPKA 5EN2B 2HJLA 3IPFA 1UADC 4TSAL 3GTNA 1IQWH 2YXFA 1QVOA 3THMH 2NT1A 3LHPL 3EJYD 4Z0BL 3N2JA 2YJLA 3ZR5A 1AMXA 1DBML 3K1KC 3L4ZA 2HT3D 4HS6A 5AOJA 3P3SA 5IQ7H 4G1EB 1IEAB 5IJKC 3AB0C 4ZNCD 2ROXA 3S5LG 2GJRA 3F58H 3MTRA 5ABAA 1J12A 3BIKB 2WYZA 5CLTA 3IETB 4PB0L 3SDAB 4AK2A 4EI5C 1KJ2B 3DBSA 4L1DA 2I60H 1LEGB 3O3UN 3IXAA 3MJ9L 2CO7A 3NCJH 4GH7B 4QAMB 5GGRA 5T1LD 2FWOB 2ZXBA 5GGQL 2RQEA 2Z91A 4HIEB 3P2BA 5I8EA 5HJDA 1TJHL 3NFSH 4W4NA 2H26B 1CD0A 2IGLA 4OFIA 1AR1C 5KVEH 2WB7A 2X7LA 3O0RL 3O3DB 3ARPA 3OLIA 1BBDL 1T7YA 2OQJA 1BREA 2CPCA 2O72A 3KLQA 2G9KA 3II2A 1E6OH 3IU3A 5E2UH 3K6NA 3N06B 2X3AA 2FECI 3PL6B 4YSOA 1J0HA 4JFOA 3GWJA 2AANA 3EF4A 4AYBA 3VXPA 1BJ1J 4WI4A 1GAFH 4P23D 1DR9A 2AEPH 3UTSE 3QARA 3TWCH 1IARB 1LK2B 2HLFD 3GSOB 3DRTA 4UT9L 4N85A 2EYRA 1BFVL 3C9NA 4IJ3B 2APVA 3P40A 1OKEA 5DJ6A 5EWIL 2P8MA 5I5JA 3D30A 2EDJA 1T2JA 2I85A 3OF6D 4MS6A 5GGVH 1JTTA 3IGFA 1KGCD 1RK1A 2XT1B 4N0UA 3ALXA 4NFBA 1T1XB 3RZCB 5IHZB 3M7FB 2B4CC 1XGPB 2CRYA 5JA9A 5E1IA 1NPJA 2VXUH 3VRLF 4DGVH 2JQMA 4W9EC 3FONA 5DHYA 1CF8H 1A4BA 1DBKL 5HJ3A 5HDRA 2F15A 4IIQC 1AXTL 1SLUA 3QCTL 3QEGH 3VI3B 1HHHA 4EVNA 3Q6FA 2PTTB 3EUUA 5DD0L 5J11B 3FQRA 1Y6KR 3QQXA 3L4YA 2CQVA 2Q8AL 4C56A 4YBHA 1VZHA 5D1QB 3ISRA 4GRLD 4Z3EA 1JJUA 4LHUD 4M6NL 4JEGB 4MZ3A 1GOHA 4E9XA 3ILQC 4WI9A 3WNJA 2NCMA 4P59H 4GW1A 4M5TA 3HMXA 4CUCA 1A21A 5KS9B 1NC4A 2YKLL 2XJKA 5GSVA 5B4MD 3OAZH 1BQHA 3EGXB 4GEJA 4Y16C 2EH7H 5IMOA 4O2EA 1FIEA 1MN4A 2FTAA 1UGKA 2RCSL 3OL2A 1L9PA 4ANVA 1TIUA 1KEML 1XVSA 1WBYA 2Y2WA 1ZT7A 2HN7B 1KYUA 5MERA 2IXQA 2BCKB 5AVUB 4QY8B 5BVJB 4LPTA 3MLYL 3X1BA 4WEMB 5FUCE 1F90L 1K8IA 4L8BB 2KLTA 2XBTA 4JQIL 4XZUB 5ILTH 1KENH 3FHAA 1C5DA 2A83A 1UACH 1XGRA 2B1AH 4KKAC 4RCAA 5D6CB 5AEAA 3RAJL 3V5HA 3EG9A 3BT0A 3HG1B 3ECBA 3MGTB 3BWUF 3QQ9D 4NQTA 3GKWH 4CVXB 3O2WH 4UT7L 1GS6X 3UBXG 4HUWA 4KNTA 3MLSL 3FT2A 4XMTA 4XOEA 1A7QL 3BWZA 1U8PA 3SDDB 4NO0A 2WVSA 1HDMA 1LP9A 3BQUD 3CZLA 3C6LC 3GDCA 2P1YA 3AUWB 3AQYA 4BSVB 1H3TA 2BOCA 1JDDA 3BX7C 4IU2A 2X12A 3BZFB 1VCAA 5EBGA 3W81A 3AACA 3RWGA 3WFBH 3NIGE 1A02N 2ATKA 3WELA 3T0AA 1F6LL 1OP3H 3K91A 1XH1A 3RGHA 2HLAA 3TO2B 4GUCA 2HX7A 2CLRB 4TOYH 5G2NA 4ISVA 4PRHA 1S7XB 4OF0A 2CR0A 3MRNB 3IDJB 4L8DA 3CFBA 4J6RH 3QG6B 4PJFA 4AWJC 4NQXB 5AZEL 3TA3C 5I6LA 1Z9MA 3H56A 2MPAL 2YEQA 5H35A 5EEXA 5IB3A 2AS5M 1BQHG 3U7WL 1KFAL 2E4TA 3EOBA 3UMNA 4HHAA 3KDMB 3QZLA 4YFLI 2VLJE 4HGWA 4EQ3A 1EZSA 5AAPA 5FKPA 4UT6H 4IRJB 2OSWA 1BIIB 3U46B 5GRXG 1I9JL 25C8L 3QUKB 3T2OA 3V0JA 3HI5H 3JWNE 3LN4A 5CJ8A 4KKCC 2DJ4A 4GP4B 2ZOKA 4JAMB 3Q5OA 1RUAH 1ZV2A 3OXSA 4POUB 2JLLA 3BP5A 4RETB 4B9ZA 1XR8A 4Y4KD 1A1NA 3VMOA 5GGTL 4FL4C 1GGCL 1FNGA 1NOAA 4GNKB 5CEYA 1XH2A 2JJUA 1FLTX 3NPSC 3HS0A 4M9OA 3RGVA 2PUQT 3AXHA 4JNXA 2VR7A 2QPSA 3MBEB 1TQSA 3QCVH 3QQ4B 1T7ZA 3L3DA 5IJVA 2WUCH 2LU3A 1G7HA 1F3JA 4EAEA 2ED7A 5D93B 1KB3A 1W0YT 4PCTA 3V9EA 1CE6B 3BGFC 4WO4A 2W60A 3DVFA 4UQ9A 2IAMC 4WHCA 5C08E 1NBVH 3GBEA 1S9VB 1AKPA 2F53B 3L4UA 3QG7H 3LKNB 5ISZB 4FFZH 1NCCL 4FNLL 2AAAA 3ABGA 4GQ9H 5AYUL 2FEEL 1YMMD 1ZHNA 4GMTL 2GUYA 3ZRFC 1OW0C 5KSVB 1R75A 1BGXH 5D1ZI 4JY6B 5ENWA 4LHQB 1QEWA 4AL8C 5D2LA 4OLUL 5E8OB 4KJQD 1EBPA 1YEJL 4ZG1A 3IDMA 1U8IB 2C9RA 2VDQH 3NJGA 4UTCA 1FSKB 1M6OA 4PJDF 4YLBA 2FR4A 1L7TL 1G6RL 1ZLVK 3CN0A 4Q6IC 1KBVA 5F3BB 2IDCA 1WC7A 3T0EE 3OMNB 5ELIA 3UTSB 5FGCE 3VD7A 3PHOA 5TD4A 1UWXK 1N3NB 3L3IA 2JB5H 4P2OD 1S46A 3L2MA 4TYUA 1Q1JL 2F7PA 5CR8A 4GUQA 5DD1H 5GJSL 1MNUH 3I02B 5HXMA 2YBGA 5FUZH 2ZQKA 3X13A 1AIFA 3FO0H 3R06B 5I1HL 4QRPE 2X6MA 3MTXA 4N68A 3TONA 3FQ2A 4D0DA 4HJ0C 1MRFL 4RIRB 4TTDD 5D1XC 2OMVB 1QO3A 2X9WA 2IANE 4GKLA 1U8CB 4IDLA 3O4OC 1WE5A 5J1AA 3LIUA 4D3CH 4HJGB 1F13A 3PDGA 3RWFB 4MZ2A 1FJ1A 3QIWA 1M9SA 3C2SA 4U6HB 1TR7A 1KTDA 4AQ1B 2WO3B 4OGAD 2GYSA 2IBGA 8FABA 3HPJA 4LL4A 1NGXA 2LT9A 3LHPH 2DIJA 3WYRA 2X2YA 2Z8RA 1HCZA 1CLOL 1A4JA 3W11C 4R7DA 2DDQL 3GLEA 4RDQG 5DFVD 4J1UB 1FFPB 2D8KA 2BDNL 2FSDA 2OM5A 4P46B 4K8RL 5F9WB 1KJMB 3VD0A 4GBXD 4PB0H 2XQYK 2I26N 4PJBF 6PCYA 4I1PA 4YHIA 1JGLL 4KZEH 3ZDYF 1LNUB 1KOAA 3MJ9H 3S6CA 3SYQA 5IG7A 4L8SC 4NFCA 4PJCE 1HXMA 4Y2DC 1G5AA 1D5MB 5BS0D 5GGQH 4O51A 4NYLA 3LRSA 1RIVL 2CO3A 2Z1KA 1MDAA 4L3EE 4W6XB 5IWLC 3VD5A 1QRND 4EN3D 4MJIE 5ID1A 1U6AL 3V4LA 3OB8A 1EQWA 2EH8L 1EIBA 3PNWB 1XD1A 2WXFA 4RAVA 4WW2F 3SY6A 1MNNA 4W9ZA 5IBUG 4LL1A 2QV4A 4X8JA 3E38A 1HZHH 1LTXA 1W91A 3N50A 3CSYB 5CLYA 1GMIA 3BPLB 5DVOA 5FYKD 3LQZA 1KLFB 3P3TA 4D0BA 4EBQH 3GFUA 3HFMH 1NCAL 3BLPX 3OJ2C 4TV3A 3GI9L 4UT9H 3T3MB 3TNMA 3JUYA 3TYFA 3GO1L 5I0ZA 5DJXA 1BFVH 3MBXL 1LWJA 4P05A 1ACXA 5EWIH 1G9MC 1MRCL 1K72A 4AUJA 4YDKL 3RX8A 4JRWA 1L4IA 5F88A 3IMUA 3CVCA 4ORGA 4KGJA 3HB3C 3L3JB 3VG0L 5JNYA 3TPKA 1ZKAA 2LLGA 1TNNA 4N87A 2DLFH 5AVSB 3AUVA 2VDRL 3V52H 3BPCB 5DEGA 5TQ0H 5GJTL 1PZUB 3B3IA 1DBKH 2NY3B 1UWGL 3OAYH 4JPVL 5CEXB 2N3JA 1AXTH 1WFOA 3QCTH 3RTQA 3V0EA 1EXUA 2HVKA 4FNPA 5DD0H 2F5AH 4KJPD 2NXZD 1QI3A 2Y7MA 2VN3A 2YGPA 4M6NH 4M7LT 5DJAB 2ADJB 4EZKA 3ZKMC 3KBPA 1IGYB 3DMMB 1A9EA 1IIIA 1MI5E 3GSVB 4KK9C 2Y07L 5HHVH 5JIHA 3STLA 4I8DA 4K8RD 1JXJA 2YKLH 4J6IA 1KTRL 4PJ8B 4HK0A 3FTWA 4NM4L 2EQDA 5AL8A 5LGJA 2Q8BL 3FU3A 3GMMB 3O81A 1FVDB 2V0AA 3DDFA 5E9DE 2DLTA 3BRDA 4NUJB 5C08B 1HL5A 3TASA 3E0GA 5E6IB 1RHHA 1A6AA 2DZEA 1UT9A 4WUUA 3KM1A 4BD4A 3DRQB 4ZDHA 3BZEB 1PLAA 3DGGB 5BW7C 3RX7A 3O41A 5HGHA 4R4FH 1F90H 3FPYA 5BQ7A 4C54A 3EJPA 3FZUD 1X5AA 3FB6B 4JQIH 3T0ED 1CFTA 2J21A 1W15A 2VUOA 1ZJAA 2CA4A 2G2NA 3MV11 4AYMC 4JO1L 4OKVA 2F1BA 2NY2D 4FYQA 3GHPA 2FX9L 4AV5A 4X7TA 3H54A 4UT7H 2W0LA 3OJVC 5EH1A 3MLSH 1AO7A 1A7QH 2W8CA 4F7CB 1PZSA 3RX5A 3OMAB 2OS7A 3ARBC 4MMXC 1CDIA 4E0RA 4FTVD 3UGXA 5DJZB 2DM2A 1KBGH 4Y4FC 3FULA 5CR1A 3HZ3A 3BGMB 4HCRL 4XNUH 2QMKA 3SD5A 5T1KA 3LNEA 3VFNB 3MZGB 4QT5B 3JVFC 4NOFA 5CCKL 4N0CC 4Y88A 3MRMA 2ZCHL 1OSPL 2D7PA 3F01A 1DJHA 5ITBL 2C3WA 4X6DE 3ZHKA 5LQBH 5GZNA 3GLDA 4OCLC 2WLNA 3OG6B 2DQUL 3QUMH 4ZS6C 5AZEH 4YSTA 1H6TA 3ZE2F 2XNAA 3PWUA 3U7WH 1KFAH 2A99A 3V0VA 4A2GA 5I73C 1OOWA 3FH7A 1MFNA 3E6HA 4TSCL 5CILL 1FNFA 4MYWB 2C1OB 5DRWB 3PREA 2GPZA 1DO6A 4Z77A 1I9JH 25C8H 1L6XA 3I85A 4IMLB 5DFTA 5HHOA 4KKNA 4YHKL 4Q58C 4JHBA 4IIZA 1B4LA 2JELL 1DQDL 5AKTA 3GSQB 2JVUA 2AZUA 3S4SB 2WXOA 1SOSA 3EJRA 4PRHE 4FNRA 3EAKA 1GGCH 5I17B 2CE6A 4RFNC 5L8LB 1H15A 1YC7A 4NO3B 3NIDE 3UZEC 3VTAA 3LPPA 4PJFE 4BFIA 4F1ZA 3MC0A 2CHWA 2X4PA 2EIZB 3ILPB 4PJ5A 3EYVB 4ZMOA 2EABA 5L6YL 3N6YA 3GUFA 2VZ3A 1E6JL 1EHAA 1I1CA 2JMRA 5CBAB 3QXAA 4G7YH 1UXSA 1NKRA 1C12B 1IAKB 4XVJH 3KPQB 1F0LA 3KLAB 4FLHA 1Q9LB 4PJGE 3US9A 3UTZB 3ALWA 3HMXL 1SZNA 4LLUB 1SN5A 5KSUA 1PJ9A 1DSYA 1XH3B 3KS0H 4XN2A 4MD5B 4P5KA 1R3LB 4U1IA 3WS3B 3RWJA 4L3EB 3BAKA 5EBWA 3VE0B 4X5XB 2N01B 4GMTH 4PCKA 1NDGA 4ZXBB 4MJIB 1HJCA 4YK4B 3O6FA 1VGKA 4MMYB 3VWJB 4YFDB 3CZFB 4OLUH 4W9IC 2WYHA 3A24A 3O8XA 4G6AC 3VFGH 4AX3A 2E8YA 1MH5A 1OT1A 3GJFK 4L4TA 5A7BA 3SE8L 1FVCB 2LU7A 1ZXKA 1L7TH 2A6IA 3BP7A 1DEDA 2JJWA 3R0NA 4X7FC 4NQEB 2Z31B 1KCWA 3N42B 3JT2A 2ICWA 1FIGH 1ADWA 4JFHE 1WZMA 1KG0A 5KSAA 3S35L 4FF9A 2ZXAA 4XI5D 4ES9A 3RVVC 2B59A 3ATAA 3R1GL 4K7PL 3WTUA 1U9KA 1Q1JH 4N86A 1A6TB 5EU3A 2UWEE 2JI2A 1WSST 5GJSH 4PP1C 1YJDL 4PJ9B 5JOPE 2WK2A 1QWNA 2BY0A 5IV2B 2CGZA 4S0TD 1I8LC 3T6VA 5EG6C 5D2LE 1ZIBA 2HG5A 2VLMD 4OCWL 5I1HH 1E8WA 4BUGA 3EGDA 3QS3A 1D7FA 2PO6A 2VKWA 1A7RH 3IBOA 4G7RB 3NEEA 4YDLC 1WAAF 5MENA 4GAYA 1MRFH 3CFDA 3JWNH 3B2MA 5ESVB 4UAHA 3KYOA 4QTFA 5KBDA 1CLYL 4I0PB 3SPHA 3ZIYA 1IBGL 5HI4D 4JREB 3LNFA 2WWNA 2YQBA 4XAKD 5ANME 1B4RA 2QPUA 3NCXA 1UM6L 1AZVA 3UFIA 5MEOA 1MDTA 1ORSA 4J12A 3ML9A 1UTDA 1GPOL 2JJVA 2DD8L 3Q2CA 1F1AA 2QSVA 1TVBA 1WP6A 3BSGA 1MI5B 3Q48A 2N1KA 5EUKA 5IROC 4O5LL 3NJVA 1CLOH 1HCVA 2QVIA 3FCBA 2DDQH 4C56D 3T0VA 4QHMA 5EC1B 3ZKNC 1P4LB 2YZ8A 5D7LB 4X0KB 1DFXA 1S7WA 4UILL 1RJYA 2J20A 2WBJA 5HDBE 3BAWA 2R4RL 5DJ0A 3LKPA 1NA8A 4XMVA 5GRZA 1NC4D 3KBEA 2WLKA 4I89A 3L7EB 4DPRA 4HUVB 1JYNA 2BMKA 4LKXA 4M6ML 2F54A 1AHKA 2NT0A 4TQEL 2X4RA 4I1RA 4LVEA 3O6LH 4K9EH 3L4XA 5EN2A 2P44B 3PWJA 5IW1B 1S7TB 4TVPL 1RIVH 5CCHE 1L6PA 2D0FA 1KTCA 2EIBA 1DQVA 4LO9A 1IIKA 1MAKA 1IEAA 2EH8H 5LO7A 2OK0L 4Q97A 1J9QA 2H5UA 1JNLL 2DEWX 2VMFA 1DUYB 5BQDA 2CNZA 1WK0A 1QSEB 5J56B 3DXAA 1YECL 1GRWA 1VZIA 4I0CC 4X8GA 1LEGA 1S78C 5EEZA 2ZF9A 2W9EL 4APQB 3GI9H 4UM8B 4Q7DA 3SBWC 4NO0D 5KYXB 4UF7C 3MBXH 2HT2D 1S8DB 3A23A 3BUYB 2DIBA 3FQ4A 2WMPB 3IT8D 1BG9A 3H3KA 3MRLB 4JM2A 5DWPA 2YA0A 3MLXH 4NN7B 4YDKH 3WLWC 1AH1A 5AB9A 4BWTA 5DD6B 4UIMA 1R0AL 3VG0H 3HS9A 3ML8A 4IJTA 4R7NB 4BUHA 5FF6A 3HN5A 1XL6A 5B38A 1UKQA 2VDRH 1E4WH 4DKDC 5GJTH 1ZRUA 2I32A 3PL6A 4QRTA 1P2CA 2WXKA 4JPVH 1YY9C 2CG9X 4JQVA 3GXTA 4PWKA 3CSTA 4TQIA 3CBKB 5DEFA 2DMCA 2NXYD 1KZQA 3QZOA 3DIDA 1LK2A 4KGLA 3GSOA 4NPJA 1DJYA 5EF1A 5D70L 1HQ4B 3T4AA 5BJTB 4I48A 1DZ0A 2RH0A 3B1UA 5BZWA 3F04A 1T1YB 2YN3A 4JHUA 4LVOC 4NQDB 3WL9B 5H94B 1XF3A 1CYWA 1YG9A 5C0BB 5MEPB 5GZOD 3PP3K 4M61B 4Y19B 3LKQA 4AEHH 2Y07H 5K1NA 2ITEA 2Y7SA 2YWZA 2HKAA 2RAMA 3F5WB 3VFUB 2EDDA 5DMKB 1GZPB 1P5UA 2A74B 3KPSB 2DM7A 3KWWB 4Z3JA 5HBBA 2XWCA 2CJSA 4ODVL 4PJGB 3VI3A 3CUPB 1JWUA 4FX5A 4HMCA 4WFGE 4U6VL 3RGVD 5DD5L 3TT1L 3ZDXE 4TVPD 3S8GB 3VD2A 1TKWB 3VD1A 1MWOA 1MLCB 4LP4A 3P9LA 5B3NA 4MZIA 2G30A 4WO4D 4GG6B 2YMTA 4QTIL 4G8GE 4X4ME 2P8PB 3NCBB 4JDEB 1AZZC 5KS9A 2A73B 4ZS7L 1ZLUK 1YPZE 3S34H 3PAYA 1JPFB 5F96L 5KUKA 3UBGA 2W38A 1G5GA 3H4HA 2FX9H 3QXWA 3P9MA 2ATPA 1H6EA 2UUDK 5F8QC 3BD4A 4LLDB 5AQ0A 1MG3C 1U21A 5EOCJ 2AXJA 3QH3A 2WWKO 2M26A 2X9YA 4N2DA 4TSBH 4KQ4L 2HN7A 1AAJA 3DK0A 4HYTB 4JUTA 3BN9D 2BCKA 2PLTA 2W80C 4RNRB 5BVJA 4TTGA 2A5UA 4Y5YB 5I1AB 3IDNB 5CJOL 3SIKA 3TWYA 4L8BA 1QUPA 5F72S 4CDGC 3VB9A 2GHZA 3B7UX 3QNXB 3TO4A 1OSPH 3NSXA 2XDHA 1BPLB 1SY6A 1YN7A 3C87A 4DW2L 2PYEA 5K9QI 4HJUA 4GINA 1MHPH 2BO0A 5F3FA 3MGTA 2EDEA 4L1BA 35C8H 4YBQD 1JGEA 1SFDA 2V2WB 3Q8AA 2D0GA 5DTFA 3RFZB 1AO7E 1TCRA 3VX0A 4YXLL 1YEGL 3G6AA 2ZUTA 4XMZA 1DANT 4P2RB 3HC2A 4TSCH 3G6JF 2IV9A 5CILH 2IDQA 2ZYSA 3BKCL 4D8PA 3MUY1 4BGLA 5I8OL 3VXSA 3FB8B 1V8HA 2DICA 4MCZB 4N1CA 3BZFA 3L1FA 2EEAA 3F8UB 3ZTJG 5FO8A 1DVSA 2Q76A 4G8EB 3BP4B 4S1QL 2JELH 1DQDH 3NVQA 1QR4A 4NRZA 5DO2D 1T5WB 1IM3B 3GTVA 2D3JA 3MRFA 3BPOC 3QIBC 3BZ4A 4KRPB 3SBQA 3TVMC 3QIWD 2UY7B 5DS2A 3MRNA 3IDJA 2F6AA 1T7XA 3U30C 4RX4A 5CCGE 4YE4L 5I1LA 4NQXA 3NZHL 1A0QH 4A7GA 2CBMA 5L6YH 2J57A 2VUYA 3O9WD 5HD8C 4LSDA 2OR8A 3WIHH 5C0JB 3SPJA 5J3HD 3KDMA 2IPUK 1J8HA 3GIVA 2XWEA 1JPSL 2NW2B 1KPVB 4HFUL 1O6VA 4OF7A 3C12A 1MFEL 1BIIA 3GF8A 3U46A 3QUKA 2RB8A 4HZLA 3RPBA 5HHOE 4HKXB 2N0KA 2PN5A 4YXHL 4M48L 3OKYA 2MQ3A 1BMZA 4QRRA 3BVWA 2O93L 1G7MB 5IMKB 4EEEA 1TQCB 2IFGA 1XGUB 3ROLA 2WAQA 1DLFL 5BUAA 1N4XL 3VM7A 4FG6D 1NIBA 4JE4B 1U42A 1S7RB 5HI5C 5EU7C 1W8EA 4PPTA 4GYBA 2L8AA 4M5YL 3LTVA 1XB8A 3QQ4A 5IEKB 3DGCR 1BZ9B 2W91A 4H88H 1ZS8B 2XTJC 4F8QA 3RBSA 1ZWIB 5TDPA 2UXTA 1JGIA 4H8UA 4G82A 3ZW3A 2F53A 3S35H 5HYSB 1U3HB 3CZKA 2FNBA 4LNVA 3P77B 5ISZA 3R1GH 4K7PH 2YD9A 5IEHB 4RMRA 4CMHB 1TZHB 4U6TA 3HZYA 3EF7A 4E41B 5KSVA 2RJMA 3OR6A 1X7SA 4H2AA 3FB7A 1MLBA 4JY6A 5I24A 3COOA 1ZHKA 1AMYA 4HWEL 3SE4C 3ISYA 2P52A 3U4KA 2R1XA 1UZ8B 2O5XL 1LO4L 3K6SA 2JKNA 5IMMA 4PRIA 2BS71 2L4OA 5EV7A 5HYFA 1ODAA 2CJUL 3AAZB 3INOA 3MLWL 1IBGH 3SPVB 2UZXA 4BE5A 1FZMB 2ZOOA 5C0DA 4FQ1L 3QI9B 3HC4L 1AGBB 2YEVB 3QDHA 3G9AB 4HA1A 3ME0B 4PSPA 2E6PA 1GPOH 1HAWA 1A3ZA 3CN3A 3RWDB 4AMXA 3MUHL 4P2QE 2YK1L 5B7MA 1QNIA 4OIFA 4XOBA 4YHZH 4O5LH 1XD0A 2AJ3A 3KPRA 3C8KA 3R06A 1NICA 3EYQC 5D71L 2F8OA 1UM4L 4JPIB 5EA0L 5LNGA 5MENE 4PRPD 4UILH 4K71C 5F97E 2OMVA 3D9AH 3KHOA 2DIAA 1F86A 3CHQA 1VPOL 4W9FC 1Q0YL 2OX5B 3EFOB 4G6FD 4APXB 4YS4A 2CAKA 1JXKA 2FQDA 1CLZH 4FMKA 1WFUA 2OJEB 2Q7AA 4JZNB 4LB8A 1OE1A 2OMZB 1TYRA 3UPRA 4TQEH 4U6HA 2WQXA 4AQ1A 1HH6B 4L0PB 1R24B 2E27L 3KWVA 1WWAX 1E4XI 4TVPH 1X9QA 2EVIA 4OKDA 4G8GB 2AJZB 1SVZA 4WUUD 3OKMB 3TIDB 4YDVB 3VFWA 4L9LC 2OK0H 2CDEB 1NGZA 5CU5A 1O7SA 1P7QD 4J1UA 1FFPA 2BY3A 4MJ2A 2UX7A 1BQ5A 1RUPL 2D7TL 2R1YA 1JNLH 2YPVH 3BEWB 2KQNA 5F44A 5JDJA 4GI8A 4RSYA 5ITFB 4YEFA 1BVOA 1DLHB 4JM4H 5KBNC 3DIVA 3K8MA 4Y5VA 4OF3A 4UIKL 1NJ9B 1U3NA 3OAZK 4LOUC 3WE6A 2UZYA 5ECGA 1ORQB 3IAGC 2W9EH 3O4LA 4PREA 4NN5C 4UNUA 1KN2H 2HRPL 3OJMB 3DVGB 5CO1A 2OXGB 3L3GB 5AVTB 4XO9A 5I16B 2Y7QA 3ETTA 3WKQA 4DUVA 2C3XA 2VQUA 2ZOLB 4X5PA 1R0AH 5H37G 2IGFL 3PNWA 4M56A 2P80A 3NIGF 2NY5H 1GC1C 1OTTD 1P5VA 3WY3A 2OTWA 3UMTA 3ZYOA 3DXAE 2YAEA 3S48A 5TDNA 1K5NB 4YVNA 1ET7A 4NQSB 3D5OF 5SWZD 2FT7A 4N2GA 2ZUQC 1AZRA 5FOJA 5JO5B 5LGYA 2VLKB 3GK8L 1RAMA 3T4YA 3QXDA 4ODBD 3AG1B 5EORH 2G9HB 4I7ZC 5D70H 1RIUH 5LLIC 5JR1L 1CXLA 1SUJA 4D2NA 1P6FA 2EIMB 3LSOB 4QMEA 5JZ7C 2YWYA 3IB4A 5HHOD 2VZOA 3DUHA 2DYPA 3L3JA 3PCYA 4LIQE 1TMQA 5D8JH 1OP3K 4IBSA 1SXBA 1RMFH 2DWSA 4JQXC 4EDWL 2BSSA 3G5YA 3BPCA 3BMWA 2C7UB 5IR1B 5D7IB 1T20B 1NWPA 1R1CA 4BWWA 3D69A 4EIBA 1JYXA 5CEXA 4ODVH 2Z93A 1WHOA 4PJ5D 1ET8A 3KXFB 5DD5H 3TT1H 3ECWA 3LRHA 4F37F 3D85B 3OWRA 1PIFA 1M57B 2DKUA 3QR2A 1KYAA 4GKOA 3J8F7 3GXPA 2L0DA 3MJ7B 4Y4HC 1TITA 2NY1C 3DIFB 3EZ8A 3UTTA 1IC7L 1FAIL 2C8NA 1BAFL 4Z3GA 1IGYA 3GSVA 3H9SA 4YVUA 4ZS7H 1WFNA 5F96H 4F58H 3L16A 1FYTB 1XF5B 5ICXA 3QUZA 2ISDA 3D33A 4MNGB 5JIMA 4EIUA 4MAYA 1KNOA 4QKTA 2X3CA 5FW6A 5IW6A 3ZSSA 3B4NA 3QEHA 3FF8A 3DPDA 4NOBA 3LEVL 4J2QA 4W4OC 1C8PA 4NUJA 2DY2A 3QCUL 4LPVA 2VDLB 3DBXB 3O8XD 5BPPA 4JHZA 1IKFH 3GSUB 4L4TD 1VFAA 4HLZG 3BZEA 1CI3M 2VE6A 1NFDE 2P48B 2JTDA 1VCBC 4FXKA 5CJOH 4FQIH 3WIIH 3M45A 4N28A 4UM9D 2BVQB 1GGYA 5I1JH 4XBMA 5KSAD 3BUBA 3U36B 4LCUA 1SBSL 2Q6WA 2JE8A 3BKYL 2YLHA 2CRZA 2E6JA 5JMOC 1GMEA 5F9JB 5DMGD 1KTBA 3RUGB 3L48A 3FYIB 4PGCA 4YXLH 4MB1A 4ZOBA 2YA2A 2J73A 2B3IA 5E51A 1KXQA 3V79C 3JWDH 3REVA 5JPNC 2YAMA 5BZDA 3NRQA 1N67A 4QRQA 1GSKA 4QHNA 5I8OH 2PO6D 4ZX5A 5MEND 2B14A 2WO2B 3BGMA 1AE6L 5FGBC 3PE9A 2QQNL 4NO5A 4QT5A 3QC6X 4N90D 1EWHA 3D3VD 1CD9B 4M5ZL 2CLZA 4P5TB 4ONFH 5ACMA 2ALAA 3D39D 3CVHB 2PYEE 2MQGA 4XCNB 1AS6A 3RDTB 5DLMH 2VDPL 4HZ1A 4YE4H 3NZHH 1Q0XL 2UX6A 3SKJL 4EZLA 4ZMYA 4ZMAT 3BWUC 2ZSWA 4OJAA 1XCTB 2LU5A 5FR3A 3D18B 4K07A 1QSFE 1SJVA 1OGAA 2OULB 3N41F 3TZVC 4HFUH 1JFQL 1T2QH 2QHLA 3VXSE 3H1ZA 3BVDB 3BDYL 2BZ7A 4IMLA 4YXHH 4UQDA 4M48H 2NW3B 3H53A 3SZKC 2E8ZA 2WJ5A 3NJIA 2KZBA 4R5TA 2YHGA 5GSRA 1PX8A 3W0WE 4UUJB 5I17A 3PJLA 1DLFH 1I31A 1N4XH 2F54D 5AG9A 3SE9H 3WAKA 2OCCB 2Q7YA 2B20A 4QJ3B 5I18H 2B1HL 1AJ7H 2EIZA 4FHJA 4PJCF 3EYVA 1BVLA 1W2KT 3L1EA 1MWAA 3VXUA 4K4KA 5M7QA 3BOVA 3LMJL 2C26A 5CBAA 1J8HE 4HHWA 1C12A 4U49A 4JB9L 3HRPA 4JZJB 1RY7B 4WWKB 3FRUA 1OPOA 2ZCLL 3Q5YA 1UA3A 3FT4A 4AIEA 4Q9QL 3GI8H 3QJOA 1EJ6A 1U58A 3KGUA 2AXWA 3P3RA 4QRRE 1BZDA 1XH3A 5CLWA 3LD8C 4IBVA 1ZT1B 2PXYA 3BGAA 3RIKA 4U1LB 3EFFA 4M3HA 4B9PA 5E8EB 5BV7L 1EFXB 2CKBA 4LNRB 4D9LL 5IWLA 1GZQB 4MMYA 2KT6A 1DO5A 4EDXA 4G70B 5A43C 1ZT4A 1KXVA 3SCMB 1EUUA 2EDOA 3L5WA 1LO4H 1BEYH 2GTWB 3MZTA 2DQIL 5B1JC 3VFPB 4Z8FL 3QB7C 1SLXA 4NQEA 2Z31A 2WVVA 4XMXA 2FT8A 4ABWA 1CN4A 2CJUH 3CCHB 3KMDA 1SY6L 3DTXA 4FQ1H 3S36L 3HC4H 5CZXD 2CMRL 2O6DA 4JFDA 2AQPA 1F02I 3QYNA 5EF2A 3TCXA 2JTYA 1R34A 2R39A 3PL6D 4KK8D 2J56A 3BZ5A 1A6TA 2VZTA 4OQTA 1AI1H 2X70A 3ARDC 5B22A 3EBHA 3S4SG 4EN2A 1GOGA 4K5PA 3LQAC 4MA3B 1BYNA 4TM9A 2LGNA 5D71H 5EA0H 1UM4H 2Y5QA 3FQNB 5C0FB 2XN9A 2YUWA 1CO1A 1WZKA 3L3HA 3OPUA 4L18A 2X87A 1VPOH 4OIBA 4PRIE 5ESVA 2H3KA 3T3PE 1KIQA 5IW3A 3IDUA 5EUOA 1Y18A 4ICWA 4I0PA 4YN3A 3HBZA 2NDGA 3R8BB 4M7ZB 4WI2A 5JTWA 1L0QA 2BHUA 2NX5B 3EO9H 3Q2VA 3HZVB 3DO3A 3DX1A 4URTB 3ZL1A 4DKFH 2E27H 3ZXAC 4PTUB 4KHXH 3HE6B 4LF3B 1TTRA 1MUJB 5C0CB 3OHXC 2FL5B 1T83C 2RA1A 4KVNL 2MNJB 4S1SH 3SKNA 5JMRA 3KPRE 1HYRC 1PZAA 5EC1A 1P4LA 1SMAA 4X0KA 3UDWA 5HJBA 2WP3T 5LKNA 1RUPH 2D7TH 4KXCA 4KH9A 1Y7VA 1QOKA 1RUKH 1IJ9A 1JE6A 4QXVA 2HTKC 4AGQA 2WXLA 3H6AA 3L7EA 4FC3E 5FGRA 4LEBA 2HKHL 3GPSA 3FTXA 4EKXA 2YRPA 4NWTL 1AQDB 4GT0A 5FM5O 4Q9RL 2APBA 1IQDA 1T3FB 5JHAA 1S7TA 1TXKA 3ASWA 4DERA 2YD0A 1KXHA 3I6GA 3HBPA 1JP5A 4K73A 3W1ZA 1XBRA 4AQAA 4Y2LA 5IK3A 1XDTT 1CDGA 2SEBB 4HWZA 4K7FA 3KGRA 3WNMA 4NQVB 4LSUL 2WQ8A 4NB7A 1DEEA 1F41A 1JHTB 1B6UA 4MD0B 4Z7VF 3KLHD 3U0TA 1PZ5B 2BVTA 3QJHB 5DS8B 3TO4D 2X0VA 5MI0B 3TN0C 2C3VB 2PYED 5LBSA 4I18C 1QYGL 3OLGA 1FN4B 3ARBA 3AT8A 4BFJA 3LH9A 3B2VL 2JJSA 4DEUA 3GK8H 3OXRA 2IH1A 3O4LE 3ZJAA 4LLVB 1IZKA 4C4UA 2XTSA 1G84A 1X6LA 2EIJB 1Z2KA 1D6EB 5IB5A 3BUYA 2CNYA 1U36A 2WMPA 1QI5A 4D9RE 1LP9F 1MEXH 2LU4A 3TBYB 3D52A 3JTSB 3LB6C 1I1AB 4HOZA 4FMFA 2A77L 3IDYC 4TNWF 5DD6A 5HHMB 3RWEA 1G4MA 4R7NA 2WZAA 3QUGA 5E2JA 1WF5A 5GS2D 4AK1A 2VAJA 4EDWH 1LD9A 3BC9A 4JANB 3Q13A 4KTYA 4WW2C 3QORC 1W72B 3W9EA 2EC8A 5E9AA 1TNMA 3MLPA 3TEZA 1SJHA 1ROCA 1UJ3B 4L3CA 5DGRA 2VM3A 3NIDF 5KYUB 2FJHA 4PJFF 1M56B 2X4SA 3C5ZB 1IGJB 5FUOL 3GSRB 3KYMB 5A2AA 4TLKA 5CGYD 2QKIC 3BPNC 3F65A 3OKNB 2FZ3B 1HQ4A 4C55A 5BJTA 5E6ZA 2VSMB 4ZSOE 3MOQA 1CE1L 1T1YA 1RZKC 1IC7H 4K15A 1BAFH 5C0BA 5MEPA 2D3VA 3DGDA 1UH2A 4Y19A 2X28A 2X6BA 1SMDA 1XGYL 3FK3A 4JZOA 5DQ9A 5LB1A 4XO3A 3VQ1C 2P4AB 3KPSA 5T1MA 3LKSB 4BA0A 4XGZB 1FE8L 4CNIB 4H1LB 4KKLD 2ZWSA 3VUAA 3L4CA 3CUPA 2KI6A 3NMEA 1V7NH 3ZHLA 3QCUH 1EHXA 1O6TA 4XHQA 2LFEA 3QPXL 3MRIB 2C4FU 3MBED 4RZCA 4Z76A 3B2UC 4IRSB 4KX7A 3A4DA 4TNFA 3WFEH 2HX8A 3WOVA 5C0EA 1EJOL 4IOFD 1LILA 4MA8H 3UTTE 3O2VL 3DSNB 1F58L 4EJ1C 4Z7NE 4GG6A 3FNKA 5JYMA 3IMRA 2P8PA 2F53D 4JDEA 1SBSH 3H9SE 3K5SA 2A73A 3UAJA 3BKYH 5ISZD 5CNHA 1VZGA 1T04A 2FEEI 3UAFA 4ZI8A 3RL2B 4FXTA 5IGXH 2GT9A 3TF4A 2W07A 4LLDA 1FA4A 1IEBB 4X9HA 4YPGA 4F7KA 2Z92A 3MV8A 4H5SB 4FLSA 1KLGA 5CSGA 3Q6GL 4RDQF 3U6XS 2G2PA 4H7VA 5DR5L 5FO7B 5D2LF 2QT6A 4JJ5B 2WUBL 3TPUA 3DPBB 1AE6H 1PG7W 2QQNH 1A25A 3CX5J 5F89A 4JFQA 5I1AA 3FT3A 4PRID 5LCVA 5DC2A 5B7EA 1A64A 4F7TA 5I71C 1AR1B 2GFBB 4XH2B 4PS3A 2J8OA 3BH9A 2WWMD 3FOMA 4UI2A 2CIIA 4QHLB 3HC3H 5KN5B 2VDPH 3W39A 4D8OA 1Q0XH 3LJ3A 2V2WA 2V3DA 1ROWA 3RFZA 1R5IA 1G9HA 3AGVA 3KPLA 3QXUA 1KXQE 4BFGA 4B7LA 1I7TA 3ZKQD 1CXIA 2XETA 3IMVA 1JFQH 3KPRD 1UUSA 5AVZB 4OAWA 5CAYB 3BDYH 1A7OL 1ZA3A 1IZJA 2VXSH 5LWYL 4EUPA 4NQCB 2IWGA 4GKNA 1IM3A 2WLJA 1UZ6E 2BNRE 4FFTA 4AITA 5KW9L 4O2CA 2X9ZA 3L1OH 4JJHA 5I1GL 2WNXA 2ZG3A 3GZKA 3IGAA 4QXTB 2R8SH 3KYNA 2B1HH 1G9NL 1MCPL 4K3HA 2DJMA 3GMPB 4J3OG 2D7MA 4AV0A 2F0CA 2N0MA 4QWWD 3GNMH 1TU2B 4BQ8A 2VN5A 1OGAE 3MHZA 1L6ZA 4WHDA 5IBLC 3UOAB 4IIQB 3S0PA 3IMSA 1F3DJ 4JB9H 1ZAGA 5C0NC 4JO2H 2FAUA 2ZCLH 4AW4A 4H40A 2Y06L 1BDYA 4NSKB 4Q9QH 1QFWL 4I88A 1FL5A 2HAZA 3JTBA 4W9HC 4ALAL 1J5CA 2WINB 4Z18A 4NUQA 3QWOA 5FAAA 3EH3B 1QKZL 3B3BA 4PH8A 7PAZA 2HTLC 5CCJA 5BV7H 1S7RA 4PJ7E 2F8IA 1FYHB 3O4LD 4X7CC 4D9LH 3ZKXB 4Y16B 1OCCB 1OAUL 1T4KB 4NHUA 1JHLL 3A6BH 3MI6A 5D2NC 4BA8A 1NCOA 1RPKA 3TFKD 3IJEB 4ZNEA 4Z8FH 2EICA 2GI0A 3RZWA 1TEGA 3VG9C 4JKNA 5FM5M 2P80D 1IBDA 5IVNA 1F97A 4L2YA 3S36H 5HYSA 2NNAB 2CMRH 3V6FB 3QUXB 4WCYH 2HJFB 3VSTA 5F1NB 5FB8B 2X4TB 1WFJA 1N68A 2AXHA 1I1FA 4E41A 4HZAA 2OL3H 1GIGL 3WIFB 1HI6B 3CIAA 4U3HA 2DQFB 2BSRB 3K2KA 3SQRA 2DQHL 3G6DH 2H3XC 3KS0J 2OSXA 4HUCA 2RGSA 5I19H 4M7JH 3QJRB 4NCC2 1UXWB 2DMKA 4XN7A 5A16A 3IK2A 3D8MA 2ILLA 4ZPTB 4BH8B 4QR7A 5ABZA 1A1MA 1RKRA 3LNGA 3IKCA 3SPVA 1BVNP 1FZMA 2CDGA 5I2IB 1FCCA 5EIIB 2D2OA 3HZKB 5FS5A 4UTBL 3KGSA 3KR3L 1Z5LB 2DI8A 1GGIL 4P9ML 5B1KA 4OZGB 1CVSC 5F1IB 1YEDA 4F15B 4FFWD 1FFQA 2HFEA 1BMGA 4KVNH 4D7BA 4XPFH 4HU8A 5DJ8B 1HAUA 3RVUD 3TA3B 3CFEB 4WJ5B 2CCLA 1EPFA 2G0LA 2XN9E 1DHKA 1VIWA 3N85L 3UTTD 5JDSA 2H6PB 3EW3B 4XNXL 4AQEA 1NPNA 4LLQB 3SGDH 2OX5A 3EFOA 5EUOE 15C8H 4BE6A 2NNXA 3OX8A 2HKHH 3HUJB 2LLLA 2XY1A 3C2AL 3QA3B 2XWTA 4GS7C 4MAYD 3V4PB 4CBPA 2ZX8A 3BUPA 1GH7A 3HI6H 4NWTH 5HYSG 2Z8WC 3VO0A 1DSFH 1HH6A 1R24A 3CPLA 2MCG1 4A04A 1MWAL 3GXDA 3FRPB 4U1KB 3D0LA 3FS9A 2VOTA 2D3LA 5E6ID 2H8PB 2CJTA 3TIDA 4YDVA 2TRHA 2YD8A 5IHUL 3NPSB 4XODA 3LZFL 3WLBB 2OXHB 5FOBB 3QQ3B 4LSUH 5IKCA 1PKQB 5EDXA 1J48A 3GQFA 4CVZB 2Z6FA 1WDAA 3J2PA 3RWHB 2VH5L 3NP4A 4YFEA 3D4CA 2CO1A 2J8UA 2A9CA 1DLHA 2NQ3A 4FQXC 4AKOA 1QYGH 2XOTA 4HIXL 3OD3A 4WK4B 2CKBL 1ORQA 1W6WA 3Q01A 4PVBA 4G42A 4JO4L 4PW4A 1FFOB 3RVTC 1J0ZA 3R4DA 1HKLL 1E67A 3P0VL 4BDVB 5FFLA 2ORBL 5I16A 2FJGB 2V7NB 3N0PB 2QLVB 5LXGH 3UZVB 1MW2A 1DE4B 3MJ8A 4PRBB 4XN5A 2GIXA 1CWVA 3QJXA 2ZOLA 2A77H 3EJYC 4I85A 4LDOB 5SWSA 5AOIA 4E42A 2HT3C 5I1KL 1AQKL 2AGJH 4POZD 3AXLB 5LXVA 1OXYA 3MUGB 3WEOA 1YO4A 2EAEA 4WI0A 2O6EA 4GG8B 1N6VA 3RG1C 4OQTL 4NQSA 1FGNL 3M17B 3SGKC 2EC9T 1GY2A 1HNGA 3K81A 3UEZA 5JO5A 4UU9A 1HOCB 2YSTA 2DMBA 2Z7WA 4TULL 4M3KB 2J43A 4N8VB 4XMWA 4YSQA 5D1ZA 1K4CB 1HQRA 2OYLA 5AW9B 3UP1A 3KHQA 2BFVL 1OGAD 2B4CH 4UOJA 2E7LC 2BNRB 1CBJA 2A9ML 2VN7A 4F93B 3K74B 4OSUL 4PD4K 3RA7L 3LSOA 3SEPA 1QA9B 4YSDA 3IJ8A 4PLJC 3BH8A 3UBXI 4D9QD 2O61A 2IBZX 3AJ7A 4ZW7A 1T1ZB 3NCCB 5I6NA 1XGYH 1NLBL 2FQEA 3S3CB 3L08A 2P5EB 3C09C 2C7UA 5D1XB 2X2JA 4FE9A 1T20A 1KB9J 4AZ8B 4OZFH 3O4OB 4FA6A 5I30L 1YVLA 4LGPB 2OSLB 1MCCA 4XN1A 3AWFA 5EEUA 3QPXH 1K8DB 2ZT9C 3VXUD 3HI1B 2KMWA 4ZODA 1MZYA 2DIEA 4P23C 3MJ7A 1EJOH 4LLWB 2GAZA 2HLFC 1PMYA 4PRNA 3DIFA 1CFBA 2P24A 2A9BA 5GGRY 4MWFB 5IOKA 5IVZB 3B9KB 2EKSB 1DDHB 1KYOK 2CU9A 3FQXB 4LESA 3S88H 4PJAA 1EAOA 4PR5A 1LM8V 1DQML 1EUTA 3ARGA 2PXYD 2OR7A 1LO3L 5EZJB 2Q2LA 2AQNA 3L3OB 4ZXBD 5I26A 4X98A 5T33H 4L5FL 3QYCA 4DK6A 3PIQA 4AMKH 4FQCH 4V33A 2ARWA 1HWWA 4OCXL 4L8SB 2Z9TA 3B8YA 5HVHC 2JCCB 2WUBH 1JV2A 3M1OA 2F7IA 4F8LA 5IJBC 5E5MA 3JV4A 4DKTA 4NQED 1YHPA 1T03L 1E5AA 2Z31D 5EO0B 5JW5B 3DV4B 2YGNA 2DS4A 2OP4H 4GRLC 5I5IA 2ZWKA 4WW1B 4N0YL 3DOSB 1UOLA 5LBSL 2WW8A 3LDBC 4KY1H 4JFDD 1F8TL 1SDDA 1KACB 2OMTB 2AXFB 2R4SL 4OT1L 3ARTA 5B1CA 3X14B 3ZL2A 4S11A 4HLZH 3UADA 4DOHE 3VI4B 3KJ4C 4PJ9D 3Q7JA 4U6XB 4FCHA 5B4MC 1SF3A 1HHIB 1E2WA 3I2CL 3LIZA 3MV8E 2DQTL 3WNLA 1S7UA 4A38A 2R23B 5SV3A 2PP8A 2ZWYA 4H0GA 1NKOA 3GXIA 4CMMA 5KEZA 4Y1TA 1IGIL 1U2CA 3X11A 3MO1B 3X1NA 3EBAA 1A7OH 5DYOA 3ETBF 4Z0XA 3KPPB 1NINA 3NBNA 4DCQB 3X2QB 5LWYH 1MHEB 5T3XL 4I0PD 2K6ZA 4P5TA 4BYHA 2XZCL 3QDGA 3BXNB 4X7EC 5I1GH 1EANA 1YUHA 3GMOB 4XCNA 1ZOXA 5EO1B 1EJ8A 1LEKA 4U0RC 2WJ7A 4AEHL 4UAOC 1I7UB 2QADC 1WIOA 4PGBB 1OAYH 1D9KB 3QQ9C 5INCB 2O6PA 2FB4L 3TH4T 3C8HA 3VVVA 2P5PA 3KPMA 1QEXA 2COVD 3IMBA 1RJZB 1E8ZA 2EADA 3TURA 2N4IA 3S97C 2IMMA 2X10A 2ENJA 2FYVA 5H4YA 4OJEH 4ZW5A 5IMLA 4E2OA 1QFWH 4L4VA 2F7QA 5C2BL 4ALAH 4HIHA 1ZK9A 1QKZH 1BLNA 3MV7E 1OTSC 3FYEB 1UT1A 4JPKL 3T1WA 2YJQA 1OB0A 4ZFOB 3AWEA 5F8RC 4L9LA 1F4HA 1U2HA 4QRFA 3IFPA 1YMHA 2FBOJ 2MOQA 5EBLB 1JHLH 3AS1A 4MXVE 1JS4A 3OZ9H 4GRWE 2EVGA 4OFYA 4R4ND 4OH2A 3NABH 5F7HA 2V3EA 4K7PY 2H1XA 2HKFL 3L4VA 3OKKB 4ENED 1HILA 5B8CC 2XQ0A 1HXYB 1EV2E 4WV1C 4NP9A 4OD2B 1YN6B 2QGBA 1S5HB 3EO0B 4HAKA 2XACC 4WLCA 5F3HB 1CK0H 4LFHG 1GW0A 1M05A 5T5FH 1MF2L 5E8EA 4LNRA 1AACA 1YEWA 4Y4KC 3EJQA 1GZQA 3R0MA 3EOAB 3MLUL 5J13B 3QNZA 4LCYB 4XN9A 3SCMA 5JIQA 4OV6F 4P4RB 3UAEA 2X1OA 1HESA 4O58L 3ZQWA 4PWHA 3FUDA 3KLDA 4JM2F 4LGSB 3VFPA 2WQRA 5LCVL 4MMXB 1MAJA 3OWEA 4M03A 3HFFA 4UMSA 2LTQC 1ZGLM 3MKGA 5KSBE 1CL7L 1OVZA 1W8NA 1YZZA 3ABMB 3H0TA 4QXGL 3U2SB 4JCWA 4WKZA 2IH3B 5T3XD 4ZBJA 1AGDB 4MKTA 4Y2OA 2D31A 2YN5A 3KR3H 3L17A 1WFIA 4IBYA 4P9MH 5E2TL 4C83A 3G08A 3MGAA 3K80A 4I3RL 2FYYB 2QVTA 4N0FA 4XVOA 1I3GL 4MASA 3IJYB 1ES0B 1AGFB 1CYXA 3FU7A 4ZO6A 1KY7A 4NM8H 3RKDD 3TYGH 3FQNA 3L95A 4ZYKA 4WWPA 1Y0LB 4R26L 1BSIA 3N85H 5JHDB 4XNXH 5JPMA 4KJQC 3VFMA 4TL5A 5IB4B 5C0BD 1G7JA 3ISWA 1BXUA 4Y19D 5I1EL 4XN8A 2IH9A 3S3SA 4R2GB 2EJ1A 4CC4C 2G3XA 5I75C 1VESA 3WTWA 2F61A 3WO3B 4ZOAA 2PWEA 3C2AH 2K8QA 4H44C 1BG1A 2C9SA 5FKAB 4DVBB 3LEYL 3ROOA 1KBBA 1UATA 3KPSD 4HWBH 4PTUA 2X42A 1MWAH 1MUJA 4P2OC 4Y4HA 5K39A 3VI3F 1LWHA 3QXTA 4OFQA 3BO8B 1NAKL 4M9PA 4K9JA 4MSWB 5CKGA 3OLDA 5IHUH 4DGYL 3LZFH 1Z9SA 3B7SA 1NEUA 5CZVH 1AHWA 1M3IA 2GEEA 4JL2A 2QQKL 2ZKYA 1KB5B 2BOBA 3MGOB 1H5BA 4TTDC 3UAJD 5C8JB 4HIXH 4A55A 2GTQA 1PZBA 4W4OA 5KS9F 1O9ZA 4J3OD 3VXNB 3UAAA 2CKBH 2JKSA 1MCQA 2AV7A 3GEWB 4BKSC 4YL4A 4DFIA 5LGHL 4PS8A 3VFRA 3NA9H 1A9VA 5AD0A 1FFRA 5ALCL 4OI7A 1HKLH 3VXRA 4A7UA 1RZGB 5E7BA 3FU6A 4N9OB 5J9PA 4OGAC 3GMNB 1ECZA 2EE2A 4X9IA 4FYSA 2H4EA 4AKQA 1P7HL 2MMXA 4WWOA 2R2EA 2Y5TA 4FZ8L 3V6OC 1WQVT 3T8XB 3VGHA 3HNTL 1JZ5A 1DQLL 5IIEB 3QJHA 2J8UE 5DFVC 3BAYA 2ZUXA 4BKTC 5F1OB 4OQTH 2A6DB 1FN4A 4QNPF 4GBXC 1Z32X 1FH2A 2AJXL 2QTVA 2BVPA 2XQBH 1UH3A 2I07B 1WO2A 5C09B 2GJZB 4P2RD 1YEKL 1VACB 1A66A 4J3SA 1J1XL 5CP7A 3PWLB 3IEAA 3ECVA 1FQ9C 5CJQH 3DX9B 4WDIB 3TBYA 3PJSB 3JTSA 4I2XB 4PJEE 1U8KB 3RA7H 1LMIA 3INUH 4ERSL 3MA7A 4OV5B 1FL3B 3MRPB 4LSQH 5SWSE 2XVLA 5EU4B 4CSSA 1NLBH 4YDLB 1IM3D 3RILA 4KRPD 5HY9B 3PWVB 4G5ZL 1EHLL 1GSMA 4AQ8C 2L04A 1D3CA 3OMZA 2AK4B 3DC0A 1UJ3A 3B37A 3ZHFA 4MNQA 4F7MB 5AW4B 4PHXA 3QDME 3OQRA 4WQOA 4Z95L 4FGMA 3ZE0B 3GSRA 3HZMB 1T4WA 4NJ9L 1GJUA 2VN4A 3V6ZA 3OKNA 4PVMA 4UB0L 4RMVA 4WGKA 1G7IA 5DUPL 2YFNA 1MW3A 4CJ1A 5IFJB 4N3TA 1OOAA 4GXVL 2HRGA 4WHTB 1R6VA 3ETSA 4DVRL 1BZQK 3FT9A 1SRDA 5CZKA 5I9QC 5D5MA 1E3FA 4Z78B 1D5XA 1NGYB 1DQMH 1U92B 4UOQA 3O11B 3ATDA 2NLJB 3HCVA 1LO3H 4HWNA 1S9YB 3GSNB 4L5FH 3CDGB 5T5NF 4H1LA 1SF5A 1MIML 5CS7A 2SODB 3V0WL 2ZNWA 3RLSA 2E9IA 4W70A 5DJDB 1LWRA 3MRIA 4YXKL 2JI1A 4OCXH 3VMNA 4DHLA 5A1AA 4GSUA 2XXMB 1RJLA 2J1YA 4KJPC 1T03H 4FLQA 5HVWA 2NXZC 2YR3A 3BEVB 5CXPA 3PV7A 1M7IB 5IB2B 1MCDA 4PWFA 2ARJB 4N0YH 4XP5L 3WHE0 2XA3A 1L9TA 4PJAE 5EU7E 3UZQA 1S7QB 3PABA 4ELME 4NZRL 2R4SH 3DX2A 4PGDB 1AQMA 3NYKA 3RL2A 2IADB 1QBBA 4K8RC 5F7NC 3J27A 4E41D 4KHTL 1BXAA 4NO2B 1IEBA 4RZKA 3NN8A 2IDFA 3I2CH 3V5DB 1K3IA 4EF3A 2XTJE 4FEMA 5D7SL 1JMZA 1IGIH 4MLIA 5IM7B 5MEQA 1BJ1H 1MG2C 1MY7A 3QWRA 4EMZA 1ETB1 1KTJA 2X09A 2AC0A 2VR9A 3NSDA 3D7PA 4PHZA 3T3PF 4S2SB 3FSZA 3ARDA 3QI9D 2FQGA 2B8OT 2Y72A 3FZUC 4Q56A 3T0EC 3P11L 4D0CB 4FFVD 2GABA 4X7DC 1SLVA 1GZHC 2O5YL 2NY2C 1AS7A 3AS0A 5CIPB 1ZGLB 1HIML 1II4E 2FB4H 4IDJL 4WFFE 2YD5A 4RFEA 4H1LG 4AMWA 4L2LA 3L7FB 1HOEA 3W9DB 1WD9A 2NDFA 3OC8A 5HVFB 2H0PA 4RGNE 4ZMNA 5J57B 4Z7OE 5GHWL 1X4ZA 4UINL 5C2BH 3UERA 2WXJA 2ZX7A 3QJFA 4KI5D 4NQCA 1NL0L 1LDPL 3UYPB 2NYYD 3B7YA 4L29B 5G4OA 3QDGE 2J5LC 4S1RL 2QGDA 3HNSL 4JRYE 4JG5A 1IM9A 3U79A 3FFCB 4JPKH 3WE1A 1MVUB 2CRMA 3DVNB 3NFNB 2GTZA 3WXWH 4CW1B 3GMPA 3VDBA 1MJ7L 3SOBL 2F18A 1KCRL 3LKOB 2EYTA 5AKRA 3ZE1E 3Q1SH 4PFEA 3HEIB 5JW4M 1NWOA 1JHKL 1DQKA 3CTTA 2Z0BA 2ZUYA 3V5KA 1QR1B 3MV9A 3U0WL 3TT3H 4U1MB 3QZNA 5TE4L 1MSPA 4L4VE 2PR4L 1SHMA 5LBGA 1BMWA 5E5LA 3T6XA 4J3UA 2JKWA 1EZLA 2E46A 3BUTA 5FECA 2DLIA 4YBLB 4N5ED 3CHXA 1ZSHA 2VDLL 4NNPL 3OM3B 1R3HA 1I7ZA 2P46B 4OLVL 1U93A 2GJ6A 4XCYB 1RZ8B 2HWZL 4X6CB 1T4KA 5I8CB 4P5MB 1J5OL 2ICWI 5LCVH 3TN0A 5ICZA 4GB9A 2WBWB 5SWSD 4OD3L 1AD9B 3PG2A 1KCBA 4HS3A 2VSDA 5E1HB 3WNPA 4QXGH 5E56A 3FHQA 2FBRA 3V6FA 3TJEH 3QUXA 4E9RA 5ABDE 1VADB 2X4TA 2J72A 3H7BB 3PY9A 4MXQD 5FDWB 4I3RH 1IILE 3LIZL 3MRHA 3SDCB 2EZ0D 3WIFA 3TL5A 1P7KA 5C2UB 2ARJQ 2BSRA 3T3MF 2CUIA 1H3PH 1ZSDA 2F7OA 3KM2A 1YNTB 3CLFH 1HINH 4I4WA 4PJHB 4B9FA 5JQ6H 1ZVSB 3C60B 4GAJL 4R26H 2VDOL 1M71A 1M1XA 1UXWA 4MMZA 5KVFE 4EUPH 4JKPL 1K4DB 4PB9L 2KL6A 1V3MA 1ZA6B 4IRZH 4OFKA 5TJWK 3TU6A 4BH8A 2ZKHH 3WCYA 5ICUA 3MX0B 2D73A 4IGBA 4NAJA 4QXUL 5I2IA 3BAIA 4A2FA 3LEYH 5E99L 4HUUB 4GKZA 4XI5C 3BYTA 2KDYA 5CLZA 4XXWA 5AB1A 1Z7JA 3QIBB 4J28A 3BPOB 5F1IA 3TVMB 2PCFA 5A2JH 4I77H 3I6KA 5DI8B 3KXFD 1BLIA 2XIDA 1NAKH 4PJ6A 4GRWH 2ROYA 3D85D 3U30B 5DJ8A 1D5BB 2J12B 4DGYH 4YZWA 3RP1A 1JZ2A 1Z9OA 3L6FA 4KTGA 1JVKA 4R3SB 4WTWA 1CG9B 4Z7NF 1ACZA 1ZEAL 2R27A 1JZHA 3D50A 4RAUA 2R59A 5HHXH 4WNJA 3OR7B 1NGQH 1XGTA 3ARGD 3QA3A 1RZJL 4YDJB 3NZUA 5DK2B 1UUNA 1ASOA 3CC1A 5HI4C 1XSOA 5BVPL 2OTUA 5ALCH 5ESQB 3N1PC 3FRPA 4RQQA 1Q94B 4U1KA 2YPLE 3AC0A 2B5IC 3APDA 4RGOL 5C3TA 4FXGB 4DUXA 2BS8A 4IEFB 4J8RB 5J7CC 4G8FA 2HFGH 4ELMB 3LNDA 4B9KC 3WLBA 3CFNA 5EZLB 5FOBA 4FZ8H 1INQB 4KTEL 4L1HA 1WYJA 3HNTH 4LP5A 3UJTL 1EGJA 4V1DB 1SNRA 3VRLE 1R3IL 2XTJB 2Z0UA 4MS8D 1HHKB 4R97B 1OO2A 1UWFA 4FQQB 5EC2A 4Z1PA 4BEIA 1GR7A 1H8NA 3PNRB 2NZ9D 3ULVD 5EIIG 1NUGA 3C5XA 3D4GA 4ZMLA 1BD2B 3MNWA 3VXRE 4BDVA 1I9EA 5I76B 1HZLA 2FJGA 5HYQA 2V7NA 3OKLA 4JFVA 3V4VB 1GC1L 4PRBA 5E5UB 1I3UA 1U8JA 5KVFL 3PPSA 1B88A 4JFFB 1RU9L 4GKSA 1N6QL 4LFHD 3HNVH 4R4BA 3WUWA 5AG8A 4P5TD 3UACA 4LVHB 4NENB 5T1DL 3ELAT 3QZMA 4PLNC 3RDTD 2DQCL 2ICWJ 5E94B 4Z95H 3DJZA 4Z7OB 4JG9A 4NJ9H 2DF3A 4N6RB 4UB0H 3B2XA 4XNQB 4X7SH 4BHUA 4QI3A 5H4ZA 3FN0H 1UHVA 2KPWA 4KC3B 1SXCA 1YJDC 3FRPG 4ORZC 2GBTA 3DVIA 3PWPA 4GXVH 4YDIL 5EB9A 5TE6L 3RY4A 4DVRH 2LHAA 4YHPA 2HT2C 3CLEL 3V8CA 4DQAA 5JXAL 4PN6A 2J88L 1QA9A 3GBNL 5TF0A 3VXMB 2G3MA 4L4VD 4JR9L 1KZYA 5FWQA 3EXJA 3SO3C 1TTUA 1UD3A 3VXOB 2P5EA 1F1GA 2GCYA 5DRZA 2QQLL 3BFQG 2NY4C 3KL3A 1AQHA 2NQDA 5DUBA 2VISB 1RZQA 2BVOA 2NPLX 4MNQE 4E9LA 1JWMB 1MIMH 3V0WH 1JF6A 2BC4B 1NFAA 1DJGA 2DQEL 2FX7L 4HXAH 1IVTA 5IVXB 3HI1A 4JO8A 3FHEA 4LPUA 2NXYC 3AGWA 3DYOA 4O2FB 1GXEA 4A2EA 1WCBB 2G3NA 2WN2A 5TQ2H 4KDTA 4XX5A 3QC5X 1IEHA 3B8SA 4N9GA 3B9KA 1HZKA 5D5ME 3U4BH 4XP5H 4PY7A 4QRSB 4UQ3B 4X5LA 2OFQA 1FNSL 4NZRH 4OD1L 4YQXH 5FO2A 3O45A 5KYWB 1YQVH 1FAKT 4F7PA 4KHTH 3L3OA 5JHBA 2XN2A 5K9KB 1CZ8L 2PPCA 2XIIA 1W6LA 1RCYA 2V7HB 3ESVF 32C2B 4PVLA 43CAB 5D7SH 4GIAA 1HYSD 1OWWA 1TSRA 2E7MA 3SCMD 4TPRL 1LXMA 2FJFB 4YUEL 2JCCA 3HS0C 3RGVC 1FORH 4YC2C 4N8VG 4GSDL 3SKMB 4I5BA 2VNCA 1C1EH 4O00A 2R0ZL 1MFDH 5EO0A 5IJDC 5JW5A 2DI7A 1TYEB 3PDOA 2HVJA 5I6MA 2BNQA 5DDHA 4WO4C 4ODTL 1GHFL 3P11H 4HU2A 4Z7WB 1TCMA 2A1WL 2JLPA 1AXSA 2ZXCA 4XVTL 1LGVA 3X14A 2R56H 3I9IA 4MA7L 2AV1A 1FP5A 2BP0A 2IQ9L 1HIMH 3L9RB 4HJ1A 2CIKB 3HG4A 2XYCA 2QBWA 2VDML 4OLEA 1D6VH 4XWGH 1UB5A 4HISA 5BRZB 4AENB 2DEXX 3MO1A 3P4LA 2EVJA 3O6ML 5T3ZE 3MCKA 4NLHA 4UINH 3DTUB 2EUVA 3BN9C 1ICTA 1MHEA 4NZUH 1HSBA 1NL0H 1LDPH 4Z7UA 1NCDH 2EEDA 1Z9LA 4S1RH 1IAIM 1V3KA 1X5GA 1CFMA 2VERA 3BXNA 3HNSH 5EUOF 2MCPL 1YDPA 4JFPA 2NX5D 5EO1A 5HHQA 2C7FA 4OIIL 2K7QA 4XBGB 3WNKA 2Y1VA 3QEQB 5TDOA 1NTDA 4AYGA 1I7UA 1F4YH 2PWHA 1UCTA 1MJ7H 2ZPKL 4CADB 3SOBH 5INCA 4YBQC 1E4JA 4NS0A 3VFVB