1JZEA

Pseudomonas aeruginosa azurin ru(bpy)2(im)(his83)
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
128
structure length
128
Chain Sequence
b'AECSVDIQGNDQMQFNTNAITVDKSCKQFTVNLSHPGNLPKNVMGHNWVLSTAADMQGVVTDGMASGLDKDYLKPDDSRVIAHTKLIGSGEKDSVTFDVSKLKEGEQYMFFCTFPGHSALMKGTLTLK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords azurin
publication title Electron tunneling in single crystals of Pseudomonas aeruginosa azurins.
pubmed doi rcsb
source organism Pseudomonas aeruginosa
molecule tags Electron transport
total genus 32
structure length 128
sequence length 128
ec nomenclature
pdb deposition date 2001-09-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00127 Copper-bind Copper binding proteins, plastocyanin/azurin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 1jzeA00
2WO2B 2DV6A 1CYWA 3UAEA 3X1BA 3NJIA 3AG1B 4HIPA 3SBQA 7PCYA 4FAAB 1WA1X 3ZBMA 1ET8A 3T6WA 3TASA 1PMYA 3NJNA 3ABLB 1DZ0A 3H4FA 1NIEA 3QJQB 4BDVA 5B1AB 1OOWA 3ASNB 3L45A 1ZDQA 3NSFA 5B3SB 2YAPA 1IC0A 3X2QB 3OMAB 4NAJA 4PCYA 4BDVB 1V54B 6PAZA 2GI0A 4BXVA 4P5RA 1AZUA 2B3IA 5LDUA 1IKOP 3PAUA 4A2DA 3FS9A 1ZV2A 4A2HA 1JZIA 3NJJA 4G72B 1URIA 1WA0X 2AANA 4F2FA 2XUWA 3WKQA 3EH4B 3TBCA 2VN3A 1GSKA 1W6WA 4N4YB 4DP0X 5A7EA 1JVOA 4HHWA 3WNIA 1PY0A 2QDWA 2QDVA 3UGEA 1AG0A 2FQGA 2UX7A 4JKNA 1PNDA 1HFUA 4DP5X 2XXGA 3FSWA 1GW0A 4AX3A 2XYBA 1R1CA 1OCZB 3UABA 1J9SA 4G71B 3MBWB 3OMIB 5B1KA 2R7EA 4Q89A 3SQRA 4AKQA 2YARA 2AZAA 1AR1B 1AZCA 3FPYA 4KO9A 3FYIB 1GY2A 2LLNA 4KO7A 4GYBA 4A2FA 1ZPUA 4DP6X 2R7EB 1KGYE 4G7QB 3CVDA 1SNRA 4KOCA 1I53A 1J5CA 2OV0A 2IWKA 2IAAC 1JZGA 2FJSA 4YSAA 2YQBA 4UAHA 1E30A 2IWEA 3ABKB 3X1FA 2H47C 1KV7A 2XV0A 4QKTA 2CCWA 2UXGA 1EHKB 2GC7C 3TA4D 3PXLA 1XMEB 1ZIBA 2XU9A 3QJRB 1W6LA 3CDZA 2GBAA 1QHQA 3NJLA 3NT0A 1RZPA 5FC9A 6PCYA 1JXGA 2VM3A 1SHXA 2EIMB 4YSPA 4YSQA 4E9WA 2TSBA 5EHFA 4HCGA 3CDZB 1OCRB 2QPDB 2VSMB 1ZDSA 4BWWA 3AG4B 1DYZA 1SF5A 2IDSA 4KNUA 5ANHA 2TSAA 1XB6A 4YSDA 2OCCB 1MZZA 3S3DB 3AG2B 4YSEA 1ASOA 3NSCA 2PCFA 2FNWA 3NJMA 2Y69B 1X9RA 4CSPA 3QJTB 3AG3B 1L9RA 1JERA 2FT7A 1J9TA 3EF4A 3MX0B 4GP5B 1PLAA 4E9VA 3X1EA 2PLTA 1TEFA 4W9ZA 2UXFA 3FU7A 4X4KA 2N0MA 1KYAA 3EH5B 1OCCB 3X1GA 4DPCX 1BEXA 5I6MA 1JVLA 2CAKA 3FU7B 7PAZA 1BYOA 3FQ1A 1PF3A 4AKOA 4G7SB 5B7MA 1TKWA 3GYRA 3ABMB 3NJKA 2BW4A 3ABGA 3ZDWA 2NRDA 4K9JA 4AI7A 4BK5C 2YAFA 1A8ZA 1V10A 2MRYA 1OE2A 1MDAA 2BW5A 4L0PB 3AY2A 1NPNA 1M9WA 2OJ1A 5IY5B 2IWFA 1AIZA 1OE3A 1FA4A 2IDFA 4JHVA 1T5KA 2Y1AA 1NPJA 4YL4A 1A4AA 2AZUA 5PCYA 4FA7B 3PAVA 1SFDA 4DP1X 3IE9A 4KOBA 1F56A 1PCSA 1CYXA 4P5SA 5D4IA 2VW6A 1KBWA 2PPCA 2FT6A 2JKWA 4E9TA 2J57A 1IBYA 1ID2A 1BQKA 1E5YA 1PLBA 4GXFA 5TK4A 1BQRA 3AW5A 4AZUA 4HCFA 4BWUA 3NSDA 4HCIA 2VSKB 1L9QA 2UXVA 1PZBA 2MTAA 3GDCA 3NJGA 1OF0A 3JT2A 3NP3A 3KW8A 2XV3A 2BZ7A 3FYEB 1M57B 2UXTA 1BXUA 5I5JA 3QJSB 3NJHA 4WKXA 2YXVA 3PCYA 2H5UA 1AOZA 3EHBB 5B1JC 5I6LA 3QPKA 2DY2A 1QLEB 1JZEA 1JZHA 3T6XA 2HLEB 2VW4A 3T71A 5I5MA 1HAUA 3GXUB 2XXFA 4NERA 1RKRA 2PPAA 2DWSA 4GY4A 3N55A 3OM3B 4DPBX 1SDDA 5D4HA 1GS8A 3NYKA 4Q8BA 2PPEA 1NDTA 1SDDB 2J56A 3IBOA 1SFHA 4YSCA 2IH9A 2XVBA 4HZ1A 2IH8A 2PCYA 2E86A 3S8GB 4YVUA 5I5IA 2J55A 3FT0A 3ZX1A 1ASQA 3S3CB 4G70B 3IEAA 5AFAA 1OCOB 2AVFA 3CG8A 4MFHA 1QNIA 2YAOA 1PZCA 1FFTB 8PAZA 3H4HA 1WS7A 2GIMA 1KCBA 2H3XC 4JHUA 4TXVB 1NIAA 2PPDA 3IN0A 3X1NA 5F7BA 2YXWA 1CUOA 4WTQA 4A67A 2P80D 1BQ5A 5I6KA 5I6OA 1KCWA 2DYSB 1BXVA 2CBPA 3EH3B 4HHGA 1WAEA 2BP0B 3V9EA 2HX8A 2HXAA 1L9PA 3FU9A 3NP4A 4N8UA 4PAZA 2W8CA 2CALA 1KDJA 3WI9A 5E9NA 1SF3A 3JTBA 3HEIB 3U25A 3WG7B 4GP4B 1TU2A 1GR7A 4GP8B 2QT6A 1E5ZA 2EIJB 2BHFA 2EILB 1B3IA 2UX6A 3DKHA 3OMNB 1AANA 2HRHA 1J9RA 1SJMA 1ZIAA 1ET7A 2FQFA 1JXDA 4M4RB 3TU6A 2B08A 3S3BB 5B7EA 2XX0A 2ZOOA 3QJVB 4W1TA 1EZLA 1JOIA 1VLXA 2FTAA 2I7OA 1PNCA 1N68A 5TK2A 2FQDA 1NIFA 3H56A 4HAKA 4A68A 5I26A 4UF7C 5I6NA 4YSUA 3BVDB 1WS8A 3WIAA 5B7FA 4A66A 5AZUA 2IDTA 4G7RB 2WO3B 1A65A 2J5WA 2FT8A 1MG2C 1MG3C 3T6ZA 4A2GA 3D12B 2ZXWB 4AKPA 4E9QA 2DWTA 2W88A 3FSVA 3PLYA 1AZNA 1A4BA 1OV8A 1NICA 2YAHA 3FU8A 1J5DA 4YSRA 4DP2X 4F7KA 2IDUA 1ILUA 1PZAA 3NSYA 5D4JA 1A3ZA 1HAWA 3QQXA 1AZRA 1TEGA 1JZFA 1KBVA 4E9SA 1RZQA 1GS6X 2PP8A 4KNSA 3QJUB 5B1JA 1AS7A 3NJFA 2GC4C 2BP8A 1BXAA 3DIVA 2YAEA 1NIBA 1BYPA 4HALA 3AZUA 1XB3A 2VM4A 3T9WA 5F7AA 4A2EA 2CJ3A 2ZONA 5B1BB 1AAJA 2BP8B 3UADA 1RCYA 2HX9A 4YSTA 2WSDA 1E67A 5AKRA 3RYMA 4DP9X 3ASOB 1W8EA 1V55B 3T6VA 3WNJA 3SBPA 2BO0A 2XV2A 3C75A 1JZJA 2YAQA 3IN2A 2ZWNA 4YSOA 2YAMA 2I7SA 1CC3A 4ENZA 1CURA 3FPXA 1GYCA 1N70A 3OD3A 1AS8A 2EIKB 1FWXA 2I85A 3FSAA 4KNTA 2A3TA 4YSSA 4DP4X 1OE1A 2RACA 1SHWA 2JXMA 3OQRA 2CUAA 2AFNA 1AS6A 2Q9OA 3CZUB 3KW7A 4NB7A 3CVBA 3FQYA 1E65A 1ASPA 2XLLA 4YVNA 1JXFA 4M3HA 2EINB 4QLWA 1X9UA 2XX1A 2QPEB 3ZIYA 2PP7A 3FSZA 4E9RA 1J9QA 2JFCA 1NINA 2BP0A 2GSMB 4UANA 1L9TA 4KO6A 2FWLB 4E9XA 3SBRA 4EF3A 3UAAA 3UACA 2HRGA 3PAZA 1GY1A 4KO5A 1IUZA 2VMJA 1BAWA 1UATA 3HB3B 2XWZA 1L9OA 1NZRA 1AQ8A 3ERXA 2PP9A 1AACA 9PCYA 5PAZA 1GS7A 3S8FB 2GHZA 4F2EA 2VW7A 2IDQA 1PLCA 2GB2A 3N2JA 2BWDA 3G5WA 1ADWA 4DPAX 4E9YA 5I28A 1NTDA 1IBZA 3DTUB 1YLBB 2Q5BA 4ZK8A 4DP7X 2X87A 2DYRB 2HX7A 1MZYA 2BZCA 3FQ2A 2X88A 1AG6A 1NWOA 3TBBA 3V9CA 4BXSV 3BQVA 3WKPA 1WA2X 1ILSA 4RH4A 4BWTA 1ETJA 1XB8A 1NIDA 1L9SA 1M56B 2PPFA 2P80A 1AZBA 4DP8X 2HZHA 5I6PA 1PAZA 3CVCA 1ET5A 1A4CA 1KDIA 4CSZA 3PPSA 1NWPA 2BWIA 2FQEA
chains in the Genus database with same CATH superfamily
4LSPL 4WW2B 1ONQA 2VKWA 1ANUA 4TSCL 2DDQH 3X13B 5ESQA 3VX1A 3CN2A 1J8KA 4L4VB 4WFEE 2JKJA 1T21B 1W80A 4U1IB 2ADFH 5INDA 1CLVA 1MJ8H 4JAMA 4X8CA 2ZOUA 1B2YA 1J8RA 2VAAB 4YK4B 2EIBA 1BMZA 3NJNA 2LTQB 4R8WH 1CLOL 5K69A 1BFVL 1LWJA 3WKYA 1PEZA 4XBGA 3LQMA 3Q6FA 4FFZA 1FYHB 5DWPA 1I1CA 4JY6B 4F93B 2NW2B 2OJZL 2GUYA 4HX1B 1E2ZA 5DQJB 4JANA 2H1PH 3OF6D 4P4KB 4YAQB 1CN4A 4E5XB 1ZV2A 4X7TB 4FABL 1O9WA 1KXTB 4JQXC 3KZ8A 1EXUB 5IWLA 3B5TA 3HZKB 1KNOB 4EEEA 4BE6A 3CBJB 5DVMA 1IJ9A 3S97C 4PIBA 3CAFA 3ZYIA 5DD6B 5JOFA 1YYMH 4L3EE 5CP3A 5H37G 1NCUA 1Q94A 2VZSA 4IOFC 4ABVA 4JKNA 1P6AB 4WI7A 2G3MA 3C6EA 4GO6B 5ITFB 5C3IA 5D1XA 3K2IA 1ZJAA 2YPLB 2CNZA 4RRPA 5KSBE 1IGYA 3QRLA 2ZOLB 3FCUB 3QDJA 3QJHA 2ITCA 5D1QE 4BSVB 2Q86A 1AR1B 3RPIB 1N67A 4R7NB 3MYZA 3BEVA 2CJUL 1BREA 5IQ9A 5CJ5A 5E9AA 1DSFL 1AD0A 3L4CA 2XA8L 1JFQH 4TQ8A 1RUQL 5C0DA 5JDSA 3ZK0A 1SXSA 5JXEA 4YBLB 4HZLB 1JRHL 3FQNA 2YQBA 5I74B 3WOVA 4R7XA 1O7DC 3SE4C 2B1HL 2NY3B 2XV0A 3GXNA 4NKOB 5CFHA 1I9JH 1TVBA 1A3LL 4LLQB 1EHKB 3VFOB 1OP5K 3ZZLA 2YKLL 4MDJB 3A67L 3L3HA 4EN3C 2VQ4A 5EDXA 3JVGC 2GUOB 3KPMA 3N40F 4JN2B 1PZ2A 3VM5A 2HKFH 4PLJD 2DWDB 2ERJB 2FGWL 1J8HD 2W60A 3OB0K 5KANI 2EDRA 4U1KB 3U30B 3L4XA 1WFNA 3MRDB 3CDZB 4PGBA 2CBQA 1AKPA 4UTBH 2VR9A 1D9KD 1QR1B 3EJUA 3ZTNL 1M6OB 1AMYA 1T0NB 2EO7A 2Z92B 3AXHA 1DJGA 2FWOB 3NTCL 1UB6A 4R9HA 3VXNB 2F8OA 5C3TA 3IS1X 5LDSA 4ZMXA 3HS0A 4YHYB 4TUUA 3QHTC 1G1CA 3P4MA 3QFJB 2OMYA 1VFMA 5CN3A 4GNKB 1U33A 3ZZ1A 4GSDH 1MOEA 4KTEH 3OJDA 4WV1C 2H8PB 2C3HA 1W8OA 4N68A 2RFXA 1CDCA 5J8OA 5D1XE 3GD1C 4HUWB 3RL1B 5H37A 3FJTA 4P2QA 3DUSA 3V0VB 3MJ9H 3QDJE 4YFEA 7PAZA 1A3QA 4UB0H 3NFPB 1XHHA 4JKKA 2BC4A 3M1BA 3RP1A 4KK5C 4FERA 1EJOL 1NMCB 5DD1H 1HESA 1D3CA 4UOJA 4WWNA 3VQMA 2A77H 2C7UB 2ZYRA 4GBXD 5AW4B 2Z93B 1H5BA 1RZFH 2R1XA 2UWEB 4GRMA 2ZSWB 5DCCA 2DLTA 4PBDA 1KB5H 4OKVB 3LSOB 3N44B 5DVNA 4XN7A 5F9AC 1GL4B 4GFXA 2FATH 4R7DA 3FT9A 2G60H 4AEIL 1LDPL 4X6EB 1DEDA 4OD1H 4AW7A 2N3JA 2CDGA 4JDZA 2VMEA 3IE9A 4G7VL 4NZUL 1AQHA 3JWOC 3IYLW 3FU6A 3HIZA 4P5SA 4XGZB 3EJCA 3TTYA 1KYOK 4DKFH 1S7TB 2NY6B 5E2TH 1KIPA 1F4AA 3DVNA 1WAPA 2EEFA 4Q9QH 1E9PB 5F0PB 1JMZA 1LO4L 2YZ8A 5GPRA 4HCIA 1I75A 3CXHJ 5CEYB 2UXVA 4OGQC 3VX0A 1XXDC 4LAQL 2KYIA 4P46A 2C1PA 1Z5YD 3ZTDC 3GIZL 4N20A 3QR2A 3GK8L 2UUDK 5KJRL 2B1AL 4JKMA 4KKCC 3QJSB 4A7VA 4LSTH 1C12B 3FT1A 4AIXA 1OWRM 1INEL 2BVUA 2GJPA 3UC0H 3X17A 4AY0A 3EHBB 1L6XA 5E8DH 2HTKD 3EJYC 3QPKA 4RAUA 4AW4A 1YN6B 2VLKA 1A6WH 3VYPA 1IGCH 3S4SG 2XXFA 1LK3H 3HG5A 4LARL 5JIPA 1PZUB 1KCRL 1HSBA 4G7YH 1MCRA 2W65B 4YUEL 4E9LA 1MQKL 2VERA 2ZXGA 2FX9L 3LZRA 1VPOL 4P2QE 4R97B 3MO1A 1ULVA 2QADD 2V2XA 4Y4FC 5GS1C 4AV4A 2ZSVB 3EOTH 5IG7A 1OLZA 4XNQA 1KGIA 1KJ2L 1YNTF 5FUOH 3JUZA 2MPAL 4WO0A 1LEGA 1ASQA 3FCSA 4OZGF 3HNTH 1S7VA 4JO4H 2P7TA 3NIFB 3CDGA 1Q8MA 5GZND 4N9GA 1UWEH 2F53A 4HFUL 4HT1L 2FBJL 4O4YL 5JW4N 3W5MA 3H4HA 3WIHH 1G1YA 5GGQL 4ENEC 5FO7B 1Z5LB 4I9WD 1CWVA 2ZUUA 3X11B 4OZIF 1PBYA 1UKQA 3DUHA 3PGCB 2ZCKL 4KH2A 4S2SA 4UM8B 4J1UA 3EFOB 4F37F 1RUMH 4W9GC 4KC3B 4XBPA 3BAYA 1UOLA 1TLKA 5HYSG 5FW6A 5I6KA 2X7LA 1U3HD 4MQTB 4YIQA 3QI9A 5L4JA 1WFJA 3FT3A 3BKCH 3V9EA 4KI1A 3SPJA 1BEYH 4I5BB 1B0GA 4DEWA 1G84A 2VJ8A 5EEXA 2DL9A 4KHXL 3HB3C 5AD0B 2AJXL 4K5MA 3H9SA 5I1EH 1TQUA 3MJGX 4LLUB 5F9OH 5KEZA 2GBUA 4EUPA 1M6UA 1HL5A 3BP7B 2R4RL 1XSKA 1AGBA 1HOEA 4YL9A 5BRZA 5KBPA 4HFWB 1SLVA 3QUXD 1AD9A 3D2UB 1QSFA 1ZIAA 1MJ7L 1JXDA 4M4RB 3FH8A 4MMXA 4XO5A 4X8XA 4M56A 1JL8A 2H0JA 5E4EC 5LWYH 1JOIA 4JQVA 5TK2A 4KQ4H 2R27A 4IRSC 4PJFA 5JW4R 4LCUB 1HIMH 4QO1A 2HYMA 4JFYB 1G9MC 4D9RD 5IVNA 4HAKA 3V4VL 3TNNB 1DTUA 1XIWD 5EU5A 1T66D 1LO5A 3DPDA 4JM4L 2E4FA 4M43H 3VQ2C 1BZQK 5FHBH 1NGWA 4MNHB 1DDHB 3WHE1 4A2MA 3FTYA 5HI3D 1DBKL 5C8JA 5E9DA 2GK0B 1NUNB 2A5UA 2OX5B 3D12B 3QXAB 2OP4H 2Z0UA 3QNXB 3S5LG 3L4WA 5IJDC 3PWLA 3MQIA 4TVPD 5FCUL 5I1IH 1FSKC 2WO4A 3L3OC 4HG4J 4G8GD 1OV8A 4Y5YA 2XN9B 4H1LB 1LTXA 1KY7A 4KGJA 4WNQA 1FZMA 1ED3A 4GINA 3FAWA 5EIIA 2RMNA 5CP7A 2YBGA 1YEDB 3V0JA 3Q48A 3OZ9L 3T2PA 4GMTH 4Z76A 1MH5B 3PHQB 1DVUA 3MV7D 4NRYB 1KENL 5FGBC 3II1A 2B2XH 3L7FB 2HLAB 1P4UA 1RZQA 3GXMA 2X40A 4IIQA 3ZL2A 3FQXA 5IB4A 1XSOA 2XIIA 2PP8A 5HGDB 1QYGH 1CR9H 1XL4A 5GJSH 2E46A 3PFUA 1KWKA 3US1A 3ML9A 3MRFA 1MFAH 3H2WA 5HYJA 4X5WB 4X4YA 1TTBA 1R17A 4A7GF 1ETA1 1DL7H 1NA8A 2YPKB 2Z35B 3H9SE 2WHVA 4WI0B 2NDFA 1I7ZB 2Z4QA 3F8UB 3IMWA 2GJJA 4PY7B 4POYA 4PRIB 2JK5A 4G11A 4QMEA 3ESVF 3RTQA 3K6NA 2OLDA 2BCKB 5BRZE 4RISH 3LCYA 4MAZA 3IDXL 3OTTA 2NUPB 2WZ5A 1V7NL 3HC2A 3QUML 1QSFE 3RNKA 5GS0C 1U6AH 3V10A 3Q6GH 4BFRA 4G6KH 4ZO8A 5DRWA 1PDKB 4HPYL 5SX4I 3GLEA 4ENZA 2XZAH 3GTVA 3TZVA 3FTWA 3DIFB 3GKWH 3RDTD 4PJFE 5IHBA 1O6VA 1JK8A 3VU2A 2JB6B 4N6QA 1CG9B 2VO8A 4PD4J 3DHUA 3UBGA 2XTJE 2XKNB 2Y5EA 4YR6B 1RZ7H 2JXMA 2WLLB 3S5ZA 3OQRA 4NB7A 1K2DA 4K4KA 5E9DE 5I2IB 3I3BA 2VDML 2ZKXA 1NC2B 5IP4A 5DF0A 1IZJA 5CCKH 1IU1A 4G9DA 3HNVL 3KL3A 3ZT7A 5L6YL 4LVOC 3WEAA 2B0SL 2HTKC 5KBNC 5TE6L 2DIJA 2XBDA 4QYOA 5CSBA 5A2KH 4K5PA 1I8IB 4NM8H 4KJQC 3LH8A 5JNYB 1TQWA 4QOKA 4P57B 3WUZA 4Y5VA 1G6RB 1VACA 3DV6A 5EC2A 3BDYL 4JZJB 1JTOA 3HC3L 4C4UA 3S88L 2P1YA 1CQKA 3DSNA 4PP1C 4H2AA 5FFGA 1OHQA 5ID0B 4YDIL 1F4WL 3QUYA 4WW1A 3E9UA 5F44A 2VLRD 3RWIA 3L1EA 4BZ1H 2QADC 3A4FA 5HYJE 2K4AA 1JGDB 1AQDB 4I88A 5F71A 2VXSL 3OJVC 5GHWL 1SOXA 1U3JA 2QZQA 4PJCE 4W9DC 4WWKD 2KLTA 1PLCA 3MLTB 4NKIH 1XBDA 4TRPL 1G7HB 4JFDB 2AV7A 4UQ9A 4L3EB 1KJVA 1EA9C 1KFAL 2RIKA 1AG6A 2GVYA 3BSHA 3L95B 3PP3H 1TZOA 1U8KA 3MUGA 3BP4A 1IT9H 1N7ML 5IVXA 4ZPTB 1BM3L 2YFOA 1J48A 1L9SA 4G8IB 2Y3NA 1FO0L 1E9QA 2D0FA 3VXQB 5D1QB 5F7NC 4YLCA 2Y24A 1BBJB 1KDIA 4CSZA 3EXJA 2HVKA 2VUKA 3MCKA 4RGOL 5GGUA 1U3HC 1D5IL 2HRPL 1RVFL 1CYWA 3RIFK 5MEPB 3UJIL 4FXGC 4LSQH 3O11B 1FG2A 3I75A 4U1LB 3NJIA 5LG1A 3O6FC 3SBQA 4FAAB 1ONQB 1TKWB 5D7LA 3UGXA 2PTTA 3WXWH 4DW2L 4OLUH 4JMXA 1SHSA 3TCTA 5GRJL 5LQBH 4K3GA 4LCIH 4JAMB 2BM3A 3K5RA 3QNFA 3QIWB 4Y1AD 4P2AA 3ASNB 4YWGL 3ZE0E 4UTAA 3IDJB 4R5TA 4PWKA 5DFVD 1IC0A 1W15A 3UYRL 3QUXC 1OCWH 3TCXA 3C5ZA 4OQTA 4XC1H 4XBGB 4D2NA 4OU3A 3Q6FB 3ARPA 2DLIA 4OFDA 4QOKE 5E8OA 5HJBA 2GJ6A 1I7TB 2IO5A 2K6WA 3FS9A 1AY1L 3KLAA 4CVWA 3IAGC 3LVEA 1WA0X 4JANB 3N1QC 1ORSA 2Z8SA 4WHCA 3TN0C 2VN3A 3DYMA 2V5RA 4LCCC 2KUTA 3DGGA 4RIRA 1EXHA 3SE6A 3LOWA 2X53A 1R47A 2MFNA 3WNIA 3SKJL 5CEZL 1U8JA 3ZMEA 1BFSA 5E2UH 3HAEG 1CCZA 2PR4H 3HC0A 3L1FA 4LCWB 4PG2C 1BF5A 5J6HA 2NDGA 1OCZB 4R4BA 4J3WA 1CBJA 5J6GA 1IAMA 4JG0H 1U30A 4OI8A 2ZKWA 2P3YA 2IAND 3FTXA 1SDAB 3FMGL 2ZWLT 5D1XB 4QR7A 1J1OL 1MAML 4G5ZH 4OZ4B 4IBUA 5CWSA 5IVXE 5J6SA 1IGYB 2J7LA 2CBOA 5F1OB 3FK3A 4D3CH 1ACCA 3QDJB 3QJHB 2ITCB 2N4IA 3U1SL 2Q86B 1RL1A 3V2AR 4JFTA 2NCMA 1I53A 2CO4A 3BEVB 5IQ9B 1AD0B 4H88H 3ZQWA 3VRJA 5C09D 1G5GA 1RH8A 3RA7L 1AO7B 3EOBA 5C0DB 4L4TA 4O58H 2X6UA 1KV7A 2KZ1B 5D7LE 2AK1H 5BVJA 4LFHG 3I6GB 4XOCA 2GAZA 3QJRB 3UPRA 4JPWL 1TVBB 2WLIA 1ZEAH 1QA9B 4TTDD 1P7BA 2SEBA 4ERSH 3L3HB 2EACA 1NMAL 4GUPA 1CBVH 4K94L 5EHFA 4HYTB 4NWUH 3KPMB 4Q6IC 2KC0A 3NJXA 4W6WB 4F33B 2W60B 1FZKB 4UDUB 3T2OA 5LGHL 2GJ6E 3DRTA 3LNEA 3KHOA 4PGBB 5E5UB 3J7HA 5ANHA 1VSCA 3LZLA 2QQNL 4D8PA 3GKZA 5JUEL 3RDTC 2NY0B 1JPFA 2PCFA 2GSIA 3EO0A 2JIXD 4UT7L 2VDNL 1DQKA 3MX0A 2PKDA 2K3TA 1JHKH 3K0WA 4FHJA 5K9QI 3HS0B 3LD8C 5FO8B 4NQSA 3P4MB 2OMYB 4WI8A 3GMOB 2YOCA 1R24A 2A0LD 4NOBA 5E7FA 3HI6L 4CUCA 1ZLWK 2H7WA 2WXOA 3HRZA 3EH5B 4I3SH 4JVUA 5DRNA 4TULL 1GMEA 1S78D 4HHAA 3EBAA 4WSKA 1DO5A 3UP6A 2CAKA 2RFXB 3Q2WA 4RZCB 1J10A 1W0YT 3QCUL 5EZJA 3V6FA 1JGVL 3JWNE 1IGIH 3FULA 1GZQB 2CKBB 5AW2B 4J7RA 3DUSB 3CZLA 1OAKH 1PYWB 4BK5C 2WQAA 3U4AA 4KDTA 2BC4B 4LP5A 2CKBL 4CAGA 1ROWA 4WGVB 4LVEA 1CLZL 3FFDA 3GPEA 1T83C 3TO4D 1H5BB 1P9MA 2J6EL 3EDFA 2K7QA 2R1XB 2ED7A 1NPJA 4GRMB 3ZDYB 1R5VA 4JFFD 2BMKA 2BIMA 2R0ZL 2CR3A 4KOBA 4MQXD 4K07A 4BK4A 3DMMB 4H8PA 4WWKC 1TPXC 4PJDA 3UJTH 4E9TA 4JDZB 2NNFA 4PS7A 5CR1A 1MFBL 1QBLH 1LE5A 4YHMH 4AJVA 4J6IA 4NN5B 4FFZH 1C5CL 1PLBA 1QVOA 4FLRA 3PY9A 1Y07A 1UM4L 3DVNB 2GY7B 3ZO0A 3VI4F 2ZAGA 5JMRA 1BYNA 1MFDH 3KW8A 3KH3A 2YRPA 4KKNA 5I5JA 5GS2D 3NJHA 3EO1A 3QIBC 1PLGH 4HU8A 3RU8L 2CK0H 4M5TA 4HISA 5E5MB 2DPKA 3QQNA 2C1PB 4P46B 1DQML 2D3VA 1WTGT 3VXSB 3BT0A 5J11C 4NXKA 1J0JA 1Z9NA 2X12A 4LHUD 2X4PA 3RB7A 1J0KA 1Q0XH 2YPVA 3OKEA 4M48H 4DGVL 4OUUA 4DPBX 4RAUB 3TM6A 1SDDA 4CMHB 4U6HA 2VLKB 3P4OA 4LOEA 4QTIL 1EJFA 1FIGL 4XP9L 2JJUA 1EZSA 2AGJH 3C60C 2QSQA 1HSBB 1GGBH 2E59A 4GLRI 2X38A 5AOJA 3NZUA 3IMTA 5DFVC 4QRPA 5FM5M 4MXVE 1MNUL 3GI8L 4ODTL 1FNGA 3KPTA 2V2XB 5E5LA 4UQAA 3KJ4B 3I9PA 5IG7B 2F5BL 3O2DL 3BH8A 2DTML 4XNQB 1X7QA 4LHJB 4HD9A 1QNIA 5F7HA 1KXQA 1LEGB 2XFXA 3T5WA 3FCSB 4AJWA 2Y6SC 3SPCA 4JKWA 2Q20A 5L0QB 4M62L 4N9GB 2F53B 4K7PL 2P5ED 3IFOA 5CO1A 1WGVA 4PJDE 1UWXK 2ADIA 2P80D 1BQ5A 2UY6B 2FJHA 4YLQT 5T3XL 1MCBA 1NCDH 3ARBC 1NMBL 3QWNA 3VI3A 3PL6B 4O2CA 1U4EA 2KH2B 4WEEA 4XBPB 1CLYL 2J1XA 3Q05A 3UL4A 3QI9B 4CJ0A 3QJFA 4TF4A 2XZQL 2WXMA 3FT3B 4YZFE 3HEIB 4IBVA 2VN7A 5D6DC 3BAEH 1B0GB 3K2KA 4JFHD 4KROD 4QXUL 1XH1A 3H9SB 1EJ8A 1WZKA 5I19L 4ZXBA 3T3PB 2G3ZA 3L1OH 2UX6A 1QPKA 2DMGA 3DKHA 5BO0D 3IMRA 1AANA 2HRHA 2X28A 4X6CF 1AGBB 5DT1L 1AGEA 2WZPA 3TU6A 1FP5A 1MW3A 5F6IB 1SQ2N 3PPEA 1SHMA 5ABAA 1EZLA 1AD9B 1ZGLB 2CJTA 1QSFB 12E8L 2WCPA 1AHKA 4FQQA 3ZXAC 2C3VA 2N7SA 1MDTA 3I6KB 4TTDC 3AC0A 4NDMA 4TUKH 3Q2CA 4OLYH 5CJOL 4PJFB 2E7DA 3W11D 5IJKC 5SWSA 4QO1B 3BVDB 3WIAA 3TEZA 1LMKA 5C0CE 4ELKA 4AE0A 5GGVY 1DQLH 3QDMB 4K5NA 5EU5B 3BGAA 3VFGH 4DUWA 1NGWB 5AENA 4XCEA 4QCIA 1BOYA 1X9QA 3SE8H 1KXQE 3GHBL 2AQSA 1DQJA 3MMEB 3ARFC 3FU8A 4XB3A 3U0TA 4AEEA 3F7QA 3PWLB 3BPLB 5IR1A 4Y9FA 3PUUA 1U8PA 5AVZB 1TTRA 3ESOA 4URTB 3ZPDA 3NA9L 4Y5YB 1JZ2A 4NP4H 4OW6A 1FZMB 1RZIB 1ED3B 2Q7AA 3QG6A 3X3FH 5LNEA 1EBPA 5EIIB 4FP8L 4KY1H 4Z76B 4HJ1A 4L9LC 2P8LA 2HAZA 5C0AD 1HS6A 1S78C 4R2GB 1QKZL 4DVBA 4IIQB 4KJPD 2GG1A 3NACL 2NTFA 1GGIL 1GOHA 4UZUA 3NFSL 5J3HD 3HPJA 4PWJA 4U7SA 4X7FC 3SQBA 2F58L 2R29L 1NKOA 2IQ9L 5K1NA 1RULH 3U4BL 1JCVA 4X4YB 2MOQA 1OF2A 2ZT9C 3FQTB 4U6XB 3QDGD 4XCFH 3AQXA 4YSTA 2WSDA 1DP0A 2Z4QB 1LMIA 3TO4C 4OCYH 2JK5B 4K2UH 3RTQB 4B9KC 4F27A 1FLRH 2DH2A 2Q3AA 3P30H 1PZ3A 3DI3B 4L18A 4BYHA 4PLOB 3V6ZA 2D8KA 8FABA 3L9RA 2IMMA 2Z7WA 2R69L 4GRLD 1Z32X 5ECJE 1L7IH 1NCCH 3MRNA 5AZEH 1RIVH 2UV3A 3MA7A 2Z31C 4GAGL 2BHYA 3TZVB 2G3XA 4XRCA 4ATWA 5TQ0L 4KNTA 1KB9K 4CSTA 1UD6A 4NFDA 2NSQA 5SWSE 1HK6A 1FGNH 3WFCL 2ZX9A 4ICWA 2Q9OA 1M05A 1HQ4A 5SWZA 4M7KL 2DM7A 2WYZA 3U79A 3VTAA 3DXAA 1U8LA 3BGFB 4KKQA 2JXMB 1XGYH 5KVFL 1C8PA 2WP3T 5I1JH 1WH0A 1K2DB 4UT6L 4M93B 1JYVA 4OD3H 5CSGA 3MRQA 5EV7A 2CR0A 1AGDA 4UIMA 2BXYA 3NESA 4ZTOL 4FQXD 4KKAD 3V4PB 3N43F 4X5RA 4ONFH 3S5LB 4PCSA 4FQLL 5CZXC 3IGLA 4NN6B 2VMJA 4QYOB 4L05A 3GS0A 5IESH 1E4XH 4QOKB 1REIA 4NRXA 1MY7A 4WI9A 4Y5VB 1VACB 3DV6B 4HK3N 4JG5A 5EC2B 1PZDA 3CXDL 1JV2A 3S34H 1QFWL 3K46A 4FHKA 3DSNB 1HHGA 4ORGA 4GSQA 3RWDA 3QUYB 4WW1B 3RWIB 3N2JA 2J5LC 2X6BA 1PJWA 4P9ML 4PS4L 4WO4A 3DTUB 4OD2A 1IC4H 3E1F1 3MODH 1QRNA 1A4KA 4PRNA 4DHLA 4EUPH 5KWYC 3MJ6A 2DL2A 4YE0A 3INUH 3NIDF 5AYUL 5BZXA 3Q5OA 4NQDD 4JR9L 1KJVB 4NKQB 4XAKE 4X2UA 3TPUA 3TOPA 3VFNB 3D3VB 2GPZA 2D31B 4HXBH 4P23B 1YY8A 5JQ6L 3APMA 5G5DA 1U8KB 3MUGB 3OLGA 3BP4B 4K23H 4NHCH 1MWAH 3PPSA 1YPZF 1OTUC 5IBUB 5IVXB 1UEYA 3I2CL 4N6RB 3K6IA 2WO2B 4RRPM 2E76C 5DMGD 3UAEA 2WK2A 5IT2H 1U8CA 3KPSD 2DQGL 2ZYHA 3MCKB 1E28A 1G9NC 4PB0L 2K70A 5SWZE 1UZGA 5EU6A 3SDCA 4R3SA 3OSKA 4OJAA 2CM6A 3DXAE 1FG2B 3I75B 4Q4EA 3MRMA 5K9OA 2YO3A 3IGAA 2CDFA 4KROC 5D7LB 3UFIA 1TQSA 3CPLA 2PTTB 4DQOH 5GXBB 2EQDA 1RFDH 1TVHA 3BOVA 5LAXA 1ZLVH 4LQFL 3FZUD 2O30A 1TJXA 1ZHNB 3OMAB 4OCLC 1I8MA 3VD5A 1N8OE 1SGKA 3EIFA 5GGRY 3HFML 2AKRB 3LN4A 3UJJH 3NJJA 2CO3A 5IMLB 5LXGH 3C5ZB 4EXKA 4X4ZA 3WKQA 3RVVC 3ZHKA 3IDNA 3BH4A 4HEPA 5EH1A 2AXFA 2OSWA 5L7XH 3D1MC 3KLAB 2WBJA 2BNQA 2D03L 3T4YA 3BH9A 1ORSB 2EEBA 4ETQA 3H42L 3W11C 3QZMA 3N41B 5A7EA 3B4NA 3DGGB 3UGEA 4NIKB 1IC7H 4U3SA 3KLDA 2CBTA 5AKSA 4H20H 3FSWA 3WEBA 5EZPA 4DK3A 4ODVL 2DQIL 1QRNE 2DB8A 4J2QA 1U8JB 4M1CD 4QTFA 2J4WL 1MIML 2JE8A 2PN5A 3EBGA 4HUCA 4J12A 4XX1E 3SJVB 2IC2A 5J6HB 4KZDH 4R4BB 1CTOA 4FXLA 3T2LA 5J6GB 3BAIA 1MXDA 4A2FA 5F93C 3L9EA 5ICUA 3CFEA 2ZXEB 4OFIA 5CWSB 1MCWW 4B50A 2X4OA 1NDGB 3E6HB 2OW6A 1S7SA 2F8XC 3PIQB 4PVBA 2K4WA 4KJPC 1EHXA 1BZDA 5I0YA 2G2RA 4GW4A 4MAYD 1Y1UA 3LKPA 1XDTT 3NCYS 2B4CH 3P0YL 5EU6E 3VRJB 4TLKA 5J3HC 5TPWL 5IFJB 3LXCA 3PXLA 4L4TB 2ISDA 2FUTA 3F6JA 1QZ1A 5BMFH 2C9QA 4AL8L 1CQYA 2A6DA 1FYTD 1SHXA 4YGVB 3RGVD 5JHDD 2F9BT 4MMZA 2GAZB 4OY9A 5F7EL 2YEZA 3SSGA 4D8OA 4F1ZA 3QIUA 3CFKA 3LRSA 2BIPA 2SEBB 4GUPB 2GEQA 3R4RA 5AB1A 3EFDH 4GRLC 2ZKHL 4TVUA 2H0EA 3AG2B 3V4VA 3MC0A 3DRTB 4BFGA 3NSCA 3OLIA 1JPTL 5A1AA 2BJMH 2OFQA 4JFZL 2BNQE 1MCNA 3LPWA 3T65A 4AGPA 4XC3L 2C9PA 4FQIH 4UZGA 1JPFB 2V9QA 4YDVA 1KTDA 2GSIB 1SJVA 2PCFB 2YJLA 1PZ5A 3D7PA 3Q8AA 4LP8A 3BIKA 3MX0B 3VD7A 5CCGE 1DUYA 5GSRA 4MJID 3HE6D 2ZUVA 4WTZG 1MY5A 2BS71 4NQSB 3SGKC 2EDWA 1OCCB 1I85A 3H54A 3V0WL 1A3RH 3X1GA 3RI5F 4GG6B 2OYKA 2IAMD 1THCA 1PF3A 3HRZB 4IRZA 5FGCE 5DRNB 4YHKH 1MAKA 4R4FL 4HHAB 2F19L 2OR8A 4M1DH 3IPFA 5EZJB 1H0DA 3OPZL 4S1SL 3HAEB 3V6FB 4KKAC 2O4EA 4FEIA 1XSIA 2HB0A 2MRYA 1TQVA 4OVUA 4XZ4A 3UPAA 3AY2A 3MLVH 2A99A 1LK2A 4U3XA 2Q2LA 1WSST 4WJ5B 2IWFA 1QEXA 3LZPA 2OSLA 1ETB1 2ZCHL 1HQRA 5F0MB 4PYGA 2CZNA 3FFDB 5E95B 2XACC 3ML8A 3BSZA 4PW4A 2L04A 2KZKA 4OJEH 4K8RD 2ICEA 1R5VB 3D69A 4PJ5D 2BMKB 4W4NA 2VXTH 3GRWL 3MBED 1NCHA 4P3DA 4MCNA 2I9TA 2F7OA 4OM1H 3FHQA 1SOSA 2APFA 3VD0A 1E5YA 5F1NA 3QUMA 1F3RB 4N0FA 3MFGB 5HD8D 1T89A 4UTAH 3QUZD 1A6UH 1OKEA 1GGCL 2R56L 2VSKB 3MNVA 3IDYB 3LS4H 4OQTH 1PZBA 3JV0A 5EB9A 3ZDXF 1QVOB 4RGNE 5KYUA 1DHKA 4JHWL 4KPHH 1RZGA 3DWTA 3GSNB 3KPRD 4NQQA 3G04A 4KKLD 3NRFA 1AOZA 1NH6A 3GSNL 5J56B 5TE7H 2XT1B 4XPGH 3N42B 3HC4H 2ADGA 5EFIA 4XPFH 5D9SA 4P2OA 3QCVL 3VWKA 2D9CA 4L3FA 4H4NA 3T0EA 2HFEA 4Q9CA 3OKEB 1D6VL 3UMNA 1Q9KA 4K3EH 5AYQA 1SDDB 3D48R 4POZD 4IYKA 2NX5D 4U6HB 5FHAH 3P4OB 1CGVA 4RFOL 4WTZA 1JWUB 4HD5A 3FZUC 2FNBA 5AW5B 1UYWL 2C9RA 3GHPA 3JWNH 4U49A 1KWGA 4EQ2A 1B0RA 5HHQA 1ZGLM 1MELA 2XCMC 3ARGD 1E4WL 3TIDA 3NSXA 4OGAD 4QRPB 5F6HI 3G5YA 3UEZA 4F15C 2BSED 3CG8A 3L3JA 4XVSH 4Z7WF 2OS7A 2QEJA 3SDYH 4G5AA 3WJMA 3DO4A 3F2LA 3OXRB 1X7QB 4U1GB 3P0VH 4JHUA 1NIAA 4J6RH 4NX0A 2BOBA 1CGXA 2QFPA 4AMKH 3ZUNC 2YXWA 2VITA 4Z7NE 1IBGL 3CN1A 1KCWA 1TYRA 3IFOB 2XZCL 4YXLL 1UENA 4R5VA 5K33A 4AQEB 1F0LA 3MRGA 5DZNA 2ADIB 4N2BA 5B1CA 3WLWD 1FFOA 3BRDA 7TAAA 2H4EA 4N8UA 4NN7C 3US9A 5L2KD 5EEUA 1JHLL 2C3GA 2C9AA 2HN7A 5E6SB 2NR6D 1FO0A 3JSSA 4G83A 4AM0A 3VI3B 4N0UA 4O2CB 2VLJA 4IHOA 1QSED 3A6OA 1GIGH 2WZ6A 3NQIA 1S46A 1Y6NR 1UWGL 2Y6TE 1BZ7A 4JY4A 3RJOA 3BPNC 1Z0NA 3A24A 4N25A 2QVIA 1USZA 3FTUA 4PI0A 5G4NA 2QMJA 3OAUH 2EILB 3N0AA 4OV5A 3PJLA 1QUNB 4QY8A 2XQYG 4P5TA 3B2PA 2GCYA 2A6KA 4QXTA 4OGYH 3ZUCA 4MAYC 4UILL 4W4OA 4ZXBB 5C0BD 3JWDL 4YC2B 4UNTA 3T0EE 3QJVB 1PSKL 4FYQA 3U7WL 4LRIC 4LSVH 1HEJC 1OXYA 3UBXA 4U31A 1AGEB 1N68A 5LGKA 5T1KA 1C08A 5HI4D 2VSCA 1HXMA 3M45A 2XHNA 4UF7C 3RGVC 4Z8FH 3NOIA 4FQQB 4JO3H 4TPRH 1CTNA 3ZMNA 3LQAH 2C3VB 2E7LA 1F6AA 2QR0A 2WLKA 2ZUQC 4N0YH 4WW2C 4NDMB 5I82A 3VG0H 5JYLA 4PJHE 4HV8B 2W9DL 4IOSA 5SWSB 2XN1A 3HZYA 4ELKB 3ATBA 3FSVA 2VTFA 2D3JA 3L3KA 1BVLA 4OI7A 4XCEB 2IGFL 3WEXB 2ICWB 3L2NA 4GKNB 3K1KC 2LTQC 1H6TA 5C7XL 1F58H 4FTVD 1DQJB 1OB1A 2EO9A 4X98B 3U0TB 1S2EA 2DQUH 1AFVL 2H6PA 2I27N 2J6WA 4OJCA 1U8PB 4WUKH 3DYPA 3DOHA 2ODHA 2C8NA 1NGQL 1UVQB 2IBZY 4P4KC 2VDOB 3TIEA 4YFLI 3V7AE 2C34A 3N50A 1UZ8B 1TQTA 1SY6L 5ILTL 2UY7A 4LSRH 4I85A 2BP8A 2VDOL 2E74C 5KVDL 2P8LB 5T1LA 4N0UE 2JKTM 1WJ3A 2VLJE 2KQNA 1HE8A 4DVBB 2R2HA 4FI8A 4XHJD 5DEZA 2NTFB 4HPOL 4CBZA 4KK9C 1QI3A 3HPJB 4NUGH 3OGCA 5I6XB 3NCWA 3SQBB 1UM5L 3L13A 5J0BA 1MXGA 4G80A 3TVMB 3ULSA 1NBQA 4DZBA 1JYXA 5D7JA 2Q8BH 2YPVH 4JS7A 3IN2A 2VR6A 1YECH 1CC3A 1UB5A 4DTGL 3P3RA 1RLBA 3VGHA 2XQYA 1L4IA 1AR1C 1N70A 2IFFH 4MB4A 2WWKT 2I07B 3V6ZB 3BUYB 2J1YA 8FABB 4NZTH 4M6NL 1NEPA 3R8QA 2A1WL 4DP4X 3MRNB 3QUZC 5I66A 4PUBH 4KZEH 1YQ2A 3MA7B 3IFPA 4XRCB 2ROXA 3KW7A 1IB5A 2GI7A 2WD0A 3FFCE 3C5JA 2X1PA 3NABH 3O3EB 4LPVA 2BOCA 2PP7A 4E9RA 5IGXH 2ESVE 5JW4Q 1M05B 1HQ4B 3D85A 4KZCA 5SWZB 1NINA 2NY3C 1QABA 2HA1A 4G6AC 3ILPA 4IS6A 4UANA 3VSVA 5JHLA 3DXAB 1S5HB 1U8LB 1VCBC 1X7SA 4U0RC 4XVJL 4XVOA 4E9XA 3FB6A 3VFMA 4XXWA 5EWIH 4K3DL 3SBRA 1F45A 1YUHA 3COOA 4L37A 3BVNB 3RRQA 3UO1L 5JYMA 2EUWA 1UJ3A 1BD2D 4NFCA 3U0PA 2AQNA 2A9BA 2GFBA 2UYLA 3MRQB 3E38A 5D2LA 3QRGL 1AGDB 3QPQD 4UIMB 2PTUA 3WE6A 4IIZA 4OBRA 5EBGA 4MRCA 3N40P 1NZRA 2VGLM 2XZZA 3CHPA 1G87A 4PW3A 5E2WH 5H2BA 4POZC 1BJ1H 2V37A 4N2IA 5BZZA 1WHOA 3QXVA 1MRFH 4JPQA 1FRGL 4JFED 5CUSL 1WTLA 3VW3L 5F7DA 4NRXB 3BQUD 5F3BA 2Y7OA 1B4JL 3W82A 4NNPH 3ULVE 1JV2B 2GQHA 1HHGB 4OGAC 1QSZA 4ORGB 3VCLB 1VFUA 4X50A 4H2CA 3RWDB 1OD9A 2JELH 3CIQA 4ZFGL 4UUJB 4XNUH 3Q13A 4OD2B 1NWOA 3MACL 1QRNB 1A4KB 2ZCZA 1Y1DA 1I31A 4J3BA 1PZSA 4Y5XA 3WUWA 1Z2KA 2YLHA 5CILH 4AK2A 3LZFL 1MCHA 4WHYH 2H3NA 1IBDA 4LSDA 5M94B 2G5RA 2HH0L 3TPUB 2VZUA 1BFVH 2LAAA 3RX9A 1FQ9C 2BWIA 1YY8B 3V0DA 3WJLA 5HYFA 4TTGA 1UD2A 3KPOB 1FF5A 3ZKQD 1CFBA 5LBGA 5DEGA 3CGTA 2PO6D 5C97A 1U8CB 5ETUB 1P84J 4KKBD 4FABH 3MVSA 4ZDHA 2HLFD 1E28B 1P4BL 5T1DH 1OSPH 3SDCB 4R3SB 3N1GC 4TVSa 3HTLX 4XCYA 2XN2A 1ZMYA 2C5DC 3IGAB 2CDFB 3G5ZB 3PGDA 5DHDA 2M26A 2WNWA 3D9AL 3HG1A 1P4IH 3X2QB 2NY6C 4QHKI 3A6BH 1JGUL 1TVHB 3APCA 3BUTA 3KLSA 3OG4B 5LAXB 5DMKA 3TFKD 2ZCLH 3VWJA 4DETA 1XD1A 5D2LE 1I8MB 2QV2A 1BGXH 1DQVA 1GAFL 3EH4B 5DD0L 2XRAH 1MRDL 2OI9C 4FL4B 2BP5M 1GSKA 2UZYB 5HI4C 1OW0A 5I1KH 3NZHL 5BQ7A 4YEEA 4WFED 3ALPA 4N4YB 3IDNB 2CJUH 3GLZA 2QDWA 2BNQB 1V3JA 2XA3A 4UQIM 4WY7L 2WNGA 1HYRC 3BH9B 3EHBC 3T4YB 5I76A 2UX7A 5BO1L 4EDWL 4ETQB 1CFVH 4JRWA 1GW0A 3IKCA 5AOLA 2EXWD 2JKNA 2XYBA 5BNXD 4NUJA 1AYOA 1OIOA 3CBRA 3M6DA 3UABA 1JRHH 3CQFA 5IUSA 1CK0H 4LEXL 1JYNA 4U6TA 1UD3A 3CFDB 4MDIA 4MXQD 1A3LH 3IJSA 1NGPL 4MTMA 4F3FA 3A67H 4X7SL 2JH2A 5KW9L 4R97C 4F24A 1FE8L 3PGFL 4G9FE 2QVMA 2E6JA 2NY4D 4HXAH 4BFBD 3HBGA 4GKZA 5FGCB 2H45A 1GOFA 2BY3A 3GSVB 2AEPL 4KOCA 4D7BA 3KBPA 3CFIC 5BOJA 2IWKA 3CFEB 2XWTA 3BKJL 4L23A 1U58B 2HTLD 3EYUL 1FNHA 1AQKH 3EJQA 3U46A 2AJUL 2X4OB 3ISRA 1UFGA 2CCWA 2MQ3A 3NTCH 3WHXA 4LNRA 2OMZA 1S7SB 2VC2B 4P0DA 1DVFB 3SKNA 4GMSL 2XU9A 4O9HH 3W0WA 1R0AH 2G2RB 4GW4B 1U9KA 4FN0A 4XHJC 3NT0A 1AXSA 3VJ6A 4NQEE 3KPPA 2LW3A 2J1WA 2TSBA 1X5AA 3HG1E 5BVPH 4LLWB 3MDJA 1IZKA 1ZT4A 5E1QA 2A6DB 2M83A 2VSMB 4X99A 5I8CA 5TGBB 4R7LA 4WEBL 3UTTD 1FPTH 2YEZB 4MCYA 1Q9OA 3QIUB 3CFKB 4FTDA 4YSDA 4UQ3B 3U82B 2NCEA 3CJJA 3LRSB 3STLA 2AABH 2CD0A 4M5ZL 4G8AC 2G9KA 4YPGA 2FNWA 2OTUA 3O6KL 1S3RA 1P7QA 2OL3A 2HJFB 4M6OL 4AVKA 1II4E 1E2VA 5L8KB 1KTDB 4FMFA 3GSUA 4PRNB 4GI8A 4W6XB 3BIKB 4FI7A 3E8UL 2AQPA 5AUMB 3LEVL 3DGDA 3VD3A 1DUYB 5I6MA 1LDPH 3IPBA 2VZ3A 4NKDB 5GSRB 1T7XA 4BHUI 1BYOA 1NFDE 4G7VH 4NO3A 4NZUH 5B7MA 3GYRA 3WNKA 3DVFA 4XCCH 2EC9U 1H3GA 1BDYA 5EC1A 4DESA 2NRDA 3NQKA 3BIAX 4Z95L 3G08A 5MENB 4D9QE 5ECGA 5T3XE 4YBQD 4HMEA 3ARTA 4ZNEA 2CXKA 1H0DB 1GKEA 4MMYA 4PG9A 3WLBB 2FK9A 1VKXB 3SOTA 5HHMB 5IY5B 4X4MA 4ALAH 2M8XA 4K9EH 4ODXB 3SE9H 4FA7B 1LK2B 3GIZH 4KI5D 4FNRA 2A74C 4NO0D 4KHTH 2V2WA 5D70L 2KKQA 3D0AA 4LDEB 4PWEA 1XGPB 2VW6A 3W0WE 1HQRB 2EO1A 2FT6A 1R3KA 2A6IA 2I60L 5AW8B 1UWFA 2PETA 4U4BA 1RZ8B 2FJGB 2OXHA 3BT2H 4ZG1A 2XNAA 3QEHA 2CE6A 2ICEB 3D69B 1WZAA 3VQLA 2VWEE 1B4LA 1BQRA 2IPUG 4HJIA 4P3DB 4X83A 4Z7NB 2I9TB 3PQYA 4L9DA 1KCRH 3GNMH 2W95A 1FL6A 5F1NB 3X14A 1RSYA 4N0FB 4YUEH 5HGBA 2WYTA 3T3MF 4URKA 2CHWA 2BNRB 3ESPA 3Q7JA 4OI9A 5DJZA 4PJ9D 5T5FL 5FF6A 1OQXA 3MNVB 2EIZB 5JXED 4XMXA 4P2CG 2FIKB 5EPMB 1V3KA 3IFLL 1KJ2H 3G04B 1YMHB 3I3DA 3BN3B 1ZVYA 3ARZA 2MMXA 5I5MA 1U42A 3LIZL 4OFQA 2PO6C 3CUPA 5TQ2L 4OCNC 2PPAA 4Y4KB 5EFIB 1FL5A 2CIIA 2FBJH 1DVQA 2EE0A 3VWKB 3ATAA 1IJNA 5GGQH 4JFXA 3FRPG 3O8XD 2QQKH 3HCVA 2HFEB 2JJSA 3IKKA 4JZOA 3OF6A 2ZCKH 2PNDA 4C4BA 2ARWA 1MEXL 3AU1B 4Z7UA 1Q9KB 5DK0B 2DYPD 4J39A 4BUQA 4LLYA 3WNMA 1BMGA 1I9RL 3MA9L 4JG9A 1GMIA 4KI5F 1RU9L 2JMRA 2QVFB 5I1HL 2J44A 1XH3A 3TFKC 2P8MA 2VRAA 5HHQB 2HKAA 5DUMH 4ZNEE 4H8VA 2HWZH 3M1OA 4WFHD 1FFTB 1WZ1H 5T33H 3FUJA 4KHXH 4OLZH 1HEZA 2AJXH 1U3NA 3L3JB 3TJPA 4XMWA 2OZ4A 4Z7VA 1QSVA 2ARJQ 3FOMB 3P2TA 2B14A 3WJMB 4Z3FA 3NZ8A 4JGMA 2BOBB 5A2JH 1LO3H 4MB5A 4P2QD 4MZ3A 5I1GL 4AZ8A 1A14L 2X6AA 2VITB 5D1ZB 5BCAA 2IXQB 5HDQL 1SN2A 1T4KA 2WQRA 1CE6B 1MJ7H 4MA7L 3TV3L 2YRBA 1T2QH 5EO9B 3MRGB 3QAQA 5EN2A 2X5PA 1H15A 1O7VA 4LSSL 2HN7B 3CE1A 2QGEA 4PH8A 3RKPA 2ZXAA 4RDQF 4AM0B 3V4VH 2NYYD 3HE7D 4JDVA 3VFVB 3MRLA 1ZLSL 4CADB 4U05A 3LEYH 3WO4C 4JY4B 1BZ7B 2HTLC 1K4DA 1KMGA 1FZOB 3NCCB 4BIKA 1TFPA 1SJMA 2BVQA 4LOUC 4LSUH 1ET7A 5T3ZD 1BG1A 4E68A 5KVFE 1FBIH 1CXKA 4OV5B 4U1JA 3D33A 2G3NA 2BERA 3GJFA 2WNKA 1KB9J 4P5TB 2GCYB 1OM3L 4FXKA 4QRAA 3QHFL 3CSPA 5C0EB 4OJFH 1S9XA 4ODWA 5I6NA 1Q0YH 2CCVA 1D9KA 1NFIA 3OZ9H 5D1QC 5EA0L 4Z7UE 5GRZA 5T1KB 1C08B 4U6YA 3K80A 1HXMB 3NZSA 4DO6A 1JRHI 3FRPA 2IDTA 1DBAL 5C9JA 1A65A 4MASA 2J5WA 1MG3C 4ZMOA 1A7OL 4IMLA 1F6AB 4P59H 4WF7A 1NBVL 3ZRSA 2NTSP 3OV6A 2NT0A 3HI1B 2ZUWA 2GK2A 3O0LA 3HZYB 1VGEL 2NQDA 3TFBA 2X6MA 4Z7VE 4JKPH 3L3KB 4N22A 1BVLB 3V55A 4HC1A 4G42A 3TO2A 5IK3A 3KBEA 3MKKA 1JUFA 3T1FA 4N2KA 4YHOL 3Q44A 1LEIB 2EEAA 3CDCA 1FFNA 2H6PB 3D4GA 3DSFH 2JCCE 4HCRL 3DTXA 3O0RL 3QUMH 2EH7L 2R0WL 2GC4C 3LRKA 4L8BB 4IM8A 1AKJA 2X9ZA 4HPYH 2VXUL 4G6JH 4HALA 1GJIA 4GBXA 5F7YC 2UY7B 4QRRD 2BP8B 3ROLB 3N1MC 3P11L 4ELMB 4NGHH 5T1LB 3IWUA 1XEDA 2R59A 4L8DA 5IWLC 4TQIA 4ZFQA 1VESA 3RPBA 5IB1B 3GEWB 2R2HB 3ASOB 5JW5B 1YNTA 5I15L 1YEWA 1IGFH 2BH0A 3MOAH 4OZGA 2K9FB 2YK1L 2ATPA 2PF6A 4OLXH 4G80B 3L3GA 2VXQA 3UEQA 1E8ZA 1D5BA 2FHBA 5L6YH 5D1XC 2APXA 3GO1L 3NCJH 3H85A 3ZKND 4OZIA 1UB5B 1MHEA 1BW8A 5TE6H 2DI7A 3Q8EA 4NKMA 1UJTA 1EVTC 1E8WA 3L6FA 1IKNA 1N2RA 1OSZA 4I0PB 1T20A 2COVD 5KYWA 2ZAIA 4HKXA 1WK0A 2BIQA 2FR4A 5I66B 3CK0L 2YGQA 5C9KA 2UZIL 3PRZA 2JFCA 4YDIH 4YXHL 5LKNA 3GMQA 3VDAA 4Z0BH 5JXEC 5BRZD 3BAXA 1UA6L 3INOA 1E9OA 3SOBL 2YD0A 2BOCB 5DC4B 3FRUA 4P5MA 5F6HJ 4WKZA 2ICES 5GHWH 2YSSB 4ZUSA 3D85B 1TZGL 3ILPB 3KS0H 5IFAL 4TRPH 3WTSA 1IMHC 2FWUA 2GT9A 2HRGA 2JKXA 1X4ZA 3FB6B 3RVUD 3VFMB 4D9LL 3SGDI 4DKEL 4J3OH 5E94B 5CLXA 1YUHB 1ZCRA 4W81A 4JPSA 4PRHD 1X5KA 4L37B 5I16A 1UJ3B 1O5PA 3NEOA 1ZTXL 3U0PB 5B22A 1F3JA 1KJ3H 2UYLB 3O8XC 2BNUA 3ZJAA 3ULUL 4X6DB 4ODSH 5MEOB 3F12A 3WE6B 4FQ1H 3ZIMA 1BM3H 2NSXA 3H1ZA 1FO0H 3O2WL 5H2BB 5E9DD 2GHZA 1OOAA 4G82A 3U7AA 1RERA 1BPLB 3G5WA 4PRPB 3BESR 5E08H 4RGOH 5F7DB 4PJIE 5GZNA 3EDJA 3HS0C 2Q5BA 3UJIH 4LGPB 4K0OA 1MZYA 3VYNA 3OC8A 5JTWA 4N9OB 3BQVA 2AXHA 3A21A 5FO2A 4CJ1A 3JV5A 2FEDD 4I8DA 3ZKXC 2J8HA 5IB3B 2YD1A 3UZEA 5G4OA 3GXFA 1U3HA 5IQLA 2H3NB 1I8UA 4YWGH 2IPTL 5C07A 5CIPH 4NI3A 4OZIE 4QNPF 4I1NB 4CVZA 2BVTA 5HYJD 1T22A 4YX2L 1R5IA 4BRJA 7PCYA 3MRCA 4ZO7A 5KYXB 1ET8A 4C57C 4EZMA 3VXRD 1H5BC 2FGZA 2VJ0A 1SBSL 4ZPVA 3ESMA 5BXFA 1DDTA 4NP9A 3QJQB 3V5HA 2R1WB 3AITA 3HE7C 1B4TA 1U8OA 4ZDHB 1U3ZA 4A7GA 3EUDA 2CWRA 2KT6A 1UHVA 3SKJH 3STZA 1JZ5A 4V1DA 4LCVA 3V8OA 4OH2A 4WAFA 2Q87A 4NN5C 3BWUC 5CGTA 3ARUA 3HG1B 4HJ0D 4KQ3L 3OC5A 2XUWA 4LCCA 4ISVA 1GPOH 3GRGA 5DMKB 2LU5A 1XIWA 4EDXA 4WHTB 2V33A 2YD9A 3VWJB 4IU3A 1OAYH 1AE6H 4O00A 3LHPL 2WZ0A 2BRRL 4P46C 1PY0A 3U1SH 4JQIL 5BQ7B 4PG2A 3LH2L 3DUUB 3ULVH 3A4DA 3MBWA 4WI5A 1MCJA 3FO0H 4PS3A 1R1CA 5IM7B 4OLWH 2AJSH 5I76B 1U36A 1YEGL 2HT4C 3RA7H 4I9WE 3IKCB 1M53A 2EECA 4Q89A 4NUJB 4KMQA 1S5IL 3AWGA 4ODHH 2XPYA 4X9BA 2X4TA 3MV7A 3D39E 2L7QA 4DP6X 4PJCF 1E6JL 4JPWH 4MDIB 1A1OA 4UINH 4FQ2L 3CVDA 3JYCA 1UT9A 3OVUB 4F3FB 1NMAH 5C07E 4J2XA 5L2JA 1CGTA 4GFTB 4NLAA 4YHLL 2H32B 2WTOA 4GKZB 3UAFA 3GGWB 5CSZA 5LGHH 5CU5A 5DR5L 2VO5A 4NENA 3O9WD 4DNLA 1B90A 4LVHC 1QOKA 1RPQA 1B9KA 2QQNH 4ZBJA 3R0NA 4AV0A 2NMSA 3W3BA 5C2BL 2DM3A 5EBWA 3SZKC 3BZEA 3I9AA 4U1NA 3WHXB 3JV4A 3NJLA 4NCC1 1QRKA 2OMZB 1R3HA 4Q6IA 2AAVA 5AL0A 3SKNB 1UH2A 5JHLH 1VB9A 1IAIL 1MFCL 4L8SA 4WUUE 5DZVA 3W0WB 3KJ6L 1F97A 1OCRB 4KBPA 4JVWA 3WKMH 4V1DE 3VJ6B 2NXZD 3KPPB 4YFLF 1A6ZB 3MUUA 5ICYA 1CPUA 3RDTA 2PWGA 4KJYA 1ZT4B 1G6VK 4CILA 4D9RE 5I8CB 1T7VA 2F1AA 1HL9A 3QI9C 4PJGF 4RBPK 3T2QA 1E6OH 2OMUA 4MCYB 1Q9OB 2RCSH 3QCUH 1QNZH 1DCLA 3OR7A 1P1VA 4GJTB 4NO2A 3STLB 4CSPA 4HUXB 3ZE0F 4EQ3A 4YPGB 4F1SA 2OTUB 3S36H 4MJ2A 1QLFA 3DA0A 5AVUB 4E9VA 3X1EA 2HMIC 4LIQE 2C3WA 3PDOB 4BCXA 1F02I 1P7QB 1WD9A 5JHMA 1CLZH 3ILQD 1RXLA 4WV1B 1HL4A 4X4KA 4GQPH 4IMKA 1NCBH 5CF3A 4KJWC 1Z9OA 1NEZA 5E70A 3OAYH 5F7MC 3T77A 2IOMA 4UT9A 2AJYH 3GZPA 1I3RB 1JVLA 4GIOA 2Y1YA 3GSUB 5F3FA 4X9FA 2DQFA 4HK0A 1XZ0A 2GJ6D 3MV7E 5CJXA 4MMXC 4K9JA 2WVUA 2ZX7A 4NO3B 3RVUC 3EDEA 5HDBF 3KD4A 4IGBA 2P4AB 4JQVC 3ZYOA 3OXSA 1E3FA 1ITCA 1NLDL 1T83A 1TTAA 4X5XA 4HWBA 5DGRA 2VLRA 4BFNA 2Q7YA 2XTJC 2D7QA 1RK1A 1CDIA 1DVTA 5D7IF 4Z7OE 1EMTH 3F04A 4PG9B 4WWKA 4DP1X 3W9DA 4JPKH 1Q72L 4XPBL 3E2HB 1PU0A 3WCYA 2PPCA 3JV6A 3N85H 2BOLA 3ZE2E 1UKSA 3EGSA 3WNPA 1S7UA 2WKGA 4JE4B 2ZUTA 2JKLA 4NQCE 1MCDA 2AQRA 2X2UA 5FR3A 2A6IB 4S1DD 1VZHA 3MROA 1W91A 2OXHB 3CVIH 2XNAB 3VRLE 3IPEA 1OF0A 1SOQA 4UM9D 2O61A 2BZ7A 2E6PA 4QTIH 4XXCA 2OK0H 1F2QA 4JCWA 3PQYB 4B5ZA 4XN4A 1CGSH 1AP2A 5AW0B 3SDXB 4BD4A 4QHKJ 4OV6F 1BWMA 1FL6B 3X14B 3S3PA 5FDYA 5HGBB 1OAQL 1IQDB 3U9UA 2ODIA 4ZTPL 1OTTD 2WINB 5DJZB 2BIIA 5FF6B 4J3XA 3N1FC 5HHXH 4AJYV 4UAOC 1GYWA 1D2PA 2FIRT 2OMNA 1S3KH 1EIBA 4TM9A 1YEIL 4QRTA 3RTQC 1A6AA 2PPEA 1YMMA 2E27H 3LNFA 2FH8A 2YKKA 1KZYA 3CUPB 4FQCL 4Y1AA 1R3LA 3UZQA 1BSIA 3OZKA 4HUNB 4ZUTA 2BFVL 1M1XA 1FL5B 2APVA 5JQIB 2BS9A 4K7PH 4UQDA 1WGOA 2PCYA 2FYVA 2E86A 4JFXB 4QRFA 3HCVB 3FT0A 1JPSL 3QNZB 3TZVC 4JZOB 3DBSA 2CMRH 1OVZA 4HJ0C 4M7LL 5MHSE 5CKAA 3FH5A 5AFAA 4LLYB 3LRLA 5T3XH 5IHLB 4KKRA 3CFBA 4DEUA 1FHNA 1TFHA 1IIIA 2VLRE 3PHSA 4HLZH 2F74A 2P8MB 1HSAB 2QSCL 1A2YA 3MUJA 4JHAH 1SMOA 5C0NC 3J8F7 4OGXH 4GI6A 4M03A 1UOWA 2V0AA 1PEWA 2B4CC 3LZQA 4H0LC 3RVTD 3ZR6A 4NJ9H 2V9UA 3IN0A 1HEZB 4QXUH 4Y0GA 4MX7A 1CUOA 3WTXA 5AVSB 3QG7L 4U1SA 7FABH 2BIHA 3EH3B 1WAEA 4KVCH 1VEMA 4KK6D 2PTVA 3NZ8B 1L9PA 5SX5H 5DT1H 5ESVA 1JDDA 2A9CA 2YUVA 4AZ8B 2P44B 2H2SD 1RP9A 3FO2B 4N5EC 3CZJA 4Y5VC 4TSAH 2DEWX 4XO3A 4KAQL 3APFA 1AMXA 2GY5A 3KBHE 5EN2B 3MRJA 1H15B 3QUYC 5CJOH 3GI9H 2YMXL 3IMVA 5GGVL 1MAJA 4TQEL 2B15A 2OL3H 4JDVB 4LOFA 5FGSA 3MRLB 1F1AA 1A9EA 2CGYA 4XPAH 3O9WC 4QRQB 1Z6JT 2G0LA 2BVQB 1YMME 3GHBH 4Y1AE 3DI2B 3LNIA 1A6TA 2Y07H 4U1JB 1QPPA 3QZOA 1KBGL 3GJFB 4HH9B 1HTYA 4JO2L 4FXKB 1T1YA 4AC4A 5ADPH 1J8HB 3V79C 4H13C 5GISL 3FN9A 3L5IA 4M8UA 1SEQL 5T1MA 1S9XB 1PKQA 2NT1A 4PJAE 2VDRL 2X41A 4JEGB 4A6YB 1D9KB 1NFIB 2X4SA 4FP8H 1AYRA 4JFSA 4LHUG 2CG9X 1TO5A 4U6YB 2KI6A 2LT9A 3FRPB 4A6YL 5C9JB 3GHEL 1QKZH 2XQBL 4WGKA 3CSGA 1NOLA 3VI4A 2K0RA 4IMLB 5CLYA 1FSKB 3L3OB 4DP2X 4F7KA 1PZAA 2QPUA 3EZ8A 3NFSH 3FCGA 5C0JA 1X5GA 1X5XA 2B77A 4AT6A 2F58H 2V17H 2ZX6A 3U4BH 2IOIA 3FSOA 3KWXA 3OKNA 2GTWA 1TEGA 3RJDA 1F3DJ 1GZPA 2ZG3A 3R1GL 1QFUH 4I0CC 3TBWA 4OCMC 4FQHA 1YSOA 4G42B 3TO2B 1DVZA 4KNSA 4GH7B 1A1NA 1YEJH 3EYOA 5IK3B 2NQCA 1C16A 5GS3A 3T1FB 2ZZUT 4K73A 3C5ZC 4ZW7A 2ZP0T 5C0CD 1P7KB 4GQ9L 1DVYA 3IU4L 2CJ3A 2CHNA 2ZONA 3ARED 4F7CA 3WHE0 3B1TA 4PJDF 3UADA 1CE1H 2FX7L 3C2SA 4GBXB 4ES8A 3TO4A 3I9GH 2RQEA 1CXFA 3NEEA 5HSFA 1OTSC 4R4ND 1OP9A 2Z8VC 5AW1B 4C83B 3NK4A 4L8DB 4PREA 5DO2C 3WY3A 2Y2YA 2ZWSA 5JIMA 4YZFF 5KVFH 4YSOA 4LDLB 1N6UA 4KXZI 4OZGB 4UT6H 5CNHA 2ATPB 5GS0L 3TJEH 2EIKB 3L3GB 1XAUA 1TZIA 3IJYA 3BIBX 3B2XA 2XXCB 3B9KA 5C0FA 3VUAA 1D5BB 1BJ1J 4M4PA 3M7OA 4LLDB 3CH1A 3S3SA 3JWNC 4Y7MA 5HYQA 4ZTOH 5ALCL 1JMXA 4XR8C 5DHMC 4OZIB 3CZUB 1MHEB 1N5YH 1KEGH 3O3UN 5FWQA 4NKMB 1MREL 3EJJX 3VACA 3L6FB 1N2RB 3JTSB 1OSZB 3HNSH 4XVTH 3V0GA 4JM0A 4PLKD 4HJGA 4ZFFA 4C58B 2FR4B 3VI4E 2LLGA 3VXPA 4JRXD 2R9HD 3RL2B 3GMQB 5KVEE 4EF3A 3GMNA 2OZ4H 1MI5A 2VUYA 1E9OB 2EYTA 4DUVA 5IMMA 4WKZB 2WXIA 2EP6A 4OIFA 4G8EA 4Q56A 3CC1A 4ZUSB 4KK8D 2J43A 1WBZA 5C08D 3MLSL 4WWOA 5HDOA 3T04D 2Y7QA 1KZQA 4OT1L 4JR9H 1FORH 4X6CA 4EOWH 2DQDL 4FA6A 5I16B 1QPXA 4Y88A 2W07A 4CN4A 3K8LA 1ACYH 1OD7A 1U95A 2QADB 1F3JB 3HMWL 5JQ6H 2BNUB 2IDQA 3PV6A 4Y7OC 3MXVH 3F12B 4NC1E 3FL7A 3L4YA 3I2CH 3DX8A 5CMAA 1OZTG 4O02B 3G7TA 1J0ZA 1OM9A 1MLCA 4DGYL 1K8DA 5BOZG 1NAMA 4KUZL 4O02L 3BP5B 1KXHA 3CN4A 4CU8A 2AXGB 1KTRL 3US0A 2MEJB 2P5EA 1ILSA 2JB5H 5F8RC 3X3GL 3RVTC 3P9WB 2P80A 2X4NB 1JV5B 2VERN 3GJFH 3MXWL 3O3DA 4K55A 4UYPA 5DMIL 2FZ3A 4DGIL 3D0VB 1EQWA 3HRZC 4ZOCA 1S9WA 4LQFH 1Q90A 4LLAA 3KE0A 1U3HB 3LQAC 4H8HA 4HS8L 1JF1A 5HP5A 2RJMA 2F08A 1XGTB 4XNBA 1HC1A 3Q06A 1WT5A 5GJTL 5T5NF 1K3ZA 1PX3A 4CVZB 3T6WA 4WCYH 1R5IB 1RY7B 4WU5A 5D6CA 2VZOA 5EBLA 4K3JL 2D03H 2BDNL 2HFFB 1A4JA 2WKLA 1P9MC 2FB4H 1R3JB 3H42H 4U6VL 3VMNA 1OARH 5CZVL 1CL7L 4NYLA 1IAOA 3V5HB 1FVCA 1MI5E 1V54B 1ADQL 4KTYA 1X5HA 4OZHF 3QUXB 1W72L 4HC1H 4ODVH 3RIAF 4OGZA 3STZB 4HGWA 4G72B 2XY1A 5I23A 1WFUA 3BPOB 1KPVA 5FM5O 2F68X 4TMPA 1MIMH 2F7IA 3IDYC 2EKSB 3FCTA 4HOMA 5GZOD 5E1IA 4X6CE 5M7QA 4S0SD 2IMNA 5BZDA 1BZEA 4LCCB 3D08A 4PYHA 4CN1A 4ISVB 2R0KH 1R3IL 5D5ME 1XIWB 4EDXB 3NG5A 3FB5A 2DLEA 4KTDH 3UP1A 1I1YA 4IU3B 1TSHA 4DP5X 4XP1L 1WAAA 1CIUA 5CLTA 1HZHL 1UCTA 1J86A 4HKBA 3Q2VA 3F5WA 3SKOB 4AUUA 1S9YA 1INDL 5CM1A 1U8HA 3MBWB 3MLWL 1MFMA 5AAMC 3SQRA 2QZ5A 1RZJL 3AWEA 2P24A 4G8GB 1AZCA 2IPKA 2P5EE 5GQBA 5TPWH 4M61A 5DZPA 5F2FA 1SEBA 3QZPA 2I69A 2VXQH 3L3DA 3DJSA 5GGTL 3BEWA 4ZX6A 4AL8H 1J0IA 3SIKA 3MV7B 3G6JF 4EVNA 2WGXA 5C0AA 3TH2T 5F7EH 1IAKA 1A1OB 1YEFL 2FJSA 3TC9A 4UAHA 3BXNA 3DDFA 1XV8A 4BA8A 4MNGB 5L2JB 2OMVB 1F4HA 4TL5A 4JFHE 4YDZA 5CSZB 2LV4A 2ZKHH 3L5XL 1RK7A 3LXUX 4WO4D 3TA4D 4BKSC 1JPTH 3QDGA 4NENB 4U1GC 4W9FC 3KYAA 1D7DA 4YO0A 5H35A 4XC3H 4LEBA 4QXGH 5IQOA 5EBWB 4HCGA 4ANVA 4U1NB 1TCRB 3D18B 4AIOA 4R4NC 1R3HB 4Q6IB 3KH4A 1DYZA 4GRLA 1G7PA 1RJLA 4KNUA 2G2PA 1XB6A 2FYYB 3VGEA 2YD2A 4WU7A 2E9JA 3TP4A 2O5YL 5ICYB 4LAJH 3AT9A 2YD3A 4KMTL 3RDTB 4GXUM 1PCXA 1PG7L 3H2QA 4R4FH 3GJEA 3JXAA 4OZFH 3OPZH 5EU6D 4M7LT 3OR7B 5I1AA 3OHXA 2PLTA 5TFSL 3SGKA 1WAAE 3SY0B 1H6EA 4BZ2L 4OCWH 5FOBA 3AABA 4TNWK 1HJBC 4DPCX 4PLKC 2N7AA 4FD0A 4HGKC 4NNXB 5DS8A 4B9ZA 3UERA 2JSFA 3KYMA 3FQWB 2VCOA 4B9JA 1ZLUH 5EU3B 3FQ1A 1E27A 5DRZA 1QW8A 4KRPD 1NEZB 3NJKA 4FQXA 3AS3A 1YNLH 4XOEA 3T77B 1G7LA 4GQRA 2N56A 3MSPA 1DLHA 5F1IA 2BVYA 3QSKB 1XZ0B 4HIEA 3CCHA 3RAJL 1KLGA 1SJHA 4HCRA 5C0AE 4KK8C 2GITB 2YGPA 4OJDH 2AI0H 1SQMA 3BKML 3OXSB 4G6FD 4X5XB 5DQ9B 1ZXKA 5GGSA 2VLRB 4YOKA 4A38A 2Y9RT 5DD5L 3GUTA 1RK1B 3U48A 4WWKB 4I18C 2WUBL 2B59B 1TPXB 2WTRA 2GKIA 3CSFA 3JV6B 4NQDA 2PYFB 1X5YA 4AEHH 2R0LL 2W5PA 1HYSD 1LM8V 4YDMA 1S7UB 1LNUA 3I02A 2NY5H 2X1QA 3L08A 1QFWI 2XV3A 3II2A 1HX0A 3A0OA 1D6VH 2F7RA 5DZOA 4LPCA 3NIDE 2C9VA 4WKXA 3HMXL 3S37L 2O61B 2Y7NA 3KPSA 4K15A 1UYWH 4TQPA 5HHVL 1AP2B 1KOAA 2BSRA 3LQZA 2MKWA 2DY2A 1QLEB 1PIGA 4Z18A 5IKCA 2VW4A 2X3CA 1KYDA 2QGDA 4MHHG 1GC1H 2FECL 4MBRA 4NERA 2P5WD 2C9UA 3NCFB 2FHCA 3QR0A 4LIQH 2DH3A 3K74B 2OQJB 1J5IA 1JNNL 1FNSL 5DRXA 1XF3A 3GBNL 4JFUA 2DIAA 4QRTB 4TLUA 3O3AA 1A6AB 2IH9A 3ESUF 2XVBA 1GH7A 4GKLA 4QTHA 4Y1AB 3CFNA 4PJEE 3FT4B 3UZQB 2Y06H 4YHZL 5CHNB 3ROOB 1T80A 4ZUTB 2JF1A 3IDUA 4BK8A 4X80H 1SN5A 3GBML 3FUEA 1HL8A 1KTLB 2NY1C 4HBCH 4MFHA 1NFAA 1F4YL 2GTZA 1MHPL 2CDEA 3PWNA 1NSNH 4XX5A 5GRUL 4PJ8D 3W38A 1T5WA 2H3XC 3CFBB 3V0AC 3HG0A 2F74B 3RY5A 5AVVB 5I17A 2Z7UA 1A2YB 1UWGH 3AT0A 3LN5A 1NANI 3UXFA 5TDNB 1KC5L 1PTZA 3BZ4A 2Z7ZA 1BXVA 1F00I 1WBXB 32C2A 3OKKA 3IBEA 4NQDE 1L7TL 4U1SB 3KXFA 2OMTA 1M7IA 2Z9TA 1HNGA 3ZRCC 3ARSA 1QMUA 2ZXQA 3JWDH 1WZLA 2ENSA 3U7WH 2IANB 5LGJA 5DI8A 1XT5A 5KOMC 5ESVB 3KL5A 1TU2A 3MCLL 2J2ZA 3DHPA 4QIRA 5H94A 1OGAE 4QGTA 4FFWC 1DLFL 3KPSE 5ACMA 2G4GA 3QUKA 2PCPA 1WD8A 4MD5A 5KZCD 4B97A 2VT0A 2IIJA 4MAYA 3MRJB 5C09B 2HT2D 1EZVY 2AQ2A 3A5VA 3ESNA 4J27A 2W9DH 5JW3L 3QARA 4JPIA 3QC5X 4ZS7H 4AE1A 2R39A 3NA4A 4WO4C 5ICXA 1OB0A 3C6SA 3DVGB 1D6EA 4KV5F 4UU9A 3MOBL 3O6ML 4K5OA 1JGLH 4UT9H 4ZI8A 2C7FA 3WD5H 3QEUA 5I26A 4A68A 1Z3GL 1VF5C 2YJQA 4CVXA 2JLLA 2VOTA 3V5DB 3WKNA 1WS8A 4JGJA 5AZUA 4DOHE 1NGXA 2YIHA 3E1ZA 1HNYA 3EFFA 1KB5A 5T1MB 3QEGL 1PKQB 1BXXA 4RFNC 3ULUE 5ILTH 5EIVA 1YEHL 2ICCA 2X4SB 1DBBH 1SDYA 4H0HB 4ALAC 1WICA 4K9EC 4WSJA 3WN5A 2WQUA 2JIXB 4U7MA 3TBVA 3S35L 3ZDZF 2RALA 1ODUA 4ONHA 3VI4B 3SDCC 5JA9A 3B43A 4HAFA 4MJIA 3HE6A 1YC8A 1AZRA 1OAJA 3HR5A 5C0JB 3QS3A 1YEKL 4AT6B 5F7WC 5C6WH 3RGBA 3OKNB 2GTWB 1EDQA 2IAMA 1N4XL 5KSAD 5EUKA 4GB9A 5B1JA 1OAZL 1EO7A 1Z9MA 3GSRA 3KXFE 5TE4H 5I18H 2PW1B 4FQHB 3ZL1A 5AQ0A 1TJMA 2H6OA 4KRPC 1A1NB 4PRDA 4R90L 5IFHH 4FL4C 1C16B 2EIEA 4RGMB 4JHZA 3C08H 2AEIT 6CGTA 1DUZA 2FLBT 1A02N 2AJ3A 4HWEL 1QLEH 1ZHKA 4KRNA 1AXTH 1NBYB 2WBJC 2A1WH 3SO3C 4XAWL 4F7CB 4APQD 2FLMA 3FO9A 3TO4B 1W0VA 2V3FA 3DX6A 1CDYA 3DGCR 2DIEA 2NZIA 4X42A 5ACZA 5F1KC 2XV2A 1NM9A 3CPUA 3ENEA 4PJ5A 4JFFB 3MBEA 1FH5H 4Z7WA 2G75B 1J5OH 5SV4A 3CV5A 3OD3A 4CDGC 1AS8A 4XVJH 1BP3B 2Q3ZA 3QUZA 1OAUL 5E4IA 2LQRA 4YSSA 5F0JB 2Z31B 3ZGHA 4KVPA 4ZMQA 1HYSC 2W80C 1TZIB 3IJYB 5HHOE 5C0FB 2VN6A 4ZZKA 4AUJA 2FSDA 4M6MH 2Y0SA 3KPRA 3QRGH 5GSVA 3CH1B 4QLWA 2QPEB 5KUMA 3CX5K 3EOAA 5EZIH 5AVXB 1GYAA 1C9SA 3ZN6A 5K9QG 5I1DA 4AOFA 2VLLA 1OPGL 2A9NL 1ZV5A 1FRGH 5CUSH 2QKIA 3NAAH 5E1HB 3ZDXE 1TJHL 4Y16D 2W9LA 3ZHFA 1SLWA 4HJGB 2OMXA 4QUOA 5LBSL 1F90L 2AJZB 4HUVA 1P2CA 4MJIE 3LMJL 4LHUB 2KMWA 2EVGA 4F57L 3VGGA 2HRLA 3CD4A 3CLWA 4PJHF 2FSEA 3GMNB 4UQ2A 4ZFGH 2EYTB 3KLHD 5IMMB 2L0DA 3WN6A 3V4UL 1XL6A 3ELAT 4L3CA 4G8EB 3MACH 1JWMA 4MMZC 4NUPA 1QG3A 1D5XA 3QIUC 4U3HA 3LZFH 4GAFB 4I77H 3O2VL 3DVIA 4FYRA 3BPCA 3D52A 4I48A 1A64A 4XP4L 3ARGA 2MCPL 3RHWK 5BUGA 3S8FB 3FFCD 3NCMA 4X6CB 3QORD 4RGNC 3KPQB 1HH9A 5HJ3A 4R96B 3QXDA 1M2OA 2H26A 2W07B 2ESVD 2J5LB 4DPAX 1F86A 3P3TA 1ROCA 3QCTH 2EVIA 3PV6B 1BAFH 3MGTA 3KR3L 3FQ2A 3TWCH 3WS6A 3DX8B 4JL2A 5CMAB 5CZRA 1AH1A 1PGRB 1VZGA 1P0SE 1EHLH 1K8DB 1Z9PA 4BWTA 1ETJA 2P43B 1NAMB 4PJ5E 4QHNA 1M56B 4Z7WE 4JW3A 1X7TA 3LXBA 2CO6A 1FC2D 2P5EB 2D2CC 4FFVD 4OQ1A 4KVNL 4WHDA 1I85C 3WFDH 3HW7A 4PVMA 4QYAA 2FQEA 2ARJA 3O3DB 3KYKL 5L2KA 1BFOB 1OANA 2NR6A 5KSUA 4JK0D 1S9WB 4LVNC 5FEBA 1TQCB 3VD1A 3G5VA 1QSEA 1N5AA 1QEWA 3KPRE 5JLZA 4I3GA 1F42A 2AXJA 3SHSA 2X2JA 4L5FE 3AXIA 1G9NL 1RUPL 4NJAL 5IF0A 4OLVH 4KROB 3SDDA 1QTSA 5FB8A 3EO9L 4WU5B 5D6CB 1TJGL 3VMPA 5D7JD 1AO7D 1MVYA 3DETD 2CR6A 3EYFA 4P06A 5DTFA 5KVEH 2XKSA 1A4JB 1L6ZA 5C0BA 1C1EH 2HT2C 3QPXH 4MS8C 2QTEA 1MVUB 5BO1H 2B3IA 5IV2A 3ZGIA 2F15A 2UVFA 2VDPB 3OKOA 4NYLB 5EULV 5HVHB 1IAOB 5IMKB 1FVCB 5A2FA 4HW6A 4NZ8A 5AZ2H 4LEXH 2ED6A 1HOCA 3F3HA 3P54A 3KM2A 4G6ML 4HGWB 5AEAA 5CGMA 1T89C 2AQ1A 2CH8A 1KPVB 1NGPH 5EIQA 3QR1A 4HJTA 5KW9H 1TG8A 3FCTB 1T7ZA 4A63A 3FH7A 3U0WH 2ADJA 5K5YA 2PXYD 2AEPH 1T1ZA 3PWVA 3QHZL 5DHVA 1BF2A 3WXVH 4F7MB 3F58H 3EYUH 1MHHA 3K3QA 1DQQA 2WCGA 2MNJB 1PQZB 4FZEH 4HKBB 1KIQA 4BQ8A 2Y72A 4M3KB 4P2OC 1NBZA 1S9YB 2Y23A 4QRBA 3VWKC 1U8HB 2X89D 5DD3L 4GMSH 4N0CC 4WJKB 3T0EC 3DJZA 2P24B 4LPYA 1KGYE 2IPKB 4ZD3H 3OKLA 4M61B 3UAJD 5IQNA 5EZOH 1OAXL 4LF3A 3BEWB 1RHHA 5ALBL 5JXAL 2Y36H 3RVXD 4EVNB 4WEBH 4XMLH 5C0AB 4KXDA 1CFMA 1ND0A 3V9FA 1QSEE 3L3IA 3F84A 5FV2A 3K2MC 5GS2H 4W9EC 5GIRA 3N43B 4GS7C 4M5ZH 3U6RA 4AQ1A 2GBAA 3O6KH 4FNLL 3HS8A 4RSYA 2NW3A 1KJMA 4P05A 5JQHC 3DJ9A 2GBVA 3QDGB 3AJ7A 4M6OH 4YDKL 3UDWA 2X6VA 1XFPA 1Y6MR 5H35B 5JIHA 5CD5D 3JZ7A 2HJKA 4DT2A 1ZDSA 4NOFA 4F58L 4OTXH 4G9FD 4J3OC 4DF9A 1SJEB 2V9TA 3SQOH 2J71A 1ASOA 4GRLB 1G7PB 1RJLB 4JY5H 4NSKB 3BFOA 4LPWA 4PHZA 4WU7B 1I1AD 1OO2A 3NIDB 1KEMH 4AG4L 5EORL 1N19A 4H25B 4CC4A 4YEFA 4Z95H 4AVJA 4YHIB 1F8TL 4GXVH 5KJ7E 5ICZB 3GJEB 1A7PH 2EC9T 2ZP8A 3B2DC 4PV1C 3KWVA 5DJDA 4D0CA 1YPZB 3OHXB 4NQED 3OAZH 1M7DB 5GRXG 3UGUA 3T8VA 1XO8A 4MA8L 3GBEA 1S9KC 4MZIA 5FOBB