1JZFA

Pseudomonas aeruginosa oxidized azurin(cu2+) ru(tpy)(phen)(his83)
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
128
structure length
128
Chain Sequence
AECSVDIQGNDQMQFNTNAITVDKSCKQFTVNLSHPGNLPKNVMGHNWVLSTAADMQGVVTDGMASGLDKDYLKPDDSRVIAHTKLIGSGEKDSVTFDVSKLKEGEQYMFFCTFPGHSALMKGTLTLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords AZURIN
publication title Electron tunneling in single crystals of Pseudomonas aeruginosa azurins.
pubmed doi rcsb
source organism Pseudomonas aeruginosa
molecule tags Electron transport
total genus 32
structure length 128
sequence length 128
ec nomenclature
pdb deposition date 2001-09-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00127 Copper-bind Copper binding proteins, plastocyanin/azurin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 1jzfA00
3PCYA 4YSRA 2AFNA 2J56A 2PP9A 1OF0A 1NWPA 1JZFA 3DKHA 2PP8A 3NSCA 4BWTA 4YSSA 1SFDA 2BW5A 2IDQA 4DPAX 1W8EA 1V10A 2QDWA 1AOZA 2YAFA 3WNIA 1AS8A 3WI9A 2YAOA 4JHUA 3NSFA 4YSEA 2FTAA 1GS7A 4F2FA 3NJNA 1PZBA 5I26A 2YAEA 1KDJA 2TSBA 1J5DA 1E30A 4KNUA 4GYBA 3S3BB 2GC4C 2GI0A 2YXVA 4Q8BA 1PLAA 3TU6A 1M9WA 1PLBA 2YAQA 3NJFA 4G7SB 4A2EA 1NIEA 1PLCA 3FQ1A 4HCIA 1SNRA 1NTDA 1OCZB 1JERA 2FWLB 2Q9OA 1NINA 4A2HA 2J57A 2HX7A 2IWEA 4YL4A 2XWZA 2BP8A 3H4HA 2WO2B 3AG1B 3CG8A 4E9TA 1L9SA 5B1BB 4DPBX 4YSDA 2HXAA 1RCYA 2WO3B 4E9RA 2DWSA 1BAWA 1J9RA 2CALA 4UF7C 4BWWA 2W8CA 3ASOB 5IY5B 1AQ8A 4AZUA 2IWKA 1X9UA 1MG3C 4AI7A 3OQRA 1ID2A 2P80A 3ZBMA 2GB2A 1UATA 4YSQA 1MZZA 5I5MA 1ILSA 1SHWA 4YSOA 2PPDA 4AKPA 4L0PB 2FQEA 1AANA 1JVLA 1OOWA 4A2DA 1QHQA 4RH4A 4AKQA 2BWDA 4DP1X 3OMAB 1KDIA 1A8ZA 2TSAA 1NWOA 2XU9A 1ZIBA 1ASOA 1NIFA 3FQ2A 2Q5BA 3SBRA 1PY0A 2XX1A 2XUWA 3PXLA 3NJKA 4DP8X 4A67A 2PLTA 2EIJB 2VW4A 3GDCA 4GXFA 2DYSB 1GYCA 5B7FA 1SHXA 3S8FB 3FQYA 3NT0A 1XB8A 3IN2A 5B7EA 3NSYA 2DYRB 4A2FA 4QLWA 1JZJA 1V54B 5B7MA 3OD3A 1AZCA 1BQ5A 2IDUA 1OCRB 2ZXWB 1RKRA 5I28A 2J5WA 1HAUA 3AZUA 2I7OA 1J9SA 1T5KA 3CDZA 1L9QA 5F7AA 3QJSB 4UANA 1DZ0A 1KYAA 1AS7A 4ZK8A 1EHKB 2PPAA 9PCYA 2PCFA 4A2GA 2MTAA 2VW6A 2QT6A 1XB3A 2BP0A 1MDAA 4DP5X 1AIZA 3EHBB 1OE3A 3IEAA 4YSPA 2X87A 1XB6A 2YAPA 2R7EB 5I6MA 3PAVA 4G72B 1JXGA 1FWXA 1IKOP 1WA0X 8PAZA 1ETJA 5LDUA 3BVDB 3NYKA 1AZNA 1NICA 3FSAA 1EZLA 1JOIA 3UAEA 2GC7C 5I6NA 4BK5C 5F7BA 1ET7A 2YARA 4CSZA 5B1KA 4Q89A 1JZGA 3FU7B 4DP6X 2RACA 1CYWA 2IH9A 4K9JA 3N2JA 3PAZA 3DIVA 1NIDA 4PCYA 4YSTA 1E5ZA 3CVCA 1KBVA 1E65A 1J9QA 1I53A 1ET8A 3MBWB 5I6OA 4E9QA 5PCYA 2HZHA 2EILB 1JZEA 2BW4A 3ERXA 1DYZA 4HAKA 2FT7A 1HFUA 5I6KA 5D4HA 3PLYA 3SBQA 3TBCA 1URIA 4DPCX 1AZBA 4DP0X 4UAHA 1CC3A 2BZCA 2X88A 1GW0A 1J9TA 2IDSA 3EF4A 2IDTA 1A4CA 2E86A 3QJRB 3CVDA 1ADWA 2MRYA 3RYMA 5B1JA 1SF3A 1ZDQA 2FJSA 3S8GB 1MZYA 3FSWA 2QPEB 3NJHA 1JXDA 3L45A 1ZPUA 1M57B 4M3HA 2QDVA 5TK4A 2FQFA 3X1EA 3ABMB 2H47C 3QJVB 2CUAA 1KGYE 2AVFA 3FU8A 4QKTA 4F7KA 4NERA 1RZPA 3NJMA 2FNWA 2XX0A 3CVBA 1WS8A 3TA4D 1TKWA 2H5UA 2HRHA 1KV7A 4GP8B 1N70A 4G71B 2XXFA 2XXGA 2GSMB 2HX9A 2IDFA 4DP9X 3WKPA 1R1CA 2VN3A 4KO6A 1NPJA 2BZ7A 3JT2A 3C75A 2EINB 3T6VA 1BXVA 4N8UA 4A66A 1YLBB 4BWUA 3UADA 5I5JA 3UGEA 3U25A 1OE1A 2BHFA 4JHVA 1MG2C 2EIKB 2EIMB 1F56A 2LLNA 3FT0A 2BP8B 7PCYA 4YSUA 4AKOA 2PPEA 3EH3B 4YSAA 1PZAA 2FQGA 3AW5A 4GP4B 1L9RA 1XMEB 3SQRA 3TASA 3G5WA 4YSCA 4G7QB 3DTUB 2UX7A 3ABKB 1SDDA 2OCCB 1CURA 1BXUA 1IBYA 2CBPA 1SF5A 3FPXA 3IBOA 2PPCA 1M56B 3FSVA 1AG0A 4WTQA 4KO7A 1AZRA 2BWIA 1PCSA 2VW7A 5B1JC 4HZ1A 2OV0A 3AG3B 5B3SB 4BXVA 2JXMA 3MX0B 3NP3A 1GY1A 4E9SA 1KBWA 3V9CA 3X1FA 4KOCA 2YQBA 3ASNB 2XV3A 2I85A 2YAMA 2GBAA 3SBPA 4HHGA 1QNIA 1N68A 3T9WA 3HEIB 4DP4X 4ENZA 2AZUA 4F2EA 4KO9A 4G70B 3T6XA 3ABLB 2WSDA 1A4AA 1PMYA 1OV8A 1BEXA 1RZQA 4TXVB 4M4RB 3BQVA 4JKNA 4MFHA 4BDVA 1A4BA 3T6WA 2CAKA 1AR1B 3QJUB 3OMNB 2CJ3A 1CYXA 1SFHA 3NJLA 1ASQA 1PF3A 4FA7B 3WG7B 2HX8A 2FT8A 4FAAB 5I5IA 1ILUA 2VSKB 1IUZA 3CDZB 4KO5A 2J55A 7PAZA 3N55A 4HHWA 4BXSV 3OMIB 3FYIB 1TEFA 2UXTA 1TEGA 2UXVA 2I7SA 4E9VA 1PZCA 2Y1AA 3NJIA 3WNJA 2BP0B 2DWTA 3ZIYA 2XV0A 3EH4B 2AZAA 3IN0A 2VM3A 4NB7A 1NZRA 1ZDSA 1BXAA 1A65A 2DV6A 2OJ1A 1GS8A 1AG6A 1NIBA 5E9NA 2YAHA 1ZIAA 2ZWNA 2W88A 1X9RA 1AZUA 2XYBA 2IH8A 3D12B 1CUOA 3X1BA 5AFAA 4GP5B 2JKWA 2BO0A 4G7RB 4HCFA 5I6LA 3H4FA 5FC9A 3QJQB 2HLEB 4P5SA 4AX3A 4KNTA 3H56A 4A68A 2XLLA 1L9PA 2VSMB 4DP7X 1KCBA 1L9TA 4YVUA 5EHFA 3UACA 5A7EA 1E5YA 5AZUA 1WA1X 2IAAC 1NIAA 1ET5A 4DP2X 2VMJA 4NAJA 4CSPA 1PAZA 3PAUA 3JTBA 1VLXA 1WA2X 4HCGA 1NDTA 2GHZA 3X1GA 6PAZA 1OE2A 2AANA 2PPFA 1AACA 3T6ZA 2UX6A 4P5RA 2IWFA 1GY2A 3UAAA 3FU9A 2PCYA 2ZOOA 3KW7A 5PAZA 2XV2A 2H3XC 1QLEB 1OCOB 4E9XA 4EF3A 2HRGA 4W1TA 3ZDWA 3AG2B 2XVBA 3FPYA 1PNDA 2ZONA 3S3DB 1W6LA 2YXWA 3CZUB 4X4KA 1J5CA 3OM3B 3NJJA 4W9ZA 1BQRA 1L9OA 2FQDA 4HIPA 1JZHA 3NP4A 1GS6X 1AS6A 3WKQA 1WAEA 4YVNA 3GYRA 3FYEB 3X1NA 3WIAA 2UXFA 3TBBA 1ASPA 1B3IA 3IE9A 3QPKA 2FT6A 2GIMA 5TK2A 3AY2A 2Y69B 5D4IA 5AKRA 3GXUB 3UABA 4GY4A 1A3ZA 1AAJA 2JFCA 2R7EA 1SDDB 2QPDB 2N0MA 1FFTB 1JXFA 4HALA 1BYOA 1NPNA 4N4YB 1W6WA 1KCWA 2UXGA 4PAZA 1GSKA 3X2QB 1E67A 5ANHA 3FU7A 1JVOA 1HAWA 1V55B 3ABGA 2A3TA 5I6PA 1IC0A 1PNCA 3NSDA 4KNSA 3HB3B 1TU2A 6PCYA 3NJGA 1GR7A 3QQXA 3EH5B 3AG4B 2NRDA 1OCCB 3V9EA 4E9YA 1ZV2A 2B08A 4KOBA 1BQKA 3PPSA 2PP7A 2B3IA 1FA4A 1SJMA 1JZIA 2CCWA 5B1AB 4E9WA 1WS7A 3T71A 3QJTB 2P80D 4BDVB 1IBZA 3FSZA 3FS9A 3S3CB 2VM4A 3KW8A 4WKXA 2DY2A 5D4JA 3ZX1A 1BYPA
chains in the Genus database with same CATH superfamily
5LG1A 2XKUA 4NQTA 5F0JB 1GTFA 2DI7A 2FUQA 3HZKA 2IDQA 4K9EC 4G9FE 1SDYA 3UZQA 2YAFA 1BZ7A 4PQXA 3BN9D 2XQBL 1LE5B 5E6SB 2ICEC 2R2HA 3ARBD 4X9IA 1FIGH 2DKMA 2YAEA 3P73A 5BQDA 3OBAA 1X5FA 2WYHA 3K2KA 5KN5A 1YEHL 3NIGF 3WO3B 3W5MA 3QO0A 1PIFA 2QFRA 4GQ9L 1L6ZA 3SDAC 4HIEB 3NIFF 4Q9CA 1A6AA 2NPLX 1UKQA 2NX5B 5E24E 3QZWB 3BP5A 1DVFB 3WTSA 5HBBA 4GLRH 4GJTB 4U7KA 1EXUB 1HQ4B 3QNXA 4HW6A 2VDQB 2HXAA 4UINL 4JZOA 1XIWA 3CHXA 5C09D 5MENB 4JMXA 1HC1A 2DBLL 2BOBA 2HJKA 2C4FU 5IB4A 2A6JA 4M5SA 1EGJA 4PJEB 1AQ8A 4NBZB 4AZUA 2ZAHA 1VEPA 1MG3C 2FSDA 1KY7A 1OAZH 3NFPB 1HIMH 4PGJA 1HYRC 1J1OH 2XTJD 3UTSA 4QHKI 2KYIA 4JPKL 1GA2A 1T5XB 3UZVB 1JN6B 3VXME 4AKPA 2FQEA 4XCEA 4BZ1A 4CMHC 1OWRM 4PPTA 4UT9H 3SDCC 1FJ1A 2IAMB 4KK5D 2HJFB 5IF0B 1WIOA 4TULH 2P5PA 2WC7A 1GGTA 1WCBB 2WINB 1NMBL 2R0KH 3DK2A 3FT9A 3EJPA 3P3RA 1B0IA 4PRIB 3RIAK 2OMZA 3GJFB 2X6MA 4M62L 3OWRA 3CXHJ 3WFCH 4OD3L 2R69H 1RU9L 1LO3L 3P0GB 2GSIA 1MW1A 2BVUA 1U41A 1XD1A 5BJTA 4OAWA 5DQJB 3ARBA 3ALWA 1ZJBA 2EH8L 4O02H 4F57H 1KYUA 3FQYA 2AXWA 3HKFA 1XCXA 5B7EA 5EBWB 4IIQA 4LLDA 2AAAA 3GMPB 1S7RB 4MMZC 1AZCA 1D5ZA 4FXKC 1M7DA 4HPHA 2F8XC 1M05B 1Y6KR 1F6AA 4N87A 1A6UL 3VFWA 1PD1A 5J1TC 3FU5A 4BRVA 3WSQL 1IZJA 3EYQC 1SOQA 3KLLA 3OC5A 5GGRY 5KVEE 1YHPA 3RHWF 4ZW5A 1A4KA 2LLGA 4QHNA 3ATAA 1HX0A 1UM6L 4YLQT 4U1JA 5C09A 5C0JB 1AS7A 4ZK8A 4G80A 1NBVH 4XVTL 2J8OA 3TA3D 1ZVSA 1KLUB 2VW6A 5FYJL 2BP0A 5JNYB 1FGVH 3OPZH 4NN5C 4WFHE 3A6BH 2DJUA 4PU2A 2CO7B 2AP2A 3LEXA 1YNKL 5HGBA 4MAUH 5GS1B 4K3HA 3VWKB 4YMPA 3NGBB 4CRPA 3VSTA 3DUHA 3VXSB 4PBWD 1R9FA 1CE6B 4KY1L 2WZAA 4R5VA 3FSAA 3V0HA 4Y9EA 1G1CA 3EYUL 4BK5C 4IJTA 3KLSA 3I02A 4HG4J 3BPCA 2I9LB 1KBGL 5G2NA 1L0XA 4U6YB 2K9FB 4E68A 5J06A 4JO1H 2YRPA 5T1MA 2Y7LA 3SPGA 5K9OB 2B14A 2CHXA 4Y2OB 1T0OA 3OAUH 1A14H 3OXSB 3HN3A 1ET8A 3QZMA 4MBOA 2EIBA 2GVYA 5PCYA 1A6WH 4HC1A 1U8KB 4G8AC 4W93A 3LN5A 1DJXA 2VDNH 5DD1L 5ICYB 1FO0L 1NCGA 4PV9A 1DN0A 1ND0B 2ENJA 5C92A 1FNGB 3KEHA 4PV1C 1IC4L 2HFFA 4LDEB 1OVZA 3LH2L 4PP1D 4MS8C 4M9PA 1AZBA 3QEHB 3QDMB 1LDPH 2IDTA 7FABH 5CWSB 4FQQA 1MCFA 3NESA 1EO7A 4JHAL 4H8HA 3CZFB 4NT6B 1Y6MR 3IMBA 4ANWA 2JIXD 5FF6B 4ZAKD 4UQ2A 1PKOA 3G6DL 3T0EC 1A7RH 4MB1A 4PS8A 3QW9A 4XWGL 1MQ8A 3CN4A 3PUCA 5CBEA 2CIKB 3GBML 1KGCD 3QJVB 4YC2B 2QMJA 2AVFA 3G5YB 1YUKB 3B1UA 3S5LG 4EI5B 1HINL 2WUBH 3GWJA 3ZE1B 2CXKA 5GZOD 3TNMB 3DO7B 5L4MA 2C1OB 4ODHL 4X4ME 2K7PA 1MI5B 1XH1A 1QD0A 4EKXA 1D9KB 2BZ7A 3GS0A 1AO7B 5CU9A 3K2UL 2PXYD 2WLNA 4YDJB 5M95B 2A9NL 4L3EB 4IBQA 4BWUA 4AMXA 4YBQC 1SYSB 2XFGB 1UT1A 3U25A 3WU1A 2ZWSA 5DMKB 4ODSH 2Y24A 4OQTL 4LSSH 3NCMA 5KVDL 5AD0A 2JSFA 3UOAB 2PPEA 3BUDA 4ILDA 4NUGL 5GRYA 1XGTB 5LO7A 1YEIL 4UT6H 5ID0A 1AHWB 3MV7E 3ZKND 3MLPA 2FBJL 4X6CA 2ATKB 5D5MF 4I89A 2NQCA 4JANB 3FXIC 1BWWA 2UX7A 4JVPA 4LGRB 1FGNL 3WXWL 2AI0H 2WZ0A 1T89C 2F19L 3PXHA 1I3RA 5JLZA 5CJOL 3DX7A 4MB5A 4TVUA 4Z77A 3FSVA 3Q2NA 2BVOB 3HNTL 1KG0B 1PCSA 3STLB 3L95A 2OV0A 4XH2B 1KEMH 2JIXA 2WNKA 3GT6A 4QT5B 4YHMH 1IX2A 1JCVA 4ZAKA 3ZW3A 3W3BA 1X7QA 1L0QA 3QK0A 2XPZA 1LE9A 1H6FA 1QLRB 3DIFA 1KBWA 4Q2ZB 1F4HA 2ATPB 1F18A 5FCSH 5AVXB 3VG9B 5IOKA 2Q76A 3GUTA 2I85A 2W0FB 1TETH 5FLUA 3TP4A 1G7QB 3UC0H 2WQXA 1XCQA 4JKPH 2X2JA 4N8CH 5FUOH 2Q6WA 2AJZB 2XWTB 1CGVA 4YL9A 3QUYD 1NCHA 3HRZC 5GZOA 1EXHA 4MD4A 4CC4C 3BZFA 3GSNH 4AEIL 1ZWIB 5K1NA 4S1SL 4JRYB 1ED3B 1HNYA 2DB8A 4O00A 5FYLD 1FI8C 2PXYA 3D51A 2IOOA 3OGCB 5AOKA 1EVUA 1FVEB 2J88L 2X4RA 3PWPD 7TAAA 3FT3B 2CO2A 1HWWA 3GUFA 3EF7A 4UV7H 3S3PA 4RETB 5ESVB 3TF7C 2PYEB 3ES6B 4GQZA 5D1ZD 2Q2LA 2XQ0A 2PW2A 1B9ZA 2YKLL 5FIEA 5C2BH 4P9MH 1T2XA 4UM9D 4YZWA 3QP3A 5SV3A 4YGVB 1NBZB 3C6LC 4O51A 1MLBB 1ZTXE 5HHPB 5SX4I 1PS3A 2BIHA 2CO3A 2CA3A 3HHSB 1KCVL 5EU7E 3S2AA 1CLZL 2HVBA 4WO4D 2HA1A 4NO3B 2F54A 5I74C 4F7EA 1IGJB 4MZ3A 5CLZA 2GUOA 4Y5YC 2F53D 1U91B 2O6EA 4O58L 2Y06L 3BVXA 2IOIA 1X9RA 2WIIA 5T1KD 4L4TE 3VGAC 3GK8H 1JRHL 1O9WA 5EBMA 4GUOA 4P2AA 4QMEA 1DDTA 4PJ6A 2G75B 2ZICA 3KH3A 2CRMA 1JGEB 3F2LA 3VH8B 4TMPA 3QUYA 5GS0D 1FDLL 4OCLC 1OLLA 1IRAY 5DYFA 4RA3A 5HYQB 2PKDA 4QUOA 2CDEB 1DBAL 5DF0A 3OAZK 4FFVD 3P2DA 5B4MD 1RURL 1NGZA 3BP4B 1I8KA 3BH8B 3MUUA 2G2PA 4IKLA 4EOWH 1CBVL 1EFXB 2QQKH 3VCLA 2A83B 2VMJA 3PWPA 4N8PA 4OFKA 4DVBB 5ADPL 3RUGE 1PAZA 3L4VA 3NK4A 2W65B 2CU9A 4ONHA 4KK6D 3CQQA 1E2WA 4G9FD 4ZNCD 1QO3A 5D1ZA 4U1LB 5C0AB 3TFKD 5E03A 1JCKA 5IB3B 3KYNA 3VE0B 4PLOB 2BSRB 3QDGA 3SHSA 1K4CB 3DOIA 4UM9A 2AERT 4JPIA 2BY3A 2BFVL 4WUUB 5G5DB 4PJIB 4JHBA 2I32A 5I1KH 1A64A 3B7TA 4PJHB 3H9SE 2UUDK 3S48A 4J2XA 4BUGA 1MXDA 1N4XH 1W0VB 4LLWA 3PDOB 3ZYZA 4OB5H 5MEOA 4WO4A 1OCOB 4RQQB 3HZMA 4ORZC 1JDAA 4P3CL 5DJAB 2BIOA 2DWDB 1NFKA 4A6YH 2F7IA 3K6NA 3K1DA 4X4KA 3ZN6A 1JWSA 1HL5A 2F53A 2FIKA 3T8XA 2EVHA 4JZJA 3TEUA 3ULSA 1ZY9A 5T1KA 3IJ8A 1MPAH 2OKMA 3APDA 1G1YA 4FMKA 3VFTB 5KS9F 4GG6A 3AU1A 4ABUA 4IMLB 2F7RA 5ECJE 1K3IA 1YMHB 3ALPA 3G5XB 4PJ7B 4DGWC 2RALA 3GSRB 3VMPA 3NCXA 4PJXA 5BVPH 1E4XH 4QRQB 5HGAA 3LKOA 3ARFC 3ZO9A 4C56D 2GIMA 1EHLH 3VXMD 4LAJH 5HYSG 3CFNA 4UZGA 4L5FH 1CD1B 4ZUVB 4CJ0A 4Y16D 5C0CB 4DCQA 2AGJL 3RAJL 4YLCA 2WZ5A 5IM7B 3LSOB 1DO6A 4XO9A 4AZ8A 4KHTH 1ERNA 1I3GL 2NY3B 4KZEL 5AVQB 2A6KA 2BNQB 4G9FA 3MRLA 4D8OA 3JWOC 1YUHA 4Y4FC 4YQXL 4LARL 4MMYB 3AMLA 1HXMA 5HYEA 5LGHL 5B38A 1J1XL 1G6RB 3T77B 1NGPH 3KPLA 1BGXL 3RL2A 4H0IA 3QPXH 4JM2F 5JMRA 3PRZA 1OAYH 2C3HA 2CR0A 3L3JB 3WAKA 1F90H 4N2EA 4NNPH 2YR3A 1OCCB 3PGDB 5FYJE 4D0BB 1OGAB 5FW8A 5AVVB 2NY5H 4NN7C 4PGCB 2VZTA 2XY1A 4Z0XB 2KT6A 4M8QB 5E4EC 1ZLVH 4NO5B 4XB7A 3CXDH 3QJTB 5DEZA 1E5CA 4ONGL 1SLVA 2ZPKL 1JGVL 2VH5H 3GXIA 1G4MA 3VGHA 3FS9A 3S3CB 3IDXH 2QELA 1GYAA 2N3JA 1V5JA 1M6UA 4JQXC 3N1MC 1EVTC 5I16B 1R3IH 3BKCH 2AEOA 4FLOA 2AFNA 4QIRA 4WFHD 4KVNH 5J12C 4ODXA 1WHOA 4LLQB 4ONOA 2DJ4A 5LHDA 1INDH 2G3NA 3WE6A 1LWJA 3QO1B 2X70A 1EBAA 1WAAE 3VXMA 1JAEA 1KPVB 3DV4A 5EF1A 3FCTA 4FQ1L 2AITA 4JM4L 4Y16A 3F7KA 2LAAA 4RWHA 3REWB 3MRBA 1VHPA 3HC0A 5I15L 5KAQF 3W82A 4LMQE 1F5WA 3QUZC 4HSQA 4YBLB 5JHDE 5T5NG 3U82B 5ESQB 1FFOA 3E0GA 3EO1A 3S7GA 3MHZA 1OGTB 1SOXA 4Z7OE 1SNRA 2D4DA 1CXIA 3PGCA 5DJYB 5TF1H 1E4HA 2VXVH 5HYFA 2Z3FA 2X3AA 3BWZA 4N6RA 3DPBB 3QG7L 1WUNT 4OUUB 4XO3A 5DYOA 3UTZB 1MDTA 1JPSL 3QISA 1A6ZA 4HZAA 3RWIB 4E9TA 1NOLA 1LVEA 1M2OA 2B5IB 2CIIB 4M03A 4W81A 3DETD 2XZZA 4R7DB 1C08B 1UADC 2CALA 3QCTL 3QRFM 1TSHA 4BWWA 1X6LA 5IY5B 2AJXL 3LKSA 4JFOA 5AW8B 3BMWA 1QLEH 2CDGB 3P2TA 3HG4A 4RVBA 1EAPA 2BRRH 3U2SB 1ILSA 4YSOA 1KZYA 3SY0A 4RH4A 4NC0B 4NHUB 2Q7NA 1U4EA 2LVCA 1OW0C 5IBUB 5JZ7D 3PV6A 4K7PH 5KVDE 3WFBL 4ES8A 1KULA 3E7JA 4Z95L 1P4BL 5E8DL 2W80C 2XUWA 4KKQA 3WUWB 1JV2A 3NJKA 43CAB 5FGBC 1IU1A 2VN5A 1EX0A 3U46B 2FB4L 5CN2A 1GYCA 4OGAD 1HZLA 4Z1PA 2QSCL 4DETA 2VMCA 2Z35B 1KSRA 4JRFA 4OLXH 1UXLA 1UKSA 1XB8A 1A4JB 2X9ZA 2IMMA 1YPZB 2WSKA 3VFGH 4B9IA 2XZAL 4WKZB 2Q8AL 3OD3A 5D1QE 4LQ1A 2F5BL 5I19H 3L5JA 4QJ3B 2VLRE 4RGNC 4AGOA 5IHBA 5IUSA 3EDEA 3MACH 3MV7D 4PY8J 5EDXA 1ZK5A 3FRPG 3GMRA 5TE7L 1U93B 3QNYB 4HPYH 3T5WA 4JKKA 2ZYSA 5KYNA 5D72L 4KZDH 1BG1A 3PWLA 4WY7L 3B43A 2C4FT 1A3LL 4PJDB 3FT1A 2WOYA 1IGTB 2JTDA 4EQ2A 1LP9E 3BJLA 1EQWA 1MHPH 3O41B 4XGZA 3ESUF 5LDSA 2FCBA 3C5XA 4OLYL 3HFMH 2XPGA 4XODA 1UXSA 4Y2DC 5DO2D 4OIIL 4OCXL 1NUGA 3J8F7 3P4OB 3QEQD 3VI3B 5LDUA 1IL1B 2CPCA 1Q9KA 4X6BB 4ZO6A 3E2HC 2BFGA 3K5RA 5E1IA 1JOIA 2Z9TA 4P5MA 1IBFA 5A3ID 5J6GB 5FA3A 4NAQA 4B3VA 4F8QA 1BZ9A 3G08B 3QWRD 4M43H 5D93C 3MAWA 3NACL 4X4MA 1KEGH 4M7KH 2EDTA 3ML9A 4OZ4B 5F3BB 4JJOA 4I88A 2ZSVA 4Q58C 1J9QA 1OPGL 3HS8A 3SYPA 4EAEA 4JZNA 5DFTA 1QYGL 4CADB 5E8EB 2N1TE 3AREC 2M8XA 3VTMA 2B2XL 5F89B 1HL8A 2CBMA 1KLGA 5EZOL 5HHMB 4S2SB 2BZCA 1PJ9A 2EEBA 4AEEA 4ZMWA 1JSYA 1ZSHA 2D2OA 4LSUL 2CXGA 5J1AB 1SLWA 1U95B 3NH7H 3MV7A 2NXYB 3RYMA 2K4AA 1JUFA 3KWWA 4WLCA 3WN6A 1TITA 2YRZA 2P49B 1L6XA 1TTRA 3SKMA 4KTDH 2JLLA 5G4MA 3NJHA 4F9LC 3JT0A 1T0MA 1NFAA 4LESA 4YFEA 1E4KC 3T3PF 1D5XA 3ECVA 1R5IB 3WLWC 1OXYA 2VDQH 5LB1A 4PJCF 1CFNA 2PTTB 4YUEH 1U8NB 5B1CA 1RZPA 2BOLA 3CVBA 4H0LC 5F6IC 2CUHA 1L6PA 4JR9L 2A9CA 2ROXA 5CLTA 2AVGA 2EDWA 1A7NL 4YHNB 4J6IA 2H45A 4QRUA 4YFLI 1LWHA 2I60H 4L4TD 4IGBC 1E28B 1Z32X 3BKYL 3AFLA 3GSQB 3GHEH 1P5VB 4WI6A 3GKWH 3BUYB 2XA8L 4M48L 5AYUH 1RUPL 4KZ0A 1NGYB 2HT3C 2R4SL 2VERA 1G9EA 4JFDD 5DURB 1MCPH 3CUPB 4RMBA 1H5BA 4RGOH 4JHVA 4AXWB 2B4CH 3HUJF 1WVZA 4OFYD 5F21B 5I0WA 1O9VA 1S5IH 3MRCA 1OTTD 4Q7DA 5IVXE 3S5ZA 2LLNA 4H1LB 2BP8B 3DMMC 1W2KT 4FQJL 3BN3B 2GIYA 5IFAL 5F3HA 4JFXA 4KDVA 3MOQA 3MOAL 2J7LA 4MA8L 2BDNH 1OGSA 2IPKB 2BSSA 4WFEE 1E50A 2NW3A 2WLZA 5JPNC 3FRUA 4XXDA 1E6JL 3U7AA 5ALBH 3ZQWA 3K71A 1NCCH 3ZDYB 1QSFB 5D71H 3AAZA 4G8EB 4NQXA 5D8JL 1GRWA 4AEHH 2ITEA 3DJ9A 3C5ZD 3MRPB 3BE1L 2LLLA 4JCWA 3V79C 1QFWI 3WIIL 2NY1C 3GPSA 3H9SD 3IYLW 4A7GA 2X4TA 3M88A 3V4LA 4ZQTA 4IYKA 4N1CA 3RU8H 2V7NA 3JZ7A 1ACZA 3OKLA 2ZUUA 5J7CC 1NAKL 4NPKA 1R4XA 3JUZA 5E99H 2GTWB 4HHGA 5FFOA 4LDLB 1FAIL 2WGXA 2YBRA 4O2FA 4KJPC 1TLMA 1O9ZA 3ABLB 4Z7QB 4L4TA 3O2VL 3SDXF 2R0LH 3CZGA 4JFFB 1SXNA 1X5JA 3ILQD 4N1EA 3KR3H 2OP4H 1MFAL 4J3UA 3SQOL 1OSPL 5D7KE 4X7DC 3D2UD 4XR8C 1GYVA 4ZS6C 1KIQA 3MBEC 4OZFG 2VXQL 3X17A 4ZYKA 2VSKB 5EZJB 2LVEA 1CLVA 4WTZA 4BFIB 4FI7A 4FEIA 4JPWL 2PR4H 4YDVB 4OJDH 5IROC 1TEFA 5DK3A 3LX9A 3ZMRA 1AGDA 2NY4B 1Q1JH 3MRIB 3RUGA 3V52H 4MD0B 2YQ2A 5JORA 1HHHA 3G7TA 3HAEA 4K23L 5ICZA 2O26U 4AQ1C 3C5ZA 3O2DL 4JRLA 1WC7B 4N0YL 4XNUL 4TUKH 1AG6A 3H9SA 5DJ0A 5EG6C 5FYJD 5EOCH 2VUKA 1ORQA 1VFOA 2GJZA 4OJCA 3PNRB 1HSBB 2KDGA 4LOEA 2VN7A 3TZVD 2VJ8A 2MJWA 3BSHA 2YD4A 2OMNA 4H20L 2XCMC 2B59A 1JMZA 1RVFL 5C0RH 5FC9A 2YBGA 1FC1A 4FQCH 2UZIL 4N20A 1KT2A 2R0WH 4Q52A 3RWCB 3NN8B 4CL7A 4Y5VC 2OSLA 5DLMH 1BZ8A 4X5LA 3GXNA 5EHFA 3UACA 3BZ4A 3G5ZB 4K3GA 3K80A 4FG6D 3SBWA 2WTOA 5EU4A 5ACMA 1BPVA 3D2UA 4H0GA 5EO0B 5KBPA 4UTAH 5CGYC 5CZKA 4N2LA 4HQQH 4EUPB 4AGQA 1LO2H 3KYKL 2X1PA 1OE2A 4CJ1A 4I0PB 2X3BA 4ENED 2V7HA 1RHHB 3TJPA 1PQZB 1TQTA 5FV2A 3FH8A 3MUGB 1KZQA 3KNBB 3QIWD 1D2PA 4TSBH 5JHDD 3RVTC 5HVGB 2NNAB 3D69A 1QEWB 3JWDH 4GAYA 1JPGB 5DZAA 5BZWB 1F1GA 4ICWA 4Z7NB 4Q9RL 1WGOA 2HRGA 4AVIA 4W1TA 2DI9A 4GMTL 5E9DE 3ZTJH 3OLIA 3TJHC 3EZJB 3KS0J 1PNDA 2OMWB 1A1MB 2WANA 4H8QA 4HF5L 4WNQB 5CEZE 2BVTA 2Z6FA 2ZZUT 1MF2H 4IDLA 4P3DB 4QO1B 2F1AA 4RLDA 3IXTB 3SGEH 5F9OL 5JDJA 3MNZA 3PS6A 2FQDA 1YMME 1E43A 3MO1B 1XSJA 1SN5A 4XXWA 3TZVA 4BRJA 3O3AA 4K5MA 2XN1A 3WFDH 5E6ZA 3IDJB 1I9EA 4N8VA 1KFGA 1T2JA 5D2LF 1Z66A 1G4RA 1I7ZB 3QORC 1IFGA 2YA2A 3U6XA 3VX0A 3EDJA 3IDIA 5AZEL 4BE6A 1CR9L 2HFTA 3GZQA 3I2CL 3O45A 4LEXL 3L3IB 4IBWA 2VDMB 2EZ0D 4ODBD 1RULL 4LF3A 1NGWB 1WQVT 1N5YL 2EJ1A 1ZAGA 1CLYH 1A8JH 2Y7QA 4PGEB 4ZUTA 4S1RH 1LK3L 4LCWE 4KPHL 2V4LA 1FFPB 1JXFA 4F24A 4ZRGA 3FAWA 4M7LT 1XF3A 1B4JH 2J1YA 1WAAA 4FP8H 4JFZL 3GBNL 4TTDD 4FXGB 1VEMA 4GBXD 5EIQA 3LVTA 1UT9A 4MRBA 2FJGB 2XKNA 1DTUA 5ERWB 2Q3AA 3QIWA 1P4LB 3GQFA 3RIFK 1CWVA 2K7QA 5JHDA 4X5WB 1JGUL 3QIBC 5DD5L 3FQRB 1S9WA 5F7EL 2P28B 4QRSB 5D1QD 4AGNA 4DAGH 1U8CA 1J5OL 2J21A 4RRPA 1UM5H 1A66A 1CI5A 2VLRD 3W37A 2F18A 3WD5H 5GZND 1YSOA 4K8RD 4JW3A 4APQD 2EVGA 3LZLA 1QQDA 1OM3H 1FZJA 1MWAB 2XZCH 1GAFH 1QPKA 2H0JA 2X4PB 4NRXA 4R96A 3AMKA 4AC2A 1F3DJ 2EAEA 4YHKH 1AP2A 4MZIA 2ALAA 2Y7OA 1F4YH 1F8TL 3AXLB 3N1PC 4MHHI 4XNYH 3DKHA 4GT0A 3AABA 3EFDH 4XNZC 4KTEL 3WENA 1LO4H 5I0YA 3WE1A 2HTLC 3MMEA 5IMMA 1CDJA 4MCZA 3E38A 1FNEB 1T7VA 5LCVL 2VDOL 3UIYA 2X1OA 3N50A 4OQTA 4GRWB 1J5DA 3GSUA 4A63A 1BBDH 1TZHA 2QVFB 4MTMA 2YXVA 4NC2B 4P59H 3VWJD 4TOYH 4C58B 1M9WA 5FO9A 2EO7A 1OCWH 2X4NB 4BSWA 4GBXA 1PLCA 3LPOA 1IEAB 1LM8V 1OCZB 5JHLL 3IDYC 1NINA 2CBQA 5DRXA 3UTTE 2CGRH 1EEUA 3BPNC 1AYRA 3DUUB 2PWHA 3O6FA 2H3NB 1J8KA 4DGYL 5ILTH 4NC1E 2O5ZL 4G7VL 5D1QA 2J73A 2NSQA 4L0ZA 2DWSA 2P45B 2VLRA 1YZZA 4O4YL 5DQJA 1VCBC 3EJJX 1X9UA 4APQA 2D3VA 3P77B 4HBQA 4DK6A 3KVPA 2AS5M 3QUXC 1XH3A 3BUTA 5AL8A 1GPOL 3QDMD 5I8EB 1EHAA 1QHQA 3LIZH 3I6KA 4IBZA 3GINA 5GGSB 1LP9A 4HJ0D 4HP5A 5HHOE 4Y4KC 1SXAA 1Q72H 4WU5A 4F2MB 1TYJA 2NNRA 2APFA 3LHPL 1GOFA 3O0LA 4JGUA 3ULUL 5IFHL 4NX0A 2E8ZA 2V5YA 1XR9A 5B3JE 4U3XA 1PX4A 3WXVL 2R9HD 4PRPE 4NN6B 1N59A 3I9PA 3TVMD 5JPMC 4ZDHA 2XN9E 5FK9A 4YHLL 2ADIA 1KCLA 1CGSH 1QPXA 4H25B 5ETUA 1SUHA 3S8FB 3IN2A 3RA7H 2R4RH 3CDGB 1IGCH 1I8IB 3VWJA 4LBEA 1IKFH 3DWTA 3O6KL 5DEJA 5IJDC 4HUXB 1DEEB 2O5YL 4GW5B 4FNTA 4WV1B 4WTXA 5KYXA 4MQ7B 4OZIE 1ZA3A 3U0PA 5J57B 3AT8A 4XPFH 3V6FB 1LMKA 4OKDA 4F33B 2YD0A 1KPRA 1JHKL 1G6RH 1HKLL 1UXMA 2VLJB 2FIRT 4P2CG 2NQ3A 4POZD 1RQ5A 3LRGA 1SZNA 3HE7B 3OHXB 1MLCB 1HEJC 1C16A 4MMXB 1CU4H 1S7SA 1RPUA 1S7TA 5JW4M 1G7LA 3EOTL 1QASA 4AT6A 2MKLC 1UASA 3EO9H 4L1BA 1LGVA 4L3FA 4V1DB 5D6CB 1F4XH 5AL0A 1UXWB 3QEHA 2XBTA 2AQSA 3GHBL 3P30L 4FJYA 1GHFL 4EDWL 4LPYA 4NGHL 1EHXA 5DCCA 5I8OL 1PW3A 4X4YB 5DJ8B 3AY4C 3Q01A 1E9PB 4DP6X 2QPUA 2RACA 2CMRH 5T1JA 5FB8A 3PAZA 2BVQA 4F7TB 2H2PC 5EMYA 1TQUA 2DLGA 4Z76A 2BSTA 2WVSA 3HKZA 4FMVA 5FWQA 2R29H 3TVMA 1S7QA 1I1FA 2QSVA 4AYDC 1MH5B 4BA0A 3DROA 2O6PA 1HHKA 1MQKL 2J3SA 4XX1G 4Z7VB 4XVSH 1DYZA 1MNUH 3QI9B 5D7KD 4U6VH 4DGUA 1GJIA 2CK0H 5DK2B 2DQDL 4JFEB 4JRXE 2VUOA 5DUML 3RY4A 4DP0X 5IVXA 5IW6A 3PL6B 3VU2A 1GW0A 2ATAA 3KM2A 1BIIB 4XPTH 2DQFA 3BAIA 3QJHB 3D4YA 1E4WH 2YGPA 2CK2A 1DQML 1FCCA 1VACB 4PI0A 3GF8A 5L2JA 1SOSA 2VR5A 4F80A 3S35H 3D85B 5ITFB 2PYED 3VQMA 4M3HA 1AKJB 2FD6H 4F1SA 3RVUD 3JZYA 2QGBA 3LXBA 3K81A 3SDYL 2Y2TA 4HJIA 4PBDA 3AM8C 3NVQA 3WHXA 4OCYH 1CQKA 2QHLA 1ZANH 3C5SA 1FVCB 1FORL 3VSQA 1YNLH 3GS7A 2VKWA 2PMZA 3B2XA 4HKXB 2P5EE 3NIDE 1WO2A 3CMGA 3ZGIA 3UGEA 1XSOA 3K6FA 2CLVB 3PWVB 3HR6A 2ETWA 3HNSL 5F1OB 5ICXA 5I8KH 3KWVA 4YK4B 4YE4L 1HXYB 2ODHA 1YNTA 3HZVB 4HUUA 5FOBB 4DKFH 2GEQA 4XMPL 3SQRA 4AV5A 5F6HI 1TJIH 4KXZH 4G7QB 1QG3A 2R2BA 3T1WA 3ARUA 3MR9B 2AJUH 5D7SL 4I3GA 1IBYA 1KYOK 4JAMB 3IU4L 3CFDA 1UM4L 3BIKA 3MLWH 4JO4H 1UWXK 2VAJA 5ANMB 1CXHA 1RIVH 1UWFA 4HHAB 3RWEB 1W91A 3O81A 4NQQA 1ZA6B 1NJ9B 2OMBA 4HZ1A 3UBXB 1XF1A 1UWEL 4MB4A 1QI5A 2DTMH 3A47A 5K33A 5EC2A 4ZO9A 3TN0D 1BMZA 3VB8A 3U4KA 1FFQA 4JPQA 1JBJA 2BMKB 5KSBF 1DQIA 4XVJH 3TIEA 5HYIA 5AVYB 4M6MH 5E9DD 5DEGB 4GKSA 1CFVH 3I50H 4XMKH 5CEZD 3BEVB 4YGVA 4C8XA 2L0DA 1N26A 4KO9A 3MLTB 4G70B 4W9KC 3S4SG 4Y9FA 1KXVC 5KVGE 3H7LA 1WBXA 5AOJA 1YMMD 1JWUA 1ZS8A 4CNIA 4M4RB 4WI9A 5H37A 3UJJL 3L4CA 3ME0A 2B4CC 4ZUWA 1C7TA 5HHXL 4NRYB 5F1SA 1VGEL 3BZEA 4PLNC 3KXFE 4BUQA 2X42A 2CO4A 1NL0H 2YGNA 4L4JA 3FC8A 3D0AA 4S0SD 1FO0B 2C9VA 2Y36H 3VI4B 3N55A 7PAZA 5B38G 3JBG7 4ANUA 1IBHA 4EJ1C 4LCWD 4YXLL 1PZCA 4TNEA 3D48R 2ZQKA 1P1ZA 1RZFH 1KNOB 1V7NL 5EFIA 1AC0A 1QSEB 3OKMA 2WQWA 2AABL 2UZYB 3O8XD 3RB5A 4ICXA 4PJ8B 4XO8A 2GTQA 1T7ZA 3M07A 3RLSA 5C0CD 3T2OA 1HI6A 2XBDA 4YIQB 1KJMA 1GS8A 4RGMB 1H6TA 5JR1L 2PTUA 2QVKA 3V0AC 1M2VB 2G2NA 3TN0A 2EC9U 4ELME 1ANUA 2FEEL 3FTZA 4TN9A 1LD9B 3MNMA 1K2DA 4XP5L 1IAII 4TQEH 3EZ8A 1T22B 3IF1B 3LPGA 1S6NA 5I6XB 2CR3A 1HDMB 4NYLA 4P4RB 3DYMA 1T6WA 5E9DA 1ACCA 1MJ7H 1DQJA 3C8HA 4I3SL 3NUKA 4GO9A 1L9PA 3VWKC 3EHBD 1W0VA 1YMMA 5E2JA 1L9TA 1BW8A 5C6WH 2WVVA 5A7EA 3UJIH 3FB5B 4M6NH 1TNMA 5F9AC 2R0ZH 3DHMA 3S98A 2WTRB 5D70L 3FONA 3RVVD 1HE8A 4MAYB 4QCIB 4ADIA 1WA2X 1A7OH 3EO0B 4GSDH 5E08H 3T0XA 5HHVL 1FZKA 3WEAA 5ADOL 1SMDA 3PP4L 3NEEA 2CO6A 6PAZA 4GSRA 4UIKL 5C0DA 3H2WA 4KMLB 3FO1A 4H1LH 2R1YB 4LCWA 5DJZB 1GGCL 3HE6D 3T2LA 1PG7L 2H2SC 2Y5TB 3PHOB 1JHLH 3HZYA 1EJ6A 1BDYA 1PPIA 3KLKA 4IRJD 4JPVH 4QRPB 3B37A 3MLXL 1A6PA 4JVUA 5DRNB 3V4UL 5LGKA 3O8XA 4Z7WE 3C9NB 5A1AA 2WUCL 2VDLL 3BDBA 5DR5H 5D2NB 4W9EC 3O3UN 4DEPC 5IM7A 4LCIL 2YXWA 1O6SB 1F6LL 3S3DB 4ETYA 5TDNB 4AGMA 2J72A 2JH2A 4GAJH 3V4VB 5IHHA 1NEZG 1XF2B 2ENSA 1AGEB 2OCJA 3V4PL 2NOYA 4HV8A 5K5YA 1TZGL 1JZ3A 3W9EA 3ETTA 3B7YA 4KRPD 4ZSOB 3ULUE 4FX5A 2H7WA 5TE6H 3GYRA 1F3JB 4EI5C 3KWTA 2IBBA 3C87A 4R0LA 3FTGB 3B2VH 1GC1H 2ICWB 2KH2B 3AB0C 2J1KA 3NCJL 4JG9A 2BSED 4PJEF 4UU9B 1J05A 1KFAH 3JWOL 4IRSC 3IFOA 5TK2A 1Y18A 2BP3A 2XZQL 5I66B 3KPPB 3L2MA 1DQTA 1HHJB 1C1EH 1NSNH 4J3XA 3MRFA 2BS71 2IH1A 4B27A 4I3RL 3GTVA 4FNLH 5LJYH 3RQ3A 1BM7A 4N25A 3WYRA 2L7QA 1H3WM 3MROA 1ZXQA 4BFBD 1GKOA 2FYYA 4KI5E 4U7SA 1IKNA 2MQCA 2AQNA 1LEKB 3NABH 5EF3A 2YA1A 4Y5XB 1HILB 2K6YA 3D25B 2JXMB 4S1QL 4EBQL 4PRPD 1CDYA 5C0IB 4H88H 1G7HA 3O6MH 3T2NL 4ISVA 3MXWH 3HE6A 4KJWC 1S9KC 1NGXA 1H15B 3A23A 3HB3B 3QQXA 1VCAA 4J3BA 5AW9B 3TBWB 1DUYB 4HJSA 1HE7A 2OMUA 2H1XA 4XP9H 4IRJA 4R7XA 4NQCB 4Z7UE 3RGVB 2X38A 3T4AC 4IBUA 4OM0L 4P2RB 3E9UA 4WWKD 3G5VA 1BLNB 4HDIA 3BKJH 1KXHA 2O61A 2OTUB 3UTTA 4MDIB 4YPGB 4X80L 5SWQB 3ZDZE 5CEYA 2QKIA 1TEYA 3FSZA 3WUZA 4DO6A 5I76A 1A5FH 5LBSL 3CHQA 2J1ZA 2FK9A 3L5WB 5EOTA 4JRWA 3RURA 2ZCLL 3UYRH 5D4JA 3K4AA 1M3JA 3QIUD 4LCCC 5JQHC 1HL4A 4PREA 5DHDA 3QRLA 3K1KC 3DPBA 1AQKH 3N06B 5A2CA 2BJMH 2ZCZA 3UGXA 3OKEA 5KJRH 5E0FA 4YHZL 3DVGA 3SDDA 3OB0H 1XGPA 4X7TA 5IHZB 3ECUA 3IVKB 2O5NA 3MLVL 1QI3A 2A7BA 1QEXA 5DQDL 5KVMC 5HHOA 2OX5A 4XP6L 3VFMB 2ZOLB 3VXNA 3AUVA 2OR8A 4MXWH 2FZ3B 5CJ5A 1AOHA 2E6JA 2VN6A 2F7PA 1OF2A 4GRLC 4PJFB 4BE5A 1TVHB 2GI0A 5L0QC 2YSSA 1P7BA 4I48B 2CRYA 3EGXA 2EE9A 4PY8I 2EDOA 1RZ8B 4PGBA 2Y3NA 4LRNH 5A2IH 3VRJB 4LPUA 2AEQL 4PRPA 3SGDI 3QHFL 2XN9A 4A2HA 4WJKB 2DL2A 1AE6H 4HUWA 4B95C 1U8HB 1YDPB 4U1MA 5A16A 1HXKA 5JOFA 4WI3A 35C8L 4JY6B 4HFWA 4JRXD 3VYOA 4W70A 4ZD3L 2X7LA 3IJYA 3MRHA 2P7TB 4WWKA 3OAYK 1GIGL 2HVKA 2X1WL 5BRPA 2QADD 3JV4B 4OZIA 4L3CB 1QRKA 3FQWA 5GRVK 4HX1A 4TQHA 3P2BA 4TVPD 3RVXD 4C47A 1RAMA 5L9DL 5IJVA 5JA9A 3OKNA 5AZ2L 3GIVA 1IGIL 4U31A 3R19A 2KBGA 3QIUA 3H42L 4HBCL 3QPQC 2FEEI 2MCG1 4M1CD 4TNGA 3VD3A 1KCUH 4N5UA 3VXPB 1R6VA 3L3DB 4TUOA 4R97C 3ARTA 2Q5BA 5LQBL 3OMZA 3ZL4L 3CX2A 1NFDB 4DP8X 1ROWA 4HKZB 1T1XA 3ZE1F 3EAKA 2FGZA 4AUYA 2VDMH 4G8GE 4NENA 2MTPA 1Z9MA 2P5ED 2VXQA 5KG9A 2X4SA 4MQTB 4IMKA 4L4VE 1V54B 2JCWA 2ARJB 3B2MA 3L2LA 3F7LA 2B0SL 3MRRA 2IDUA 3HJEA 4TRPL 2HT2C 2ZCKL 5A2JH 5DZNA 1TQBB 2E6PA 3ZDXB 1LMIA 2Q10A 2WAQA 3Q9QA 3BI9X 1IGYA 5EUOB 4DPRA 3QJSB 2OXGB 2YPVA 1FFNB 4J8RA 3BVWA 4AYGA 1XIWC 2JCCF 3O2DA 4JRXA 5CBAA 2WZ6A 4XB3A 3FMGL 1D5MB 3NPZB 3D4GA 4MVBC 4DZ8B 5GGRA 5DMYA 4K3JH 4DP5X 1QW8A 1NBYA 3QNFA 1JXKA 4G9DA 5E94A 2OJEB 3RVWC 2VOTA 2ZYIA 1M42A 2YAPA 2O1AA 5HDQL 1JXGA 3CMOH 3VG0L 2FRGP 1C12A 3WDJA 1ZLSH 1MIEL 1QSFD 1MIML 4LSQL 2EEFA 2GC7C 4BH8B 4B9JA 4Y19B 4UT7H 3HC3L 4LNRB 4AGLA 3UPRA 3IDUA 1JTOA 4GKZB 3RJDA 1FSKC 3RX9A 3PREA 1C5DB 5D7IF 3ESVF 3BN9C 4HISA 4HU2A 1IC7H 3L3KB 3P9LB 1DSFL 5FKAA 5KUMA 1SXSA 1VFUA 2IADB 4M61A 4WTZG 4XNQA 1ZXKA 1FV1B 3ARBC 5F93C 2WLIA 5DVNA 3P11L 5FKPA 2EILB 4IDJH 2P5EA 3UBXI 1L9NA 5DFAA 3W1ZA 1OT2A 2FX9H 2UWEB 4IIQC 1YN6B 3KXFD 4LFHD 2Z31B 4KKRA 2IDSA 2R59A 5IB2B 4HWBL 3BCDA 3GSQA 3HAEG 1BVKB 4QEGA 5D7JB 1RIHH 3RZCB 2PETA 4JFQB 1NGYA 5ITBH 3BPLC 1ZDQA 2VC2L 3S8GB 5E0QA 2WY3B 3US1A 4JE0A 5CO1A 1S7WA 3QCUL 4K5OA 4DZBB 1RH8A 1DL7H 1ZEAL 1Q0XH 5I1CL 2XJKA 5T5FH 3JWNE 1ZPUA 2RFXB 1AVAA 5DK0B 1NUFA 3NCWA 4NM4L 1JK9A 1MCWM 3GMNA 1JD7A 3ABMB 3L4WA 3B3IA 3X1EA 3ZR5A 4L05A 3CBRA 1EUTA 1K8DA 3SB3A 4RIRB 4KRLB 2ZXCA 2XX0A 3LZPA 2OTPA 4O9HH 2LFGA 3UGUA 1WV7T 3MRGB 1WBZA 3SZ6A 5EA0H 1VZGA 4XZUA 2ENYA 1T66D 3Q5OA 2XWBB 4EDXA 3TM6A 1H3TA 2Y7SA 4I2XB 4KK5C 2I27N 2Q3XA 4P5TD 1KLFA 5DWUL 3WTVA 1NCWL 5TQ2H 4P5KB 4X99A 5I17B 5I1LB 4L29A 4TTGA 3HS0B 5H4YA 3JVGA 4XNMA 2E74C 3SE6A 5DMJB 1T3FA 1QWHA 3FTYA 4K94L 3SKUD 4NQSA 3ZHFA 2YK1H 2FO4A 1GKEA 1S9YA 1L9RA 2ITDA 3DX6B 3QG6A 4HIXH 1B4RA 2AJVH 4YSCA 4IS6A 4Y2LA 1M1XB 5ALCL 3A6CL 3KXFA 2J1WA 4TLSA 2ESVB 2YEVB 3II3A 5DJCB 5TE4L 2ZUXA 4ZUUB 1AJ7L 5H35A 4L37A 3MLRL 1BZEA 4KO7A 3WIFB 5B8CB 1UACL 3MJ9A 4LVNC 3TO4D 3NDZE 3U4BH 4XI5D 2Y3AA 1QMUA 4MA7H 3G6JB 3ZU8A 4N28A 4PJIF 1IAKA 4LVOB 5FCUH 2CJSA 3UJTL 4PJHF 4HZLB 4CKQA 1GXEA 4N0UE 3OR7B 4PRHE 4WDIA 2OW7A 4Y9CA 5DD6A 4N8VG 4N2HA 1KPUB 2O5XH 4J6RH 4LSRL 3U7WL 3V2AR 2MMXA 3F12B 2IBZX 2C1PA 1VFMA 1D6EB 2GAZB 1AXIB 4L8BB 1IGFL 3KPSB 1I8MB 3TBSA 3QB7C 5BPPA 4ELMA 1GH7A 1RPKA 4B5ZA 3EOAA 4TXVB 4V2CB 3ULUD 2UZXA 1WTGT 5TH2B 4P5TA 2OYLA 3CNKA 2V9RA 4O2CA 2NUPB 3BH9A 4XBPB 4PJ7F 1BEYL 1B90A 5ESAA 2XQBH 4QY8B 3VFVB 2E56A 2Z91A 4RBPK 4WW1A 1ZHKB 3TV3H 2OTWA 3MNWB 4AMKL 4QHUA 1HH6B 2ENQA 3NCCB 3MV9B 2YIHA 1NEPA 4X98A 2MHAA 4G6MH 4E9VA 2ENPA 4N3TA 2R56L 4NNYB 3GRWL 3X14B 3U6XS 5DVKA 4NKOA 4QF1A 2MNWA 3UH8A 5JHLA 2DEWX 4NSKA 3U36A 4OLWH 2J8UB 3TYFB 3UTQA 1OB0A 2L3BA 3ZKMD 1U92A 1EEYA 2YWZA 2CUIA 3VQ1C 5IGXL 4HCRH 2MCPL 3BGMA 3CVHB 4OIAA 2OJ1A 2N4IA 5C07E 3MLUH 1J88A 4X6FB 3QA3B 4ZAKC 3TO4A 5BV7L 3P9WB 3LS4H 4MD5B 1G5GA 4UINH 1CFBA 5IQMA 2BC4A 1INEL 3IETA 3LQZA 1A21A 3BSGA 4Z7WA 5DHVA 5AFAA 3TPKA 2G2RA 4DK3A 5L88L 3FBQA 4ZFGL 4O2EA 4HS3A 2ZP0T 5KSAD 1KWGA 3HG2A 1SM3H 5GZOC 3CSYA 4R90H 5FYKL 4JPKH 4U3SA 1ZT1B 1MFNA 1JHTA 2D3NA 3H7BB 5IKCA 3VVWA 4P99A 4LQFL 3OLDA 1P5UA 2PXYC 1FNAA 5E6IB 3VO0A 1NIAA 1CT8A 1NCUA 1P6FA 4NAJA 3M17B 2LW3A 3IDGA 4P2QE 4D9QD 1YVLA 4OD3H 2A9ML 1RU9H 1U3HD 1LO3H 2FWUA 4NIYE 4A2MA 5JW5B 3U9UB 1LEIB 2ERJC 4ADJA 3GNML 4YXHL 3ZKNC 2EH8H 4GQRA 5L2KE 2IWFA 2NY6B 3WS6A 3ISYA 3UBGA 1CLOH 3AT0A 4PM1A 3EW3B 1GY2A 4AGPA 3LAFA 3WJMB 2PCYA 3KW7A 4GI9A 1P4UA 2H3XC 3BQUD 5L4JA 3FNKA 1MY7A 3WSQH 3KBFA 3U0TB 4AIZB 3P40A 1M71A 3LRSB 1W6LA 5DT1L 1MCSA 1J5CA 4G8IA 1I75A 4R4BA 5LAXA 3QZLA 1UM6H 2EC9T 1H9VA 3AU0A 5EZLB 4XVTH 4Q6IB 5CD5D 3MFGB 2IALB 4Z7UA 2DQUL 2EIDA 5CNHA 5CILL 4YHIA 1WAEA 3TONA 3IB4A 4KKLD 5SV4A 3X1NA 2UXFA 4X6EA 5KSAA 3QUYC 4FABL 2A6IA 1HEZB 4XTRD 3U2JA 3VGEA 2XJLA 5AKRA 4U1NA 4DGIH 5EDSA 4BFFA 4HWEL 2GHWB 3THMH 5CFHA 4UUJA 5HPOA 5IFJB 5J13B 2VQ1A 2LQRA 3ROLB 2H1PL 4IOSD 3QQ3B 3BHBA 5DSCB 4G82A 1FBIL 2WMPB 2O30A 1CZ8H 1NPNA 3CK0H 3KCPA 4IW4C 3BXNA 2FJFA 1J5HA 3RWFB 1DQVA 1U8JB 1P69B 2YD1A 1U3HA 5CINL 5D1ZC 2NW2A 4I18B 4AWJC 2ZXAA 5D1XB 3BYTA 1HL9A 1QFOA 5DD1H 4G8GD 3PJNA 1FO0H 4P9HH 3ZYJA 4OCMC 1IC4H 2FSEA 4OLEA 2VTFA 4XCNB 2OK0L 4L4VD 4X6CF 5C0ND 3BQUA 4WO4C 4LVEA 3ZL2A 3LXUX 2HG5A 4DSYA 5J11B 5K59F 2FEDD 1OTSD 4PJGE 1OPOA 2LABA 5F9JA 3CFBB 3ISRA 3FW6A 4OFIA 1BAFH 2HRPL 1MHHA 3CPLB 3G6DH 2AQ2A 2C5DC 2NTFA 2UVEA 4JZJC 5C3IA 5GIRB 3B6SB 3U1QA 2EE3A 4XWGH 5BZZA 1RZGB 4HMDA 1DBML 4FCHA 1J8HB 2P8LA 5GXBB 1GC1C 4JKWA 5IW1B 3PCYA 1C8QA 1WH0A 1C5CH 1ZHBA 1HINH 4PJDF 4M1GH 4ZMLA 2PP8A 1T1YB 2AQPA 4OLVL 3MRDB 5GS0C 4JQIL 1A9EA 4U3HA 4QHLB 4DUVA 4QXWA 1FYTB 1IFHH 4FFVC 5GHWL 3NSFA 3WI9A 1KCSL 4PJ9D 3KH4A 3DC0A 3VI3F 4XBEL 4IOSA 3E9TA 1E2ZA 2A9AA 2JKNA 1P4IH 1JYVA 2A9NH 2Q86A 4NEHB 1PX3A 4FKKA 5DS8A 2ZSWB 5I1AA 1BCIA 3DARA 3JV5A 4BELD 2FO1A 4FOMA 3PWJA 4KK6C 2XETA 4KWUA 5HGDA 3CH1A 4Q8BA 4OQTH 5IMKA 3TFKC 2IF7A 4OCSL 4G7SB 4NZDA 5KVDH 5GGTH 2CGZA 1UFUA 1F13A 4NUGH 3LDBB 1YEIH 3MCLH 4E41E 2FBJH 4G8GA 4Y8AA 3AQXA 3JQOB 4PJBE 2E27L 4LDOB 1FGNH 3GI9L 3WXWH 4L4VA 3OXRA 5DU7A 1RCYA 4B50A 4B9YA 1QTSA 2F19H 1OQOA 1KF9B 1UD4A 2YPLE 3RL1A 5F7WC 4UF7C 1I1YB 1JMXA 2VAAA 4J3OD 4WU7B 5SWSB 3WN5A 5JW3L 3C12A 3ZE0E 1PD0A 1P53A 4DEUA 5AVSB 4DFHA 5KYUA 2BS8A 3CFEB 3BD3A 1N9PA 2AJ3A 2X4OB 1U3JA 2A77H 4PWJA 3U9PL 1YEJL 5CLXA 2EDDA 1H6EA 4JFED 1MEXL 4AYSA 1JVKA 3V4VH 4BINA 3V0FA 4WUKL 4KJYA 3KS0H 2V37A 3I75B 1ZIBA 4QI3A 3R7QA 3RWDB 4ZW7A 4XPAL 5GRJL 3AQYA 3PXLA 4AEIH 5FO8B 5FGCB 1PLGL 1FZOA 4G43B 3GDCA 1A9BA 4BD4A 2EVJA 4Y16C 5BQ7B 3D3VE 4PJ9A 1P7HL 4AW7A 3S3JA 5E1GA 2J88H 4JM0A 1PKQE 5DD0H 5GJTL 2KMWA 2COVD 1WZLA 3S6CA 5C70A 4QLWA 4X8JA 4WIQA 3VXTB 2EC8A 4OSUL 4MKMA 1LXMA 1NKRA 1UXWA 3DUSB 3EFOA 4RMWA 3BCFA 2YKLH 1XV8A 1RKRA 2ZUSA 3GSWB 3HCVB 4X2UA 2JELL 1KJ2L 4MGXA 1A0QL 2NYYC 1DE4B 2I9TA 4X4XB 4BKLA 4R5TA 1KYAA 1I9IL 2B9AA 3S97C 4IU2B 5AEAA 2PCFA 1CLZH 3MRJA 4OM1H 2FLBT 4NS0A 4PIRF 5E2WL 1T1ZB 5TD4A 4BK8A 4MASA 2ORBH 2ZCHL 3L5XL 5FDWB 1AIZA 5CKAA 4KFMA 3ZDYF 3LTVA 3FQNA 3WFHB 1OALA 5I1GH 3OKKB 1T4KA 2ICEB 4O58H 2BNUB 4YHPA 1WA0X 4N24A 3HR5B 3T0AA 2HTKD 4HOXA 4OI8A 1EH9A 3NZUA 1JRHH 2EIZB 3BVDB 5DUBB 1FCGA 5H37G 2WWKO 3EJZD 5HVWA 4LCYA 2EACA 4GG6F 5I6NA 4XVOA 4HMEA 4IBVA 4NPYB 3SDAB 5KWYC 4N2AA 4XWOD 3LNIA 3N2JA 1FDLH 1M7IA 2Y23A 3HI6L 5HHQA 1ZHNA 5KYWB 2VDOB 3L48A 4PJXF 3ZE2B 1DBAH 1F3DH 2G4EA 3GRBA 4QTHB 2PNDA 4KNQA 4Z7QF 1CBVH 5CJQL 3I6GB 2Y6SC 1HQRB 4NDMB 4WCYL 5ADPH 5F1NA 3V0EA 1BQHB 2A6DB 1CG9A 3F58L 3MFFA 3PV7A 4WTWA 3CU7A 4FXGC 2Z92B 4QRTB 2WW8A 3RWJB 5H4ZA 3LKRB 5EO1B 1T04B 3QXWA 2MRYA 4G42A 1IQWL 4CMHB 4B7IA 3SO3C 2IOMA 3L81A 1YJDC 3SDCB 4J27A 1IZKA 1KTLB 4QRAA 4XCCL 1MRCL 1BA9A 1JXDA 1JTPA 3GJEA 3L45A 4NKDB 4PUBL 4NO0B 4LLYA 3APNA 3K2MC 3DETC 3C60D 3VRIB 5EIIA 2FQFA 1N3NA 2H47C 3BSZL 2H26B 4HLZH 4AJYV 5C07D 1AQDB 2GYSA 1BOGA 3VSUA 4BZ2L 2K45A 4JFHE 1IBGL 3OG6B 1IGML 4WK2B 1I7RA 5E56A 4M7JL 4N0UA 2R23B 4PRHA 4W9CC 3O3BA 3C75A 3N40P 4MMZB 4YLBA 5JZ7C 3HI5H 1JNHA 4FXKB 1ZA6A 3KHQA 5MERA 12E8L 3AGWA 4NUJA 3RBGA 4HKJA 2R2EB 2ZOKB 1R17A 2PO6A 3P4NB 4WJG3 2DQJL 1QPPA 4G6KL 3MLSL 4OGAC 3PIQA 3RAJH 4GP4B 1PIGA 1N64H 2Z93A 5J9PA 2P8PA 3G5WA 2XWJA 5T1LB 3SCMA 3E1F1 4ZZFA 4ZXBD 3ZYIA 1QZ1A 2AXGB 4P2QD 4CU8A 1F1AA 4NN5B 2K8QA 1FG2B 5TFSL 4AQ8A 3GSOA 4YQXH 2BIQA 4LARH 1JGIA 1B0RA 1BMGA 1KTBA 1N5AB 5LGHH 1M56B 1J1XH 1PYWA 4MCMA 5AUMA 1BGXH 4EKJA 1WSST 3VFUB 3QE5A 4F8TA 1Z9OA 1K9TA 1QLFA 4JUTA 4P2YA 4C55A 1NLBL 3SZKC 1U8OB 1S9XB 2VL5A 4PB0H 2X0WA 3GRGA 4BYHA 4J3VA 1DUZA 2VXTH 2JKLA 3WS3B 1SJXA 3WNOA 3C60A 5BRQA 3QQDA 4G6JH 2YQBA 5F96L 2GK2A 3T4YB 2EECA 1S5HA 5GSRB 3IWUA 4ZFQA 4LLUB 3FUIA 5C07A 5LBSA 1ORSA 4U4BA 3T9WA 4Z7NF 1J0JA 2A5UA 2I07A 2GFBA 3GMLA 3M1BA 5DO2C 4ONGH 5DO8A 3UAJA 3LZNA 1JGVH 1OB1A 3V5HA 1A4AA 3GZOA 3G6JE 5FA4A 3X11B 1KELL 4I0CC 3O3DB 3JV0A 5E8OB 3SYQA 3ROOA 1AYOA 4K3DL 1IO4C 2V8LA 2GABA 5A3IC 5EU6B 2BWQA 4L8CB 3ULVD 1C5BH 3ARGC 3OSVA 1H5BC 3CZEA 4OFVA 4XP1L 1JNLL 3ZZSA 4HJGA 5F0LB 3IS0X 3DHPA 3F5WB 3D39E 2C9UA 3IMRA 5IQ9B 1R3KB 4W9LC 4FQ1H 4JM4H 2BS9A 4X6DE 3T0EB 3QWOB 3CXFA 4MLIA 3FYIB 1UJ3A 3L08A 4QXGL 1G7JA 2YD5A 5DFVD 2QEJA 3DX8B 4ZXBA 1JI1A 2A73A 4MYWB 4P2QA 4HIIB 5DZLA 1E42A 1UH3A 3ZIYA 3ZPDA 1Q9WB 4KAQL 4HS6B 4CW1B 2AXFB 5FECA 4WV1C 1L3NA 4HUCA 4JQVA 1RZKH 1G7MA 1Q94A 2PUQT 3QG7H 4I5BB 1AD9A 3UXFA 2ZUQC 5L2KA 1XGRA 2L04A 3ECWA 2Y07L 1XGUA 3CLFL 5EU7C 2Z34A 3QCTH 2BOCB 2ZAIA 2HLAB 2JKWA 2BO0A 4G7RB 4MJ5B 1EO8L 2HUHA 3VD0A 3ZSTA 2HLEB 1B2WH 4MCYA 3VXQA 1BBJB 4L9LA 3Q43A 4OLZH 3H56A 2AJYH 4WWOA 2VR3A 3J2PA 2BNRB 1KIUB 2WLHA 3HG0A 4X8XA 4GXUM 4ZFZA 2ID5A 2WB1A 1DQQA 3EOBB 4NI6A 4Z78A 1I1RA 4P2OA 2VDPL 1RJCA 3MJ8A 1OHZA 5D9SA 3RGVD 4CA4A 1QRNE 5GS2D 5I30L 1JGDA 3WFBH 3K8KA 3NCYP 2FL5A 1VGKB 2QHRL 3VA2C 4N9GA 3B4NA 1OTTC 3KLAB 1FPTL 1H0DA 1RZIB 2FWOB 3X1GA 1PSKH 5KS9B 4HXBL 2BXYA 2FB4H 3LZQA 4JDVA 4OBRA 4ORGA 1ECZA 2QSCH 5DQ9B 5SWZE 4PCKA 4PGDB 1XHHA 5IBUG 1AI1L 1R24A 2GW5A 2HYMA 2K6ZA 3IFLH 1FZMA 1UWGH 2G9HA 1W16A 2XZAH 3BVTA 4FTDA 4LL4A 2Q8AH 4Z23A 2OPCA 4QTIH 5T3ZL 3VW3L 3LEYH 4KC3B 4EF3A 4F8OA 3R4RA 2RTTA 2ADFL 1CDIA 3HRZB 3CPUA 3SY6A 1LEGA 3C5ZC 4URTB 1ULVA 3O3EA 5TE7H 3QDJE 4UOQA 5F88A 4MHHG 2YEZB 3NCFB 3H3BC 2WLJA 3V55A 1AKPA 1R3LB 3CDCA 3D4ZA 3L7FA 3NPSC 3MRQA 4WY7H 2YPLD 5EZIH 4OF3A 1ONQB 3T2PA 4PJGA 3QEGL 4KTYA 3FYEB 5DUPL 1DBKL 5AW3B 4JFWA 3ZXAC 4E5XB 4HUKB 3MJ7A 4PIBA 5I1IH 1JPTH 2FT6A 2WXMA 2OL3L 4OCXH 4OIIH 4UQDA 5JQIB 4N22A 3MCKB 3F7VB 3TF4A 2QKSA 3VUAA 4ETQB 3W0WB 3WEMA 3C6LB 3O6LH 1SDDB 2BX5A 2KQMA 3EYFA 5AALA 3SBWC 1A6TA 1ZLVK 1MRDL 5ACZA 3GGWA 4EVNA 1IIKA 3DOSB 5I74B 3CZKA 5J56B 4F37F 1KCWA 1EEZB 2BY1A 3NBNA 4B9ZA 2JJTA 4PYHA 5GRVL 1NC2A 4Y5YB 4OCRL 3KJ4C 3P9MA 3ECBA 4BHUI 4QJ5B 5JYLA 1QYGH 3D3VD 4RWYH 5HYJB 1G7IA 1VADA 3VGAB 3CFKB 3VM7A 4NNXB 4PN6A 4U6HB 1GR7A 5DHYB 3EH5B 3ZZQA 4HWBA 2TRHA 3ZQ9A 3W9DA 5C71A 4F8PA 1FN4B 2YQ3A 3J07A 3UG5A 4HGMA 3SGJA 1JFQL 1Z5LB 4GKNB 4LSUH 3WELA 5IG7A 4IU3B 5DTFA 4E41A 1EDHA 1SJMA 1RUML 4S0TD 3FT4B 5B1AB 5A2KH 8CGTA 2E3VA 2X3CA 1I3UA 4PJBA 5EV7A 3T71A 3W2DL 4H4NA 6CGTA 3CVHH 1IT9L 3INUL 4KHXL 1XO8A 2YPLA 3TNNA 32C2B 4XXWC 3ZX1A 3FCSA 4GG8A 2HKHL 1II4E 2J56A 4KMQA 2FO8A 1JZFA 5F3FA 3VRLF 2ARWA 4NHCL 2VR4A 3MGAA 1A1OA 3CHPA 5CP7A 1O7DE 1P84J 4Z0BL 4AQOA 1MFBH 1RSYA 3GSVB 3NIGE 3PHQA 5HI3D 1NAMB 3BKYH 1IBBA 3O4LE 1UEMA 4GIAA 4HIJB 4PGZA 5FFLA 4EXKA 3QFGA 3Q6FB 2XA8H 4PRAA 3NIFE 4PS4H 3QZBA 1RUPH 1WGVA 2PN5A 4FG6C 1QWNA 4MDJA 1YAIA 2DBJA 5HTSA 2CKBB 4U1HA 1A7BA 4MNHB 2GC4C 4QXUL 4X83A 4ZW6A 3CV5A 3HMWH 3E80A 4JFYA 3DVFA 1SJEA 5J6SA 2VIRB 4X0NA 5J3HD 4FQJH 2J4WL 3EJCA 3D3VA 5IFAH 1NTDA 2EDBA 4ENEC 3C6SA 3GXDA 2G30A 3IXAB 3MOAH 4AH2A 4HKBB 3FUNA 1PKQA 3QIWC 1SVCP 1CQYA 2E7MA 1E6JH 2JMRA 2OMXB 2WWKT 1KXTB 3L9YA 1SEBB 3ARFB 2CHDA 5IQNA 3RWHB 1D2OA 5IBLD 3ASOB 3BJ91 1TDQA 2DW5A 3DRQA 5L6YH 4YEFA 1YY8A 3V4PB 2J2ZB 3DK0A 1S4IA 5H94B 4NZRH 1UATA 1DQKA 2VUYA 3KMDA 1R3HA 4JPSA 4GUCA 3BT2L 2W0KA 3NA9L 4ZOBA 4YAQA 1NAKH 1YCSA 5EO9A 1KDIA 4Y4FB 4PJ5E 2CO1A 5EWIL 1NWOA 3IGLA 2XU9A 1Y7VA 3O11A 3QYNA 3U1SL 4JFHD 1H3XA 1CXKA 1PY0A 2B77A 4XAKE 3O2VH 5KSVA 2EZ0C 3E8UH 5LWYL 1MW3A 2WXKA 2YC1B 2NQDA 2VLKB 4IHOB 1DANU 4OD2A 1EMTL 5K39B 1OSPH 4WAFA 4G8FB 1TR7A 4XBGA 3FUEA 3LD8C 1U42A 4P46D 4A1RA 1TJHL 2VXQH 4LFHG 5E4EB 5AYQA 3KPRE 1W72L 4TTDC 4YO0A 1PBYA 4GBXC 1EGJL 1MAML 3DBSA 3GRWA 5I28A 2K3HA 2J5WA 3OZKA 2LHAA 4BH8A 1CD8A 2I7OA 1I7TB 1R3JB 4IK7A 2DLHA 3UX9B 4YNYA 1HOCA 1NANI 3O6FC 3F7YB 4UANA 4BZ1L 3KPOB 1RMFL 2VISB 5I18H 1MFEL 5D1QC 1UG9A 1Z9SB 5BMFH 5J12B 2VLME 2A99A 4A2GA 3IFNL 4KI1A 3O2DH 2C3GA 1S7VA 3PFUA 4K8RC 5EU3B 1NC4D 4APQC 5EUKA 5HDRA 4HGWA 1CXFA 4FF9A 4RFOL 4XNUH 1KBPA 1U8QA 2VR7A 3HG5A 4KDTA 5ENWB 5JDSB 3IGKA 5I6MA 2VR9A 5JXEC 4FFTA 1UCBH 3CC5B 1ETJA 3OG4B 3PG2A 4RDQF 3SN6N 3S88H 4Q6YA 3LXCA 3QUZB 3LQAH 1MCIA 1VFBA 4Q0XL 3MZGB 3EFFB 2MQGA 2CZNA 4H8WH 1HJCA 1RVFH 4Q89A 3VFPB 1CYWA 2IH9A 2OR9L 2C3WA 1OM9A 3P4MA 4KK9D 1XD0A 3E6HA 3TYGL 4EQ3A 2E9WA 5KYYB 1VSCA 1RIUL 5A2FA 4ODWB 1E5ZA 2FR4B 1ZHLB 3L3GA 1GZPB 3WNPA 1U2YA 2HZHA 5CCGE 4QOKE 4LLMA 4F1ZA 5I2IA 1Z0MA 3HBQA 3R4DA 2YPKB 2JTYA 4P46A 3KPSD 3VWJC 3H3PL 3SPIA 4F20A 1TT6A 1WUZA 2HFEB 3D39D 4OV5A 4WJ5B 1FHNA 1RJYA 1N19A 3QJRB 3CVDA 1S9VA 1ADWA 3DBXB 1HNGA 3CX5K 2N01B 4G6AD 3D9AH 2AV1A 1DVZA 1MZYA 3H54A 3F83A 2JV6A 2QPEB 1F2XK 5CGMA 3ZL1A 4LCUB 2J71A 3Q6GL 3DRTA 4NRZB 3ZK0A 1M57B 4EUPG 1Q9OA 2K78A 4WW2A 4Q9RH 2QDVA 3GJFK 5HJ3A 2KLSA 1UUSA 4HUVB 3MXVH 1K4DA 2P4AB 1NC4A 1QHPA 3SQBB 3M6DA 4HF5H 3LRKA 1TKWA 3MV9D 4Z7OF 3NZ8B 4HT1L 3MDJA 3WTUA 1DSWA 3VFRA 2YGQA 3EJRA 4BKTC 2RQEA 2OXHA 4XMLL 2Q8BL 4K7PY 2HX9A 1Z7JA 3TBVB 5DJ6B 4UNVA 4LOVA 5DJCA 1GMIA 1NPJA 2IH3B 4HC1L 5KOMC 3ZHLA 3QJXA 2OMTB 1AHKA 3TWCH 4TNVF 4JBSA 1YLBB 1DJZA 3EOYG 5DI8A 1IAOA 4F3FB 2XFXA 5D5ME 3J7HA 4ZX4A 1BFSA 1CR9H 4UQ3B 4LEXH 3I74A 1MG2C 5HHNB 4RSYA 1KN4L 2OW6A 3G6JA 8FABA 3T1FB 4ZMNA 1RULH 4BQ8A 3BAEL 4UOJA 4AKOA 1QBAA 2R9HC 5HGHB 3TVMC 1E9QA 5DGQA 1QRND 1WZ1L 1KPUA 4UTCA 5T3ZE 1X5AA 4KPHH 3FB7A 4M1DL 2V2WA 5LGJA 2M26A 3DO4A 4HGKC 3D39A 4K5PA 4AQEA 3D87B 2XSKA 3FPXA 3IBOA 4PTTB 4Y2DB 3MZTA 1T1WA 4X6DA 4H8VA 4AIOA 4NKIL 4NQEE 3HHRB 1JPFA 2CUMA 3BGFC 1IM3D 1AGCA 3FUFA 5EORL 1IAMA 3E2HB 3VFNB 3DNKA 3QUHA 1JGUH 4IEFA 3QXAB 5E7BA 4POZC 3PWUA 1LO0H 5F7EH 5IESH 2HT4D 1J5OH 3B9KA 4DO5A 3FOMA 2CDFA 4AG4H 4OF5A 5D93B 3ASNB 4GUPA 1DDHA 2JKIS 5DLLA 3PNWA 3V8OA 1CL7L 4ODTH 2CLZB 3QDJD 4ENZA 2NY6D 3TEYA 3KVQA 2AQ3A 4LK4A 4QYOB 4YDNA 2WSDA 3BD5A 2XRAL 3AREB 3STZB 5CSZB 5F9DC 4OZHB 2K1MA 3FAXA 3TXAA 2EDKA 3IE4A 4JQIA 3FN0L 1F8TH 1NKGA 3OMNB 3IJHA 1A2YB 4LOFA 1FP5A 2W9DH 3FQTB 3S8WA 4RAUB 4KTEH 2APTA 1HHGA 2HX8A 2WXNA 4G6FD 3IM1A 4NKMA 1FHGA 4KJQD 4PW4A 1SHMA 4KO5A 2IPUG 1QVOA 1DCLA 3A6OA 5LCVH 2EH7L 1PTZA 3FB8B 5CCKL 1QRNA 2VDOH 5IHUL 1TEGA 5DRZA 2ZP9A 3LNDA 2XOTA 2XIIA 4X5XB 5C0FB 3QZPA 2XWXA 4XC3H 3IGAA 2RD0A 5JO5B 5F6IB 3EH4B 5FW6A 1IM9B 4RESB 2QMKA 1F02I 4KKCD 5IOPA 5SWZA 1WJ3A 4IGBB 1IM3A 3FTXA 1NUNB 1J1PH 2VL4A 4RMQA 4DGYH 1PZ5B 3IJ7A 2JKJA 3MRNA 3KBEA 4G7VH 3UPAA 1EAOA 4UNIA 3GBEA 4HWNA 4MDRA 5EPMB 4R26L 4O4YH 3RVUC 1MELA 4LHUD 2E9GA 1HH9A 2GSGA 2MSPA 4NUMA 4PHZA 2NLJA 3DMMB 3IFPB 3QDJA 4KNTA 4MX7B 3N43B 4E0RB 1J8SA 3PQYE 4YGAB 2ZNXA 4RMVA 5IVZA 1FL6A 4S0HA 4IOFD 3LQMA 5DC9B 4YVUA 2P8MA 5JPNB 2RR3A 4X8CA 2IAAC 3TGXA 5IEHA 1P0SE 3T65B 3C5JA 1BX2A 2JJSA 1E2VA 4WSJA 3CH8A 5E51A 4DNLA 3UCRA 4XCYA 4F7CA 3O4LD 2NY1B 4MA3B 1UZ6E 3SPVA 4YHLH 1RP9A 4IHBA 3BAWA 5D2LB 2MH4A 4P5RA 3H2QA 3M46A 2DIBA 1OY3B 3MGOA 2ZOOA 2XG4B 4UOZA 2BVEA 3VXRE 4E9XA 4LEOB 1KJ2A 2O5YH 1JZ5A 1FYTD 2WQAA 4I4WB 3GD1C 3RI5F 2ZXGA 3F01A 2XNAB 3RZCC 4OI7A 2GTZB 1D7BA 4M8UA 3GSXA 3QJFA 5HI5D 1HKLH 1W0WB 4X0KB 5D6DA 3VFOB 5EN3A 4W9ZA 3TN0C 4PG9B 3DV6B 4M8RA 4AY0A 2XN0A 1NA8A 2WLLA 1QKZL 1QUNB 5FYLL 1OAZL 2A4EA 4JLRA 1HIML 2NY7L 1ETZA 1J1OL 3MBEB 3SPHA 4LHUA 4F7MB 2GI7A 4K7FA 1J18A 4UDTA 5KZCB 1UVQA 3IKCA 3OB8A 3EOTH 2MIZA 4UT9L 5H2BB 3MA7A 2P48B 2NZ1A 3EJYD 2X6UA 3P30H 4GY4A 4EDWH 4M7ZC 1MFVA 1U8IB 3IMTA 3MC0A 2IXQB 3DX4A 3KEDA 4PV8B 3IAGC 1FVDB 4FYTA 2R69L 1FFTB 4PJ5D 2V2XB 2RJMA 3SKNA 2YUWA 4AQ1B 1GW6A 2FE0A 5GGVY 1D5IH 2DQHL 3DURA 4RNRB 4XAKD 3M86A 2C3VA 1MFDH 1T5WB 2UYLB 2YKKA 3O4LA 3OJDB 3FZUD 3ABGA 2WXGA 3V0IA 1N2RA 1NFDF 1RPQA 4OF0A 3NCYS 4ZMQA 1QATA 1EPFA 3P1VA 3KYAA 2KLTA 4EI6A 2WN3A 1EWHA 1MJUH 2DQDH 3KJ6L 5DUMH 1ZMYA 1P7QD 3KPRD 4WHYG 1OEZW 3RFZA 1DVSA 1ODAA 3O8XC 3KBHE 4ZQKB 4KH2A 4J3OG 3IBEA 4MBRA 4Y5VB 4L8DA 1DQMH 2KS0A 2ZG2A 4W4OA 2CRIA 1MUJA 2WXPA 2YFOA 2OQJA 2P26A 3BOVA 1MCJA 3BSZA 5CHNB 3ZDXF 3JWNG 1I4FB 4JDZB 2NT0A 3U6RA 3ALXA 1L7TL 4B97A 1FLTX 5EUOF 3S36H 3MV8E 2VLMD 3PABA 4K3EL 3ZKSD 4RZCA 4L1TA 1O6TA 2JF1A 1KCRL 3QQ4B 4BZ2A 5CP3A 4EEEA 3IU3A 4UM8A 3SDYH 1CD0A 2NCMA 4FYRA 4XHJD 2H6PA 3C8DA 3EHBC 2R1WB 5C6TH 1YECL 3QNZA 1FORH 3WMSA 2C9RA 3L9RA 2F2HA 3F00A 5CMAA 2X4QA 5EOCJ 4BHUA 3NJNA 4CSSA 4Z3FA 3SOTA 5JIDA 3RPIB 4JO1L 3VDBA 1Q9LA 4PJ5A 3ARYA 4V33A 3OAUL 3RVVC 1A14L 4FA8A 2P5WE 5E6UB 4AUUA 1AR1D 3HNSH 3VXUB 3UTOA 1QFUH 2VDNL 4BCYA 3D33A 3SSGA 4HIQA 1OLZA 2GT9B 4YE4H 1E27B 4QOKD 4XMPH 4CVXB 4YL4A 3HE6C 3RY6A 5BXFA 1LDPL 7FABL 1R5WA 3CG8A 3V6ZB 5D7SH 4U0RB 1NFIA 3C09C 1P7QA 1T2QL 3KPRA 3L7EA 1K8IA 3QORB 3KGUA 4MNQE 3S5LB 4FFWC 4E9RA 3FFCB 3P3SA 5EIIG 2YD8A 1UM4H 1LL1A 2UWEF 3OR6B 1FL3A 3PXJA 1NCJA 1YEEH 3I3BA 1T0NA 3OQRA 1ID2A 3EIFA 3V8CA 3ZBMA 2GB2A 4DW2H 2QKIC 3ILDA 1EBPA 1F45A 4JJ5A 2DKSA 4NC1C 5M7QA 5AQ0A 1H9DA 3EG9A 1HWHB 4KRPC 1BV8A 4LP5A 2B8OT 3P02A 3OMAB 1LO5B 2CCVA 3UBXG 2B9BA 1ZVNA 5AWNH 3SDCD 2FECI 3RG1C 4QXTA 4YEEA 2FBOJ 1DHKA 4GW1B 3SDDC 2PLTA 4GB9A 4PS7A 4U6TA 5KVFL 5E00B 1JDDA 2L8AA 1N8ZA 1F2QA 4ODSL 1LK2B 4LSSL 1ZD6A 3NT0A 1BJ8A 4UT6L 5DEFA 4CDGC 2X6CA 4NZTL 4WRLA 1CD9B 1HHIB 2E76C 5BZDA 1OCRB 4FJZA 1DLHA 1I1AD 4RAVA 1E3ZA 1JXJA 2VXSH 5I9QC 3L1GA 4PLJD 2EYTB 4QOKA 5F7DB 5T3ZD 5KVEL 4QDGA 4YXLH 3D0VA 4IJ3C 4J7RA 1ACYL 4I8DA 3BEWB 3SKJH 1M6OA 1PEZA 5LNEA 4GXVH 4XRCA 3EYQD 4NQVA 1YN7A 3D05A 4WWKC 1X5GA 2QL1A 2DEXX 4YHML 3QFJB 2ROYA 1IEBB 4BZYA 5F1IA 4H5SB 2Q7YB 4NQED 3I6GA 3F85A 4GLRI 2BIMA 4OTXH 4WGKA 1FWXA 1IKOP 2I5YL 3CFCL 1TETL 5CZVH 1ZCRA 3TT3H 4AVHA 4URKA 3MNVB 1B0GB 3LIUA 3K72B 1XEUA 4D7BA 5CEXB 1AD0A 3D0LB 2R1XB 3X12A 5IV2A 4K15A 2EDXA 4H13C 2PYFA 3QR1A 2D3JA 2V17L 4KK8D 3A22A 3IDYB 3S37H 2DYPB 3O0RH 4ZO7A 2C9XA 5EOQL 3BPNB 4JGJA 1KBVA 1VKXB 1DANT 4E9QA 2VLLA 3HMXL 2V6HA 2WJ5A 15C8L 4OGXL 4XCFH 1NAMH 3ERXA 4B5EA 3HS9A 4ZPVB 2H32B 1HKFA 5D5MA 3DTXB 4GSXA 4IMKC 2F1EA 4P9ML 2AXHA 4KV5F 5C2BL 2LTQC 4LKXA 4ZO8A 5HHVH 5ADOH 3G04B 4PW9A 3PP4H 3T3PE 1I1AA 1OAQH 3QUXB 3V7AG 3BWAA 4UIKH 4PJCE 4MS8D 2ZTBA 1GGCH 4MCNA 2BVPA 1PG7H 4ZPTB 3TPUA 1YYCA 3L6FA 4AUJA 3QHZH 5EBLB 1XBRA 2WM0A 3QXDA 3V4UH 1INQB 2Y5EA 1UA7A 3FKUS 2ADGA 4Y4KB 2Y1VA 1RJLB 2WUCH 2VDLH 5KANG 5I1HH 3ENEA 5KSUB 1IMHC 2QADC 1WYJA 1QABA 1B9KA 2GITA 1A7QH 2EUXA 3AS3A 4NQEA 4D8PA 3RVXC 1JK8A 5DMIL 4G3YL 1NDMA 3N44B 1Y1UA 4LCIH 4D3CH 1JYNA 2X40A 5JPMB 4U3CA 3CXHK 1UB5B 3HUJE 3NZSA 2GSMB 3MUJA 3V4PH 1MVUB 1TZGH 2XT1B 4PP2B 4OU3A 3DSNA 2VN3A 4UV4L 3HBPA 5JUEL 5TDOA</