1JZFA

Pseudomonas aeruginosa oxidized azurin(cu2+) ru(tpy)(phen)(his83)
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
128
structure length
128
Chain Sequence
AECSVDIQGNDQMQFNTNAITVDKSCKQFTVNLSHPGNLPKNVMGHNWVLSTAADMQGVVTDGMASGLDKDYLKPDDSRVIAHTKLIGSGEKDSVTFDVSKLKEGEQYMFFCTFPGHSALMKGTLTLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords AZURIN
publication title Electron tunneling in single crystals of Pseudomonas aeruginosa azurins.
pubmed doi rcsb
source organism Pseudomonas aeruginosa
molecule tags Electron transport
total genus 32
structure length 128
sequence length 128
ec nomenclature
pdb deposition date 2001-09-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00127 Copper-bind Copper binding proteins, plastocyanin/azurin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 1jzfA00
3OM3B 1TKWA 3PAUA 4BDVB 2DWTA 2PLTA 8PAZA 2PPCA 2PP8A 4W9ZA 1BXUA 2BW4A 4E9XA 2A3TA 1JZGA 2J5WA 1A4AA 1E67A 2GHZA 1ILUA 3AG2B 3NJFA 1E65A 5F7BA 3V9EA 4NERA 1AOZA 3NSDA 3V9CA 2I7OA 4QKTA 3KW8A 1ASOA 3N2JA 2YAHA 1ETJA 2VW6A 4FA7B 2YAPA 3NSYA 2YAMA 1PY0A 4HAKA 5ANHA 4AI7A 1GR7A 4YSTA 1GYCA 4P5SA 1EZLA 4BWWA 1OCOB 3IN2A 2WO2B 1IKOP 1OCRB 7PAZA 2IWKA 3NJJA 3ZDWA 3FU7B 5I6KA 4HCGA 1CC3A 1KGYE 1KBVA 3FQYA 4JKNA 2UXTA 4KO5A 3WG7B 3QJRB 2FQGA 2EIMB 1TEFA 2CUAA 5EHFA 3UACA 3X1FA 3HEIB 1OE2A 2IWEA 2IH8A 1MG2C 4X4KA 1NIAA 3X1GA 1FFTB 2W88A 3EHBB 3FSWA 3NP3A 1NIFA 2FNWA 3FYIB 1TU2A 1PNDA 1JZHA 3WIAA 1BEXA 3FYEB 4A2HA 2XV0A 4A2DA 5B1AB 1BQKA 3NSFA 2HX8A 2PP7A 5B1JC 5PCYA 4DP2X 3NJNA 1WA2X 1W8EA 1BQRA 1DZ0A 2HXAA 1YLBB 3WKPA 1ZPUA 2AZUA 5I5MA 2VW7A 5PAZA 2XVBA 1KYAA 5FC9A 2EILB 5I6MA 1OCCB 1SNRA 4N4YB 1JZIA 1GS7A 2AFNA 2UX6A 2HLEB 1BXAA 2J55A 3OMAB 2AANA 2PPDA 3QJVB 4GYBA 3T71A 1AANA 1A4BA 1PLAA 2IDSA 1BAWA 2OJ1A 2QDVA 5F7AA 2IDFA 3MBWB 4HHWA 1CURA 3CVDA 3FSZA 7PCYA 1RZPA 4DP9X 1GY2A 1SHWA 4G7RB 1AZRA 2Q9OA 3PPSA 4CSPA 5LDUA 4G7QB 1I53A 1UATA 1VLXA 3CDZA 1IUZA 4EF3A 1PCSA 1AQ8A 1ET5A 1QNIA 1AAJA 3TA4D 2B08A 1AZCA 1BXVA 4DP7X 4BK5C 2GBAA 3EH4B 1CYXA 2PPFA 1J9SA 1XB6A 1ADWA 3JT2A 2DY2A 1AG0A 3IEAA 1ASQA 5TK2A 5I5IA 3AZUA 3NYKA 1AS8A 2XV2A 1XB8A 1ET8A 3AW5A 1PMYA 2IDQA 1A65A 4HZ1A 4YSRA 2IH9A 3S3CB 1L9PA 3FU8A 3OD3A 4A2GA 3X1BA 2JXMA 2R7EA 1XMEB 3QJSB 4AKOA 1SFDA 4G71B 4DP6X 1NPNA 3FSVA 3NJHA 3T6VA 3ABMB 3WI9A 1AZNA 3SBPA 1AR1B 2IAAC 3WNJA 1PNCA 1KCBA 1PZAA 3AG4B 1SFHA 4KNUA 1WA1X 2FQDA 1IBZA 5A7EA 3ABLB 4BXVA 2FQFA 3S3DB 2YARA 3NJIA 4YSPA 4E9YA 1MDAA 4K9JA 1B3IA 1WS8A 2HX9A 1L9OA 1JXDA 4AKPA 1JVOA 3JTBA 2H3XC 1NWPA 4BDVA 3UAEA 2VM3A 4AX3A 2B3IA 2AVFA 1OE3A 4YVNA 2YAFA 1SF5A 3QQXA 5I5JA 3UGEA 4UANA 1NICA 2QPEB 2YAEA 2JFCA 3KW7A 1JXGA 2DWSA 2YAOA 2QDWA 3BVDB 3ZX1A 1SHXA 4BXSV 5TK4A 2I85A 3NJMA 2ZOOA 4NAJA 3TU6A 2PPAA 2YXWA 3ASOB 2H5UA 3X2QB 1JERA 4DPAX 1X9RA 4F2EA 4G72B 3WNIA 1QLEB 1CYWA 3FU7A 4RH4A 5B1JA 2XLLA 3IBOA 3T6XA 2VW4A 1R1CA 1KV7A 1QHQA 2XV3A 4KO7A 1V10A 4G7SB 2MRYA 2BZ7A 3AG1B 2DV6A 2QPDB 4E9WA 2J57A 3S8FB 2BP0B 4TXVB 4DP4X 2BP8B 4HHGA 1OF0A 3GYRA 4A2EA 1KDJA 3N55A 4HCIA 1AG6A 1GY1A 3AY2A 2BWDA 1NINA 1ZIAA 3NJLA 3H4HA 3FQ2A 2BWIA 3ERXA 3OMIB 1E5ZA 4HIPA 2VSKB 3RYMA 2PP9A 3AG3B 3CVBA 3SQRA 3U25A 1N68A 1IC0A 2BO0A 4UAHA 4MFHA 1SF3A 2EIJB 4Q89A 1JZEA 2XXGA 3PXLA 2XXFA 4DPBX 1BYOA 2GC7C 4YSQA 4KO6A 4P5RA 1PLCA 1OV8A 2PPEA 3QJTB 4L0PB 2IDUA 4A68A 2VM4A 1ID2A 1MZYA 1OCZB 2FT7A 5B1KA 5I6OA 4E9RA 3NP4A 3H4FA 3T6ZA 2P80D 2TSAA 1ZIBA 3D12B 3FSAA 2XYBA 1BYPA 1GW0A 1JZFA 3CVCA 2GI0A 3S3BB 4PCYA 1X9UA 1N70A 3T6WA 3HB3B 3C75A 1J5CA 4QLWA 5IY5B 1JZJA 4KOBA 4E9VA 3T9WA 5B7FA 2XU9A 2BHFA 5I26A 1A8ZA 2CBPA 1AS7A 1ZDQA 2FT8A 3CZUB 3FPXA 2GIMA 4FAAB 3ASNB 4YSEA 4YSUA 4GY4A 5D4JA 1AS6A 2ZWNA 2CAKA 4DP0X 4YSCA 1A4CA 2YXVA 2BW5A 2UXFA 1MG3C 5B7MA 5I6NA 4WTQA 1RCYA 3IN0A 1AIZA 3H56A 3PLYA 4KNSA 3DIVA 5B3SB 2Q5BA 4Q8BA 1L9QA 3FQ1A 1IBYA 5D4HA 1NPJA 2OCCB 1AACA 2J56A 1SDDB 4GP4B 1PZCA 3DTUB 3OMNB 2N0MA 5D4IA 4N8UA 3L45A 4CSZA 1AZUA 1OE1A 1BQ5A 4E9SA 1HAWA 3SBRA 4YSOA 2OV0A 2UXVA 3GXUB 1NIEA 2GC4C 3EH3B 3FU9A 3EF4A 4YVUA 2FTAA 6PAZA 4YL4A 1GSKA 3S8GB 2FWLB 2GSMB 1A3ZA 5E9NA 5B7EA 1WA0X 3WKQA 2AZAA 1HFUA 2GB2A 1JOIA 2UX7A 1CUOA 3NJKA 3EH5B 1RZQA 1JXFA 1PAZA 2VSMB 1E30A 1SDDA 2TSBA 1T5KA 1WAEA 2FJSA 2JKWA 3TBBA 4ENZA 1ZDSA 2XWZA 2FT6A 2PCFA 1JVLA 2W8CA 4AKQA 1J9TA 4A66A 1EHKB 1L9RA 2HRHA 5B1BB 1KDIA 1L9SA 1M56B 2E86A 4YSAA 1M9WA 1NIDA 2CJ3A 1W6LA 2YAQA 1XB3A 4KO9A 3ABKB 4F7KA 4KOCA 3FPYA 4WKXA 2IDTA 5I6LA 2VMJA 4HCFA 2VN3A 4GXFA 5I28A 2FQEA 5AKRA 2HRGA 2BZCA 1NTDA 4KNTA 4DP5X 3G5WA 1J9RA 1MZZA 4M3HA 2HZHA 1PZBA 3ZBMA 4F2FA 2WSDA 4DP1X 3MX0B 2EIKB 1F56A 1L9TA 3CG8A 3DKHA 1ASPA 3X1EA 2I7SA 2BP0A 2PCYA 2DYSB 5I6PA 2MTAA 2BP8A 3NJGA 2ZONA 2P80A 2WO3B 4JHVA 1AZBA 1M57B 1PF3A 3IE9A 3NSCA 2IWFA 4HALA 3UABA 1J9QA 3FT0A 4UF7C 3UADA 1WS7A 4PAZA 2X87A 2XX0A 3CDZB 1ZV2A 3PAZA 2ZXWB 4GP5B 2Y69B 2QT6A 6PCYA 4BWUA 4M4RB 1KCWA 3TASA 1OOWA 3QPKA 1V54B 1GS8A 4A2FA 1NWOA 1ILSA 1FA4A 1KBWA 3GDCA 4JHUA 4DP8X 1NIBA 1W6WA 2HX7A 1NZRA 2RACA 2XUWA 3PAVA 2EINB 3BQVA 3OQRA 2CALA 2UXGA 2CCWA 4ZK8A 1V55B 4E9QA 1FWXA 1URIA 4BWTA 3NT0A 3FS9A 2R7EB 2YQBA 1ET7A 4YSSA 4GP8B 1GS6X 3ZIYA 2Y1AA 1SJMA 3ABGA 3PCYA 4YSDA 1NDTA 1PLBA 1DYZA 1J5DA 2NRDA 2H47C 3TBCA 9PCYA 4NB7A 4W1TA 1E5YA 2LLNA 4DPCX 4A67A 3SBQA 1RKRA 2XX1A 4AZUA 1HAUA 1TEGA 3QJQB 3QJUB 2DYRB 4G70B 5AFAA 5AZUA 3UAAA 4E9TA 2X88A 3X1NA
chains in the Genus database with same CATH superfamily
1D2OA 2IFGA 4FQLH 4JFQB 1MREH 1K5NB 2DWEA 4OLWH 2ESVA 3GLAA 4PRPB 1JZGA 5DD5L 4KQ4L 3EYOA 1XXFC 3LCYA 3BWSA 1VIWA 3ULUD 2YWZA 2NQDA 4HEMA 3AG2B 1UWXK 3UC2A 3DJ9A 4UYQA 1PW3A 3AXLA 3MOAH 4KV5E 4HU8A 2YAHA 1QWHA 2HFTA 1W72L 2X70B 4XGZB 4F7EA 4PRIB 2YAMA 1S4IA 3KLKA 4AI7A 3MXWH 1YY9D 4JFED 4PUBL 4APXA 5L2KB 4LKCA 1OCOB 4Y1AD 3TN0C 5JW4M 4ZNEA 2JKXA 2Z64C 4GRLC 3T2LA 3KBHE 2Q3XA 4DKFH 2A6IA 4WDIB 5E8OA 3JV6B 4HCGA 3ROOB 5DT1L 5LGJA 2UUDK 1IM9D 2W9EL 4XCNA 1I82A 4NT6B 2Q7YB 4EQ3A 3MACL 1XAUA 5J1SC 2PYED 3HNVH 5C07D 3B56A 4NP4L 4WGWB 2XKUA 3V4VB 1VFAB 1Q4NX 3LKPB 4HKXA 4JFZH 5I1AA 3GSXA 1BA9A 1E2ZA 1TQVA 4PV9A 3KNBB 2GIXA 4H8PA 1ZHKA 3S2CA 3NRFA 9CGTA 2D31B 4OZIE 4Q9RH 2R2EB 5GISH 1ZWIA 3B7TA 2ZWKA 2CHZA 2ADFL 5T33L 3BDYH 3FOMA 4F27A 1BQHB 1C16A 1NIAA 3L3OC 3VD4A 2OXGB 3UEQA 1T04A 4GSXA 1VF5C 5SX5K 5FYKE 4L4VE 4X7CC 1IQDB 2C5DC 4ZO9A 2VH5L 5I1DA 4G3YL 1A7PH 3H54A 4XP9H 1CF1A 5DJ0B 3JYBA 5DD3H 5FR3A 5PCYA 1K4CB 4MNQB 1GVIA 4G9FE 1SXCA 1U8OA 1AO7A 4O02H 3MA9L 2XWRA 4PJFF 1KGWA 3IWUA 3LXCA 4YAQA 1YLBB 2KERA 4I5BA 1AY1H 1QYGH 1KUMA 1A6TB 2WUBL 4AE1A 4NNYA 1KN2H 3FOLB 1WV7T 5AOMA 3A23A 3QIWA 4AITA 5FC9A 4ZSOE 1AKJB 1P69B 1MFCH 2BSED 3QCTL 2OSXA 2NY2B 3QDGD 3BQUD 4LLMA 1RIHL 4N4YB 4XPFL 4ZG1A 1YPZE 1BVLB 1FL6A 1J9CT 2J6EL 1BZDA 2GYSA 4MCZA 5EBLB 1QSVA 3VSTA 2MOVA 4WFED 3LJ3A 5KW9L 4HCRL 3UTPD 5KANI 2OJ1A 4G8EA 1G7JB 4L0YA 3CSBA 3E9UA 3OKKA 4M7JH 3S0PA 4FNLH 5E5MB 3BDBA 3DUUA 4ODXB 3MJ9L 4G8GD 3JV4B 4MGXA 3RWFA 4TVUA 1P6WA 4TULH 2P5EA 3L17A 5DYOA 3WO4C 1PCSA 1RZIB 3N9GL 3VXRE 3VGAC 4LCCC 2B08A 2DOCA 4XT1C 2X53A 4AYFB 3S37X 1BEYH 3FT2A 3GJFA 2P44B 3IAPA 4KK6C 1CT8B 5HYQA 5EOQH 1YJDC 5E0QA 1ORQA 5HHVL 2R2BA 5IHLB 5FKPB 4Y19D 3QYMA 1REIA 3NIFB 5LGHL 4RFOL 3CGTA 5DQ9A 1SRDA 4XN4A 4HXBL 4JDEA 4C54A 2X3CA 4NO5A 4ZXBC 3PWNA 4N1EA 1YN6B 3HI6H 3DX7B 3PDOB 2R7EA 2EAEA 3X13A 1N6QL 3EGDB 1AD9B 4FFVD 2YFNA 3QXUA 1AZNA 1OZUA 3QO0A 1I85A 2ZCKL 4P5TC 3KPOA 5GRZA 5INCA 3U7AA 3WKML 5BMFH 1VFBB 3B9KA 3MV8B 3WNJA 1N7ML 1PNCA 2LE9A 2EJ1A 4KNUA 1BM7A 1WA1X 1ECYA 5E8DL 4GAAA 4XVUC 3T1WA 1NBYA 1SOXA 4NZDA 5A2BA 1DDHA 4K94H 3QCVL 4AV4A 2GBUA 3X11B 4E9YA 1VB9A 4N26A 1GYUA 3V0FA 4F33A 1A6AB 1Z32X 1MRFH 4P0DA 4I0PA 5D1ZI 4BDVA 4LOFA 3UAEA 2VM3A 1NCHA 3DIDA 5ID1A 3WV0A 4PGDB 1GSMA 1QTYT 4OGYH 4LDCA 4G6JH 5F0MB 3ZN6A 4QXTA 4HZLA 4L29A 4OZHF 3L7FB 2YAOA 4BH8B 1Z66A 4HLZG 2FH8A 4GRMA 1I8IB 2I85A 4F58L 1GYVA 2KHAA 4KHXL 2YXWA 3P30H 3RZCB 2IWGA 4BZ1L 1KLGB 1EXUB 4JX0A 5CZKA 4IKLA 3MOBH 3D7PA 5A6MA 5LBSL 1OARL 2JCCA 3LN5A 3VFUA 3W9EA 5E08L 1DQML 1TCMA 3HHSB 3CZKA 4RH4A 1D5XA 1XH0A 2FJFA 4LVEA 4ZUWB 1G43A 1KLFA 3PV7A 3LZLA 1QVOA 3DX9A 5IVXF 1XF2A 3HC0B 4M1GH 2CBMA 2QPFA 4GMSL 1TTUA 4UBDD 4JQVA 1Q9WA 2WXLA 4YHIA 3DSFL 5EUOB 3BP7A 3UPRB 3BAXA 2R0LH 3N55A 3O6LH 2EDDA 2ENYA 2G75A 1HH9A 2BWDA 4XWOD 1KTLA 2Y7QB 1ICTA 1Z5LB 4GKSB 4WZ9A 1UFGA 2B14A 2E9GA 5KVFL 4GW4A 3FUIA 5IB3A 3H4HA 4I13B 5EO1B 3ESMA 3SDXA 4EDXB 2A9MH 4QRRE 5FLUA 4N2BA 3IE4A 3SQOH 3IDIB 3JUYA 4P57B 1EAPB 4XTRC 1WBZB 2YD2A 2AMUA 2AK4D 4M62L 3U25A 3N50A 1T21A 3THML 4ONGL 4P2QE 4DTGH 1KYOJ 3GBEA 2EIJB 3UBXB 1A2YA 4WEBH 4MXWH 2J8UF 5F7WC 2XG4B 1FV1B 4O58L 3FO2B 1S7QA 4HPHA 5EU5B 5BOJA 5FYJH 1BFOB 2WLLB 5C0EB 5JA9A 1B0RA 1RSFA 3GJEA 3NJXA 4JS7A 4UU9A 5B1KA 2VDMH 4FQCH 2F8XC 2CPCA 1D9KA 3DV6A 4W9CC 1AC0A 2D03H 3LRGA 4WUKH 3RX9A 4PJAE 1CGUA 4PJGA 4RMRA 1QWUA 5DJYB 3E3QC 4NENB 4X99B 1Y6MR 2WM0A 1B6DA 5DFWH 1F18A 1QKZH 3OLEA 5CGYD 5J1TC 4IOIB 4IBQA 3VSUA 5TPWH 2IF7A 5J12B 5GGSB 1CLCA 1AS7A 4M61B 5L6YH 1Z9MA 4FQIH 5IW6B 2IANA 3ZR6A 3MV7E 4W93A 4IBZA 2IPUG 1HKFA 5DRXA 3E6HA 1JHTB 2NUPB 5E1AA 1FZJB 3UJJH 5I0ZA 3GM8A 4GAJL 4L05A 1E8WA 1WSST 2DYPD 4OSUL 2EKSA 3U0PB 4EXKA 5C8JB 1OZTG 4KVCL 1O6SB 5I8KL 1RJYA 3IKCA 5DVLA 2A4CA 2A83B 4LPCA 2VDOL 4B7LA 4NN7B 3QWOA 1FCCA 4N85A 4NZRL 3FTVA 5E6ZA 3RE0A 3B1UA 1JIBA 2FWOA 3AB0C 4LMQE 1SXAA 3OLGA 3DVNA 2TRYA 2W5PA 1O6TA 1I8LC 1LVEA 2OMUB 3OMNB 4E42A 1JHLL 4FERA 4LLWA 3FT4A 4KRNA 5EN2A 3BOVA 3D39B 4YDIH 1OE1A 1Y18B 2ADIA 5KVGE 3ZZQA 4WY7H 1JRHI 3LIZH 3LKNA 2NSXA 4IRSD 4ZX4A 5J8OA 5F88A 1F8TH 1HL4A 3BUYB 5F21B 3OR6A 3VU2A 3MRPB 3M86A 1UM4L 5AKVA 2FWLB 3AM8C 4QRPE 4LHUG 1XF3B 3WN5C 5B38B 4JREB 4KI5C 1JOIA 5T3XE 2XN9B 1WICA 4NN5B 2A38A 3ES6B 3TFBA 4KY2A 1KEML 43C9A 1UM5L 2WQVA 2GPZA 5GGTH 1KJ3L 3B9DA 3U48A 3OVUB 4JO4H 5JHLL 2WLZA 3TA3D 3CN4A 2W8CA 3DUSB 4E41E 3NEOA 1AGFB 5KVEH 3MYJA 4NO3A 5K9KA 3CHPA 2Z4QB 5DJ8B 5GRUH 4ZFGL 1F1DA 3DXAB 5D1ZC 5KBLA 2YAQA 3DYMA 1P9MA 1XB3A 1E2VA 3T3MB 2JI3A 4ORGA 2VN3A 3VXME 5HHQA 3MRMA 3ULVL 3CFUA 3RX8A 1NTDA 4LAQH 2BOCB 3OSVA 3HG0A 4YK4C 5JQ6L 1ZLVH 3P0VL 3G5WA 3TCLB 4JL1A 3V5KA 3WTUA 3LDBC 4AMXA 5D7IB 5EOCL 2WXRA 1A66A 1MJUL 1Q0YH 1T1YB 4MD5B 4ZUVB 3PQYE 4ZDHA 4XNAA 3HZMA 1QMUA 1A1NB 4UT7L 5I74B 1RZ7L 4N0FB 1BVZA 1GGCL 3AQXA 4FFZH 1ZS8A 3HG1B 4JZJC 1WAAF 4AQAB 1WUZA 5E2VL 2DH3A 2GUOB 4MNGE 3FB5B 1MSPA 5AD0B 4NC1C 4RISL 5H94B 1IRAY 2J4WH 1HNYA 2C8NA 2Q86B 5CZXC 4N0UE 3KPLB 2PABA 3QZBA 4P4KB 4XNZB 2VJ8A 3HMXL 1JPFB 2I60H 3VWKA 3OJVC 2UZIL 4OFQA 2Y69B 1TZOA 4NPYA 1JF1B 2AI0L 3EHBC 2VE6A 3O45B 5GRYA 2PUQT 3K71A 3U1QA 4M8VA 4OQTH 1RIUH 5DLMH 4LSUH 5JZ7C 2QSQA 4JHUA 2I32A 1SMAA 1VFUA 2BH0A 3WEAA 4MX7B 1MNNA 4KK8D 3V4PH 3FQTA 5HVWA 3RURA 3N42F 4AGQA 3CQQA 3ISYA 3Q3GB 4EVNB 3OMZA 1U8IB 2XWTA 2VDRB 1IZKA 1G6RA 3ZIYA 3M8OL 3WXWH 4WWKA 3EYOB 3IJHB 4KK5D 2OL3B 4IOSA 5KYYB 4MMYB 1FE8L 2X4QA 4QO1B 2FBOJ 3OB8A 5DDHB 2QQLL 3LQAL 4FP8H 4RZCB 4JRFA 4KI5F 4U1HB 5T1KA 4ZMLA 2DEXX 2IPKB 4X7FC 4PS8A 4XPBL 5AYUL 4PHZA 4APXB 1QLEL 1SLWA 5LBVA 1TUPA 1SUJA 1RJLB 2G2PA 3KPRB 1TKWA 2Q0ZX 4LVOB 3X1NA 4NQEA 5L4FA 3SJVE 8PAZA 3BYYA 3MFFB 3QZWG 3DBXA 5DEGA 4CC4C 5JW4R 1ZANL 2HTKC 2GHZA 1ILUA 1BXXA 2W65A 4UV7H 4NERA 1UWFA 1AOZA 2YD1A 4TTDD 4FMVA 3D85A 2I7OA 4LQFL 3VD3A 3MRRA 1AGDA 5AZEL 3BAKA 3FO1A 3LAFA 4HKXB 1QAWA 4HULB 3C5SB 2QQNL 4PV9B 5E4EB 4AVIA 4L4VD 3KDPB 3NCCB 2KBGA 5ISZE 5LNGA 4Y5VC 5J6HB 4HAGA 3MKKA 2YPKA 3QFGA 3FOMB 3L5WA 1EDYA 3IN2A 4X6DF 4OJFH 4BGDA 1P7KB 1IKOP 3EJRA 1KACB 4Y1SA 3QC5X 5AAMA 4B50A 1IC5H 3NBNA 4G9FD 4X83A 2OYPA 3RA7H 3U9PL 5HBBA 2ZOKA 3M17B 1E27A 4G6MH 2APSA 2O5ZL 1BOYA 4KO5A 5IBTH 5CLWA 2H41A 4JFFA 4AG4H 1EBAA 1S7SA 3E8UH 5DC4B 1YNTF 1WUNT 2Z8VC 1BZ9A 1RXLA 2B9AA 3QARA 4G6AD 2VLRA 5I30L 2E59A 4PJ7A 4GUOA 2A1WL 2FJUB 3BW9B 2IV8A 3K8KA 1AO7B 2IH8A 1J5OL 4QTIH 3DMMB 3ZO9A 4X98A 3NP3A 4XMXA 3K6OA 1DJZA 3EF7A 3WUZA 4AQEB 1XH2A 3QDAA 3SZ6A 4I1PA 1TDQA 1N4XH 3KBPA 1GCFA 1E9OA 2L04A 4HSAC 4WI2A 1BQKA 7FABH 2KDGA 5SWZE 4DKEH 4I8DA 4WFHE 4X50A 1FNLA 3IFPB 3SGEI 1F6FB 3HUJA 1OO2A 1UWGL 3WCYA 3VXRD 5DSCB 3UERA 3NABL 4MDJA 4PRAA 3RU8L 3EFDH 4HS3B 1XGQB 5IESH 5I5MA 3BIBX 3OKKB 4ISVA 1NFDF 2G5BA 5IJBC 4RGOL 1S7VB 3QPXH 4S1DD 4NI6A 5GZNC 4GEIA 2P5EB 4PJBA 4ZOEA 3SSGA 4XB7A 1K5WA 3H9SA 1TEYA 5C0CE 5FUZL 2HKFH 4M7LL 2GUYA 5F3BA 2AFNA 4JVUA 5GS3A 4J6IA 1IGCH 3FT2B 4X6BA 4MJIE 2OMTA 2AJZA 1D5MA 5HYQB 1BVKB 2VDNL 3BT0A 2SEBA 5JUEH 2NDFA 1ZE3C 2AJXH 5AALA 4HHWA 2IH1A 2GK0A 3UTTA 3O6FD 1B2WL 2R0ZH 1CD1B 2HMIC 4G7RB 3Q6FA 4CSPA 5D6DA 1VLXA 2RCSH 3KYNA 3WGVB 1OKEA 5J5EA 4HX1A 1INDH 1T0OA 1NGXA 2Z9TA 1OXYA 4YPJA 3OGOE 1AZCA 1QG3A 3QORA 1VENA 3AVEA 5INCB 3KPOB 4R90H 1DQQB 2PWDA 5IMLA 2FEJA 1J9SA 3A24A 3CU7A 2DY2A 5GGVY 1NFIA 1TPXC 1JZ8A 2CZNA 3TVMA 2FK9A 1ET8A 5J6GB 4OFPA 4HC1A 5CAYB 5IGXL 1VACA 2JKLA 4NQCB 2I27N 3ZE1E 4FADA 3L1OH 5IVXE 5ECJE 2X6MA 4BCXA 1EXGA 2FIKB 5KYUA 3D2TA 2BWQA 2AS5M 1XMEB 1YA5A 2AXFA 2OI9C 2VQ1B 3LN4A 4PJ5E 3ZR5A 2J5LB 2R0KH 1U8KB 1F4XH 3GSNL 4IMKA 4K71C 5KTEH 5FCUL 4ZS7H 5A43C 3VRJA 3WEOA 1FL5A 3BP6B 2PR9A 4DW2L 3L4VA 2Y6SD 2YD0A 4N8PA 1F90L 4N5UA 3OJDB 3SQBB 1PLGL 3PHSA 4N0CC 4PREB 3SE9L 5IB5B 1SJHA 1OT2A 3CLEL 5F96H 2GEQA 5FWQA 2K9FB 2IQ9H 1FC1A 2PCFB 2YUZA 3HHRB 3Q44A 5DMJB 3H1ZA 2WZ6A 4U1LA 3GQFA 1EMTH 1KY6A 5ALBL 2QVFB 2AC0A 1H5BC 1RV6X 3NA9L 1FZMB 2DWSA 4UQ3B 1INEH 2MFNA 4B96A 4RFNB 1XF2B 1KZQA 3V4UH 4K55A 4UT6H 4EN3A 1JRHH 2O6FA 5CEZH 3JWNG 1OD7A 4UINL 3EJYC 4QRRD 2OYMA 1ZT1A 1Q9WB 2NYYC 5CFAA 3S5LA 3BP7B 2H5UA 3RUGB 3OJMB 3FUDA 4DHLA 3HC3H 4EDWH 5A6LA 1FP5A 4F2EA 4V1DA 2X4PA 1YQVH 3HC4H 3IJ7A 4P2QD 3ZTJH 3DURB 4XC1L 3EGSB 3RIAF 5EU7C 2ADYA 1C08B 1IO4C 1EJFA 4OIAA 1P4LA 1UGKA 5KEZA 3BEWA 4TVPE 3WBDA 4DESA 1HOCA 1TJHH 5DR5H 1XH3B 1K3ZA 4OZGB 4LAJH 1RZJL 3D06A 1J48A 1T21B 4LSQH 4Y2OA 1FZKB 2CK0H 2WYIA 1ZK9A 2AERT 4EIGB 4MNHA 4PJCB 2C7UA 3FTYA 3W39B 2DEWX 3NZSA 1NINA 4E5XG 1NCCL 4ZTOL 2QPSA 3VTMA 4MJ4A 5F72S 2VABA 3DECA 2NX5E 4KRPD 4TYUA 2VSKB 2OYLA 3CMOL 4I3SH 4Z7NE 4BEIA 4WI5A 2DQIL 3RVUD 1AMXA 2QHRL 2X2UA 3WAKA 5DRNB 2NZ1A 3MV7D 4J5VA 5FFGA 3UAFA 4RBPK 5CCHE 4MA8L 1UACL 1SDAB 1NDMA 3VFNA 2XPGA 2ALWA 4FNTA 3EYSL 4XMKL 1PKQE 5C08A 3MVSA 1GKOA 4KRLB 3MOQA 4ODHH 1A1MA 2HFEA 4E9RA 2X4UA 4KXBA 1AQDB 3BZ5A 3UOAB 4FG2A 1A7NH 4YC2C 1AGBA 1WLHA 4Q97A 2VLLA 1DJIA 3WEMA 1HI6B 1X3DA 1Q9OA 4Z3EA 2EKSB 3CVCA 4YXKH 3ZDYB 1QZNA 4WO4D 5HYEA 5I8CA 1IFHH 5TDPA 3IKCB 2QSCH 3NCFB 3ZXAC 1X9UA 5AVWB 4QLWA 1KENL 3PABA 4M6OL 4R4BA 3SGJC 3QWOB 2G2NA 1XGZA 3FH7A 5GGVL 5K39B 1DL7L 4UOW0 2PR4L 1H9DA 4JJHA 4F8TA 3JBG7 5KS9E 1UXSA 3PV6B 4AEIH 3UC0L 2HVKA 5H37A 4CU7A 2HUHA 3MRNA 3BSZH 4QRPD 1BD2E 4GIPD 4YSUA 1YC8A 3BH9B 3FT4B 1F6LL 1E5AA 4BINA 4U7SA 1D2PA 1GAFL 4YXHL 3FB7A 4B9JA 2EH8L 4HAFA 1A4CA 4PJ8B 3X12B 2NY6D 3LKNB 3GKZA 4ADJA 4Z78A 1MG3C 3MXVL 5GHWH 4NJAL 1K8DB 5DO2D 2ZOTA 4Z7OF 2F8IA 4N24A 1Q9LB 1PJWA 4NKDB 3QI9B 3S37L 5HXMA 2BVOA 4FA6A 1DSYA 3O2DA 3QUZD 4K23H 4E41D 2NXYB 4EI6B 1R34A 4XOAA 4EKJA 4NHUB 5DC2A 4TOYH 1JI2A 3MZGB 3SKMB 4JG0L 3X3FH 3DTUB 3E3QE 2WV3A 2Q7NA 1NOAA 2MNJB 3B2PA 4MAYA 1CO1A 3GMPA 1Z5HA 4LCIH 4AC4A 1RERA 2K6ZA 1OM3L 1O5PA 3C5ZB 1HAWA 2HLFD 1KCUH 1SYSA 3VXMD 1IEBB 4WU5B 3ZZLA 3IMRA 1RLWA 3KL5A 5IT2H 1NCUA 1JK9B 1HDMA 3BRDA 3W0WA 3WTXA 2G3XA 1A7QL 2AZAA 1IGFL 2EECA 3QJFB 1CDGA 1FFPA 3EDEA 1A1OA 2UX7A 1BJ1J 5JLZA 4DVBB 3UMNA 1J0HA 3I85A 3D9AL 2VR3A 3H85A 3PQYD 3D4ZA 4ONOA 4Z95H 1L6PA 3CUPB 3PAYA 2VDKL 5HHQB 3DC0A 4LOVA 3EYUH 3C09B 3HJEA 1HHIA 3U9UB 2PCPA 4ENZA 35C8H 4ZMAT 1J87A 4Y4HD 4JPSA 3G6AB 5EA0L 2NCEA 1ZJAA 3Q1EA 1QUNA 3TZVA 2OR9L 2HH0H 4JO3L 4C83B 2BY3A 2E86A 1HXKA 4BE6A 2CJ3A 4N0RA 4YWGH 3TBWA 4JO8A 5CJBA 1Y1DA 3CZGA 3JZYA 4KOCA 5I6LA 3C5JB 5C3LD 1Q9KA 2LVEA 3SDDB 3JWDC 4PGJA 4Y5XB 5KSUA 3P4OA 3P77A 4WWOA 3D33A 3A4AA 1OSPH 1WEJL 3SDYH 1L6XA 3UTSB 3GBLA 4CKVX 5FS5A 4L9DA 3P11H 4KI5E 4LB8A 1G7PA 1BP3B 1LL1A 1MAKA 2OKMA 1QSFB 1UEYA 2VE6B 4HDIB 5AW3B 3IFOB 3D0LA 4LDOB 3BKCL 4KTDH 4S0TD 2I7SA 3FFCE 5I1HH 4P07A 5T1MA 4HOZA 2OS7A 2UVEA 2MTAA 1CI5A 4P23C 1DQJA 2QR0A 1N0XH 3CZSA 1NLBL 4F92B 3E2HC 3IE9A 3MROA 2Y6TE 4KKCD 4LSDA 4ZW3A 3TBSA 2F08A 3NCWA 1UH4A 3WFDH 2CIKB 4FE9A 3F7VA 2Y36H 5T3ZE 2XX0A 3E1F1 3GSQA 3T8XA 3VE0B 3U4BL 2C9PA 2CJUL 4NQDA 2R1XB 5E4AA 1OOWA 1YEIL 1E6OL 4PJIA 1JGLL 1KGXA 3I3BA 1Z5YD 2GCYA 2JI1A 3RKPA 2BNQB 2X4QB 4NZFA 1KJVB 3GDCA 1WF5A 2VZ1A 3SJVD 4J39A 3EOTL 4B5ZA 2HX7A 4TSBH 2FJGB 3ZKSD 1YEGL 1ZRUA 4GT0A 1KB5A 3L3GA 3QCUH 4MHHG 2XY2A 2UXGA 4WHYG 1DQDH 4NQSB 5LCVA 1N67A 1T0NB 4BWTA 3Q5TA 4XP1H 1I31A 1I7ZA 2OZ4H 1P7BA 3FFDA 1FJ1A 1PPIA 3QK0A 4FJZA 2JXMB 3GSVA 2YSSA 4L3CA 1GS6X 4DVRH 5IROD 4QMEA 2AAAA 1CR9H 3A6CL 5FYKH 4JFEB 4Y89A 2G3ZA 5T1LA 1E28B 3SD2A 3W11C 2H47C 1JZ2A 3MJ7A 4G8FB 2IAMC 2LLNA 1U8PA 5J11B 1EFXA 1LP9B 3SBQA 3MBED 4LXFA 4B41A 2ZUWA 4W9DC 5JIMA 1XIWA 4TQHA 2A9NH 5K33A 5DMKB 1E3ZA 4X4YA 2WKOA 1U95B 4OAWA 2AQ1A 2PYEB 4P9HH 2DDQH 1V27A 5DUML 3BAWA 3OM3B 3L5WB 2I9LA 2R23B 1G0DA 2R2CA 3L3JB 2GTZA 3MCKA 1MCPH 1AI1H 1Q72L 3P2DA 3BO8A 3WU1A 4JO2L 1RUMH 2HN7A 1XZ0A 2VDPB 1ORSB 4DKTA 2WBJA 3WENA 5K59F 3IDJB 3BHBA 3KYKH 1NFDE 2GY5A 2CCVA 2XETA 2VLRB 4GKOA 1JBJA 1NLDL 4GPVA 1HTYA 2BS9A 2G9KA 4HLEA 1EZLA 4PJ6A 4MJ6B 5SWZD 3TV3L 1JPGA 4YEEA 5IR1A 5B21A 1PG7L 1CU4L 2D7NA 2LU3A 2JWYA 4W9GC 5IBUB 3TN0D 4Q74A 4FFWC 1CLZL 4GRLD 2XTLA 1M9SA 4NWUH 2F5BL 1F4YL 5EF1A 2ADJB 4YGVB 3WG7B 4A39A 5KBPA 3IMWA 4RCAA 1CIDA 3FCSA 4LSSH 4MDIA 4M5YH 1TEFA 3CVHL 3T3PE 2HTLC 3MNWA 3JWDH 1YDPB 3D08A 3O2WL 3BVTA 5C0CD 3SGDI 4RETB 2IWEA 4HKJB 3BQUB 3CLFH 3P2BA 4OJDH 2E75C 1Y6NR 3ISRA 5DEZA 5IMKB 4PBXA 2N59A 1CL7I 2HB0A 3QR1A 4K5LA 4MJID 5KJRL 2Z3FA 1MRDL 3VA6A 3IDYC 2V7HB 2O6PA 4UIKH 1BQSA 1J1XL 4FX5A 4QHLA 1ZVSB 5F9WC 2O61A 3GZPA 3B2XA 4HIXL 1KXHA 2GT9A 2HCZX 3CFJA 2YUXA 1KNOA 5DEJA 4G8GB 3I02B 2HX8A 3QRBA 4ELMF 1N8ZB 2BVTA 5DRZA 5HHPB 4C58B 1W8EA 2JIXA 2DPKA 1JWSA 3QZLA 1F6AA 5IW1B 2VZTA 4R84A 7TAAA 3IFNL 3QGVA 2K1MA 4HGWA 5HGDA 5CP7A 1MCEA 1LMKA 3BZFB 4FXGC 2DJ4A 2XVBA 3M88A 2XACC 1HZKA 3Q6FB 2JELL 3ESOA 1ZT4A 3US1A 2XFXB 2EILB 2YGPA 3IGFA 4MQSB 5I6MA 5J9PA 4Y19B 4A55A 3Q0HA 4FD0A 5ADOH 2UVFA 4XXCA 4KWUA 1CF8H 3KPSA 2HLEB 3X3GH 4X6CA 2XCMC 4OFVA 2ICWI 3IPFA 2FHBA 2QZQA 3IF1A 4XPGL 1J86A 2VQTA 4PJ5D 4YDLB 1ZPLA 4JPWH 1EZVX 3RX7A 4BHUA 3BRFA 1VFMA 5D1QA 4A2LA 4KU1A 2B1OA 1Z9LA 3DI2B 5C0IB 5DEFB 1QO3A 3LD8B 4D9RE 3L3IA 3CNKA 1XVSA 2UYLB 4XNUH 1SM3L 3WJJC 1EXHA 2CIIB 3LN4B 2ZXEB 4AQ8C 4KTYA 4Z77A 1AHWA 2HKAA 1XGRB 3EUUA 3FTZA 2WW8A 1FNGA 2P46B 4JRYE 3KJ4C 1GZPB 1IC4L 3L3DB 3ZO0A 3QEUB 3GXDA 3L7EB 5FM8A 1FL5B 4HYTB 3VFTA 1OOAA 1QEWA 3D34A 1CQKA 3MTRA 4G1EB 3SOBH 4FQHA 4P06A 1E4XH 3MSPA 5KSBB 3D87B 3TH4T 3DIFB 2YMXH 3OTTA 4ZXBD 4PBVC 5CINL 3T0XA 3WXVL 3X1BA 1UADC 4ZMYA 4QNPE 1MNUL 1SZNA 2AJYL 3H9ZA 4YHKL 3GMRB 4P5TD 3AWGA 4KI1A 4YDJA 5CLYA 1QQDB 3P9MB 2QLVB 1KCBA 3C6SA 3E0GA 2X0UA 4XVUD 5C2BH 1W0VA 2M83A 3BZDA 2VLKB 3WFEH 2BHUA 4OFYA 4UTBA 4TVPD 1FHGA 4M6ML 3J07A 2HX9A 1SN5A 4WNQB 3VFPA 3I50L 2WNXA 5FDYA 3NFNB 4UI2A 2YRBA 1UT9A 1ZLVK 4BH7A 2B3IA 4JFDB 4TUJB 3OQ3B 3WUWB 1SEQH 2P5WE 1IBDA 4Y2NA 1KPVA 2XN1A 4GKNB 1WCBB 2EICA 3KBEA 1H9VA 2UZPA 3OPZH 4UILH 2X6VA 4NKOB 1ACZA 3MMEA 1S5IL 2ZP8A 4Y4KD 2WCSA 3KW7A 2WY3B 2EUXA 4K7PY 2G4EA 4TMPA 2PNDA 2FSEA 2WXGA 4NYLB 4WAFA 4A6YH 4JMNA 2NX5D 1HSBA 2J88H 1LILA 3C5XA 3ASOB 2BXYA 3KH3A 1WC7B 4FEIA 1ZLDA 4MXQC 2CLZA 4JB9L 2LAAA 3CFEA 3LKOB 3VCLA 1XGTA 2E27L 2OP4H 4D0DB 1RUQH 4YDKL 1PZDA 2VRAA 3S5LG 1IAIL 4J2XA 3BP4B 3IDGB 1M05B 2YPVL 4JG1L 2OR8A 4TXVB 2R56H 4Q0XL 2B4CL 2OJEA 4K7FB 3CE1A 1KXQA 1JWMB 4RVBA 2G9HA 3SDCA 4OFDA 3N06B 5D6CA 2YEZA 3RGVC 1FFRA 1NDMB 1JFHA 3MZTA 1G0XA 2F5AL 5D2NB 2R1WB 3MRFA 3WFHB 3STZA 4XP4H 1E4WL 4GSDH 1DJGA 2ZXBA 3AUVA 5EBGA 4YPGA 4HWEL 4QD2E 2BP5M 1NC2D 3QB7C 3KR3L 3MRJA 4CMHB 2Q76B 2E6JA 2VZVA 4FQXA 2XJKA 4XTRD 3BVVA 3SDAA 3P4MB 5KYWA 1W9XA 3O3DB 4DERA 1BD2D 4LCWE 4XBEL 5C0FB 2YD3A 3DJZA 3O2DL 4DPBX 2R69L 5EBMA 3EGXB 5EU7E 2WB7A 1CD0A 3D18A 4LEXH 5LWYH 3POHA 2WOYA 2ZICA 4KKRA 3J8F7 2DYPB 4U6YA 3QJTB 1WGVA 3OX8B 1UXSB 1C5CL 1U21A 5T3XH 4FKHA 3GLDA 4XB3A 3NP4A 3D25A 5EU3A 3UZVB 5FYLE 4FL4B 1FI8C 1AXSB 1D5BB 2WWNA 1MCFA 2H9GA 3NCXA 4LLDB 4RFEA 4TSAL 3QQ3A 2ZAHA 1YMMA 3LZFH 4LKXA 3MNZA 4LBEA 1TFHA 1ZTXE 3N41B 4ZI8A 2XC8A 4M5ZH 1JWUA 4F7TB 4PRHA 4N22A 2ZYHA 4HBQA 4KOBA 2KL6A 5ICZA 4IRSB 5CS7A 3STLB 2BNUA 4PRBA 2QVTA 5HP5A 4WLCA 5AKTA 4F9PA 3F12B 1O7DC 2XWCA 5EZJA 1FG2A 4M8QA 2CAKA 5HDBB 4X8JB 3V4VL 1HE7A 3MRCB 2NXZC 3V5HB 3QUMA 4JFHE 1RZKH 3FRUA 2E6PA 4KNSA 4DSYA 1I7UA 4EZKA 1U8QA 1QBLH 3O8XA 4OCMC 3TA3B 5JIKA 1QFUH 1U3YA 5BV7L 4Y9EA 1OTTC 1RZ8A 3WAJA 1CXHA 2CMRL 5HVHC 2VITA 5A2AA 4HIIA 4R97C 3VFGH 4Q6IC 5MEOB 2XWBB 4W4OA 4XNYL 1K9TA 5LXGH 2HVBA 3WKYA 4XN7A 1JPSH 1UT1A 3DX6A 1U6AL 4M48H 2C3HA 5I16A 5TQ0L 5L8LB 4WEMB 2WN3A 1R5WB 4XAWL 4U0RB 4P2RA 4MVBD 1KELL 4OFIA 2K70A 4K7PL 1T6VN 5HHNA 4JRLA 3BUBA 3OJ2C 4KI5D 3QS2A 1HJBC 2NY0C 3CN3A 2QGEA 5IFAL 3RIFK 1R24A 4FQJH 1ZGLB 4P2OC 2Y5TB 1WAEA 3P77B 2R2HA 5AYTA 4MZRA 1FVCA 2A6JA 3FFCD 2CDFA 3DO7B 3T4AB 5I19L 1I1AC 4ZPTB 2V5YA 4XHJD 2F18A 2WOBA 4RDQG 4PJXE 5IFHL 4RQQA 2YGQA 4U1SA 4OJEH 4DGIH 4XMLL 1IT9L 1T1XB 3KPNB 4MMXB 4OD2A 1E8ZA 2JQMA 4X9BA 1GRWA 2OJZL 3NZ8A 5C0GB 5F7LB 5D1ZD 5IMOB 3D0VB 3SKOA 3PIQA 4QGTA 5LCVL 1GXEA 5DYFA 2Q8AH 1CBVL 2FLMA 1MI5E 2HRGA 1BM3L 4D3CL 5JXEA 5E6ID 3CXFA 4MS8D 1BX2A 2G60H 1FYTE 3SGDH 2CGRH 3PHOB 1K8IA 3C9NA 3B37A 3DOIA 2H2PC 1J9RA 5A16B 4RRPG 1A0QL 4J4PA 1LMIA 1CL7H 4F2FA 2QV2A 1AD0B 1IB5A 4NQDB 3ZKND 3TURA 4KX8A 4YOKA 4O02A 1L9TA 4GO8A 1V7NH 2BSTA 1BQHG 4IRJA 1MEXH 1I8KB 2CM5A 2ZG2A 2PYFA 3TTYA 4R0LA 4UIMB 1F4WH 2FR4A 1ERNA 4O5LL 3N1QC 4WJ5B 4AGOA 4UCFA 2H26A 5FB8A 4X4ZA 3S35L 5C9KA 3OSKA 4KDTC 4ZX6A 5K59E 4OKVB 1I7ZB 1OVZA 1FJ1B 3L3HB 3S36H 1XCTB 5I1KH 5HGAB 4YL9A 5GS0H 5I8OH 4XCYA 2FO4A 4PJFA 4J2QA 3GT6A 3EHBD 1FNHA 1FNFA 2FRGP 3HE7A 1NWOA 5AWNH 1P7QA 4F80A 2Z31C 2VDQB 1JN6B 2YMOA 3HR5A 3CXDL 5D7JC 3VMPA 1U8PB 2O5NA 4NQTA 1C8QA 2IPTL 2WTRA 2Z65C 3SKJH 2CWRA 1N3NB 3CZLA 3OXRB 3R4DA 2IGLA 1A7RL 3G5VB 4E9QA 5L88L 3K2KA 4NSKA 1YEKH 2NY3D 2IOMA 2XOTA 3UZEA 4PN6A 3K8MA 3WE6A 1XF4B 1C5BL 2I9LB 2XVLA 3OGCA 3QIBA 4GO9A 4L4VB 4MA3A 5EORH 4JLRA 4AOFA 5AOJA 3MCKB 3IBEA 3NTCL 5E8PB 1M3JA 4EUPB 4L9LC 2Z7WA 1DBJH 4F9LA 4NB7A 4IDJL 5ESVB 2OMYB 5K9JH 4AYSA 2GQHA 5TQ2H 4CNIA 1V3JA 5INDA 3IXAB 5AFAA 4IBUA 1NC4D 3CJJA 3FHAA 4IBYA 2VN6A 3RWIB 3VQLA 1JP5A 1X4ZA 3Q2LA 3D6GA 3H42H 1S7TB 4OCXH 4QRTB 3TFKC 4E9XA 3RL1B 4D0BB 1E67A 4APQC 5C3TA 2NR6A 1WT5C 3PJSA 3FUNA 3AU1A 1UD5A 4CW1B 1LD9B 1I75A 5DQDL 2PF6A 3KW8A 2EVIA 3N2JA 1NMCC 2GSGA 2WBXA 2VW6A 4U1IA 2COVD 2WLIA 3QBTB 1FVEB 2LOEA 3PGCA 3HE6C 4RAUA 2E8YA 3IMBA 3DETC 5GGUA 4AJ0A 4YSTA 1M2VA 1GYCA 2BCMA 4ZFZA 2YBRB 4MXVE 4HBCL 4WHTA 4Z7AA 2R0WH 1RMFH 4JNXA 1P84K 3LKRB 5JMOC 3MLVH 2IWKA 5DJXA 4WHDA 4NCC2 3ZDWA 3GMQB 3FKUS 4UZUA 4K3EH 4HJJH 4PGBA 2X4RA 3VXRB 4AV5A 3ZRCC 4NN6C 4O2FA 5C0BD 2EDMA 2ZJSL 2MCPL 5HGBA 2CD0A 2ZOWA 3WNOA 4Z7VE 4N3UA 3B5HA 1I3GH 2QJDA 4ODWB 2H0JA 5C92A 1U41A 5DRZB 4W9LC 4YDMA 4NQQA 3TEXA 4PJEF 4U1GB 1CXKA 1D6VH 1B2YA 1RIVH 1ODUA 1DHKA 2R8SL 4JQIH 3VSVA 1UWEH 4OZHA 2O5YH 2PO6D 4RZKA 1HH6B 5EWIH 2DTSA 1A64A 1U58B 2CGYA 4JN2B 5D2LB 3CFQA 4Y4FB 3WIAA 1ZT4B 2XZAH 1WZKA 1XF5A 5BO1L 1QLFB 1LE5A 3AABA 1OTSC 1S78C 1CFQB 4LSPL 2N1TE 2AJSL 1NUFA 2Y7SA 3O6FB 4JHAL 2WHVA 1M2OA 3HPLB 3FT3A 2DKMA 1KIRA 4UM9A 1I8UA 5FA4A 4F37K 3ARBA 2JV6A 4MS6A 3KWVA 2YPLA 4Q56A 4G7YL 1S7XA 3MLTB 3BPLB 5AYQA 3QG6B 3BVUA 4JRYD 3LH8A 5GGQL 2DJMA 4ZAKA 3N43B 3MUY1 4IHOA 5MENE 1LO4L 1Z0NA 5BPPA 3P3UA 1FVDA 4Y16C 5AL0A 3MNMA 4X5XA 4L1LA 3UDWC 1GS7A 2LV4A 1ND0A 4ABQA 3QP3A 4Z77B 4QWWC 3U1SL 3QJVB 1KYFA 3NCBB 4XPTL 3MACH 4UTBL 2F74A 2IDFA 3VFTB 3TCTA 1V7MH 4LPUA 4C4UA 4EI5A 5BQ7A 3R19A 2AEOA 1FNEB 2HMID 3VFWB 2BXZA 2ZX6A 4Q52A 4WHCA 4BZ2L 1RVFL 1AAJA 1JNNH 3EJCA 2J8UA 2OX5B 3MGAA 2NTFA 1LDSA 3UBXG 1CG9B 4PG2A 4WK2B 5GIRA 5EEZA 5D8JL 4N2MA 1EUTA 2Z4TA 1MCHA 3FRPB 2VH5H 1AG0A 1TQSA 4NRXA 4L1SA 4G3YH 5EDSA 2VLME 1YEEL 2FVNA 2H2SD 4L5FL 4K3HA 5IJDC 1L7TL 5BZZA 2NUTA 3KH4A 3CU1A 1RURH 2JCWA 4Z0BL 3GI9L 1U2HA 4F15C 4N2HA 3FSVA 3MJ6A 4HUUB 4JO1L 3NZUA 5SWSB 1UJ3C 2IAAC 3I9IA 4XPAH 1MW3A 2PTTB 1RK1B 1RK7A 2HKHH 4XP5L 2F7QA 5IOKA 3AG4B 5C09A 3BIAX 4P2QB 3BAJA 4UQCA 1RIHH 3G6JB 3A67L 1QFOA 2H6PA 3CZNA 2F6AA 2CSPA 1UZ8B 1MDAA 4W9JC 3DO3A 4XCEB 3OR7A 1WS8A 4O4YL 4R7XA 1FN4A 3MLYL 3LIZA 5FWRA 5CU5A 2CLZB 4HLZH 4PJAB 5SWQB 2EYRA 4G82A 1XR9B 2J43A 3VX1A 3K6NA 2WJ7A 3P9LB 1N12A 4GT7A 2XXMB 1KSRA 4Y9FA 2DQUL 1CLYL 4DN4L 4U3SB 1ETA1 4PS7A 1MW0A 1MVFA 2PCXA 3B8SA 4GQRA 5FGBC 5I76B 3EJYD 3BKYH 3QFJA 2NYYD 5GGTA 2OJEB 1FBIL 3KGTA 3KWWB 4FQQB 5FOBB 1JGVL 1JERA 4DPAX 4ILDA 2Z92B 4I4WA 1KB9J 3VFVB 5IFJA 2EXTA 4MKMA 4RFOH 5LGHH 4JW3A 1ML0A 3VXQB 4ERSL 4ANVA 2VW4A 3WHXB 3BKML 4BFOA 2I5YH 3EBHA 3HC2A 3MTXA 5GRWA 3WEBA 2EC9T 5E7BA 2Z0BA 5BCAA 1ETZA 4AV0A 5IMMA 4Z7WE 4R4FH 4AEHL 3CBKB 4UM8A 4J3BA 2ZCKH 4NQVA 4ONFH 3GSUB 4QF1A 3WIIL 4OUOA 5C6TL 3S8FB 5FYLD 1F2QA 3KCPA 2BP8B 1MCOH 1CZ8L 1N7MH 4F2ME 3TCXA 2CNZA 2V2WA 2BFVL 4PJHA 3WFBL 4U6YB 3QCVH 4WO4B 2ORBH 2Z93A 2VDRL 3VXNA 3D25B 3KDMB 4FXKA 3VI3F 1PY9A 3G5YB 1Q38A 2A99A 4FQ2L 4FFZA 4XRCA 5A6IA 4XZUB 4I1RA 2XQBL 4Z7UA 2XZCL 1JPST 3LQZA 4OM0H 5KBMA 2COQA 2WKGA 3QUML 4JGMA 4XZ4A 5DI8B 5BS0A 3ZHNA 2OM5A 5CKAA 1E9QB 2VN7A 2WIMA 4MA1B 4QRPB 5AQ0A 1IM3B 1JCVA 5FLVA 2GC7C 4OLWL 5DHVB 1PLCA 1OV8A 3EFFB 2NY6B 4L0PB 5ICZB 4JGUA 1J1PL 2J8HA 4JZNB 2F8OA 2JKJA 3HKFA 5GZOC 4HXAH 4JFHD 1T89C 4I9XA 4ZZFA 5C3IA 5IHUH 2WQSA 4BZ1H 2OMXA 4AL8C 2OXHA 1A9BB 1OGAE 2Y22A 4OQTA 1U3HA 1TVBA 1OARH 3TF4A 1NUNB 4IYKA 2ZTBA 2HLAA 3UBGA 4E41B 1DQMH 1GW0A 1P5UB 2H32H 4ELKB 3MXWL 3I9AA 4TLUA 2R27A 2F8VA 3MRLB 2XTJC 2FWSA 3MDJA 3O4LA 5ANMA 5IJVA 4GXVH 4NS0A 2ARJQ 3V4PA 2FUQA 2DD8H 4GUQA 4XCFH 2ZUUA 3ML8A 3OKLA 4WW2B 1MFUA 5C9JA 3T9WA 4Q6YA 5AL8A 3VXMB 1BBJB 1PS3A 4M3JA 2OMVB 4JPIB 1VZHA 4BFRA 3VXUE 3HNVL 3MV9E 1NKRA 2DQ6A 2VITB 4FAAB 3K5SA 3JVGC 4JRXE 2B20A 3DSFH 4Y9GA 4YHYC 3M1OA 1KCKA 3V95A 3LEVL 4G6FD 4BRVA 4DP0X 1R5VB 2Y2WA 4Q9RL 5DD6B 3ATAA 5GISL 3ZE2F 5E6RB 5ESAA 2M1KA 1YUKB 3BDYL 3PQYB 1U33A 3ULVC 4PMEA 1XD1A 1RCYA 4UOZA 1QWNA 3EFOB 4IIQC 3LNGA 4Y1AA 5F3HA 4HT1L 2O93L 3BPNB 2O5XL 2WZAA 2NY4C 1WZMA 2NQCA 3II2A 2O6DA 3HMWH 4FF9A 3QRFM 4Y4HB 5JHMA 3GMMA 2DLEA 3OKNB 1HT6A 1IM9A 4M62H 4ALAC 1CXIA 3GB7A 3SY0B 2FJHB 1FPTH 1NPJA 5D4QA 3BGFC 3NGBB 4N0UB 1MVUB 1DSWA 1A7PL 1TJGH 2CO7B 2PWEA 4XP9L 5I2IA 2YLHA 5EIIB 4RX4A 2BVQB 1FVCB 5G5DA 5DD3L 3ARDC 4POZC 3SBRA 1OQOA 5HI5C 5ETUA 1MI5D 3GBMH 3UO1L 4TSCH 5T3ZH 4GRWH 4YL4A 4Q14A 2AXGB 1A3ZA 1FYTD 1QYGL 1S9WB 3FH5A 2LFEA 3WKQA 4JKPH 3EYVB 2ZCZA 5C0AE 1CK0L 2GJZA 2ITFA 4HUXB 3V6ZA 1AOHA 1QBBA 1MFCL 5BQDA 1TZIA 5A3IC 1BX2B 2VB5A 1TU2B 3RJOA 3I6KA 3ZYOA 3U46B 4ZUSB 4AIEA 5JW5A 1QRNE 3QXTA 4LVOC 4NNXA 1TXKA 4IBVA 3DO4A 2P26A 4M7JL 2FECL 1NJ9B 3KGSA 4FNLL 4UUJB 3GMNB 5LN4A 3KCWA 3WLWC 1RULL 5JW4Q 1AXIB 1CMOA 4YHML 4QOKE 4TULL 4L3EE 5ILTH 2VLJA 1HILB 4KVCH 2CLVA 3U4EA 1KWGA 3ZZ1A 2BSEA 3QDGA 4GXFA 1LDPH 2CHNA 4WUUE 3AREA 4RDBA 5H35A 1BEYL 3I75A 5KVDE 4OIFA 3LQAC 3SJVB 3L4ZA 5EOQL 3RNKA 1TZ8A 2WWKT 1ZT7B 3LXUX 4XPHL 1XT5A 1DBAL 2LLGA 4J3UA 3UCRA 1JZ4A 4GFXA 4XCYB 2FO4B 3BH8A 1XAKA 1JHLH 4PJFB 1IGML 3VRLE 5C70A 4XMTA 1I1YA 3B6SB 4ANKA 3HE7B 4CRPA 3ROLB 1F02I 2DQFB 1NGQL 5ENWA 4C8XA 5IQNA 3NJGA 4JHVA 5IB1A 1BBDL 4P23D 4IOFC 1UM4H 1IFRA 5IP4A 3LHPH 1VA9A 1UD2A 2Z7ZA 1XR8B 2YD8A 3CK0H 1KFAH 2ARJB 4WI7A 3UROR 3EZJB 1ED3B 3B83A 4PRPE 4PJDF 5I0VA 1U2YA 3MRDA 3L48A 1CD9B 3MBEB 3QIBB 4MA3B 4K94L 5DS1A 4M4RB 3T4YB 4AE0A 3ULVF 1KJ3H 4LIQL 2CCLA 2C9RA 4XXDA 3ET9F 5JHLH 3QIWC 3T65A 1MRFL 2YOAA 4O2CA 5JHDD 5CFHA 4MRCA 1A6WH 4Z9KB 5KYXB 3QHFL 4KJYB 3IWVA 5LLIC 1KGIA 2BSBA 5HPMA 4AZ8B 1KIUA 3RWJA 1Z9PA 1TZHB 1J05B 2XBTA 2OK0L 5DFAA 3GO1H 4QTHA 4GP8B 3HA0A 5JQ6H 5E2UH 5SWZB 3P0VH 3W11D 1IAKA 3MOBL 2EYTA 2RH0A 4DPCX 3TN0B 2IAMD 3TIEA 5HYSG 4RGNC 4GRLB 4G7VL 5F6HJ 1JI1A 2EUWA 4TM9A 3K4ZA 4FI7A 1LEGA 4FJYA 2XZZA 4YH6A 4UQAA 1GGCH 1M2VB 2RFXA 1M6OA 4IEFA 3U0TA 5E2VH 4WHTB 2D0FA 4OT1H 1JXJA 5AOZA 4RISH 1E6JH 1QBAA 3VXOB 5DVPA 3DOSB 1MF2L 3Q01A 2DKSA 1NANI 2CM6A 5DHMC 5DJZA 5C6PB 2Y06H 3BN3B 4P5KA 2D3VA 3HMXH 2WNKA 2HFGL 2R0LL 5D1XA 1E9PB 2AEWA 1ASOA 4MJIB 3L3OB 4MNQE 1IARB 1VCAA 3BT2L 2W91A 2CDEB 1I85C 1JV2B 3FZUC 5BRZA 3B9KC 3WMSA 4JO5A 1O9WA 1QR4A 2A9ML 1WD9A 3CPLB 1QR1A 1JJUA 4PBWD 1R3LB 4M6AA 3UGUA 3B9AA 4YN3A 4OZHB 3FU7B 5F7DB 4BQCA 3MGTA 4DTGL 2O4EA 1UXWB 2F54D 1KGYE 3O9WA 1OHZA 4UT6A 1UVQB 4WEBL 4MXWL 1NPUA 3UYRH 4I0PC 3JWNC 2X3BA 4B97A 3M8OH 3O3BA 4RA3A 4XR8C 5MEND 5FA4B 1FE8H 4FQCL 3VFRA 4ODBD 4P3CL 3IMUA 3U36A 2D03L 1J0ZA 4OBSA 2SODB 2QQLH 4WENB 1OAQL 1CLVA 1O75A 3P69A 4NPJA 1FFTB 2EYSA 5IVXB 4H13C 4OW6A 4G2AA 3LMJH 4XPBH 3PWVB 4ZAKB 1GYAA 1NAMH 1S3KH 4N2FA 1QLEH 1O9VA 3NCYP 4NFDA 5B1AB 4OI8A 3U6RB 3BIKA 4B53A 5TPWL 1HCYA 5SV4A 1TZAA 3DGDA 4U4IA 5L6YL 2YUVA 3NIFE 4FQIL 3NJNA 2ZOLA 4NIKB 5GGRA 3WO4B 4RFNC 4M8UA 4L3AA 3VGAB 1OP4A 4HV8A 4LCCB 5EO9A 3LZOA 1CFNA 4X5WA 1NMAH 2P9RA 4JQVC 4MHHI 2VQUA 4OCNC 1G5AA 4DN3L 2K6YA 2EKJA 2VLMD 2BJML 3ZOAA 1SNRA 2XTSA 1KJMB 1JZIA 2WMPA 2IADA 2J8UB 5FIEA 2J55A 1CTMA 3HN8A 5GIRB 3UTOA 3RDTA 3GMLA 2XZQH 1PZ5A 2LHAA 1A4BA 1X7TA 5EC2A 1I4FA 5CHNA 1T7YA 2JSFA 3CC1A 3DVIA 5HYJA 2WCGA 1JCKA 4OF5A 4NNPH 4WY7L 1EUUA 4POYA 4P5TB 5GSVA 2Q7AA 1CTOA 2EDOA 3GI8H 2A1WH 4G7QB 4QY8B 3BUTA 4BJLA 2IBGA 1I8MB 1LE9B 4XH2B 1HEZA 1ES0A 3T8VA 3DV4A 3DJSA 1T3FB 1D5IL 2VMCA 4UTCA 1UA3A 2PPFA 2NTSP 3OWRA 1D9KC 1IC7H 5EPMA 1E3XA 1JK8A 1WISA 1D6EA 5GGTL 1GGBH 3BSZA 5FW8A 3PYCA 1USZA 1Z9NA 4DCQA 3B3IB 2K7PA 3LPWA 3UG5A 4H8UA 2EP6A 4Q4EA 5K1NA 5KVEL 3F3HA 3PL6A 4ZQKB 5I1JH 1SXBA 2WYZA 2Z1PA 4JKWA 1RZJC 3RU8H 3O3UN 4AQ1C 4G71B 4HUNB 2AVGA 2NX5B 4LCUA 1MQ8A 2X4SA 3BISA 1M7DB 4PY8J 4RGOH 1JL8A 1AFVH 1A22B 4XBGB 1NOLA 2X09A 3P73A 4WFFD 1PZAA 4U1MA 1KB3A 2AXJA 1TJMA 2MQGA 4LAQL 3S3DB 2XVGA 2VR8A 3NJIA 1Z6JT 2DN7A 4ZO6A 4OZFH 1D5RA 1WZAA 1A3RL 4JG5A 2VDNH 4NOBA 3UYPA 1XQ4A 3DWTA 5ID0A 1PKQB 3HB3D 1TIUA 1TSHA 2QLYA 4DGYL 2AVFA 2DQGH 1OE3A 5LHDA 2YA1A 1B2WH 3Q43A 1T0MB 4FFZL 4M5TA 2C1OA 3LZQA 3RWCA 4RGMC 2JCCF 4NO2B 4JCMA 2V3FA 4JDZB 1H8NA 4J3OG 4ZRGA 5L4JA 4GI9A 2BCKB 4Z1PA 1ROWA 3O4OC 2I60L 4FTVA 1OANA 3QIUD 4P3DA 4K2UH 4RWYL 3WS3A 4JFTA 2MCMA 3GMOB 1HYRC 4MXQD 4OQTL 1RIUL 5DLML 4U6XB 4LSUL 4PSRA 2OTWB 1T66C 2GKIA 5MERB 1MH5B 2J20A 2X2IA 2BLFA 3SDXF 2NY7H 1NBCA 3GSNH 4XBPA 1WFTA 5JQHC 1OGAD 3JSSA 5FCUH 2KYIA 5FYJU 4R4NC 4X7EC 4OI9A 3L95B 1LWRA 3DVGB 3WXWL 4JZOB 4YR6A 3MCYA 2WIIA 1P9MC 1GZQA 4AT6A 3AWEA 5IQ9A 1KCVL 4NJ9H 1FF5A 2GIYA 1XGUA 3OMIB 1PLGH 3SE9H 3P3TA 5F7EH 4BGLA 1JGUL 3VXUD 2F1AA 5K9OB 3R06B 1UXLA 4PBDA 3OBAA 4JRXD 3DROB 1VSCA 3V4PB 1JZEA 5ALBH 4BKLA 4PJGF 4LPXA 2Q2LA 2X42A 4PHXA 1DO6A 2OTUB 3LPFA 3NN8A 4N68A 4X9YA 5JA8B 3CQFA 4JQXA 1MHCA 1L3WA 2K78A 4S2SB 2GJ6A 1PGRB 1SJEA 3SGKA 3FN9A 2VDPL 4YNYA 2IBZY 3BZ4A 2QKSA 5KSAA 3AB0B 4X4XA 4XC1H 5CP3H 4OU3A 1ZHNA 2XKSA 3N42B 3V79C 3VWKC 5FO9A 3S96B 1TTFA 3T6WA 4OJFL 2X6BA 2XN9E 4OIBA 5ICXB 2ZNXA 1J5CA 4Z3TA 4OZIA 4X7TA 1IC5L 5IY5B 1RUAH 2L0DA 3RA7L 4GSUA 4UQBA 1EFQA 2RR3A 3GB7B 1A8ZA 4G6ML 1EJ6A 3M7OA 5AUMA 1KB9K 2MPVA 3KM2A 5IBTL 1JPEA 3B9VA 3IYLW 1N0LA 1RFDH 4AG4L 5CBEB 5AOIA 3C8DA 2O72A 1T1WB 2VC2H 3WN5B 5C0AD 2ICEA 4WO0A 1EEZA 4I7ZC 2IMMA 4ZTOH 2UXFA 1LEIB 4U1KB 3DXAE 4QTIL 4QCIA 1ZAGA 1QA9A 4ACTA 25C8L 2BP3A 3FFCB 2NXZD 4JE4B 4BQ8A 3JTTB 4PTTA 4WWKC 4G9FA 2DQIH 3HI1A 4RLDA 1IX2A 5BUAA 3JWOL 4YO0B 1N4XL 1OTTD 3I9PA 5JOFA 7FABL 4X8GA 1TZIB 4MA8H 4GW5B 5JNYB 2XTJE 4DKEL 2EVHA 1UACH 3BFWA 3MUZ1 4QOKD 5D1ZB 4ZSOA 2X4NA 3EYSH 4XMKH 5DJAB 1AQHA 2GABA 2OV0A 1U8CA 2UXVA 4TNGA 5JW5B 1YPZA 2EDTA 2WAQA 3ULAB 1Q0XH 1HXMA 4WUUD 1MWAB 2FTAA 3K2MC 3CC5A 5CJQH 4PH8A 2W0KA 6PAZA 5IESL 3HG1E 2CDGA 2BY1A 4X6DB 15C8H 1GHFL 3QPXL 5IV2A 4YK4B 2MJWA 1TNNA 2UZXA 3FTXA 4BBWA 1EEUA 4AWJC 1WBXB 3CFKA 3MRHA 3LDBB 2NY0D 2P48B 2HKFL 1DLHA 4P2OD 5GGVH 1MDTA 1IGCL 3A4DA 1ZDSA 3ARFA 2W60B 1DL7H 2ZX7A 4YBQD 1E0OB 1YNTB 5JUEL 2J2ZB 4JZJB 1EHAA 3S97C 1XFPA 2AKRB 2AJXL 2X89A 2WWKO 3OKOB 4TUKH 4A66A 1PVHA 4MQ7B 2CR6A 3PWPD 3HZKA 3BH8B 5F3FA 4RMSA 3LEXA 5AAMC 1M9WA 1UASA 4BD4A 4XN8A 4PRPD 3MUGB 2RCSL 5IBUG 1W91A 4J3TA 1INDL 5JIIA 5E8EA 1TVHB 3VNZA 4XE0A 3MRIB 4JY6B 3D51A 1P5VB 4NP9A 1KT2A 2HT2C 4H44C 2ESVE 4RIRB 6FABH 1INQB 4CGUB 1NCAL 1UD3A 1I1FA 2H2PD 2WTOA 1LQSR 4HWBL 4JG0H 2WSDA 4DP1X 4M3KB 4XN2A 3MX0B 4PLOB 2OA9A 2YK1H 4XXDB 2X40A 3BDXA 1NFDB 1GGIH 4PP1C 2NSMA 4KZEL 5SX4I 2P80A 2V9UA 1G4RA 3MODH 2GTWA 1A7QH 2R0KL 5KTEL 3QJZA 4UB0H 5HDQH 4ZNEE 5JDSB 2EADA 1ZVHA 2G0LA 4PAZA 2QSVA 4Z3JA 3D9AH 2ZXWB 1D7CA 2DLHA 3RHWK 2FH6A 4AH2B 1T4KA 1JPTL 4OV5B 2QT6A 2AITA 4HFWA 2G5RA 5CGMA 1VKXA 4L48A 4B9PA 1A5FL 2I9TB 4H4NA 1BV8A 5L0QC 1NC4B 1UD8A 1IAII 3F7YA 3FO9A 2VKWA 5EDXA 5EA0H 3NEEA 5AVVB 1T7WA 1V05A 3W37A 3AMKA 1NZRA 1QRKA 5D7JD 5F96L 2EINB 2IQ9L 1GC1C 2YGOA 4GSRA 4PMFA 2BVUA 1YECL 1EMTL 2CKBB 4LPWA 4IEFB 1O0VA 4MNQD 3W57A 1JTOA 2DQHH 4PI0A 3V4UL 3QH3B 4LLQA 5DJCA 3KHOA 1Z3GL 5CEZL 1CICA 4U6HB 2P8MA 1PLBA 4Y5VB 2VJ0A 2X4TB 1R6VA 5KZCB 5D6DC 1HQRB 3CX5J 4I1NB 4P5KB 3RTLA 5ESQA 4W1TA 4XI5D 3HC3L 1MCNA 1LNUA 3HC4L 4FHBD 4DH2A 2DM3A 3QORC 1AO7E 1ACXA 4N8VB 4AQOA 2V5TA 4JFOA 4PWJA 43CAB 1DVSA 1RHHB 1OHQA 5C0BB 5BZDB 1QNZH 2X88A 2ZXCA 4YDVB 1TJHL 2JH2A 4FOMA 5DR5L 4W9ZA 1BXUA 1ESOA 1KCLA 3TVMC 5F0JB 3MGTB 4LSQL 2CO6A 3D50A 2E9JA 2JVUA 3TV8A 4CU8A 4CKQA 2BIIA 3FB6A 3S36X 1SBBA 3U4BH 4U1JA 5IB4B 5EEYA 1VEOA 2D7MA 3GZQA 3M6DA 4FEMA 3FUHA 2Y2TA 3K4DA 4FA7B 4X2UA 1E6OH 1JGLH 4IMKC 2GJPA 4FNQA 5GRVK 3VFSA 3HE6D 2IOIA 3VGEA 3DETD 1CJYA 5E03A 5IEKA 1EGJH 4TTGA 1DSFH 4NC2B 3F6IA 2HWZH 2P5EE 3QDHA 2BHZA 1G7HB 4PJ7F 1NDGB 3ZHDA 4ZMNA 2C1PA 2X1WL 1KPRA 2D3JA 3M1BA 4RGNE 1KBVA 1HU8A 4G8IA 2A74A 1G9MH 1SN0A 4A6YA 3QNXA 3FQRA 2BOLA 4OD1H 1QI3A 3QHTC 5AW2B 3IJSB 5SV3A 2HPTA 1DUZB 1KGCE 2H0EA 3A6CH 3CFMA 4QLRA 3AQDA 3WUWG 3T04D 2GTQA 3FW6A 1ZXKA 3ZT5A 4WCYL 3SHSA 4ANXA 3O11A 3ZPDA 4EN3C 3HUJF 4YXKL 1PNDA 1IBHA 3W81A 1IFHL 3MV7A 3ARWA 2QSCL 3K81A 2ZD0A 1I3VA 1S78D 3PNRB 3ZTJG 5HD8C 4XOCA 1UEMA 4N6RA 4PRNA 2J7LA 4PJBF 4GO6B 4HP5A 3SPVB 4G9DA 4JO2H 1OGTB 3G6DH 3BSZL 4UYPA 4HPYL 5E8NA 1U30A 4GAGL 5CHNB 4NQCE 1BMWA 5PAZA 3COOA 3PP4L 3TL5A 4NO0A 2B5IC 3PWUA 5TF1H 3G08A 4F8NA 2EXWC 3QEHA 3U2SA 1S7UB 2DMBA 2G3NA 3BXNA 3TV3H 1TPXB 2VIRA 2FATH 1PG7H 4QHPA 1W0YT 5EZLA 4Y16D 2Y23A 2ILLA 1CLZH 2VISA 4K23L 5FFOA 4ZUTB 1YNKH 2HJKA 4YZWA 1RU9H 1IAIM 4GYBA 4QWWD 4BRJA 1AANA 1PLAA 4LLYB 3X3FL 4A2MA 3GD1C 1MLBA 3WJJA 3CVHH 2AEPL 3MBXL 1KCUL 4UQ2B 4ZO8A 3UZQA 4K71B 2JCCE 5J06A 1KGJA 5DS8A 3CDZA 1U91B 4U1NA 5AW4B 4OGAC 1RPUA 2P3YA 2BSCA 5BW7A 3QUZA 2QVIA 3G7TA 1DUYB 1MRDH 1RHFA 1WD8A 3V7MA 4A38A 1T83A 2W80C 1J1XH 3LPOA 4Z95L 5ICYB 3D69A 1NGYB 3IRPX 3AADB 35C8L 3ULSA 1PQZB 3RUGE 3ARQA 4YHNB 3DOHA 2X6AA 1OF2B 1PMYA 2HT3D 1H6TA 1M71B 4WSGA 1H5BB 3FU8A 2R9HD 2ENSA 2HH0L 3LH2L 4XB8A 1SFDA 3HFFA 1CGWA 1DR9A 3IFNH 3RPKA 3SDXE 2DTML 3WLBB 4Z7OB 1MCSA 2B4CC 4YFDB 2ATKB 4YHOL 3WIFA 2EE0A 4P59H 3REVA 1S9KC 5I1IH 2QQQA 2C3XA 1F1GA 3GDBA 3TM6A 4DO5A 1FL3B 1JD7A 3QZMA 1B6UA 1HHGA 1KBPA 2DI8A 4PWKA 5CLTA 5EBWB 1CDHA 1VRSA 2WQ8A 1L9OA 5AVRB 5H8DA 2H3XC 1U92A 3CFDA 3IKKA 4KZ0A 2RD0A 1NEZG 4KTDL 4R7NA 4WK4B 2K3TA 4MJ2A 2Q3AA 4CVXA 4FMFA 5I1HL 1HYSD 4JVPA 1DEEA 5I5JA 1NICA 4PJGE 2F7PA 3U4KA 2QDWA 5CMAB 2PXYA 4M43H 3ZMNA 4MAYC 3FF8A 2JQAA 1HSAB 5TDOB 3S4SA 3WFDL 5DC0A 2CRZA 2VAAB 4PWHA 4N1CA 3HR6A 1MCQA 1NGZA 2GHWB 2YRPA 1C1EL 3N1FC 4MSWA 1S7WB 4IBSA 3EAKA 1IC4H 2BRRH 4WGVB 3IDUA 4DGWC 4G72B 1OPGH 2IANE 4X7DC 3HLAA 3LB6C 4AT6B 4E0RA 2IBBA 1EAQA 2PKDA 4YIQB 2J73A 1H15A 3OXSB 4OGZA 4TSBL 4H8WH 5CINH 2C3VA 3MO1B 1KEGH 2B16A 3QCUL 4G7SB 1DQDL 2AJYH 1YAZA 3AG1B 2OSLB 4E9WA 5CILH 3HZVA 1R3JA 1UKSA 2B9BA 2OZ4L 4IS6B 4XP1L 5DMGC 3T77A 4G5ZL 3S9DB 4F7CB 1IU1A 3FQWA 5FXCH 3TZVC 1CCZA 3UP6A 2Y25A 2CLRB 1W0WB 4K8RC 2ZNWA 4YC2B 2OQJB 2FCBA 5FYKL 3HTLX 4Y9CA 3IGAB 2XN9D 4M6MH 3U4AA 2CJSA 3CFNA 3F8UB 1KXVA 3BPCA 3FCUB 5BV7C 2J6WA 1HL8A 4HKBA 3RWHA 2A9NL 5CEXA 3BZ4B 2E9BA 2JB6B 4X4XB 2WQAA 5DK2A 1RJZA 2B59A 3KLAB 4P9HL 3UBXI 2V5MA 3FJTA 3RTQA 4DEWA 1S5IH 1T5XB 4G6FB 5ISZA 1MCPL 1HWWA 2PPEA 1SMOA 1KBGH 3E7JA 4ACPA 1A8JH 3QDJB 1RUML 3BVXA 3RWGB 4BK5A 3VGGA 5GSRB 5SX4H 1B3JA 2EXYC 3P4NA 2V2TB 3FBKA 2BSSA 2MPAH 3JXAA 3QZNA 5FO8A 1U8HA 3D3VD 2CO2A 1MHHA 4M93C 3QUHA 1VAHA 4PFEA 3C8KB 2XTJD 4YDKH 4IJ3C 5FHBH 1AE6H 3OF6A 4MD0B 2HT4C 1MCLA 4PTTB 3US9A 1JZJA 1QFWM 4UDTB 2APTA 2P8LB 4EN2A 2CO1A 4IKIA 5DJ2A 2BC4A 1MI5B 4Q2ZA 5DQJA 1NCDH 2YPVH 1DEDA 1JYWA 4JGNA 3HG1D 3ASNB 1FRGL 1PZSA 4EIZC 1FYTB 4LSSL 4M5YL 1SVCP 4QRQB 3O3EB 1UCBH 1PD6A 4GUPA 4HG4J 3WY4A 5J57B 1S9VB 1AHKA 1U8CB 3CLFL 2VXTH 1HQ4B 4BQBA 2ED8A 2GAZA 4DT2A 4HWEH 5C7XH 1A4KA 3CC5B 3ILPB 5CIPH 4PP2B 3QJXA 2GFBB 5T5NG 3V0DA 4ETQB 4L4TA 2NY4D 5B3SB 1L9QA 2YD4A 1ONQB 3O3AB 4UIKL 4IKJA 2OYKA 1CGXA 3E6FB 2DQMA 2YRZA 3TBVB 4PRDA 4ABUA 1A3LL 1KG0B 3IRZA 4XBEH 3UTSE 3DBSA 4H1LG 2R69H 2Y3AA 3EIFA 5CD3B 4R96B 2XWJA 1XIWC 2HUEA 3MJ8B 4LLVA 3HZ3A 4YSOA 3BVNA 3EOYG 2FYVA 3VRIA 5C0CA 4D0CB 1N2RB 1UHVA 3UGXA 5HI5D 3FU9A 4MA7L 4AGPA 2HFFA 3DRTA 3MRGB 3Q6GH 2ESVD 2F2HA 1JMZA 2C4FT 3WEXB 1ZHBA 2IDCA 5ABZA 1CUOA 4GW1B 5CWSB 1JXFA 2OCJA 2WBJC 4PCKA 1ZEAH 2YRLA 4PS3A 5I23A 4LVNC 4E9LA 1CF8L 4H40A 3X3GL 2Y5QA 2XWZA 3JZ7A 5A3ID 1KT2B 3QQ4A 4N87A 1NH6A 1UWYA 4HOXA 1CTNA 3PHQA 3GNML 1OB1A 1FIGL 4LGPB 4P23B 1L9RA 3BUPA 4NRYA 4JPWL 2BNQE 3E2HB 3PWLB 1SHSA 1W6LA 4JQIA 3UJIL 3WLWD 1AQMA 3BLBA 3V4VH 4F7MA 5MHSD 4WKXA 5E5RB 3ULUE 3KLDA 3L6FB 4G80A 3VD5A 1CDYA 5AZ2H 4TRPH 3E80A 4NQEE 4Z5RB 4WW1A 3T0DA 3CZFB 2WANA 4ELMB 1VERA 4NFBA 5JHDB 2CMRH 3TPKA 4DEPC 4FKEA 4PJ5A 4JFEE 2PN5A 5E2WL 2RMNA 4PW3A 3SOBL 3ZY7A 4Z3FA 3RVVD 1O5DT 2CA3A 1E4XL 4WU7A 1QACA 4RSVA 2YMXL 1BVNT 2OLDA 3ZL4H 3BE1L 5MP6H 4ETYA 5E1HB 4PJIF 4XAWH 5IIEB 4IOFD 2QKIA 1KELH 4HGKC 2Z8RA 2AAVA 2A73A 2BVPA 5DF0A 3K5RA 4ZUUA 1NMBL 3LVEA 2HG5A 1NGWA 2X87A 4H88L 2IAMB 5HJDA 5IFAH 4BCYA 1AO7D 4M1DL 5C2BL 5DJDB 3VACA 4YLBA 1KIQA 4G83A 3PWJB 3GS7A 3L3KA 3OWEA 3WFEL 3EOBA 1CN4A 5I8EA 4A63A 1P2CA 3QS3A 5I19H 5F6IC 3KL3A 3QIWD 1G7MA 2MKWA 3UFIA 1N18A 5IFHH 2VLRE 3IJ8A 3IJYB 5EU6A 4PJ7E 3R7RA 1SEQL 4XXCC 4YX2L 1XBDA 4Z0XA 4A7SA 1V55B 2AV1B 1FWXA 1B90A 4UILL 3P0GB 1H3PH 1FGNL 3WY1A 4YDZA 2DLGA 4XMUA 4BFJA 2YQBA 3IJEB 2WKOF 3BPLC 1BM3H 4D3CH 4L37A 4A6YL 3HJ0A 4PG9A 5F89A 1G9NH 5D1QC 4YSDA 1AQKH 4M6NH 3B1TA 5JPNA 4GXUN 3FB6B 2F53B 3FBQA 2P5ED 4IW4C 4LEOA 4ODUA 4O51A 4U1JB 3BP5A 3HUJE 2HP4A 2FSDA 3PGDB 1DE4A 1T1ZA 4RGND 4ZMOA 2L7QA 2F54B 5DMYA 3QJUB 1AHWC 2OP4L 3BMVA 1GOFA 1RUQL 1KMGA 4Y4KA 3QO1B 3EJZC 1OCWH 4JANB 3QQDA 5F71A 3GRWL 5IEKB 2DWTA 1FO0B 2W38A 4O5LH 1KGCD 1YEDA 2CXKA 3FRPG 3H9SE 4G1MA 3HAEB 3L9EA 4ZS6D 5F1IA 4CN4A 3ZMRA 2R56L 5B39B 2P8PB 2Y2YA 2ZCLL 5E1GA 5DLLA 3OKDA 4QKTA 1FAIH 4K5OA 5JTWA 5F1NA 3SYPA 3ZL2A 4ZW5A 4XP4L 1MY7A 4JDTL 3WMQA 3V6BR 2VERA 3FZUD 5F9WB 4BUGA 3QEQB 3UTTE 3B9KD 4P5SA 1U8MA 1CFBA 1WG3A 4JY5H 1JNLH 3CXDH 1PEWA 3OKMA 3GZOA 2IPTH 2RALA 5KVGL 4PV8A 1A7RH 5L88H 1MXDA 3TONA 1UB5A 4HIJA 4NQCD 2E7CA 4KROC 1JDDA 3CSFA 3MU3A 2R1YB 1WTLA 1C5BH 2LLLA 3VXPB 4I0PD 3N44F 4FXGB 5EHFA 2IH3A 2L4OA 2MKLC 3NTCH 5T3XL 3X1FA 1KTDB 2X9WA 2BS8A 4JFSA 2V6HA 1BSIA 1NC2A 2JKTM 4QHUB 4QXVA 4IDJH 3V0JA 3RWEA 1XSJA 1Z2KA 4FYRA 3QRGL 4ZODA 5KSVB 3LZFL 1IC1A 1X9QA 1R3KB 3ME0B 3WS6A 1BD2A 4NO0B 1Z9SA 3QXAA 3PWUB 4MDRA 3VXSA 3FYEB 3G08B 3G5XB 3IVKB 4PGCB 3FTSA 3VWJA 4M5ZL 5C86A 5KVMC 1OGSA 5FO7A 4JL2A 2HVJB 3TGXA 4AJYV 3ZKQD 3HIZA 1HINH 4IGBA 4B9FA 5IB2B 4FLRA 2X1XR 3CX5K 4CMMA 3RB5A 5H2BA 3V4LA 1HHJB 2K8MA 2EDXA 1WA2X 3BYTA 1N26A 3H2PA 4JFYB 5EG6C 5J7CC 4N5ED 1DZ0A 1V3LA 1G7LA 5DQDH 4X6CF 5GS1A 1A7OH 3ZVVA 3CBRA 1KXTA 4L2LA 2KKQA 2QHLA 4HJ1A 3EO1B 3TIDB 1OW0A 3KJ4B 1NCBL 2DJUA 4HBCH 3SDCC 4XNMA 3FU3A 5ITFA 1CXLA 1QFUL 2YWYA 3FL7A 2D3NA 4HH9A 2FECI 5MEPA 3ELAT 5IF0A 4KXDA 2YBGA 3IDMA 3T71A 2WXIA 3QJHA 2VLKE 4YE4H 3MBWB 4OH2A 2MCPH 5LXGL 4TLTA 4FQXC 3VI3A 5B1CA 3SDAC 5CBAA 1JPSL 5TH2A 4BZ1A 1GY2A 1IGYA 1T5WA 1CFTA 1EEYA 2EIDA 4LGSB 4M48L 5EOTB 4BSVB 4JFDE 5EUKA 3P0YH 2H32A 2I07B 4Y9BA 4DK6A 3ZKXC 4QAWA 5IVZA 4YZFF 3TA4D 3A3YB 3ASWA 3B2DC 1JFQH 5L8JB 2ZUYA 1KOAA 5J13C 4HMEA 4X9IA 4J1UB 5BO1H 4FLOA 2K0RA 5EEWA 5IJCC 4FQJL 2E9WA 3PNWA 5I5RA 1G4MA 1UXMA 3F5WA 3AZUA 5HJ3A 4N9GA 1G1OA 2VXUH 4ATWA 3VDCA 2D2CC 2ZKHL 1QX1A 4IMLA 4R7LA 3DPBB 4QT5B 3RVXC 3AROA 3S3CB 3ZDZF 4AYEC 3UL4A 5CJOL 1J8HA 1RD6A 5LDSA 2V7NA 4M02A 1IBGL 2X9YA 3BFQG 4K3JH 3ABMB 4AXWA 1VADB 3FQUA 4LDEB 4X4MA 3SBPA 1AP2A 4ANUA 3PY9A 2NW3A 3BUQA 3H6AA 1UZ6F 4F9PC 2IAND 1LO4H 3VTTA 3GRBA 1IAOB 3ABLB 4PWEA 2FQFA 4H5SA 4MCYA 5IKCB 2G60L 2YARA 1HCVA 3CSGA 2LW3A 3GSOB 2CGRL 1IL1A 3PF2A 5D2NE 3U1SH 1YUHB 4QYOB 3MNDA 3KXFA 1QD0A 1I9RL 3T8MA 5C08E 1NWPA 2QSTA 1OSZA 4HD5A 3PREA 3ENEA 3O8XC 1V7NL 1VZGA 4POUB 5AW8B 1OGAB 1MEXL 1IVLA 4P46A 4YHPB 5F9JA 1QPKA 1F4WL 1JXGA 2OPCA 4G42A 5JW4N 2C3VB 3BGMA 3ISWA 4W4OC 3RGVB 2IOOA 1WWAX 4S10A 5E6IA 3ZX1A 4BZ2H 2FLRT 4AM0A</