1JZTA

Crystal structure of yeast ynu0, ynl200c
Total Genus 72
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
72
sequence length
243
structure length
243
Chain Sequence
LKVVSSKLAAEIDKELMGPQIGFTLQQLMELAGFSVAQAVCRQFPLRGKTETEKGKHVFVIAGPGNNGGDGLVCARHLKLFGYNPVVFYPKRSERTEFYKQLVHQLNFFKVPVLSQDEGNWLEYLKPEKTLCIVDAIFGFSFKPPMREPFKGIVEELCKVQNIIPIVSVDVPTGWDVDKGPISQPSINPAVLVSLTVPKPCSSHIRENQTTHYVGGRFIPRDFANKFGFEPFGYESTDQILKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of Yeast Hypothetical Protein YNU0_YEAST
rcsb
source organism Saccharomyces cerevisiae
molecule tags Structural genomics, unknown function
molecule keywords Hypothetical 27.5 kDa protein in SPX19-GCR2 intergenic regio
total genus 72
structure length 243
sequence length 243
chains with identical sequence B
ec nomenclature ec 5.1.99.6: NAD(P)H-hydrate epimerase.
pdb deposition date 2001-09-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03853 YjeF_N YjeF-related protein N-terminus
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.10260 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold YjeF N-terminal domain 1jztA00
3ROGA 2AX3A 3RTEA 3RO7A 3RTAA 3RT9A 3RRFA 3RTDA 3ROEA 3RS8A 3D3KA 3D3JA 2O8NA 2DG2A 3RSFA 3RS9A 3RSGA 3RU3A 3RRBA 3RRJA 3RT7A 1JZTA 3RU2A 3RTGA 3RSQA 3ROZA 3RTCA 3RREA 3K5WA 3RSSA 3ROXA 3RNOA 3RTBA
chains in the Genus database with same CATH superfamily
3G79A 1GAQA 2X2EA 3KUXA 5IP5A 3TAUA 3NVKI 1I2MA 2QM7A 2ASVA 3L7YA 4BC1A 1DUVG 3FBWA 1PV1A 4CODB 4OAOA 1M5TA 2D1FA 1SBTA 3SVTA 4DHWA 1MBZA 4YBZA 3ROQA 2PZLA 4CMJA 3CH6A 4OI2A 3MAJA 2B3TA 2FF7A 4R3UC 1UAAA 1IOVA 3D1LA 3HUEA 4FGZA 5TEVA 4HAWA 5AKZA 4TKUA 2ZE6A 4BV3A 4AMUA 3L6CA 2ECOA 2ODNA 1VL2A 4BXOA 1OJLA 2BGGA 3L6RA 1GAJA 5GTDA 3EZ6A 4PNPA 5HCNA 2PD4A 5D01A 1XRRA 4RTKA 1YV9A 2ET6A 1CX9B 1XTQA 2H9AA 4CG2A 3A06A 5REQA 4P0QB 2Z58A 4L5IA 4KYIB 1ZGZA 3HDYA 1TVMA 4GS5A 4LZZA 3H75A 2F4NA 1B00A 1YACA 1SKUA 2UUBB 5DIFA 4OATA 3JQRA 4R1SA 2C95A 5J1SB 4UMVA 3LX8A 2WTBA 4WY8A 5CW2A 4G86A 3GMDA 4HN9A 4EGSA 4GXRA 1TQ2A 5KOJA 4PQYA 4FZJA 5I8ZA 2LPMA 1HKHA 2W11A 3ZS8A 1JA9A 3TGWA 1Y81A 4A6PA 1YZKA 5CA0B 2C2BA 3QWBA 1OLUB 2XSZD 1O2DA 3BH6A 4HFNA 4IX9A 4UC0A 2IYYA 2B6HA 1XHLA 1TQ8A 2OK8A 5K0GA 1MC5A 1GPBA 3C8ZA 3D6HA 2DFVA 1BD4A 2IA5A 1MVOA 1IIRA 1W2GA 3ESAA 4O59O 4UUNA 4YH1A 2R6ZA 3OQIA 3OX4A 3X44A 1RCUA 2O3TA 4ZJUA 1XNJA 1GUZA 5AHRA 4XJXA 4MWEA 3N5CA 3IERA 4MDFA 2Q1TA 3HVKA 1JL3A 4NG4A 3ML1A 3VSCA 2O4UX 3TMKA 1FFBA 2HPHA 1FA9A 1RRPA 2O2EA 3CGWA 3H13A 4XVHA 1L4MA 2ZRBA 4CR8A 1EWVA 1XAJA 3WDLA 3TAXA 4ESHA 1X3LA 1QJ4A 2E89A 4KO2S 1JQAA 3WJAA 5I7EA 5AI5A 4Q4CA 3UKDA 1NIPA 1TGYA 1V26A 2AZTA 1XK7A 1XP8A 4Z4IA 2G77B 5HDBB 1JLRA 2A9QA 2D0DA 3ZD9A 1GGNA 2OZPA 3V2UA 1X1TA 2RMKA 1N2XA 3EGDA 3K1JA 1YBMA 3M1LA 1OLXB 4GX0A 3EWNA 2Y99A 3QI2A 2I33A 1J6UA 2G71A 2X8JB 3FFTA 4JEMA 4O2AF 4R9SA 5BN4A 3SKVA 1KXJA 2EV9A 2YJTD 4CUZA 1PR0A 2IBTA 3V8QA 4V03A 3RS8A 2IGBA 3R0QA 5CLIA 5BSKA 4DGSA 3ZWQA 3HVHA 2O7RA 1SY7A 3QX7A 3I1IA 3RC2A 4K1XA 5G4KA 1JFVA 4QO7A 5CFZA 5KYGA 3QEAZ 4Q02A 4B2YA 3BCSA 2XKKA 2UVPB 3W5AA 1YZGA 3MCAA 3BGDA 2G83A 4ND8B 1EK0A 1P1FA 1U1CA 2BRUA 1YOVB 5KYXB 4J4BA 3RJ5A 5A9TA 5A04A 1SQ5A 4FZVA 1JQ5A 4ZANA 4H3SA 5BSHA 1PVVA 1D8TA 3ZQKA 3RFTA 4WZBE 2V4MA 5F73A 2J7PA 5MFZA 3ZJYA 2R84A 5T4EA 3AEZA 3BFXA 2YN0A 3IHKA 4ZZ0A 3SYNA 4P4NA 3OKCA 4RE5A 5LYJA 2EJWA 3VPBA 9GPBA 1SWVA 5HGXA 3EPLA 4CIWA 5C1OA 5KVVA 3G8AA 1ESNA 3ENKA 1M2JA 2VH2A 3H6KA 1TUGA 5CVDA 1KJYA 1VKHA 4KNYA 4MQFB 1RI1A 2BCJQ 1G5HA 1QH9A 3FCEA 3HBFA 2PSEA 3ZE1B 5EZ5A 3ZZNA 4MQEB 2LIPA 3L46A 3B2QA 1DJPA 1Y7IA 4O2AB 2PMWB 1ULBA 3UMRA 3BL8A 2VYFA 3O4HA 1HT1E 4PLCA 1Z2EA 7AT1A 4PCAA 3QELB 4FOOA 3NFRA 4PGFA 1MOZA 1TF7A 3RO7A 4IDGA 1N3YA 1O97D 3H42B 3KOZA 3T8YA 2HUPA 3FI9A 1JHVA 4KLCA 3PA6A 1DKQA 1ITZA 2CXOA 3Q85A 1H5UA 4U2CA 3SX4A 1VIAA 4C0QC 1TRHA 3BXZA 3C4QA 3VHQA 2PZ8A 1KJNA 2G9QA 4XFDA 4BEBA 2XGJA 1YL7A 4NOMA 4J03A 3CCCA 1MUUA 1G98A 1L1EA 2MDTA 2H1OA 2BLLA 5E9QA 1ZA2A 1CD5A 5EZYB 5K05A 2YIJA 1CR0A 4RANA 4DW8A 3QYAA 5ALVA 5F9HA 4TZ6A 2FR0A 1NG1A 2CF6A 4MYRA 1YS2X 1W6UA 2R6R1 3DZIA 3H97A 4B32A 5EWLA 3THYA 2JFNA 2BKAA 1OFGA 3PC8A 3QK7A 3H04A 4BNYA 4DANA 3L1IA 3V33A 3TCNA 4IIXA 4DNXA 2O5RA 2EJUA 2ZXFA 1T36A 5DGCA 5AD1A 1JDNA 4F3CA 5HNKA 3LYAA 2V98A 3JZIA 5LDGA 5DCLA 1PD1A 1S7GA 2I22A 2Y1DA 1OB2A 2QLFA 3OJ0A 5JSZA 2BHTA 3QSYA 521PA 3VO2A 3OIDA 2ZK7A 1OXTA 2EWMA 3TDNA 2P9QA 3WOHA 4JQOA 4NQRA 1ARZA 1E3TA 1KWGA 1FFEA 1P60A 1TZKA 3CRRA 1QH1B 4LYHA 4RW0A 1ZVMA 3E7PA 4MI6A 3RK1A 1V5IA 3C97A 5E8JA 2HMYB 4BJ1A 4XB1A 3ZU6A 2YN4A 3CRVA 3IOBA 3QA3E 4JLPA 3ROKA 4BMOB 2OG1A 2G09A 4ZZ3A 4GBGA 3EFEA 1PR2A 2QUBA 5EKTA 1QKKA 4R31A 4EKNB 3MD9A 1U9IC 1LDEA 2X40A 4N49A 4ENPA 2J3IA 3SQMA 1VHDA 2PNFA 3ZWPA 1YNOA 4NMHA 2F1OA 5CFRA 1MXHA 2XUGA 4XGQA 4GR5A 4KXWA 3AUKA 1J09A 1V4BA 2VPYA 2XYQA 4G0NA 1RHMA 1A76A 1S3IA 2GK7A 3GP5A 3PXUA 4DCPA 1RYBA 2NSJA 4HWGA 1PR1A 3L07A 5FBVB 4MCHA 3MILA 2QU8A 2GKSA 4BECA 4AKIA 4AY2A 1TA4A 3QLVA 4Z51A 3K9GA 4E5VA 2BEJA 2ZIXA 4A10A 4QFCA 1U3TA 3DO5A 1AGXA 2HFKA 2RHLA 1H0KA 1AKVA 3H1BA 1JQBA 3NH9A 2H3EA 4GQAA 3SX0A 4CE6A 1XU7A 1NW4A 3AI2A 3GUZA 5JBNA 1E1DA 2ZQZA 1O4WA 3SAJA 3WYGA 4ARVA 2OHOA 4UW9A 4F8JA 4ZRMA 4BKRA 1QBKC 1U31A 4L9SA 5F21A 2RC5A 1UZMA 2B78A 1Y82A 4FOTA 3C3KA 4RD6A 5DP2A 3K6SB 1V96A 4Q4JA 1ZD5A 2UU9B 4ND7A 3KELA 1GPJA 5ALRA 1XQXA 2HA3A 3OP4A 2QAJA 1FLNA 1RJFA 4IDNA 2I3GA 5CVCA 3B8EA 1T2EA 4YXFA 1UK6A 5F2KA 1P19A 5FHRA 4CF3A 2HRDA 1G5RA 1SZJG 1TCUA 1U0OC 2A5LA 3KALA 1D2NA 4OP2A 3TPFA 4GPD1 3FF1A 4D98A 4UXHA 4EQ6B 4XDHA 1LPOA 2BWJA 3A10A 3K2IA 2VCEA 4DAOA 2AG1A 1IY2A 4PVCA 4RSRA 4NBSA 4ZARA 2Q5JA 4OY3A 2X2FA 2ACVA 4W7SA 2C7VA 1O96A 2VFAA 3D31A 1XQ9A 4Y2RA 5KAPA 4LJRA 1J8VA 1OWNA 3G2MA 2O7SA 5CFNA 1UODA 3P9QA 1ESEA 4P8RA 4EJ0A 3ZGOA 3RG2A 4IJMA 2JGAA 3O1HB 3VNBA 3TJRA 4F04A 1T1SA 2VNAA 2IEZA 1LWNA 4BKPA 5A4FS 1LFAA 1QF6A 3C6YA 2XD4A 1NQWA 4HY3A 1ODSA 5F1PA 3U4QA 4EPWA 1RE1A 1GXSA 1DWOA 1RHRA 1YB7A 2NO6A 4N0DA 3PUKA 1DT3A 4MWDA 4PFKA 4WE3A 3WIEA 2ANCA 2OENG 5CCEA 5TVKA 1QWOA 4CTJA 5I7OA 4GEKA 4PSDA 4CIVA 4JASB 3KQWA 5JPIA 5L45A 3ZVKA 3FCAA 1D09A 2VDVE 4QDKA 2AOVA 4ZT3A 1PSDA 1WMFA 2I6UA 3R3WA 4HDMA 3SFVA 2QRLA 3WK5A 4YAKA 1Y7TA 3CLUD 2Q1UA 4AK9A 3KPVA 4ODIA 4DLWA 5LLTA 3P2KA 2RSLA 4TN5A 1RWOA 3K4PA 1YZUA 3CVXA 2XOKA 2P0EA 1AHPA 2PGJA 4BU0A 5ABPA 2BFAA 2GZDA 2E4YA 4I4TB 5FADA 3KQUA 4A7PA 3L6OO 3LA6A 4E88A 3R5XA 4K86A 4I4NA 1K3TA 3WL4A 3QY0A 4D4LA 1GPYA 3ILYA 3KVNA 5GGYA 5SZHB 3BDVA 4GVLA 4ETNA 3KB2A 1NT2A 4PYMA 2RBEA 5JV5A 3KYCB 4IIJB 3FNRA 1E98A 4LGYA 4WQMA 1HSZA 3RVQA 3STWA 4E6EA 1P9OA 3V1MA 5F3WB 3QG5A 2W22A 5COBA 2QA5A 2KBEA 3FI0A 1PYOA 2WIJA 2BHRA 4JT4A 3LLSA 2IS1A 5EUCA 4LFAB 3U81A 2V6MA 1H4SA 1NP3A 2Z5VA 4V1CA 1YQXA 2QN8A 2YWDA 4BNIA 2ZR7A 3JQBA 4MYDA 1K75A 1JKIA 2OBFA 3GFBA 1CUFA 4BV9A 3MERA 2HU2A 3EDCA 4QTXA 2HA0A 1U5BB 1V1JA 4WA7A 3Q7RA 5JDIA 4M0FA 3DVQX 1R9GA 4TRRA 1CRPA 2Q2VA 5K51A 3UNXA 2XMDA 1HLPA 3LM8A 1R1DA 4O4IB 4MQ6A 5IDXA 2ZRGA 4YJHA 2LV8A 2QAGB 1NMSA 4IOMA 2UYYA 2RGWA 2RAVA 4YASA 4LDPA 1A9SA 2H2DA 1UDXA 4GRIA 2QQ5A 2WPNA 4MAMA 2FQWA 4PHGA 4V3CA 5IJZA 4GGOA 1S2OA 1ZH4A 4N0PA 2O50A 4YJGB 4B3BA 5H68A 4D4JA 1D6NA 5DXJA 3CF6R 1TZ2A 4YREA 1X1CA 2BE9A 3ANLA 3O3OB 1A9XB 1JAXA 1X19A 2JJ2A 4PSCA 3P4XA 5CT4A 1R0CA 3EEQA 4WCFB 1FP4A 1UINA 4CMIA 1CERA 2D5CA 4YAFA 4JYZA 1NXSA 3CF2A 4QTZA 3IJPA 2PR2A 5C4GB 4ARIA 2NU6A 3DLIA 5JEEA 1PL7A 3HB0A 2XUPA 3KQYA 4RD3A 5C8XA 4BX9A 3TEJA 3RC1A 1M66A 3BL5A 3GN2A 4AJEA 4D9HA 2VT2A 2FN8A 4PPNA 4KQGA 3PGA1 4LWOA 4IQ8A 4P32A 1BMQA 4FW8A 3K3PA 4BV8A 1FYXA 1IXRC 2JAUA 4YRJA 2XNCA 4RA9A 4F21A 3FKQA 4XGKA 3KVYA 3QHAA 5FP0A 3PJRA 1DBRA 2Q4BA 4C20A 4B4UA 3WGKA 1QR6A 4Q9AA 3GVXA 1D1QA 4OBEA 4NK5A 5ESRA 1OU4A 2P41A 4UZSA 1WDMA 3K31A 1A82A 3OLXA 3ZK9A 3DT6A 3RVMA 5ESWA 2M32A 4P54A 2K2WA 3H2JA 5BWLA 2ZSAA 5FHQA 3UFXB 4AU1A 2QXUA 2RG7A 1HGXA 1ZK3A 1W8DA 2JI8A 2ZCVA 4L2IB 3GH3A 4QFMA 1SKYB 3ZV6A 1FE8A 3OT1B 4E4YA 3VR4A 4CYMA 2IH5A 2H1RA 3F9IA 4MLPA 3KKQA 4M9CA 4KSBA 5AW9A 3VYWA 2ZWAA 3ZDFA 1FQKA 4FSDA 3A9TA 1KTIA 1GFWA 4RCZA 4ZJZA 2JASA 1T10A 3HA2A 5D3MB 4BCCA 3I58A 1ZITA 4GXNA 3L5KA 4B09A 1AB6A 3K6SA 1DBWA 1NE2A 1G6KA 2FW9A 4URVR 2PVSA 1BE8A 1XP5A 3D0OA 3U3KA 3C4JA 3F8TA 4O08A 4EKDA 2I99A 2JJMA 2ZANA 2CK3A 3H16A 2QTCA 1J7KA 3X2EA 3FPEA 4RL4A 2O57A 4MCIA 2VYQA 4NBVA 2O2ZA 4RORA 4II2A 5JCPA 1VYHA 4P6VF 2GPSA 4IW3B 2I91A 2C96A 1R0WA 1ZXXA 4L8GA 4MS1B 3RIGA 1HLDA 2YN2A 3ER6A 5E6SA 1IL0A 2W2MA 3TLGA 4AF8A 1SXJE 3EIQA 4HD8A 3R9KA 4G8JA 4HEA6 3EWIA 4MW9A 2C4UA 3K8OE 4M0CA 1CQJB 4BFYA 2VSYA 4ZOAA 4HMOA 1UANA 1NJ8A 4ZQCB 4HC4A 4DUPA 4RGQA 3DO6A 5ITVA 5EE5B 2NIPA 4HQOA 4HQKA 3SJCA 1PZHA 1U0NA 2CNLA 2G36A 5HBRA 2JFPA 4Q7EA 2CMKA 3JQ8B 4EY5A 3COJA 5CLFA 4ZVRA 3GVPA 1JTVA 3GEEA 3GUCA 2R5NA 5DULA 2V7QA 5KTNA 3SVLA 3NP7A 2NXWA 1G42A 1SXIA 2SICE 4PNZA 4Y2PA 3TLEA 1GPUA 2Q45A 4ITVA 1Q1BA 4LECA 4B9AA 1WD5A 4ZCTA 2YOHA 2OP1A 3PHHA 3NIWA 1J2YA 3CZ9A 1YRQA 4EG3A 4QUIA 5FPKA 1FSPA 4DWJA 4FOSA 3VH4A 4Z4EA 3MPUA 1M1ZA 3HB1A 1Y6QA 1DKRA 1C14A 3ZDRA 1K5GA 4CIXA 2NO4A 4B4KA 4IIJA 4KWIA 3ZNPA 1DTEA 1KNQA 2ADOA 2AG6A 1KMQA 1WVIA 2DUMA 4N6OA 1JTFA 3ILSA 4MVJF 1TU3A 2X15A 3DDWA 5E4TA 2JD1A 2F1KA 5CEFA 4V0SA 5FBHA 3K9WA 2WNHA 3QW2A 2Z2ZA 3BB3A 2H1IA 2QVBA 2P7IA 4YUVA 2WE8A 1U0RA 1NNLA 4MW7A 5U4QA 4IX1A 1C29B 1YI0A 2FSPA 2YIVX 3KZKA 2D74A 1DC6A 2QRVA 1GCGA 3JQCA 3LECA 4ZU6X 4NZYA 1C9NA 3BDIA 1IBSA 3A6FA 1FFXA 2IPNA 2X7JA 2G04A 4PIVA 2GK4A 2YOFA 1I6KA 3U5TA 2A78A 2YQ4A 1KOGA 1RZRD 3JWHA 2WT9A 2FDCA 1AG9A 4MKHA 1GUDA 4MGKR 5ICMA 2RHGB 5HWSA 2PLFA 1A9TA 2Z43A 2ZR0A 3TTSA 1SOUA 2IY9A 3NNNA 4ZQEA 4IIYA 2QT9A 2PS1A 3S2IA 1BMDA 1F9AA 4QOEA 3WB0A 1I6WA 2GXUA 5DYWA 1AB5A 4TGLA 2FMKA 4MUMA 2BMEA 4NZNA 5T6BA 3S70A 3DE3X 4L6AA 3TZLA 2OAQ1 4D0LB 5MGBA 1IC6A 4C4XA 4MR9A 1Z4KA 4X24A 4S1OA 3T52A 5E7MA 2NADA 3VXKA 4ES6A 2VCHA 2E4WA 2GCOA 3FVTA 3IPYA 4OXQA 2AUTA 3PFGA 2L42A 2OA0A 4J0QA 1AHNA 5BYBA 3MINA 4DJAA 2GM4A 1E3WB 2LIVA 3WQHA 1FQJA 4EG6A 3PTLA 2BGUA 1SCNE 4UU7A 4DNFA 5B5SA 4RS3A 1NPDA 3L1VA 2XVMA 1QG6A 3DEIA 4LF7B 2IVZA 1NRWA 3HKDB 3Q6MA 5DNYB 1IBCA 4WD3A 5IAAA 2V58A 5BRAA 3HCAA 1M8GA 4CN8A 3R6WA 3ZNQA 3KXLA 2Q0HA 5G0VA 1CQWA 3PNPA 5BSUA 2XWSA 5TEWA 3RU2A 1T26A 2X1LA 4HPWA 3IODA 5DN9A 3S5UA 1XBTA 5KWSA 4MV6A 5IVHA 1ND6A 1IBMB 1U98A 3AIIA 3R9IA 1Y7HA 3R4CA 1I24A 4JFRA 1N5RA 1WSWA 5CFMA 3K8ZA 3ND7A 4NAVA 1BDHA 2YXBA 3I6ZA 5K0NA 3VH2A 4GWGA 4LAFA 1FYWA 1OLXA 1PR4A 2Q3FA 5DEOA 4MV1A 2E6KA 3KWFA 3AINA 4K0KB 3B3GA 1DC3A 1CBUA 4LRUA 4RX1A 2ZJ3A 3HZOA 1THMA 2OCAA 4JUIA 3SR0A 3WLHA 3GFFA 4ZXFA 2BR5A 4UTXA 4YRNA 3FPHA 1FUKA 3TE7A 3RSGA 1E1CA 3ND9A 4D3DA 1MZVA 2HK9A 2BP7A 1KPHA 2NV0A 3C3EA 1ADCA 1JA1A 2AC7A 1UBTS 2WD9A 3COZA 3HH8A 3LP8A 3IR5A 4FI3C 1I36A 1AKYA 3RAPR 1ZI9A 4MP6A 4WLNA 1Q19A 3SM3A 4V0KA 1LK5A 4LJ5A 1QPGA 4UM9D 4AZ3A 5K8UA 3RTBA 4ZVPA 3L0DA 3NIBA 2NN3C 2ZTVA 4B3MB 3DMRA 3VJRA 4DA9A 2UXDB 3PRKE 2B8NA 4PG7A 1TM3E 2Q5CA 1CHDA 2UVDA 2VSOA 1M0EA 1SVMA 1JI3A 2YFYA 3IELA 4CGZA 2H6EA 2Z4RA 1A7UA 1W73A 1Z74A 2BFWA 2X0FA 4F38A 5H9VA 2FPPA 1OV4A 2QTNA 4X7MA 4CTKA 4DCUA 2B1JA 3EDQA 3K4QA 4R9NA 3U1BA 5DNCA 2OCPA 4TZKA 2BGRA 4G0UA 2JGMA 3TG8A 2ON6A 2O7QA 3DXYA 4YJ3A 5LA6F 3N05A 1FUIA 3L5OA 1ML3A 1CTQA 3IJRA 4KZKA 1C9KA 2XA1A 4MA4A 5DI9A 4DMCA 2GN4A 4DDTA 3UBTA 2ACKA 2V6FA 2Y77A 6NULA 2E87A 4D80A 3FPCA 3KQTA 3AVQA 3CEJA 1Q16A 4YRMA 1DIRA 4A3SA 1KY3A 4QE3A 4OK6A 1TADA 2FMIA 5KREA 4GKVA 4HNRA 3BTSA 4KQHA 3DLBA 1S8NA 4ZVMA 4RVDA 1NMZA 2IOFA 3GX1A 4KVAA 3ADPA 5DF1A 3FKJA 4BVKA 3IR7A 4B4WA 3K70B 4IH1A 4JJFA 2OLJA 2XUDA 4BZXA 4YMWA 1V8OA 1UBUS 1NAIA 3GEHA 4D45A 3JTEA 3VOAA 2OD9A 2R8XA 5IJ0B 4XVRA 5JS7A 1FU8A 2PU7A 1PFGA 1Z29A 2X4DA 2Y0BA 4KOAA 1TUBB 1TT5A 1FB5A 1U8UA 3K5PA 1I0IA 4MINA 1TK9A 2CXQA 1R0KA 2FGKA 2Q4OA 4GOJA 1MOQA 2QG6A 3CBQA 3P4UA 4X0EA 4Y2QA 5LQNA 2FEWB 4HG2A 3T4UA 3T1OA 1X0VA 3NYRA 4C07A 2HCTA 2V5UA 4H9GA 1NG9A 2OO5C 1R7RA 1QDLB 4ENVA 1CR1A 2W2KB 3VPSA 3DMPA 4C4RA 5AVUA 3N0TA 3QU9A 1FW6A 1OZAA 2MU1A 3GGJA 4WECA 4LRXA 4N0QA 2GT1A 2NUPA 3DP7A 4UBNA 3A05A 5AXCA 1KAOA 1KK2A 1PD0A 4IQFA 3RI3A 1BW9A 3CRZA 1U7OA 2OB1A 3IP3A 4FYHA 3KSZO 1LZLA 4BIMA 4NYMQ 2XXAA 5LKAA 4C4YA 3NTQA 2F8SA 3QKRB 4BB9A 4EG1A 3AUTA 4LJYA 3M5DA 2JFGA 3JD1A 2J32A 4LC0A 2HSWA 2R47A 3AUYA 4HXGA 1J7JA 3KLBA 4G5RA 2JFQA 4HAOA 4X20A 1OMOA 2UYGA 3JQ7A 4JP5A 1G20A 1V16A 1IOZA 4OIFA 5K4AA 3HY3A 5IW8A 5AK4A 3VSEA 4E1BA 4YWJA 1RW4A 5AVJA 3E35A 3WLIA 5F5XA 3K35A 1IN4A 3ANMA 4OQFA 2VS1A 2HGZA 5ILGA 1J8MF 2OQVA 3ZZ0A 3IMGA 1F3OA 2PJZA 3HUTA 2JEOA 5K01A 3IUSA 3L4EA 2BR4A 2H52A 2JW5A 1X6VA 2FWMX 2ZWIA 3BBLA 3ZH2A 4KACA 4L74A 1WZNA 4D96A 4RTQA 3F1LA 2CV2A 3K71B 1YR1A 1USIA 3O8QB 5IAOA 2PE5A 3AFGA 1Z6GA 4ARZB 3VYVA 4BQOA 4FXOA 4O4IA 3B7PA 3A7DA 2I7CA 3OCVA 3F5SA 2X77A 5U9CA 1NUSA 4I6EA 1R8YA 4E2ZA 1KORA 4R6WA 4PYIA 4PX5A 1VPDA 2JGKA 2B4KA 1WY5A 4ZOBA 5HRAA 4WLVA 5EIHA 2H59A 3ELUA 3RS4A 4G5HA 1CUJA 1JAHA 2FWAA 1T9ZA 3PI7A 5AVTA 1E6KA 2PBFA 5AVKA 3UMVA 3LVRE 3R3UA 1EQAA 1I9CA 1H6BA 3OM1A 1E4OA 5K0ZA 4IY1A 5M29A 2XOKD 4DXAA 5JJCA 4RS4A 2VT7A 3BMCB 2EW8A 4DXDA 1CUCA 3TNYA 1ESMA 4AM8A 3OTIA 4TWZA 4IAOA 5E1OA 2IUTA 4RPJA 1Q22A 4E5PA 4BKOA 3GEGA 5AW2A 3TSYA 1ABFA 3U60B 2FX5A 1QQAA 4H7PA 4QASA 3RBXA 3GZNB 2CHGA 1HMYA 3IDFA 3LC2O 5FUVA 5JC8A 3V4OA 5DTMA 4IKOA 2C9BA 5CNKA 5A05A 2F1JA 1O54A 4BO2A 4K9KA 1T2DA 4NOJA 1WZUA 1SB8A 3HLTA 3OQVA 2J6HA 5FOXA 5HZKA 5I7VA 5EWMA 3GNLA 3I92A 5JECA 2PL3A 3AXSA 4ZJYA 4G01B 5ALFA 3RTGA 3W4IA 2HSGA 4ZP1A 5EIEA 1DB3A 4DC0A 4LJ7A 2FOLA 4N3CA 2AFHA 3JZFA 4N5IX 4LYEA 1EP9A 3F73A 5IH7A 4MQUA 2YWGA 5THXA 3GLQA 3LX4A 4KQ6A 4WI1A 3ZOKA 3P2EA 3SYKA 2QZPA 3FHLA 5KOJB 2O52A 1ODCA 3GVIA 2R1UA 4L2IA 4P58A 4CR6A 4E5KA 3UJ8A 1Q5PA 1UM9A 3EMVA 3NIDB 2IZ0A 3JPWA 1J0BA 1F6DA 2ONYA 3HPRA 5BR4A 2OBMA 5TDHA 5DB4A 4BRUA 1XO1A 4FE7A 2JCVA 1NVXQ 3GXBA 4B2IA 1YRHA 4AYTA 4IH4A 5LIPA 2VKQA 2C2YA 3WISA 4QJ5A 2HJ9A 4DLBA 2JS7A 4QGSA 5D3KA 2WJ3A 1MXFA 3GH1A 5IWCA 1QHIA 1I1OA 1YQUA 3HJNA 4KAJA 3C1AA 4YI5A 1Y3BE 2JI4A 1R0RE 4BLUA 4EVSA 5INTA 4Q18A 4AJIA 1INLA 2H00A 3DGEC 4R69A 2WILA 3PHCA 3TIIA 1U3WA 3VZDA 2R0QC 5ALDA 1MJGM 5C2JB 5BY2A 1WSDA 3WVNA 2AOTA 1M2VB 2PX3A 5KO2A 3K53A 4U0JA 2WJ6A 4Z2AA 1I2BA 4FZ5A 4GZMA 3HJFA 1CVRA 1EFVB 2C54A 2XUQA 1XRNA 1M73E 3V2HA 2VBIA 2QTVB 3RV3A 2HF8A 2IYTA 3NCTA 3MRTA 1J07A 1P3Y1 2DG2A 3F5FA 2HR1A 1ZW6A 3GLGA 1GCOA 3GLFA 1YO6A 1R5NA 4WX2B 4DLNA 3ST7A 1FMTA 2A9VA 2O1SA 3FVRA 2VSFA 2YJ4A 3GEDA 4TUYB 1PKXA 3JRXA 4UUMA 3Q9SA 2Y1GA 3HBMA 3HU2A 5EWMB 1KOLA 2WWVD 3RR2A 4KNWA 2FR8A 1G7RA 1MRZA 3F6CA 3P27A 5KYUA 1P2BA 5DHQA 5F4BA 3NYWA 3RM3A 4EMTA 5C35A 2XCRB 4KQJA 1I10A 5BQOA 3JXEA 1JVNA 1TCBA 1HE3A 2R7MA 4BQEA 1G18A 2FKNA 5KTPA 1EXVA 3OF5A 2WHYA 2ZIGA 3EHEA 4TM8A 4N9QA 3DBOB 3CEPB 4X84A 3W2TA 2PMDA 2FF5A 3LK7A 4JLAA 3TD6A 1DO8A 2FSVA 4UVDA 3EWAA 2XQGA 1N6KA 3AF5A 1Q0SA 2ZYWX 3GRZA 5GJBA 2GF0A 2Q3LA 4AW9A 1T24A 3HP4A 4L7QA 4CMHA 3Q8LA 4QDOA 3KKNA 2JFWA 3CSSA 4URYR 5D7BA 5F1YA 5LLSA 3OC0A 5HSGA 3THYB 1ZCFA 2OQRA 4HQLA 5C4IA 5AM2A 4C2AA 2JKZA 4OHBA 2FAXA 2YVKA 4BC0A 3I37X 4B3CA 3GLIB 4MUJA 3V6LA 1II9A 3L9XA 3MLBA 3G7SA 4PQRA 4F45A 2GEFA 5IJ9B 5EY5B 2H31A 3D4IA 2GK6A 2JIMA 3HBAA 1ILEA 4Q3LA 5KOHB 3JU3A 2WNIA 1OX6A 3BK7A 3NWBA 3I8OA 4PZDA 1MAVA 1DXQA 4XYGA 4AWXA 2QLTA 4GPZA 4XXHA 4TUYF 1NOJA 1NV8A 1VE3A 3AW8A 4X9XA 3W77A 2NP7A 2JFUA 3GAZA 4D26A 1VOTA 3FIUA 4DQVA 4OFBA 2CFOA 3I3SR 4HV4A 1H65A 2CBZA 3KLOA 4RTLA 1NF2A 2GQ0A 1TEHA 2HADA 3E5MA 3UK2A 1K7YA 4I8XA 4BO8A 1JP7A 1QCDA 3NWEA 1UJ2A 1XMIA 2QENA 1BDBA 4UKDA 5LC1A 4C4OA 2H9IA 1U7ZA 3VYUB 1ZH2A 4Y2XA 5AKYA 4D9CA 4DV6B 2CUKA 4S35A 1NNSA 1KYVA 2V55B 4Q3KA 5C7OO 2WD7B 3SI7A 1QB8A 1XAHA 2V7TA 3HN7A 4JA2A 5FBWB 1C0KA 3WAKA 3H17A 5ESDA 4KREA 1OWMA 2WMDA 5E0KB 4WEOA 5LU9A 4B71A 1XVLA 2QPAA 3RF7A 1GVNB 3NOVA 1NTOA 3TBKA 1JIJA 3LFUA 2I3DA 3P7MA 4GP6A 4R8VA 5EHNA 4A36A 1ZHFA 3ZY4A 4KVFA 2ZVQX 4OJMX 3VOSA 1WO8A 4AICA 1IPHA 1DIAA 5HRCA 1W0CA 1DOHA 1Z26A 3D0KA 4JQCA 5DNEA 5IDWA 5AQ1A 5A4MS 1UKCA 1RWNA 2ZUBA 4N7MA 4UMEA 4WKNA 1UKZA 5F7JA 4HYTA 1KP2A 2RGDA 3W8RA 4C08A 5IT9A 3BWDD 3OEED 4RK4A 1MTOA 2ST1A 4N01A 4MRAA 4W1QA 5CTAA 2X1VA 3MOIA 1Z0DA 1M8FA 3CYFA 4ZREA 3UOAB 4BATA 1Q15A 1M33A 3M4YA 3ESYA 4OXRA 1XNGA 5K3AA 4RKFA 3UWKA 2WSMA 1UEXC 3MGBA 2HPVA 3NHAA 4W9NA 5I8PA 1G63A 3ENQA 4IBOA 4ZOLF 4MA5A 1GITA 5CX1A 3HCBA 2C1EA 3I5AA 1LNQA 4LDAA 2A35A 2JJ8A 4FFRA 5HJEA 2YXLA 3AF4A 1ILWA 3QNMA 5LCXA 3V1LA 4G0WA 3C3PA 1VLQA 2YCLA 3BMNA 4HS9A 1X1RA 3GQBA 4ZWNA 5DI3B 3KZ1E 2RGYA 1KP9A 2JCGA 3V4VB 1L6IA 1SXJB 3FW1A 4Y2GA 3WGVA 4FSXA 2BDEA 4QHSA 5KQGA 4BNVA 4YV1A 4DWWA 4Q9LA 4EO7A 4XQEA 1XZAA 1CIPA 4U6QA 1QVZA 2QE7D 1RPZA 4ESEA 5KJ6A 3JAMA 3TUJC 2JLAA 3OZXA 1VI2A 2X3FA 3L05A 1N0VC 2CDRA 3NB0A 1SUCA 1ZU5A 1PJTA 3AV3A 2D13A 4P4GA 3TFQA 1KRHA 1YH3A 3IHLA 3AVPA 5BUCA 2D7DA 4H7FA 2XWBF 1RT9A 2C82A 1NF3A 2V6BA 2YJZA 2AXNA 3N2IA 4DR2B 3A6GA 5K03A 1ZM3A 1E4EA 1RFGE 2W0MA 4G63A 1EXNA 1ZSVA 2CLEB 3I9KA 4LZWA 3AETA 3TEMA 3DLHA 1EJ0A 2BZ0A 4Q9NA 4HZIA 3SX2A 2WF7A 3O4VA 2AG5A 4DSOA 5JAUA 2C5HA 2WM3A 3FRJA 3G5LA 1M7HA 4J0JA 5D84A 5TPZD 1BGXT 1YVPA 1Q1NA 1TM5E 3G2HA 4IHJF 2QG9A 3ZE2B 2IEIA 3PGVA 4UFPA 2NZXA 4YMTA 4MV9A 3U44A 3GF4A 1DLJA 4TN1A 2GXSA 1T6NA 4QXOA 3V1TC 1EH5A 3RYTC 3EDYA 5JVDF 4C4PA 4HATA 4OBWA 5B30A 1SZDA 1K8QA 4YRRA 2NQ8A 3Q8WA 1VPVA 1FXSA 2ZJ8A 4N5LA 1BRTA 5H3CA 3HU1A 2B94A 4KXFB 4QYSA 4RYDA 1ENPA 2VJPA 4P4SB 5EIWA 3RAJA 4HVLA 2YL2A 2HF2A 5KDLA 1AMUA 1OAKA 3BXPA 1E5XA 4L76A 1SHKA 1O94D 2BC9A 3B78A 4R0NA 5IBCA 1JFFB 4ZHQA 1G8PA 3AC0A 3SBEA 1BHO1 4U2FA 2Z1NA 2Q5EA 2W4QA 3C8MA 3FNFA 3PFWO 2FN9A 1IN1A 1LVHA 5C1BA 2O1WA 3MXTA 2QJFA 1FYFA 2HBYA 2IP4A 4NH4A 2EQBA 1LJ8A 2OPBA 4TVOA 1PT7A 3T7CA 1WQ1R 1UC5B 4BVLA 3E05A 2CJYA 3HBLA 3SHWA 4P0TA 3EK2A 1G2OA 1GXSB 1ULAA 4K1LA 1Z08A 5ICFA 1LXCA 5KQSA 2F1IA 2VCYA 1DIGA 1GQYA 3EGWA 3PJGA 1BN6A 2AMVA 2C2WA 2J3HA 4L5CA 4LQ4A 3JQ6A 3R7NA 1WS6A 3DF7A 4AWBA 2Z5LA 4D8WA 4QJ3A 1ETHA 2WUWE 3OJEA 4Q4DA 5JZMA 3M6UA 4LHZA 4WKOA 4DDWA 1KDPA 1T13A 2J3JA 2Z0MA 2CKDA 3ET5A 3QXXA 2CLMB 3MELA 5JADA 4Z5XA 3GLHE 3R6DA 1VGRA 1TTTA 2ZRIA 2EJVA 3C87A 3DAYA 4FHEA 4RIEA 3W2FA 5JWRA 5DISB 1K66A 5BWNA 2MSCB 3IUPA 3LWBA 2AF3C 2C29D 4AY4A 1DWQA 3OQ6A 3DM5A 4KMRA 3WMFA 3V3KA 3H4TA 4D9IA 4ZU1X 4Q7MB 5LBUA 3NH6A 3HYRA 4CV2A 1BS1A 2R751 1J5XA 2NLOA 2Y8EA 3QP9A 4QBGB 3ZBTA 1U1DA 2QY9A 1EYZA 3BM5A 3CU5A 3TL2A 5LXTB 4OQPA 1ADFA 4PX9A 4Y6QA 3I0MA 2V59A 1EKXA 2RHJA 4XASA 3W05A 3FUCA 3ZGYA 4OQDA 1JA0A 2H2IA 5DX0A 2VLIA 2Z8XA 3NNDA 1LBQA 1T8RA 4H7IA 1OX4A 4KSYA 5EERA 5KAMA 4MGIR 4ARZA 4CMCA 1XPRA 3O4JA 4AJOA 2HIAA 3W9YA 5HIAA 1SVOA 4I1OA 5DGIA 1GG8A 3NOQA 5LYJF 2DUNA 2FLVA 2ZBGA 3ABZA 1BTOA 3EGXA 4N7RA 2EL7A 1O1YA 4PZ9A 3M4NA 1KFCB 1E0KA 1USVA 3CBGA 1YE3A 3CNNA 3KZXA 3QUSA 4Y0NA 4BWYA 3MAAC 3S1AA 4Y2UA 2QS9A 2QTFA 1ULZA 3EXHA 1NUAA 2H5LA 2YX1A 3OJXA 4ENTA 1E2DA 2X5KO 3UAGA 4D1YA 2V8OA 2QEQA 3DUFA 3K6JA 4YCBA 4Z54A 4CEHB 2HV9A 1R8JA 1L8XA 4FINA 4WAUA 3KKLA 4DY4A 3TNDA 5CVTA 9ATCA 4MPRA 3KYBA 3O3MB 1E1NA 2PUGA 2QAGA 3SXJA 2CB9A 2C8VA 5LM3A 1FQOA 2XH8A 4FC7A 1L4GA 5LP6B 2AZXA 4B34A 3PLNA 4QKQA 2YJ3A 1M2OA 3GRFA 3I39X 5F3RA 3TM5A 4EB0A 4OQXA 1TW2A 3H2KA 3HCRA 4I2VA 5F9MA 2GTHA 1SJ9A 2PVCA 1F14A 4PU0A 2QAGC 3FNQA 4PO1A 1T1JA 3Q0TA 4C7OB 2UYHA 5J40A 1LH0A 1JNYA 1ZD9A 5FFMA 1HNWB 3C3BA 5A03A 4JP1A 4PXYA 3QRWA 3ZE9A 3E3MA 3AEUA 2QLJA 2V96A 4PZYA 5JFOA 4H6VA 2P9BA 3SICE 3F1KA 3IQIX 3OG9A 1EUCA 3C7TA 2H5EA 2QM3A 3LS2A 4D9BA 2QRVB 2ZI5A 4G1EB 4ZQBA 4Z7NB 1P9RA 1MKYA 5KBYA 4EJFA 1XCGB 4W1SA 3DTYA 3HLKA 5FUBA 4OHZA 1MB0A 1U7TA 4G9GA 3HACA 3UM9A 3RODA 4G1BA 2JGNA 4CRWB 4LZJA 4KRFA 3EA4A 1HZZC 3HCCA 1R0YA 1Y9EA 3LO8A 2ZDGA 1H9CA 1GDTA 3HSSA 4DGQA 2Z9CA 3BORA 2QMYA 3FYUC 4Y7DA 4PBSA 3RS3A 3I6BA 4PBTA 4F7DA 1I30A 1DTWB 3TRDA 1KQNA 2W83A 2GPWA 2BFOA 2EG5A 4RVFA 1PYGA 5K6RA 3QH4A 1CSEE 2BLNA 5E9WA 1Z7EA 1ZQ9A 2HRZA 3S1AB 3TW8A 1WWKA 2CJXA 4OMCA 2BUBA 3DG9A 4ACAA 2CNBA 2XWQA 4Q1VA 3AVVA 3GJ3A 3H5RA 2XNDD 2GHQA 4TKLA 3N8DA 2AC2A 1O0BA 3NHJA 2NWQA 3IVRA 1PHRA 1YS4A 5A2GA 2ZQ5A 4LYGA 1FDIA 4OG2A 3D8NA 1Q1AA 3C48A 1TU0A 4JR2A 2D2EA 5DWQA 2AN9A 3SZUA 3EH2A 2F64A 2F6RA 3IHWA 2UUPA 3IT1A 1N2CE 3L41A 3I5XA 3GJZA 2G40A 4NTZA 1U11A 3TUIC 3BIOA 1U9YA 3ACDA 2X9QA 3KHTA 3ORFA 2QW8A 3T1NA 2GHRA 2X41A 3CEHA 3DE7X 1E3QA 1UBJS 5B3KA 1M2WA 1MFPA 4I9HA 1RRCA 1BVHA 4L6CA 4DIEA 4C4AA 1NWHA 1M2NA 5CA1B 4IF6A 1U99A 1F20A 1ZVVA 3F74A 4Y2SA 1QZUA 4HRYA 4YT8A 3SXPA 3KSBC 4AP5A 3OMWA 4JDPA 3HO6A 3V8BA 3MQ4A 1U81A 1YU9A 3IS3A 4HDNA 4OPMA 5FBRB 1QBGA 4WBSA 3T7RA 2FH5B 5AESA 3UIEA 1OF1A 3PYMA 5AVVA 1SEPA 1CEEA 1ZI8A 4BWGA 3AR6A 1RWBA 4AZ0A 2POCA 3C3JA 3DV2A 4RZXA 1IVSA 1BYIA 2VJMA 1YJXA 1YHNA 3EXIB 4NYIQ 2ZIVB 4M21A 4JBNA 2IP2A 3VI3B 4J7UA 2DH5A 3EG5A 1SK8A 4JLKA 5REQB 4HAXA 5KTRA 2QQ0A 1UAGA 1I1QB 4MGYR 5LSAA 5JD6A 4YWHA 5E38A 5ALEA 2GVZC 3NAQA 3H9UA 4RPGA 1CUSA 2HSJA 4UDXX 4Z8XA 5HCIA 3NC4A 1LK0A 1S89A 3QOXA 4LBWA 1IXZA 1H8HA 3D5TA 4XGRA 3HNOA 4M8LA 3WBFA 3U48A 3RKRA 2JLUA 4X3OA 2FW1A 4BLWA 5CH5A 2PANA 4XA8A 2CNNA 3WB2A 4QM6A 1JG7A 2ORED 3TIXB 5J4HA 3KJNA 3V4ZA 3RC7A 1W30A 3O8NA 4F60A 1E1QA 3T61A 4HFMA 4H7KA 4J1QA 1MJ5A 3RVLA 3T6KA 2Z1MA 5KMGB 4LSMA 2YDYA 3DS8A 3Q3GE 1NXWA 1BXKA 1SC1A 4ENUA 5JSKA 3VC7A 3FNEA 4FGKA 4IGEA 3SQWA 2BT4A 3FBTA 3CRMA 3TE6A 2RAPA 2XQIA 2B5VA 2QMEA 4MWTA 5EJIA 3P0RA 2IU3A 4LVCA 3IQHX 2LD4A 421PA 4AT1A 3FCOA 1RWPA 3IVAA 4YP0A 1ZFNA 1K0FA 3VYSB 4HPJB 4EG7A 3UGTA 1ABBA 2PA3A 4MLCA 1RHKA 2RE8A 3HLYA 3O95A 2Y1XA 1TUBA 3ICEA 3WL8A 3B70A 2G70A 2N3ZA 2RJNA 1ZD4A 1YBVA 2JAOA 2XW6A 3A6KA 4C01A 1A5SB 2C7QA 4FDMA 3R3ZA 4U3JA 5KKNB 4TXMA 3GUHA 5JAHA 3HNPA 3G8BA 2CGEA 3CUYA 1K4YA 4MI1A 2FZLA 4IGKA 2ANBA 1E5LA 4FYWA 4YA6A 4C3ZA 3DUFB 3ITKA 4XOUA 4HLDA 5AIBA 5IUNC 3P5SA 4CKWB 1VBNA 3QXJA 1VMEA 2EZ4A 4MMXB 4IMRA 5JO9A 3LUHA 3UTDA 3N7AA 3PDHA 5B1DA 1IIBA 3TFWA 5IXSA 3QENA 2J4DA 3DAGA 4Q1EA 5I4IA 4AWAA 1KEKA 4P2GA 3OUUA 3EVDA 1NZFA 1WMEA 3MLAA 4C76A 2H7CA 1H3FA 3IURA 5HOQA 1O95C 3DL4A 5LL6P 1HR0B 4GMHA 1RJ9B 3JZAA 2HT6A 3MWYW 1FYVA 3DL0A 1X2EA 3FUWA 5EA2A 2P2ZA 3Q10A 2A2ZA 4MNTA 1U63A 4AN0A 3H2ZA 3PEWA 1EX1A 2HJGA 2JJQA 4PF1A 5GP1A 3LVFO 3A2LA 4JL5A 1ZVQA 4F97A 2HCFA 4GSKA 4LOHA 2H48A 1L5OA 1EUDB 1DWPA 3C74A 3I53A 5DXFA 4M9ZA 2DM6A 1IEVA 1BOOA 4U9IS 2EC5A 3U4QB 5H16A 1XL0A 1FRVA 1SCDA 2AJCA 2GEBA 3RS9A 1GZ3A 1KVRA 3BRCA 3CRQA 4Q4HA 1BS9A 3B7GA 5A5VA 3L4BC 5K3FA 4B40A 1N2IA 3ROZA 1IJFA 5A06A 4KR3A 4OMUA 4BMSA 1E1YA 4KIWA 2VOEA 3ZHYA 4G4SP 4F3TA 5EZYA 2D1YA 1DMRA 2DFPA 1FJXA 2Z04A 2R6HA 4TQUS 3UZUA 3GJRA 1PO7A 4UEJA 2IPMA 3U7JA 3PWKA 3C6ZA 4NPCA 1JX6A 1IQUA 2J48A 3AL2A 1GPNA 4TWBA 3T7EA 4INPA 4LDRA 4LOLA 1V0JA 2DWUA 1JMYA 2WFMA 2G0NA 1O89A 1RFLA 3CSUA 5BPFA 4IGFA 1V5WA 1DHTA 2Z8ZA 1E2BA 3HJRA 2BMWA 3IE0A 3KLMX 4P81A 5IRCD 4S1PA 2GCIA 4JT9A 1XZIA 3U2QA 5I9NA 2ZJZA 3F4KA 4E1VA 4XUGB 4JXZA 1UMBB 4LI0A 1T2UA 2XIQA 3KQMA 3LNCA 1WU8A 2C4WA 3FGZA 5FR2A 4OHMA 2P1RA 3AJ9A 1T8SA 2OZEA 1RRGA 1L8QA 3CC8A 3NYIA 1WB4A 4ZCMA 1GD1O 5AVSA 4AYXA 5EYPA 4MEAA 3OE1A 1XJ0A 1XCBA 5DLYA 1N6LA 5JNVA 3V55A 1PG2A 4URHA 4S04A 3VPAA 2M6SA 1YZLA 2AR7A 1SBCA 3OTQA 4HWOA 1U5AA 1XMJA 3MCWA 4ZIRA 5AJYA 1XMXA 4DMRA 7MDHA 3U13A 5K3EA 4LY3A 2PQ2A 2JGEA 4WJLA 1JEJA 4XIFA 1Y1RA 5CHEA 4AQYB 1UKVY 2DB3A 4KXUA 3TB6A 3WY9A 1TT5B 1U7XA 3K4HA 4JY7A 4B4VA 4EUKA 1SXPA 2W2PA 4KQFA 2GI4A 1NVVQ 2PRSA 1E63A 4UNSA 4KE6A 4AURA 1PJQA 1ECGA 4HDKB 4DZTA 4AY6A 4MSUA 1VSQA 5ADUS 4ZCQA 1CR6A 4L8LA 2ZPUA 1C9DB 3KT3A 4MUNA 3Q3HA 4RLSA 4D6YA 2G4LA 1VSUA 2GNOA 1EDOA 2GMWA 2QM8A 2DHEA 3GNQA 2B34A 3U3JA 4TTAA 3CNEA 1N6HA 1UC9A 3QBTA 4ZC1A 3BMOB 4GPEA 1E5TA 4FNMA 3PUYA 1J21A 1WUHS 4TS3A 3EZFA 2VPZA 3NV7A 2MIIA 4DMUB 1A9ZA 1IN7A 3O83A 4LYYA 5CITA 3FPKA 3R3SA 5BVGA 5KQRA 3KZOA 1XXHA 4LNUA 4AI6A 1A9OA 5ELMA 1F0YA 4AF6A 4OB6A 2E0IA 2C0CA 1YDFA 3D81A 3NNSA 1F8GA 3DKPA 4K6HA 3GWZA 4PLFA 1UWKA 4CMEA 4JWKA 1AH2A 1OFUX 3M2TA 1RHJA 5AM0A 1MQAA 3JQ7B 3M81A 4A16A 4EW1A 5BNWA 2OP0A 1CFJA 3GFPA 3A3PA 4ITRC 3QPAA 3V8PA 2JLRA 3OHSX 3WNQA 3CUKA 1OSNA 5BT9A 3BJMA 1WCIB 2X9VA 3C5VA 1WD7A 5AFSA 3HABA 4Q3EA 1AJEA 1PJ8A 3BYZA 3U0VA 4RJIA 5AI0A 1OFHA 3UGKA 3GLFE 1E9AA 3HJUA 3RJTA 2GCNA 5EAIA 2FMFA 1VA4A 3NHUA 1KSJA 1WSAA 5C5DA 4O4JF 3RPEA 3ZVMA 1JEQB 1M67A 3KV1A 4AJKA 1YS1X 5DHAA 4M1WA 2GCEA 3AWIA 3W6ZA 3AU8A 1Q95A 2C57A 5DBEX 3T95A 5AXBA 2YCBA 3ZY2A 4DEXA 1UM9B 3LIPA 2HGSA 2ODAA 3V34A 3WGZA 2JJ2D 2QTWB 1XKXA 2KPOA 1LDGA 3CUTA 3EA0A 3O3CA 3S2YA 5J4LA 4G4SO 3ZTYA 3E1GA 3N70A 1V1MB 5JYDA 3CXRA 3THSA 1TMYA 3SCZA 1SRQA 3LHSA 4BVEA 1XYVA 4X8OA 3TB4A 3VGJA 1X8JA 4B3XA 2K6GA 1Z3IX 2ZYRA 2E4XA 1NXPA 1M1YA 1VMDA 1VPTA 2J41A 2QYTA 4WXHA 1PS8A 3OO1A 2YBDA 1SQ6A 3MS2A 4P93A 1G16A 5AJHA 1UMCA 3X1ZA 3U7GA 4KQEA 5KDOA 2YZKA 4NV1A 1Z62A 5AVOA 3S40A 5JPDA 2VATA 3K9LA 1G6OA 2F1HA 1V8BA 2II6A 2XF8A 3FR7A 4IICA 1L1QA 4XDYA 2O2DA 4JVLA 2Y0CA 1RQXA 3P1JA 4CKZA 3C6BA 4BP8A 1XZJA 1Y8CA 1GFSA 2I2FA 3HDGA 1EVIA 3VR6H 4X71A 1XJWA 3TDKA 3K0CC 1VB3A 3FB1A 3OZGA 2PV7A 4A2CA 1R3DA 1SZCA 1Q77A 1QFJA 3M3PA 1ZKMA 3QA9A 3HCNA 3SMQA 3ZG6A 2GN1A 3L7KA 4DLLA 2RH5A 3IUBA 4YAEA 4QYXA 1Z6AA 4YRLA 1DAOA 4RV4A 4AKEA 3OY7A 2PZMA 3NHWA 1Z4JA 4BNJA 4P33A 2VQDA 4XPIB 3G2QA 3DHNA 2JJ1A 3FB4A 2OV4A 3GJXC 3ED5A 1QAMA 4PLTA 3TW8B 2Q50A 4CLXA 3FAZA 4POOA 5A4DA 1OZHA 1GTJ1 1AQJA 3NXKA 4JI7B 2SBTA 1T6ZA 3B38A 5LOVF 1HDZA 2OUKA 1F5NA 1GQRA 3HUUA 2Q6KA 4LYJA 3CUWA 4I9NA 2VWQA 2JA2A 2G8NA 1JQKA 1B26A 1M8JA 1QOZA 1W88B 2W6OA 3D43A 2DPGA 1E99A 1MO4A 1LWOA 4P3OA 2HQ1A 1AZSC 5EJ4A 1NXVA 4NY1A 4Z99A 2IZ7A 1WVMA 2JLVA 1ZOLA 3M83A 1NBOA 1DFIA 2QIOA 2W2XA 1E2UA 1UK9A 1L7NA 2WWFA 3AG5A 4JT2A 3VX3A 1MH1A 2HCBA 4EAQA 4Q82A 4Q7KA 2E4ZA 5FTMA 1FYDA 4RK6A 5J2TF 5AW3A 1EGQA 3CS3A 2BISA 1FSGA 5GGXA 4G3XA 1ZGGA 3AHEA 4GE3A 3V7NA 2CV0A 3VYRB 4Z7JA 4JLVA 2H57A 1JIVA 2DFTA 4NATA 1Q12A 4MUEA 4TRNA 3O26A 3QY9A 1Z2NX 3HJTA 3X2SA 4IWNA 3PXDA 4FUTA 3KKZA 4KHPB 1LTKA 3HRHA 1MEEA 2QMQA 3Q72A 1Z38A 2ZI6A 3OLVA 4RCVA 3T7IA 2OXCA 4F9GA 2FV8A 5EYPB 5TPZA 1USGA 2AQIA 2QIPA 3RHZA 3KEQA 3VKFA 2PFSA 1A04A 3EH1A 4GBED 3IJ5A 3K05A 1QGOA 3CV3A 4QJ4A 2H2FA 1SKYE 4RADA 5G0SA 2FVYA 3VTAA 2QYSA 1I8TA 4ALKA 4XD2A 1Q17A 3DTNA 5EP1A 1AHHA 4YMGA 3D4NA 4N54A 3MINB 2XT0A 3DZKA 3RSSA 1Z0ZA 5ES3A 1R4ZA 1D7AA 4IR7A 5COAA 3NEAA 2M6LA 1DZIA 1NNUA 1TQHA 3R3JA 5AUQA 2IEGA 1CXZA 1GIAA 4PQFA 2G82A 4LOAA 4UARA 4HEJA 3IYLW 4P5EA 2WSBA 5EINA 5KCMA 4AX8A 2FWBA 3QITA 2F9MA 3CMCO 3K0FA 2NPOA 4EA6A 3TVTA 1ADGA 1G2QA 3LZCA 4IH9A 8OHMA 1TO6A 2IIPA 2X6QA 4F2HA 3LFHA 1O6FA 4GR4A 1WXWA 5CD1A 4DLUA 5K8VA 3N2ZB 3BMOA 3KV3O 1VXOA 1D2EA 3I12A 8ABPA 2BHSA 3A1CA 5K9ZA 1EXWA 2HQRA 3IBSA 2YW2A 5C52B 1ISJA 1SU6A 2JL1A 3ENNA 1SXJD 1ACJA 1U2GC 2ISSD 3BWYA 3IAS1 3PFHA 3TKAA 4EPRA 5B7QA 5JXWA 1UMDA 2PA0A 2VDKB 4LJLA 4MP8A 4OSPA 4ZEWA 1JFSA 3OIYA 3DDUA 1ZWLA 2ZZKA 2H8GA 1JHOA 2C9OA 2P0YA 4QDXA 4B7XA 1W48A 2YQ5A 5IDQA 3L4JA 3RYCB 3L79A 4AJJA 1F5SA 2REOA 3PGJA 1P4HA 5JWOA 1E7WA 1LPSA 2QTZA 2WG2A 3IOMA 3JRNA 4G67A 2IODA 4GZ3A 2JFBA 5K2MA 1AQ6A 2R1ZA 4KGXA 4HKTA 2X0EA 3OEHA 1I7SB 1WUKS 2AI2A 2GTIA 3V7FA 1QRAA 2BKXA 3DE6X 1DAMA 1VSTA 3WBKA 4V1CI 4X95A 2EBWA 5AVQA 2W6ID 4RENA 3H3XA 6REQA 1JW9B 5HUHA 2TMKA 3LQ1A 3QFFA 1IHUA 1V41E 1XK6A 4M55A 4X1YB 4KU4A 3KPYA 4ZOLA 3HJCA 1LY1A 4NU8X 1YQGA 1UL1X 1C7FA 4F5WA 3FOAA 4FQ5A 1Z0IA 5H59A 2EIHA 3DZBA 4XRGA 4JOQA 4FFSA 3NPAA 4KFCA 1FRQA 4GMGA 4GMKA 2ZZMA 5K0CA 2AN4A 2E55A 4QOHA 5ERXA 5GOTA 1P9WA 2VUUA 4TRJA 3QVKA 4ENRA 1TVKB 1WP9A 4IRXA 1B74A 5B1YA 1Z4OA 4ND4A 2ZAIA 3SMVA 3G85A 2W6NA 1CY6A 3FUUA 3KD3A 3D6FA 3CLRD 5FV4A 4KIUA 4M8SA 3PXBA 2PUCA 1Z0SA 3ZDBA 4ZI7B 2FFJA 3CF4A 1PK8A 1EU1A 2E4AA 1RAAA 3GCGA 5SYMA 4E7OA 2P9FA 5IJAA 3SHOA 1PWXA 3EY9A 4G8BA 4IKPA 2CXNA 1AQYA 2LDBA 4RHXA 4L5AA 3ISTA 4BOYA 2JLXA 5DX1A 1K6EA 3IAEA 3KQOA 2OBXA 4HZGA 2P8JA 5DBGA 4AZTA 4OQYA 1KQGA 2XCSB 2ZBVA 2Q2OA 3INYA 2H0QA 2XSZA 1VDZA 2I7TA 2X0IA 1UADA 1ZO8A 4ABYA 5CFPA 5KWEA 2EW2A 3W6OA 5A4IS 2WHQA 1BXZA 1NV9A 4MB6A 1E79A 1TX4B 2Y1WA 3DZGA 3EZYA 4BMVA 4ZYUA 3WOVA 2UVPA 1FNCA 3O2QB 3MQFA 4GFDA 1I0ZA 3UH1A 1PFVA 4I8IA 4CNQA 1Z7GA 2QAIA 3DYIA 2XY4A 2NZUG 2PIDA 2WAOA 1V2GA 2B2XA 5FEMA 3GARA 3HCEA 4L08A 4CM3A 1JNXX 3OX1A 2DHQA 1Q7TA 3F6RA 1JXMA 1PGNA 1Q83A 1R0XA 3HA5A 1H1LA 2G1JA 3F5DA 3GROA 3HWWA 3PFCA 1DUSA 3K2QA 4NZOA 4B9EA 1U2PA 3BFJA 2CEAA 5FQOA 1RJWA 1IAVA 1P8JA 1T1IA 4L3OA 4RESA 3PJEA 2C92A 4AJ1A 1POWA 1QORA 2ZT8A 3K8QA 1ZOSA 2WF6A 4B7AA 1PFYA 1FPMA 1T6YA 2ZI7A 3QLVC 1JHDA 3P20A 3R6LA 1G3RA 5HS6A 4YQEA 5GPBA 2JCXA 1NU6A 1ECBA 2B1GA 4Q3AA 4P82A 1TJ4A 2ZE8A 1XSEA 1YHZA 1CVIA 5EPOA 3CLKA 2VYND 3ZR4B 1GEGA 1YB2A 4I9FA 4R7TA 1P0IA 2AN3A 3RAGA 4E4TA 3I1FA 4DCNA 4TTJA 3MJTA 4MEJA 3UHPA 1MIHA 2DKFA 3TYXA 1T6XA 3FYTA 1GLGA 1R6VA 3VV3A 2ZU6A 4BZQA 1LB1B 2UZIR 4JLOA 1L5FA 1RAFA 3UAWA 5IYZA 4I08A 5AQEA 5CBPB 3TLCA 4BBAA 2JANA 3L0PA 5KYNA 3K92A 3L7LA 3LY9A 3KQPA 4FGJA 5CRIA 2JFXA 1V71A 3FLMA 2XADA 1NZDA 1NR7A 3R75A 1XTZA 1ZH0A 2P5TB 3UHJA 3OPYI 3VR5A 5FI0B 2F3TA 3SF8B 3EW7A 1T0IA 5J1TB 4AUMA 1Z0FA 1SQ0A 3KO8A 1E5QA 1Z13A 3CY6A 1BXRB 3C43A 3LKVA 3NEJA 4LWZA 4EY6A 5LLDA 1JH8A 1QH8B 4MYUA 4Q39A 4I50A 5ALMA 3E5RA 2PWZA 4D43A 2GPBA 2JAHA 4Q16A 5DBIA 1SCUA 5FT9A 4AZ3B 5B7NA 1C81A 2BFCA 3OESA 4RPKA 1AO0A 3HVRA 2FK8A 1RWXA 3NAGA 3RRFA 3NRBA 1G6HA 4QAQA 1TYAE 2W2LD 1DC8A 4M22A 1QE0A 4TVSA 2C98A 4ZEVA 2PAFA 4S1NA 3B5IA 1GL3A 1VRVA 3OFNA 2ZFUA 1VCNA 1JILA 4YMLA 1C3OB 1DOAA 1T2CA 4PYOA 3MRXA 3H2SA 1KE1A 3CSDA 9ABPA 5MFPA 2WKPA 1CQXA 2P2CA 4LHWA 1YRAA 1NI4B 3R7BA 5EJ7A 1ZNZA 3ICQB 2C1ZA 1JEDA 3F5MA 4NP6A 4DT1A 2YFQA 2IH4A 4GLOA 1NW6A 1RLJA 1N2BA 3QU5A 4HJXA 5JPCA 1ZU4A 2YMPA 4DAEA 3RRXA 3AL0C 1QHNA 1XG5A 2B92A 1US8B 2R65A 3QFHA 4HRXA 4J2HA 4CCWA 2FHPA 4DJDC 4ZK6A 3BD8A 2J3KA 2QX4A 3OTGA 3ADBA 2ZS9A 2B5OA 4UE6A 1O5OA 2IV3A 3WYNA 4C14A 4CQJA 3UANA 4YR7A 1EGHA 2GAIA 3IALA 3UUEA 5CDFE 4HQ0A 4KQIA 5I3ZA 1Q2XA 2J3LA 3D3KA 1Z0JA 1U3VA 4EQZA 3DPSA 3AEYA 1PZMA 4U5XA 3GJ0A 2H2GA 1E6LA 2IYAA 1OIWA 3EB9A 4M38A 3AKYA 3L43A 5I9LA 1MDBA 4RUKA 1JIKA 2XE4A 1AVTA 1YHYA 4R2HA 4BN4A 5CA1A 3VZPA 3SGLA 1P0CA 3PC2A 2I2BA 4QD3A 2F17A 1FP2A 3H9GA 3K0BA 5EXDA 4HZUB 5CEEA 7MHTA 4W5OA 1XA3A 3DYVA 2BGJA 4IXTA 2PUDA 3PQ4A 4B0PA 3HHPA 4POAA 5DXAA 3P9KA 2H65A 4PSAA 4BFUA 2ILVA 1WMBA 5JH7A 4ZOEA 2P2DA 1DADA 4QC2A 1J24A 1PR5A 2WIKA 2KJQA 2ZQYA 4WNAA 5CB4A 1AUXA 1J0XO 2P2GA 3FOWA 2D1RA 4UJ5A 2EJTA 4WWHA 2WDZA 2X8JA 4IJQA 3CIOA 2PX5A 1TI7A 2KHZA 3KDSE 2OBYA 4A6DA 1C30B 2NNLD 2QNBA 3WKEA 2BM8A 1X14A 3GD7A 4MKXA 4QUAA 4BO7A 3DULA 5F98A 1F51E 2AMYA 3PB3A 1G9TA 1N2SA 2VO1A 3I8XA 1KDZA 2LP4Y 2PYZA 3DB1A 4MW0A 2FFQA 1C80A 4ZAYA 5LZ7A 3WLAA 4DMFA 1QX4A 1K8XB 4O2RA 2I55A 2R2GA 2FG7C 4BTVA 4YYZA 1OV6A 2EFCB 3AWDA 1ORTA 4N40A 3SEQA 1U7UA 4TXLA 1J1IA 1CUHA 2WWTA 3KAPA 3IMKA 1CUBA 2CXUA 1XQWA 2ECKA 4LVOA 4GUDA 5EMKA 3B9QA 4WVFA 3ESRA 3QVMA 2BMAA 4QUKA 2I2XB 1VP9A 2F43B 3DDHA 4RE6A 3TMAA 2QX7A 3AUJB 4WKPA 1Y8ZA 4KBYA 2P2LA 1V9CA 3FCXA 2FPSA 2WKQA 5D2CA 4AL4A 4CHTA 3HB7A 4OI0A 4QA9A 4XPIA 4YTEA 3ZY6A 4LVNA 5ILOA 4RY0A 1GAEO 3CJTA 4EG5A 1V16B 1YBAA 2IYEA 3GRCA 2EFDB 5DH9A 1B8PA 1UZAA 1WXFA 3CX7A 1N5JA 3L02A 4QWWA 5FB3A 2WT4A 2QRPA 1FU7A 3GVHA 3IP9A 2O8CA 4DF3A 2VJOA 1BFKA 3H1PA 3KR9A 4AUNA 5CUQA 3GOQA 3QKIA 5LZ5A 4BLVA 1CKEA 2PFGA 1R5JA 1AKWA 4WVLA 2Z83A 2OHGA 4WK6A 4AROA 3FCCA 2FE1A 1RAEA 2E6UX 4FYMA 2Q9BA 2ECFA 3SP1A 3IKMB 4BO4A 1HZJA 4WEQA 3FLBA 3ESDA 1GRCA 2VBFA 3RVRA 3V3TA 1KI4A 5T3YA 2C42A 4WA8A 1NQVA 1G8HA 3D3NA 1SC6A 1AKMA 1D04A 5EIFA 1YVEI 1N3LA 3FNIA 4N3BA 1Y80A 2D8AA 1OC2A 3KKMA 4UBKA 2C9ZA 2QYHA 2A8YA 1PUJA 2RKBA 2EKPA 5JRJA 3VNVA 1MR3F 3W9SA 2NTJA 5I9BA 4NMMA 3AB7A 3AGPA 3K0KA 2D59A 2IOFK 2JZCA 1C4WA 3NR2A 1GNRA 1KO5A 3VISA 1DRVA 1DXYA 4WZBB 3Q2IA 1V4NA 1PW7A 2VPXA 4ZCLA 2PUFA 4I66A 5IEJA 5JZSA 3WRXA 1KYYA 1SUEA 1Z6QA 2G1KA 3NTXA 4PQEA 3K70C 1TJNA 4RKWA 1TYEB 2M1ZA 3SSMA 4OJYA 5TVGA 1ZUIA 1LJLA 3ORRA 2ZI9A 1Q84A 1E8DA 4TLEA 1JJAA 2Z2KA 1X38A 3F49S 1WB9A 1JHYA 2ORYA 2QHXA 3R7DA 2VF5X 3WNDA 4IYJA 2PPLA 3W6PA 1ONBA 1AGYA 2OEPA 1KYQA 4NENA 5A7GA 1DV1A 2WV9A 4HB2A 2A57A 5BW8A 2IS2A 1FS4A 1Q7GA 1IOLA 2VPIA 4AX4A 3B3FA 1GUYA 3S2EA 3O90A 1P7VA 2PR7A 3D6VA 1I7NA 2DR2A 3NEPX 3HJHA 2BMFA 4URUR 3ZPXA 4ZQFA 3TDMA 1EEHA 1MT3A 3FYCA 4B74A 5C8ZA 1EHCA 3WKAA 1QLWA 1ZN7A 3CKLA 1PI3A 2IY8A 2IHKA 5AK5A 1JV2B 1QAOA 1U6IA 3DNPA 1XRMA 3AXTA 3MJ4A 4URWR 3LUCA 2EX1A 4E08A 2BCEA 4QGBA 3SZOA 2WPDA 1ISGA 3EVBA 1N4DA 5TQJA 1RHQA 1VA5A 1Z75A 2PQMA 3M1YA 4FFPA 4TXJA 3VOTA 3ZGVA 2UYOA 3RVKA 3WL6A 1G60A 4WKCA 3EQ9A 4JC4A 4Y6RA 3AW9A 1X94A 4OGLA 2V3WA 3S7TA 3TQSA 2BGIA 2D6FA 5EMMA 3O8BA 4EQ6A 4L8YA 4BEWA 1LVUA 3ADKA 1I13A 2GVDC 1Y9AA 5E7QA 1AA6A 3U09A 4HNHA 2MTBA 3H1TA 3N2EA 3QVUA 1EFRA 3RREA 3LYLA 1SKQA 3BGVA 3CWCA 4IDHA 4EMSA 4MS4B 1HDCA 2O3RA 2XCLA 1QTNA 2NM0A 2QR3A 3AHDA 2FZ4A 1BH2A 3E3AA 4R1NA 1EXDA 2FPMA 2W43A 2XPCA 1N9ZA 3MS4A 2RGCA 3E15A 3LH5A 3U4AA 3KJGA 4KGZA 1NBEA 2ZR9A 1E8MA 3IBGA 3ETHA 4MKIA 3E03A 5AM3A 3M6AA 5JZBA 2OBLA 3CZ4A 4KODA 2AQHA 2IU0A 4BB5A 3BTUA 3JZDA 4DA7A 4FX2A 4FNAA 4JELA 3R3XA 1CQIB 1X9HA 5DBOA 1EINA 1DDIA 1DG1G 5KPDA 2C9CA 1S6YA 1I14A 2XUAA 5K3FB 1VPLA 3RARA 1DDGA 2VSXA 4FT2A 5HE9A 3R9XB 1VTKA 3FMVA 5ANRB 4Q21A 4Q7JB 4R1OA 4KXXA 1W4ZA 4U39A 2GN9A 4M9UA 5DW3A 3I45A 4M98A 5GQSA 2C7BA 3RNOA 4DQ0A 3FZQA 3UXEA 2FSVC 2YV3A 3V5NA 3VU3A 1YUNA 3WWCA 2BJWA 3ZJUA 3I4LA 3AMVA 4GI7A 2AR0A 1E3SA 3CLSD 3CZCA 3GLRA 2BKEA 2H4ZA 2ZUWA 3T7AA 4C0BA 1DCKA 1KSFX 4G0QA 3I52A 5DYNA 4L5YA 3A3NA 3ZLJA 5ALKA 4E3ZA 2IZ5A 5BT8A 2D0IA 1DO0A 3H2GA 4QPDA 4Q9IA 1QGZA 4RJLA 1IEQA 1P74A 1D0IA 5AIAA 4XPZA 3AP2A 1I6LA 1CZOA 1I5RA 2QRMA 3OPYA 3KYIB 4KVGA 4M1QA 4HDMB 1DG3A 2PLRA 2Q62A 1C5KA 1PEKE 1MGOA 3O1IC 4LTDA 3WKDA 1W85A 3GLSA 1TVCA 1CDOA 4KWEA 4OGGA 1SCAA 4CDNA 1UJCA 3R5TA 5JD4A 1KY2A 4XAQA 2IYQA 2QGZA 1GLVA 1FL9A 2V9PA 4KYTA 2VDWA 4TZTA 3E1SA 5DTIA 1KGDA 3CEMA 2ZB4A 3RRMA 2WSLA 1Q7EA 1L7PA 3VPDA 4BLSA 1L9XA 2OOSA 2RBGA 5EUBA 5DFAA 3BXXA 5ADWA 3EVCA 3IPRA 2A1TS 2EL9A 2X1MA 2UZ0A 2IHYA 4KIGA 2P4UA 4PQGA 3GMSA 4XEHA 5L7TA 3ZQ4A 3IE1A 4Q3DA 1MH9A 3AERB 3WYDA 2W2NA 1JEQA 4KIJA 4M0MA 2AGVA 4CM6A 1R4MB 3D2CA 3IOCA 4U1RA 3DV9A 4BN5A 4FP9A 4MJXA 5KQMA 2VZLA 1JG1A 1QRRA 3DJYA 4YJHB 5H4GA 3RD5A 1O57A 3EF1A 1Y3IA 4Z4HA 2FJ0A 1PJAA 4DG8A 4DDVA 5CLGA 3MB8A 4GZ5A 3HDVA 1YC2A 2QI9F 3Q0EA 4J43A 2JJ1D 2EBFX 3BEDA 3A9UA 3GNSA 4YO8A 3RVOA 1UPFA 2DRIA 2QTHA 4H7JA 1G291 2JC3A 1A9RA 1E0JA 5G0WA 2PJUA 3P19A 1E2MA 2R25B 1RMQA 3LWNA 5BV8A 2A0UA 2WKRA 3GLIA 4YT2A 3EPPA 1YAJA 4PZPA 1M0TA 3AUFA 4G5FA 3QQ5A 1XTVA 3UEOA 2XRYA 4TTPA 4D5EA 4OB7A 4PC7A 1XN4A 4DV7B 5DNAA 1UFVA 4RHEA 2OFOA 5D3QA 3WZ2A 3NOXA 5TMDA 2HBZA 4MAFA 2RCNA 2IX9A 2A3NA 3A4NA 3BREA 3TAHA 4QECA 3ZC3A 2GPAA 2ZR8A 3ZWNA 3UVEA 4NCIA 4XDZA 1K6XA 3KCNA 3L7CA 2JATA 3HZRA 4L8FA 3V32A 3FVVA 3W2IA 3QWHA 2IRWA 3VU8A 1N5OX 4D4GA 1MC1A 1T25A 2QT0A 1G9SA 1PJRA 1N2ZA 1J8YF 4L1KA 5JXHA 1KH1A 4YAWA 1VI5A 3LMKA 3T4PA 3LUGA 4TMWA 1Z88A 5AHKA 4AXXA 3I3OA 4CL2A 5JTUA 3AR2A 1QGUA 4MW4A 4XSHA 3F6EX 1KH2A 2ZYTX 2ZRFA 2PKQP 3JYOA 1WG8A 4U02A 5CGZA 4ZQGA 1UBEA 3DEZA 1HQYE 5ALIA 2DECA 5ARBA 1EX6A 5FOUA 3ZYZA 1I32A 4RA6A 4C3VA 2VQSA 1PFUA 1EQ2A 2QB5A 4KPUB 1TZJA 5THQA 4WXRA 1SHZA 1VCHA 2OZLA 4YXWD 3BICA 1XMSA 3PDIA 2GLUA 3MUNA 2VHVA 3HM2A 5DGHA 1C2TA 1JIIA 4I5FA 2ZSHA 1QYCA 1HTWA 3KJHA 4G37A 5DNDA 4CKEA 2EOAA 1W88A 5KSZA 1HDEA 1RNLA 4GZ6A 3WWYA 1HBJA 1ZRHA 3U19A 3HK2A 2IUEA 2YZNA 1BKDR 3X1WA 3B85A 1QHGA 1YVUA 3AJRA 1CHNA 1W4AA 2CN1A 2FW8A 3K30A 4FJ2A 4UXJA 4F3RA 3OMLA 1NQOA 4ASUD 2OPHA 4LZOA 5KTMA 2G4CA 3YASA 5HYVA 2I2DA 1CB0A 3SQXA 3T99A 1JEAA 4I3GA 4H15A 2BM1A 2ABWA 4IYRA 4L4ZA 4CIBA 4FM9A 2R7NA 1KIMA 1L5SA 2V5VA 4P36A 4JITA 1PNTA 4W99A 3VPFA 2GEDA 2HNBA 5L3SA 3HXOA 1ODFA 1BQ4A 1GPWB 2DHCA 2HV8A 121PA 2I7XA 3FTEA 4MS3A 3NV9A 1RXWA 4CDRA 1NZJA 2PSFA 4DMLA 5HIMA 5LKRA 4MQ5A 1OH6A 2DF8A 3AVYA 3ENWA 2RGAA 4Y1FA 4YCMA 1PS0A 4MS4A 4DCOA 5KNBH 1BC5A 5JCJD 2I6QA 1NVEA 3DSRA 2IUSA 2CKMA 2GZ2A 2IITA 3DB2A 4OMFG 3TO5A 3ZVRA 1RZ3A 3R74A 1U4NA 3MMNA 2WD7A 4RTJA 3M6WA 2RKWA 3SJZA 1XU9A 3EMKA 2HIHA 2O06A 4F1JA 1ORWA 4EYEA 2WZDA 3LBIA 2FFHA 4QQ8A 1UOQA 3S1LA 1IHXA 1HKUA 5EGNA 3VSDA 5A9RA 1KVTA 4BQQA 1DKLA 2QZ4A 3K09C 2WF5A 1T3TA 1MN6A 2JAQA 2N9UA 2X8AA 2C9MA 4HR7A 3OU6A 4U6NA 4XR9A 1CZRA 2HX1A 4QODA 4U8GA 4R8MA 3N8GA 2JJYA 5J2TB 2CSXA 2IV2X 4JAVC 1XEWX 3F9CA 1YZFA 1A9QA 4BUZA 3H9EO 2VNKA 1T0UA 3H5NA 2M2IA 4KTTE 4DC9A 3ROMA 4P1ZA 4D9FA 3FTNA 5EQJB 1CY1A 1WXDA 1XEWY 1NJSA 4IZ6A 4OF4A 5L40A 5D7NA 3IMCA 2LCIA 1AK9A 5DHTA 5FFFA 3TVYA 2GN8A 4HN2A 3N2GA 4P7FA 3PQ5A 3TSCA 4PVDA 3RUPA 1A8UA 1YGPA 1W4CA 2XA2A 4RVOA 2GO1A 4PWZA 3H4MA 4XTRA 3VKVA 3O74A 3TQCA 4BP9A 4PYLA 4ZTUB 1ODIA 2P3OA 5IJ0A 1LD3A 1Q0QA 2A0YA 3AEQB 3ZTTA 3ZKWB 4E7PA 3EC2A 2HK8A 1PQUA 4MMYB 2FW0A 2ISCA 3IESA 3T9FA 4BZPA 3B9RA 1GDHA 1T6BY 3BSYA 4U4AA 1DWUA 3K6KA 1Z4QA 1NVDA 3RFVA 2YNMD 1MEJA 5CB4F 3WWZA 5T7BA 4YRPA 2EP8A 2VHEA 2WE7A 2ZS7A 3TI9A 2WC1A 2JFOA 2M98A 3MWDA 4KXNA 4DR1B 3DBVO 5AW0A 1X9IA 4RACA 3RH0A 1YMVA 2NYRA 2R3SA 3L7NA 4F3KA 1QWSA 3OZCA 1PWEA 3NVDA 3TOVA 4CF6A 5FF9A 1L8LA 5KTTA 3WDKA 5CXUA 2F8LA 4DA4A 2NZYA 3LBAA 4JCOA 1P7WA 4HWPA 4P3NA 2I7DA 1MA3A 1XX6A 2WKWA 1Q11A 1Y4ZA 4A27A 1LX7A 1NVWQ 4XFJA 4QU5A 2ORWA 1LJUA 4JBGA 1TLLA 3MS7A 3RS5A 3JQEA 3VQTA 4JL8A 4BLRA 1MQ9A 5FWXA 2Q4RA 3I5UA 3SLKA 4W5HA 3IBFA 1RVV1 5A71A 3ZWBA 4NOKA 3F4LA 3BRWD 4FHDA 3U61B 1US8A 5TMPA 2Y6UA 4YRZA 4CT5A 4EB6B 3DNFA 5JBQA 4HNVA 3DBHB 4E31A 5IFKA 1QQBA 5E1DA 3A6JA 3CNBA 4QVGA 3I1YA 4KR2A 3OZSA 3TXYA 1R27A 1E2KA 1IG0A 1MAAA 1O95A 1QQ5A 4JB2A 4BNNA 1PSZA 1JKMA 4B3JA 2GAAA 1X1DA 3PPYA 1BO6A 1A7AA 3C6MA 3I76A 3PKJA 3URMA 4UDNA 2WU3A 5JQGA 2UV8A 3PPIA 4KJXA 1E5VA 1N5LA 2OAGA 2H0RA 2WYIA 5AJZA 5M04A 3GOHA 2HHJA 3VBEA 4OYHA 3FKSD 1U0LA 5IXYA 2JIOA 4EB3A 2AE2A 4RQTA 4DSUA 1KMCA 3DLTA 4CTOA 3HP7A 4FFMA 3K1YA 3RYCA 2VLBA 5IT0A 1V7QA 1ZK1A 2QJOA 2XJ4A 4ZI2A 2DYKA 1JMKC 1GZ5A 5JANA 3SC2B 4BNTA 6Q21A 1FP6A 3CO0S 3IBTA 2QW1A 4U3JB 1EBUA 3GPCA 3IXQA 4P3KA 4ZT4A 1V6SA 1WLSA 3H05A 5ILQA 4A73A 5LR6A 1KYXA 2BH9A 4NOLA 2A4KA 1KYTA 4UOQA 3Q7TA 2PZEA 2MT9A 5CHYA 5DT2A 4PTYA 4C30A 3JASB 3O4RA 4B81A 3PGXA 4WZAA 5H4HA 3VKWA 3GV0A 4H60A 4TROA 2WDPA 4WRRA 1ZUWA 1RTKA 5A6SA 4CKWA 4ROSA 3WHPA 4A91A 2P3SA 1GTL1 4BX2A 1N2CB 1QIFA 3IP6A 5A6VA 3D2LA 4KN9S 3I6MA 2IUFA 5LN1A 2QNIA 1A69A 3R44A 3P5BA 4D81A 2GBCA 1N8NA 2AN5A 4EHAA 2V0NA 3I05A 4BTLA 2QRQA 4EOGA 1NJGA 2Y3IA 1FP7A 4FFBB 5CX4A 5CA0A 3ICWA 2ZRJA 2PFKA 4ENSA 4KYVA 3QEBZ 2Q2NA 2NTNA 4DQLA 2AI1A 3DHWC 2PU5A 4AZVA 1GOTA 1Q57A 5E8RA 1AGRA 5JTTA 1IQ0A 3DE2X 1SC3A 1H2RS 4NVRA 5J23A 5I8WA 3PICA 5CNMA 4CMEC 3ZHCA 1FRZA 1JQEA 4E22A 4OX9Y 1DKOA 1E2QA 1YRLA 5TQVA 4IJUA 4DZRA 1G5PA 1VFNA 3AHHA 5JDCA 1T4MA 4QHTA 1D8AA 2AC4A 4G4JA 5ALUA 1DSSG 1QQ6A 1Z6ZA 1ZSYA 2Q29A 4LV5B 1NYLA 5IHPA 1C1XA 3PRHA 2A86A 2EP7A 3NZEA 4I55A 2CLFB 4ENWA 1ZR2A 2IWHA 2ONKA 1CVLA 1GADO 3TZQA 3QJYA 3I01M 3IDAA 5HIKA 4BO0A 3C3CA 4REQB 3D3JA 3AF0A 1KEUA 1VJCA 1KF0A 2PKRA 3LYUA 3QYPA 1ZUNA 2I8AA 3R24A 4LDNA 1ZM9A 3PLAE 3AILA 1K5PA 4QATA 5EXSA 3T3IA 1E62A 4U2EA 3QWAA 5EP3A 1J8QA 2IYLD 4XWGA 2OXIA 5DM70 1BQEA 1KS9A 1UQUA 3MCVA 1BN7A 1D5CA 1GRQA 1M1NB 2FG6C 3DZHA 3ND6A 4FYJA 3RSCA 3W5VA 2P6RA 4JXKA 1IUOA 3LZ6A 4MVCA 1O94C 5AHWA 2QP3A 5G4LA 3GGGA 4HO1X 3PPXA 4UZEA 5AYVA 1O9HA 3RYFA 2PBZA 4TWIA 3EGVA 1W2WB 2XECA 1WXQA 3EQ6A 3HYTA 2V65A 2WTMA 1PS9A 3RYHA 5EZQA 2AD1A 3L6UA 1XNHA 4MMZB 2K87A 3O38A 2OM6A 1N1DA 3OQBA 1YVDA 4KMMA 3W6NA 1ZJ5A 3IAM1 4O4HA 2QMOA 5B1HA 4Z0NA 4CMGA 3T3NA 3PXXA 1N1EA 4IIVA 1F6WA 4FFBA 3GG9A 4FCCA 5BW4A 5L4NA 1SBYA 3AI7A 2G5TA 1G9XA 4IWYA 1I3MA 3QEOA 4NMXB 1JVBA 2CCJA 3FR8A 4QQFA 4EY8A 3GELA 3IVGA 3E18A 3W06A 1YZVA 4HAYA 1BAPA 1LDYA 2OO3A 4JT8A 5BR8B 3EARA 4H17A 1P7ZA 1XEXA 3AI1A 5FPSA 4RZHA 4D25A 2D0OB 4JJAA 3QUCA 3P96A 5KNDD 1OT3A 3HRKA 1G64A 3EGDB 4GI1A 5FORA 3QQPA 4QBTA 1E1CB 1PG0A 3FHOA 1QKJA 5AP9A 2AI3A 5IVKA 5AJUA 3W8FA 3JVUA 4Z9FA 1KZYC 1UFKA 2GD0A 1TF5A 3K96A 4Y2HA 4NLLA 5LXTF 1VHWA 2I2AA 4P7GA 2ZE5A 5AI6A 3NBQA 4ON9A 4A8PA 2TMDA 2UUAB 1NC3A 1YBFA 4TMVA 4I50B 5G41A 3GRPA 2ATEA 3C5WP 1P6UA 1P80A 1NF8A 1PFWA 1RPTA 4XI9A 3G0HA 1M74A 1GGKA 5EFOA 1HDXA 4ALMA 3UJ7A 3WLQA 1TAUA 5A5GA 3HFRA 3V9AA 2QUIA 2BKVA 1II8A 2PL9A 4FOLA 4XOIA 3FUVA 1CLEA 3UTCA 4YRIA 1TKBA 1LC3A 2WYHA 3GAAA 1JB9A 1QHYA 3H1GA 1CNMA 4ZKEA 1A88A 4E4RA 3DVRX 2XVYA 5BV7A 2CVHA 3GCXA 5C3UA 4LC1A 1SR8A 1E3MA 1L5VA 4TOIA 2C00A 3OEEA 2JDID 3D9QX 4OGWA 3AHGA 5HF9A 3CINA 4HAIA 1NXXA 1WCYA 2AVDA 1T4GA 2XQJA 5BR7A 2VAPA 2WPDD 4E32A 4FWIB 4OEHA 3L93A 2HJRA 5FI3A 2RAFA 1GL7A 2G5GX 3MTEA 2P2SA 1E7MA 4MYCA 2Q3EA 4IO0A 2CSUA 1TTHA 2ARKA 2R5WA 4O4JA 3S27A 1TFUA 5EI5A 3B6MA 3OF3A 1SBIA 2J0QA 1YNSA 4UEKA 3VTZA 1WPGA 4DUGD 3UV3A 4J29A 2P9ZA 1OBVA 3IAXA 3B8HA 3FTQA 5E2BA 2O0KA 2GD1O 3ECCA 4G5XA 1SQFA 1USUA 4Q4LA 2G08A 3UC5A 5FUYA 5C3MA 2A9JA 1NY6A 1X1AA 2AFHB 2QG4A 3QLUA 1A72A 1FYEA 5JMPA 1NXQA 3LXXA 2EATA 2HJSA 3K8YA 4HB0A 4Q6WA 3E6AA 1CDDA 3I2YX 4L3VA 2PZKA 1N2OA 2PZFA 2JCSA 3VKGA 5IAGA 4RJJA 4WLOA 2OD2A 1JDBB 1U0JA 4QFDA 3G9XA 3I9FA 1DPGA 1RQGA 3NFYA 1EZZA 2EKZA 3DZ8A 5CB8A 3ICOA 2RJOA 2Y1KA 5JCZA 1N0HA 1BKSB 1I9GA 4P38A 1I94B 1QP0A 5CXQA 1D1PA 4BO6A 2FY8A 2HYDA 5J63A 2AFHE 1VLMA 3OCCA 3MK31 2AHOA 4B4DA 1L7AA 2NUTB 2OCGA 1LI4A 2PCJA 3WTCA 4GSLA 1Z6PA 3K5HA 4H1UA 4HH1A 2OXEA 5JALA 1RZRA 5HJ7A 1O8CA 3IAFA 3N39C 4M6WA 1SOMA 1U8ZA 2Q21A 2ZTLA 2CF5A 4B2LA 1E0DA 4LQCA 1KI2A 5DCWA 4EJSB 2ZWPA