1K0SA

Solution structure of the chemotaxis protein chew from the thermophilic organism thermotoga maritima
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
151
structure length
151
Chain Sequence
b'MKTLADALKEFEVLSFEIDEQALAFDVDNIEMVIEKSDITPVPKSRHFVEGVINLRGRIIPVVNLAKILGISFDEQKMKSIIVARTKDVEVGFLVDRVLGVLRITENQLDLTNVSDKFGKKSKGLVKTDGRLIIYLDIDKIIEEITVKEGV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CHEMOTAXIS PROTEIN CHEW
publication title The solution structure and interactions of CheW from Thermotoga maritima.
pubmed doi rcsb
source organism Thermotoga maritima
molecule tags Signaling protein
total genus 16
structure length 151
sequence length 151
ec nomenclature
pdb deposition date 2001-09-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01584 CheW CheW-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 1k0sA01
2.40.50.180 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) CheA-289, Domain 4 1k0sA02
2ECZA 2JS0A 2C0TA 2RQWA 2X3WD 2ED0A 1T0HA 3O5ZA 2DL3A 2JMAA 4RTWA 3UATA 4RTYA 2O9VA 1UGVA 1RI9A 1MUZA 1VYVA 4J9EA 1K9AA 2FRYA 2K9GA 2YT6A 1WXTA 3QWXX 4RTXA 1VYTA 4OMPA 2F2VA 2JMCA 1JEGA 1H8KA 1AVZC 4OMQA 4ORZA 1QKXA 2A36A 2KRNA 2K79A 2FPEA 1MV0B 2OI3A 4OMOA 1K76A 3I5SA 1JXOA 3REBB 2HSPA 3NHNA 1X6BA 2DJQA 4F17A 2K6DA 1WIEA 2D0NA 4RTZA 2CUBA 2JW4A 2J6KA 1BK2A 5ECAA 3RNJA 1A0NB 2EBPA 5FWCA 4LUEA 3U23A 1OOTA 1WLPB 3EG2A 4F14A 1T0JA 2L3PA 1ZUUA 1N5ZA 1HJDA 1KIKA 1RUWA 1UJYA 4JJDA 2DE0X 3ULRB 2ESWA 1M27C 2MOXA 2GBQA 1Z9ZA 1GFDA 1WXUA 5FW9A 2JS2A 2MIOA 1JXMA 2AZSA 2PNIA 2KNBB 2VKNA 3CQTA 4QT7A 1UECA 3M0TA 1WYXA 2EQIA 2LQWA 3PVLA 2KXDA 3VS5A 3I35A 1K4US 2RN8A 2PZ1A 1YWOA 2RNAA 1WXBA 1E6HA 5HCKA 1PRMC 2KE9A 1QLYA 2CT3A 4GLMA 1YWPA 4CC2A 1ABQA 2DA9A 1V1CA 1SEMA 3EG3A 1FMKA 1X2QA 2ROTA 2YSQA 1E6GA 4DEXA 2SEMA 2A28A 4HXJA 5I11A 2DMOA 1UHCA 2D1XA 3EGUA 4LUDA 5IHKA 1AEYA 2HBWA 4AFZC 3JV3A 2HEQA 2L2PA 4HVUA 2KROA 2CSIA 2YUOA 4EIKA 2CREA 4Z88A 1LCKA 5GJWB 4ZNXA 2EYWA 2HCKA 4LN2A 2D8JA 2LNHB 2CT4A 2KRMA 4GBQA 2BZYA 2AKLA 1XOVA 1NYGA 2SRCA 2DBKA 4WCIA 2GNCA 1GCQC 1BBZA 2BZXA 2ED1A 5EC7A 1G2BA 2C0OA 1KSWA 1Y57A 2DX1A 2EKHA 3VS6A 2FRWA 2KT1A 2JM8A 3VS3A 2LP5A 2CDTA 4JZ4A 2J06A 1RLQC 4ESRA 4J9DA 2EGEA 4J9BA 1GBRA 1QWFA 2O31A 1NLOC 2KYMA 3I9QA 4HVWA 2ROLA 2JT4A 1TG0A 1SPKA 2DNUA 3VS7A 4D8KA 1K1ZA 3EHRA 3H0IA 5FWBA 4AG1C 1AZGB 2RQTA 1QCFA 2BTTA 1W70A 1NM7A 1K0XA 1M30A 5GJVB 3C0CA 1UE9A 5I22A 1KJWA 3VS1A 3PE0A 1H3HA 2NUZA 3EG0A 2KGTA 1KFZA 1GCPA 3EG1A 5IXBA 1TUDA 1Y0MA 1UTIA 1JQQA 3IQLA 1ZLMA 2G6FX 3GBQA 1ZUKA 4DEYA 4M4ZA 2K3BA 2V1RA 4JPBW 1U3OA 2L3SA 1Z9QA 2EGCA 1SSHA 2O9SA 4RTUA 2DBMA 2AKKA 1CKAA 2EYYA 1CKBA 4X1VA 4E6RA 3ZL7C 4FSSA 3UA7A 2CSQA 4J9IA 2FEIA 2A08A 1HD3A 1OV3A 1AD5A 1WA7A 1X69A 4AFSC 1GRIA 1UG1A 2KT8A 1OPKA 2P4RA 2LJ0A 1ZSGA 3TSWA 1H92A 1YN8A 1PHTA 1GCQA 3VRZA 4CC3A 2J6OA 1ABOA 4HCKA 2EGAA 3M0SA 1ARKA 1YP5A 2LJ3A 1M8MA 1AWOA 2J7IA 3UF4A 3QWYA 4J9GA 2LQNA 2FG0A 2KRSA 1WX6A 3UA6A 1U5SA 2GTOA 2AZVA 2E5KA 1BB9A 2YUNA 2W10A 3EHQA 5IXFA 1M3CA 2L3QA 2A37A 1MV3A 3KFVA 4F16A 1JU5C 2KYBA 1I07A 3NPFA 2W0ZA 4AFUC 1WDXA 2M51A 2DL5A 1T3LA 3VS0A 2LJ1A 4IIMA 4OMNA 2LX7A 4A63B 4OMMA 4RTTA 1GFCA 1M3AA 2DLPA 2L0AA 2O88A 1ZX6A 2DRMA 1BU1A 5L23A 2GQIA 3M0RA 2KR3A 2VVKA 2JTEA 1E7OA 2MCNA 1NLPC 2GGRA 1CSKA 5IHIA 1VYUA 1PRLC 4RTVA 3THKA 2YDLA 1X2KA 2F2XA 2RQRA 1YNZA 2J6FA 4AFQC 4CC7A 2LMJA 1GBQA 4CC4B 4RUGA 4J9CA 2LCSA 3M0UA 1M3BA 4LE9A 3SHWA 1RLPC 4KRTA 3SEMA 1SHFA 2RPNA 3VS4A 1WI7A 3H0FA 1AWXA 1X27A 1UDLA 2K7AA 1OEBA 2CUDA 1AWJA 4LNPA 3REAB 1S1NA 2JM9A 2X3XD 1UHFA 1ZUYA 2ABLA 3I5RA 1J3TA 3VRYA 2FPDA 2RMOA 1K0SA 1AZEA 2J05A 2EVRA 4D8DA 3M0PA 1NYFA 1FYNA 4HVVA 4Y92A 1NG2A 3LH5A 1NEBA 3H0HA 2KEAA 4J9HA 2DYBA 1EFNA 1HSQA 3A98A 1NEGA 2D8HA 1B07A 2LZ6B 2DL4A 1SHGA 2XMFA 2PTKA 3FJ5A 3TVTA 1YCSB 3VS2A 1VA7A 2VWFA 2EYZA 2DF6A 2DILA 4K11A 3RBBB 2B86A 3PVQA 1PWTA 1AWWA 2RQUA 4IIOA 2CH4W 1SRMA 1B3QA 5IHNA 1QWEA 2OAWA 3H41A 1SRLA 2K2MA 1GL5A 4Z89A 4JJBA 3R6NA 1IO6A 2RF0A 1ZBJA 3TSZA 2EW3A 1X43A 2DVJA 2EPDA 2M0YA 2DL8A 1TUCA 2EYXA 2KXCA 2YUPA 2RQVA 3NGPA 4JJCA 1PKSA 2H8HA 2O2OA 1W1FA 1QKWA 1UJ0A 1X6GA 2JXBA 4JZ3A 2AK5A 5IH2A 2F2WA 2IIMA 2V1QA 2YUQA 4R0KA 1PKTA 1W6XA 4AG2C 2ENMA 2I0NA 2DL7A 1PNJA 2DM1A 1I0CA 2CH4A 2FPFA 2FO0A 4OMLA 2BZ8A 1T3SA 1AOJA 1OPLA 2KBTA 1WFWA 2DRKA 3NMZC 2GTJA 2C0IA 2HDAA 1UUEA 3M0QA 1I1JA 1U06A 1JO8A 1G83A 2NWMA 2QDLA 2OJ2A 4J9FA 4Z8AA 1UFFA
chains in the Genus database with same CATH superfamily
2A73B 4IPHA 2DXUA 2VASA 3QHSA 3EAEA 3CPWP 2FYKA 1Q81R 4J6HA 4A4FA 4V2SA 1JICA 1SKUB 2X3WD 3HOYH 2QA4T 4KJNA 4POGA 3M59A 4GY5A 3FRPB 4RCNA 1EYGA 2P4TA 2R5AA 2JN4A 2QXFA 4KKUA 2Q8IB 2PVGB 3UATA 2VW9A 2H3JA 1EQRA 1UUPA 3NTKA 1D6EC 5EGTA 5CMDA 4A3BH 2L15A 4ZKCB 1MNEA 1VYVA 1YNND 2VL6A 4JLIA 2KK4A 1Y8NB 2E41A 3KYHC 4DK1A 2H3EB 2DTHA 3L2ZA 1VYTA 3NFCA 4JK1C 5HGQA 4RHRA 3T1HL 1ZHIA 1JWUD 2SNMA 1BCPC 3PUWA 4JI6Q 1HR0Q 1FGUA 4R56A 5C4XH 5C44B 1TWGH 2CW0D 4ZAIA 1J5EL 2UUAQ 1N9WA 1EOVA 1QB5D 2CZ6B 2E5QA 3AHUA 3VA5A 2OI3A 2Z9HA 4A93G 4PJLA 2K14A 4OMOA 1UGRB 3OW2S 2DAQA 3I5SA 2XTIA 2GF7A 3HFNA 4PL6A 5LMUQ 1G6ZA 3REBB 3MHBA 3STBC 3HOZG 1ZQ1A 1X54A 4JI3L 5JPMC 4F8MA 3MHXA 1IHVA 1TR5A 4P73A 3RD4A 3S17B 5M3FG 2WACA 4LF4L 1OXSC 4GLAC 1TWAH 1Y1VH 5KRUA 3BW1A 4F17A 2HHHQ 4RTZA 3MEUA 2FHTA 4OB3B 4C5IA 1I8FA 5ECAA 1WYDA 3RNJA 1A0NB 3GP7A 4V190 2KCCA 2EBPA 2WB1E 1KNAA 3ZFJA 2ZXPA 4M77G 2R7ZH 3U23A 1W6JA 2K5HA 1M2VA 2F0IA 2I07B 1K8OA 1ZSZB 3GIBA 1KD1R 1KIKA 2CQOA 4A4IA 4LFCL 1U1TA 4NS5A 2K32A 4BWGB 1STHA 1L0WA 1EIHA 1M27C 1OQKA 2MOXA 5D7UA 3ZBDA 1Z9ZA 3CCMQ 4L59A 1VQFA 5GMKl 3JRZA 3CU7A 2M9UA 2K4KA 2EE1A 1FGBD 2JS2A 2R7FA 4DV5L 2B2VC 2JXMB 4C1NI 4ME5A 1OXXK 2VQEQ 3GTKB 4LF9L 1Q1BA 1O7LA 4J8QA 2KNBB 2QA4Q 2JZ2A 3CMAA 4DR2L 1BCPD 4BI4A 1FWZA 5M5YH 1M2VB 1RI0A 2X4XA 3ERQA 3L0OA 2ENBA 1G8XA 4IFDH 2KXDA 2G9DA 2M9VA 3BU2A 5FLXE 4DR5Q 4NXMQ 2RN8A 3KLWA 2K2VA 3X3MA 2NVTH 2PZ1A 1IYJB 1N32Q 2F0EA 4CJ0B 1BOSA 2QKIC 3STBD 3SK6A 4FXKC 4HJAA 4H13C 2K6AA 1SFOB 1EYCA 4JRQA 3FRNA 1RCVD 2EIFA 3A7AB 2IX3A 4FF1A 5EBDA 1JJ2A 2IHFA 2CT3A 4OX9Q 3GTGH 4BI3A 1EY9A 3SHLA 3I4NH 4KY5A 4C5HA 1KTKA 1O7YA 2K52A 1P92A 4N8X1 4ZYSA 1PZID 5FLXc 4XT1B 3OS2A 3M58A 1FMKA 5BN5A 1BR9A 2I5MX 2ROTA 2WSEE 3W2DA 5LMNW 1B1ZA 1NPRA 2SEMA 1OX8A 4DEXA 3SGIA 2DMOA 2O4XB 2KI7A 2ZPEB 2D1XA 3M55A 5IHKA 2HL3A 5GMKh 2M2LA 3HPWA 3QUIA 2EQJA 4AFZC 1PRTF 2NTSA 1I4K1 3JV3A 4KGXB 1OX9A 4FYVB 3CCQT 2P5ZX 1EY5A 8AT1B 3CCEA 1EU4A 2EOTA 4OIKA 3VU3C 2L0CA 2Y4XA 1HNXL 1STEA 2YUOA 3FEWX 3A1PA 3D4RA 4DAPA 2NVQB 1A63A 1HQMC 1E22A 4JI1L 3A5ZB 4IFDJ 4A75A 4QQGA 2L89A 4RGNA 1P16A 4DR7Q 3BFMA 1EEFD 2AQ3B 4II1A 1N34Q 4LN2A 4G7OC 1UEBA 2D8JA 3BYYB 3EBEA 2XVSA 5D3DA 3JB9H 2V4DA 4JI4Q 2Z0WA 1ESFA 1NNXA 2OQKA 4HT9A 4R55A 1IREB 1FJGQ 3CRKC 1DGSA 1KQSS 1NYGA 3DEPA 3RLNA 3CAMA 1GCQC 4QCLA 3OQ5A 1BBZA 2VY3A 2YHTA 2ED1A 5IP7G 3I90A 4K5WA 2C0OA 3AYHB 3L2UA 1XJVA 1VQ9T 1TXYA 2KT1A 1SMXA 5AJ3L 4JZ4A 3AU7A 4C92G 3SWNA 4ESRA 1TWHB 2HL5C 1GBRA 1YI2T 1G2SA 1I4HA 4DUYQ 2FVUA 2XG8D 2Z4HA 4G7HC 4FXDA 2EYMA 1XPUA 5E4WC 1H9MA 4KN7C 2ROLA 2K75A 2YTYA 5DLOA 3EROA 2CVRA 4JBMA 1EU3A 1N33L 1PHJA 1WHLA 2JA9A 2VQFL 3H0IA 3G4SQ 1RAFB 5M3MG 1N6AA 1C9OA 1B50A 3A0JA 2BTTA 2KCTA 4YHHQ 2OTLT 1SNMA 1W70A 1WOCA 2ID0A 2LKVA 1RIPA 3J80c 4BY1H 2GQVA 1S40A 1IL2A 3JB9J 1K8AR 2KHSA 5I6YA 3SWNB 4RMOA 2E2HH 4DV6L 2FMMA 4XQ3A 4A4HA 1VQ4A 4C3IB 4QVCA 5C44G 1H3HA 4LXCA 3EG0A 4EMGA 1HA5A 5GAHC 1GXIE 3GF5A 5A0GA 1Y71A 1ICWA 3CCMA 2AWOA 1PH2A 2LCLA 2KA7A 3HGBA 2A74C 1TUDA 1WTXA 2HAXA 5GAOn 4HN7A 1E1TA 2E64A 4HTHA 4QQDA 4QKUA 4MDXA 1LJOA 1KQ1A 4FSXA 4KT0E 1KC8U 1VQKT 2Z6KA 4AQYQ 2L12A 1XYIA 1SRUA 1X32A 2UU9L 1ZLMA 2G6FX 5A2QE 5FU7B 4KI0A 1YJWT 5LJ3g 4IKFA 3DKMA 4DR1L 1LT4D 2D0OA 4M4ZA 1MSHA 2K3BA 3FEOA 4F7UG 4ZN3A 3M9QA 4JPBW 1L2FA 2ZXRA 2JA8B 4OVAA 4C8QF 4QGUA 3HHTB 4QIWE 2L3SA 1G91A 5CQXA 1HZ9A 4JRKA 4FCYA 3RUZA 3S14B 2CP0A 3F2BA 2EYYA 1CKBA 3QKJA 4YWKA 3OYYA 1M4VA 3HP9A 2JEBI 3A7LA 3OS5A 3OYHA 3TCJA 3ZL7C 3MVVA 4KV6A 3VDYA 2DNEA 5A35A 1JMCA 4A93H 3S24A 2YRDA 2OTJT 2VXEA 1BI1A 3OYLA 3CCVA 1CKMA 1X3GA 5C0XI 2FEIA 2IX0A 3HOZH 4B3MQ 1HFGA 4WFN3 3MFYA 4KH0B 3P8DA 5M3FH 1X69A 4JV5Q 1VQ8Q 2KT8A 2QF7A 5LHY1 1GHKA 5C3XA 1Y96A 3PTAA 3A56A 4M78F 3OPOA 3G6EQ 2UUBL 2X4YA 3GNFB 3KF8A 1QVGS 1I6HH 5CAIA 1O80A 2EZVA 4PZ7A 5J3BA 2OTLQ 5GANe 3CXCA 4JG2A 3TQYA 4IOCA 3BZCA 1YNXA 2UXBL 1UE6A 1MSGA 4TRDA 1OZ2A 1C48A 4RKUE 2N78A 2RCFA 3HZXA 3LNNA 4JI2Q 1I94Q 2F0UA 4FIBA 4JI0Q 4R4OA 3UF4A 4O1NA 2ZXOA 3OA6A 2NN6I 1D1IA 1E1OA 1WVLA 5JAVA 1M1GA 3K7AH 3P1HA 4PZ6A 4LFBL 4JJNK 3N6RA 3OY9A 3K7UC 3U4VA 3UA6A 1KC8C 1Q3LA 2NUPB 4ELZC 2B8AA 1U5SA 1Y96B 5DY9A 3H6MA 4KD3A 1FR3A 2ATWA 5D3IB 3KF8B 1BB9A 1VQKQ 4FL6A 4PFZA 1VMCA 2YUNA 2WSFE 1YJWQ 1X3EA 5IXFA 4HCEA 4GKJL 4HJ7A 2D6FA 3K5MA 1M3CA 3HFOA 4XQNA 3Q24A 1MV3A 2IHEA 4OIJA 4F16A 3R6OA 3E9IA 3S1MB 3K8AA 2AT1B 2VV5A 3MEFA 5F2DA 2E5LQ 3K59A 1C0AA 4YCWA 2A6HC 4AFUC 3OW2P 4DPGA 2RSOA 5CORA 2CP6A 2HQEA 2X4WA 4PJOA 1OI1A 2YWWA 3M4GA 2KEEA 4NW2A 1QW1A 1AP0A 2PQAA 3JCMe 2B2YC 2N55A 3ONAB 5J26A 4CDEC 2OTJQ 2LX7A 1KD1U 4OB2B 3G4SA 3CCJQ 1NE3A 1GFCA 2DVEA 4LUOA 5EKLA 1STAA 1J9OA 2E70A 2L0AA 2B2TA 4C0DC 1LABA 4XU1A 2DRMA 1BU1A 2N3SA 1VUBA 2RK1A 2VVKA 1LTLA 3KLSX 1E7OA 2MCNA 3G48A 4IALA 1BO0A 4E6IA 1KIXA 1R0BG 4BE1A 3CC7A 2KHJA 3MEWA 2GGRA 3M56A 1CSKA 3EA6A 3GD7A 4JI6L 1LOJA 1VYUA 1TS9A 3SFMA 4PJOB 5D6WA 4DN4M 2F2XA 1YEZA 5GAEC 1HR0L 2OAUA 3GTOB 2EYOA 2UUAL 3URGA 4I7AA 5CBAE 5LMNQ 4HKEA 3KUFA 4R8IA 5FO9B 2R6GA 3RLFA 1LT5D 5LMUL 4BS9A 1N8RU 3UPUA 1S72T 4HJ5A 2E8GA 1CZGA 2EKOA 4GN5A 1PSFA 2LCSA 3M0UA 1R4PB 2B63B 1SE4A 1Y07A 1QCOA 3NTHA 2EJFA 5AYFA 4KRTA 3SE0A 1SHFA 2RPNA 4XTXA 5I21A 2OT2A 5EG2A 1PYSB 4NPSA 1C7YA 4QW2A 2K7AA 1CKNA 1G51A 3CEYA 3HRTA 2RK2A 3QOLA 3E3XA 1TS4A 2HHHL 1OEBA 1AWJA 3REAB 1KDAA 3JCMg 2JM9A 2X9HA 4HIOA 1VQOA 5IP7H 2E75C 1ZUYA 4Z02A 1VQ7T 5DM63 2FPDA 2RMOA 5KEEA 5M5WB 1AZPA 2DTOA 3D6WA 3H3VC 2LQ8A 3KDFA 1O9SA 1K28A 5KYXA 1M8VA 4IUVA 1IKLA 1VQJA 4UDUC 5GANd 4C3IG 1BF4A 4J8OA 2KCNA 3LGFA 4D8DA 1Q86R 2JA5G 1U1SA 1FYNA 4HVVA 4Y92A 5CKHA 2BDNA 3PGGA 1EY7A 3GTLB 1KD1C 1ZYRC 1PH8A 1CKNB 3CD6A 3LLRA 1B34A 1VQ8A 2XRQD 4UP7A 1NEGA 2R92G 5M3MH 2VQEL 2D8HA 1OXVA 3IL8A 3G6EA 2ZJRA 2LZ6B 1K9MU 3MXNA 1SHGA 1X65A 4QMGA 2ATCB 3GPLA 2VWFA 2E76C 2EYZA 5GAN6 1SNQA 2JA8G 2OTLA 1KRTA 3RBBB 5HKCA 3NBHA 2B86A 1EYDA 3R8BA 4JUVA 2F0PA 3SD4A 3PVQA 2PCFB 2MUYA 4TSSA 1RAAB 2JP1A 1PWTA 4DR5L 4NXML 2GCXA 3I4OA 4CHTB 5C44H 3S1QB 2KQ3A 2RQUA 3A74A 4IIOA 2QEXA 4FVMA 1N32L 4MN3A 3HOUB 4A3LG 2JA7B 1SRMA 1PTOB 3L9AX 4X66Q 1B34B 1LPLA 2DFUA 2LTOA 4B9WA 1VQPQ 1N8RC 1NUCA 2DIQA 2K5NA 3J81L 3K5LA 2YLCA 1EX4A 1RHPA 4OX9L 1BCOA 3Q0AA 4JJBA 3CCUT 4GNXC 5FJ8G 3R6NA 4F04B 1FXXA 3GTJB 1LTRD 1UGPB 4M7DC 5GAOm 1VQLT 1X43A 2A0FB 1KQSP 3PMTA 3JCMf 4FF2A 2C06A 1WPYA 2L4NA 3NBHB 4MMLA 4DR6Q 1V43A 5C5MA 3AT1B 3PT9A 3FP9A 1WTQA 2FB7A 4B3TQ 3CPFA 4DF7A 2ZGWA 2QAZA 4JZ3A 5IH2A 4M7AG 1CFMA 2IIMA 2V1QA 2YUQA 2XIWA 4LFAQ 2CKKA 2EY2A 1LO5D 3Q1JA 1VQ7Q 5GAGC 2O01E 3JAML 5CGKA 1ZYRD 1K8AU 2A68C 1E3PA 4K14A 3B6YA 2CH4A 2FO0A 4E47A 2HIVA 1GHJA 3EVQA 2E2IB 3E19A 2BZ8A 2XKOC 2FZKB 4RCBA 5GAMe 2OTJA 4YCVA 4DR7L 2C5CA 3CCJA 1EIFA 4OXPA 1N34L 1AOJA 1OPLA 2OEOA 3S2DB 1WFWA 1RADB 4LD9K 4M7AC 2DRKA 3OYCA 4JI4L 2GTJA 1K9MC 2MNAA 1F9PA 4K6LA 4DOVA 2N88A 1STBA 5JVG3 1FJGL 1I1JA 2EDGA 1L1OC 1G83A 3TZDA 2L9HA 4OB0B 1FMVA 4HCSA 4ELYC 2OJ2A 4J9FA 1EIGA 3H15A 1UFFA 1YITA 1UE1A 4DV7Q 4GOPC 1JQYD 4BDYA 2IVWA 1OTCA 4M78D 1MGQA 2WFWA 4DBFA 2PZUA 4K5VA 2ED0A 1SFOH 2DL3A 4DUYL 4A3MB 3AEVA 4M75B 5CYUA 4M7DD 2XICA 1XMQQ 2D2CC 1QVFA 4A53A 1BCPF 4RTYA 3L2PA 1M8AA 2IPOB 2O9VA 1UGVA 3BDCA 3RERA 1RI9A 4P74A 3D7SB 1MUZA 5HK0A 4N9TA 2HQXA 2PPBC 1G2TA 2K9GA 3TREA 2YT6A 1WXTA 1SYCA 4EQPA 4IOAA 1LT3D 4OO1H 4RTXA 2IG0A 3MCAB 2HDMA 2RKSA 2KUMA 2F2VA 3GTMB 4OMQA 4ORZA 1G291 1GUOA 4DK0A 4YHHL 5D6XA 5GAMg 1GOZA 4Z9CB 4A3KH 1PLFA 2Y0SG 4J15A 1HQRD 4GS3A 2VB6A 3H8ZA 1LM0A 3ZEHA 4EPCA 1K76A 1Q1EA 1V1QA 2F0JA 2MK5A 1JXOA 2DZ9A 2DERA 5C4HA 1HPCA 5C4ZA 2HSPA 4PJOG 1K8AC 3CCST 3M57A 3VR5A 2Z8LA 3OYAA 1LTTD 4BBRB 1PDQA 1V29B 3W3AA 4X3UA 3D4DA 2K6DA 1PH1A 4XTYA 2B63G 1VIEA 3EGXB 3RKWA 4AQYL 2QI2A 3MAQA 2LMCB 2CP2A 1AEXA 5A0LA 3HP3A 1QVGP 2K04A 3EG2A 4CJ1B 1ZUUA 3S1RB 2F03A 2ZPFB 2YYZA 1HJDA 2F0MA 3EG9A 2F0TA 1HK9A 2K05A 3D4WA 2ESWA 2VYTA 3EFRA 3CC2Q 4XTUA 1BDOA 5EPKA 3PO2B 5KNDA 1TS2A 3ULLA 4EX5A 4DR4Q 1CA5A 1TWHH 1WXUA 3E9FA 3P75A 4HSPA 1VQPA 2MIOA 1ZA2B 3NHHA 3EFOA 2B39A 3NEMA 1JE4A 3J7A5 1D5ZC 3E6ZX 1BVSA 3LWEA 4AIMA 3H3VH 4B3ML 1YBYA 3FB9A 2F5TX 2A6EC 2FFKB 2H4OA 3OTOQ 3P8BB 5GAMd 2V8IA 5BR8Q 1R8OB 1WYXA 3KF6B 4XTCS 4JV5L 3MEAA 1D09B 2LQWA 1VQDA 2F0NA 3D8GA 3FPPA 3I35A 5GAMf 3RKXA 2F0HA 3EG9B 4ZCKA 2MHVA 2YU9B 3S15H 2RNAA 2BE7D 3NPPA 4HR7B 4RHSA 3UDGA 4N0AA 1E6HA 3TP8A 3A8LB 5HCKA 4PJOE 3V8LA 2L1BA 3MC0B 1T5EA 3PO3G 2L3RA 2KE9A 5ELDA 4JI2L 1NJIU 3EFOB 4GLMA 1I94L 1IGUA 2X51A 4JI0L 4CC2A 2JA5H 3UE1A 3HOUG 4JYAQ 3JCMX 2Y90A 1ABQA 2JA7G 2RF4A 3QDRB 1SEMA 3EG3A 3K5OA 4DQ2A 3CCSQ 4K8JA 5ISRA 1MHNA 2QDYB 3DLLA 4BE2A 1TXQA 1VQ5Q 2VUMB 3M7GA 3PUYA 4RA8A 5I2XA 1IL8A 4LUDA 4Q5VA 4A54A 2R92H 2QK0A 4KULA 1X6OA 5GAOr 2GVBA 2HD0A 2LSSA 2MAMA 2QTVA 2Q2TA 4LF6Q 4IN3A 2YXYA 4LDUA 2XHCA 4HVUA 4JOIA 2JA8H 1V1PA 5FRNA 4L6TB 4C2MB 1MJEA 4IUQA 2CREA 3CCLA 2M0OA 4JS4A 3S14H 4XQQA 3DMUA 4WF2A 4QIWB 4C0GA 4QUCA 2M1HA 5JJIA 3U9SA 2HCCA 2E5LL 5GJWB 5DNFA 3BZKA 5DLQE 2KAFA 3CC4T 3G71T 4A3LH 1QNUA 3L2QA 2A6ED 2LNHB 4DV2Q 2MI6A 2KRMA 4GBQA 5CK9A 3S2HH 5FKAC 2BZYA 3L2VA 5FJ8H 2SEBD 4JC0A 1Q86U 4KN4C 2DBKA 3URYA 2WIIB 4WCIA 4E7JA 1CHQD 2DY7A 3N52A 2BZXA 5EC7A 1G2BA 2EJMA 1CQVA 3OIPA 1HA6A 3EQLC 4P71A 3TN2A 1MI2A 2Q2IA 4FYXB 2KBNA 3V7SA 2I46A 2LP5A 4ABNA 2CDTA 3BYTB 1Q8KA 2DD4A 2J06A 1A6XA 4A3CH 4E7IA 3JB9D 3SK5A 2DO3A 3PMFA 1JJGA 1NLOC 1I5OB 1NMFA 1NJIC 1IKMA 1EZ8A 4EMHA 3A8HB 1V76A 1SPKA 1GO3E 4A3GB 3JCMc 3VS7A 4D8KA 2LY7A 2QQBA 3HRZC 1SYFA 2DJFC 1ICFB 4LDXA 4JVZA 4R9WA 5LMNL 1RAHB 4A3MG 4M75G 4AG1C 2RQTA 3OHXC 5IE8A 3FKIB 1VCIA 4PZ8A 2CZ0B 2NN6G 1QQJA 4BXXG 2XWJB 2JTFA 4FP5D 1LTAD 2P0QA 5CV6A 1RKNA 3V2TA 5IGGA 3M7NA 4GZYC 5EKIA 4F87A 3C0CA 5CKBA 2COYA 1UE9A 2EYPA 5IYBG 2OWOA 4K2KA 1RODA 1DJRD 4FYDA 2CFMA 1QWYA 3CC2A 3EFSA 3SK4A 4F88A 3QZ5B 3S1MH 3C46A 4FYWB 5IXBA 5EJWA 1Y0MA 3RMSA 1S5FD 1CA6A 1Y8OB 3L2RA 4B3RQ 1D1AA 1VQGA 1MMNA 1AN8A 1JQQA 2EAYA 1RF2D 1T9HA 1ZXTA 5IAYA 5KYNA 4NB3A 1EEID 1R77A 4QB4A 1LTGD 3G71Q 3RIRA 4IPCA 1DONA 2E74C 3OB9A 1Q86C 4O5VA 3I55T 1HYOA 4XDXA 1YJ9T 3LX7A 3SEBA 1TU2B 5T1GA 1U3OA 4EMKC 2Z6BA 2DUDA 4M77C 1ILQA 4N4IA 4RTUA 2AKKA 4F7UF 1YJNT 4WORA 4C56C 4OHJA 4E6RA 2NZ1D 4X65Q 3K57A 1K3BC 1A62A 3META 5C4JH 1VDZA 1N27A 1S5CD 3PO2G 3MPUB 5FOBB 2A08A 3VYHB 3OMCA 4KMUC 1N8RR 1ASYA 1W2BS 3GTOH 4FYYB 1AD5A 1WA7A 1X9NA 4M75E 2EXDA 1W4SA 4U68A 1QMCA 2NBFA 1GRIA 1UG1A 2F1MA 2ZTCA 4X66L 4JBWA 5I2YA 2P4RA 2UUCL 2LJ0A 1VQ5A 1HTLD 5NUCA 3J80L 4POFA 4C3HH 2EFIA 5GMKj 4KKTA 1QVPA 2XSCA 5C5LA 2B63H 2A69C 1Y1WB 2RB6A 3P20A 3RZDB 4KD4A 2JK8A 1BBXC 1ABOA 3TRZA 4OGEA 4PNYA 1PRTB 5I2SA 2B2YA 4LWCA 3UDCA 3RUXA 3I8ZA 3CF5A 3M0SA 4DR6L 1ARKA 5IYDG 5LJ3j 5IY0A 2LXKA 1VOMA 1CSPA 4A3FB 1GJXA 4B3TL 2B2UC 2MGSA 4V0BA 5E4XA 1OXUA 1JT8A 2QGFB 2DKGA 4LFAL 2MJ8A 1YHQT 1WX6A 1JR0D 1H9JA 2QILA 4HJ9A 1ENAA 4N4GA 2PVDB 5DM7R 1IXDA 1B53A 4LW1A 4B3SQ 3OS0A 5LJ3h 3LYIA 4EGVA 3T1YQ 4LMQD 2F0SA 2AZVA 5IGCA 4DAYA 1EFWA 4M77D 4NDXA 4TKOB 5DM73 3GTLH 1K9MR 1YIJT 2VUMG 4PKCC 3AB9A 2VC8A 3CQZH 1I4RA 3EHQA 3A8GB 4KK7A 2JOYA 5C6SA 3HRSA 3C1FA 1ZBXA 2BCOA 1F9SA 3I55Q 2B2WC 1YJ9Q 3T16A 4LK1C 2L5QA 4K0KQ 3QYHB 2K5LA 3WDNA 3HL8A 3C2PA 3NPFA 3PF4A 3V8KA 3A8JE 4IO9A 1WHKA 3PIO3 3EH1A 4DV4Q 1T3LA 1IYVA 4TVRA 4C0ZA 3PO3H 4DV7L 3WOEA 3RESA 2LJ1A 4IIMA 3OOCA 3S1QH 5M5XB 1K83B 1SSOA 4BA2I 4DAYB 4LF5Q 3HOUH 1UAPA 4HIMA 4Y91A 3RZOH 2JA7H 1T5XD 2LFNA 1PTOH 2A69D 3AQQA 3TBIB 1DCZA 5JJLA 2DLPA 4IPGA 1XMQL 1R4QB 1RL2A 2PNRC 5HURA 1ZX6A 4ZQ3A 2BDOA 4G57A 1I81A 2XN9C 4ZUIA 5JJKA 3GTJH 5M9OA 1QJOA 4Y7NB 1CQFA 3M3YB 1EY8A 2KR3A 1DOLA 1F1BB 4UY8C 2JTEA 1QILA 3I56T 1UEAB 2JJ9A 2LX9A 2X4JA 5J39A 1NLPC 3TU4K 1LV9A 2NVYB 2RH2A 2V8JA 3H6ZA 2VGNA 4C92C 2R57A 4RTVA 3CPWA 1O78A 1TWCB 1VMPA 4PLLA 2RQRA 3PV0A 1HTPA 1YNZA 4PV1C 5KYUA 4CC7A 4C8QA 4RG8A 1EY0A 2BE5C 2WP8J 1GBQA 3OYIA 3RLOA 4Y28E 1H95A 3WXMB 2V26A 2PO4A 4L5TA 1AH9A 5IODA 3JCMJ 3RN5A 4P72A 2DZCA 2QQSA 1QCNA 2JSOA 2OCEA 4DK6C 5HGTA 2HDLA 4A3GG 3CCQQ 4ZGEB 3HG9A 4LE9A 2YTVA 1MD2D 1DM0B 3VS4A 3JCMP 2KEDA 2E2IH 1WI7A 3UWNA 4DBQA 1M1FA 3H0FA 2WAQB 4KH1B 2QGQA 2QQRA 3WVDB 2JEAI 3J80i 3QO3A 1BYMA 3TEHB 1E2WA 3HOXB 3D6CA 4X62Q 2CGHA 5FU6B 1UHFA 3VUBA 2QA4A 1ESRA 3VRYA 1MHWC 2PU9B 1S5DD 4C8QB 3CMET 1MJCA 2AWNA 4M78A 1K0SA 3KBXA 2CP3A 1VQNT 1QVCA 2M00A 2J05A 1UE7A 1FYCA 1VQHA 2F0QA 4XK8E 3ZJYC 2VXFA 2Z0SA 1R9TH 1D1CA 5CQYA 5CV4A 1SSFA 2LQKA 1RTNA 3L42A 1NEBA 4OP0A 2KEAA 4FF3A 4J9HA 4DR4L 2DYBA 4O0AA 1VQ9Q 3A98A 2JUFA 9ATCB 1XNRQ 2K5WA 2QW7A 1B07A 2F0GA 4BXXH 2DL4A 2NN6H 3FJ5A 4DUZQ 3TVTA 1YCSB 1YI2Q 1GUGA 1I6VC 3IAYA 4C5EA 4C92D 3K0YA 4M78B 3OYFA 3S3NA 3OTOL 2DF6A 1IXRA 5BR8L 1NE8A 5D6YA 1I4XA 1WCMB 1WD0A 2A19A 4C1NK 4X64Q 2OX7A 1U4LA 4NMZA 5IT9L 2DK3A 5IYBH 4BY7G 3OYNA 1QOHA 1ZSZC 3K6OA 4FDBA 4UP8A 5C0XJ 3HOWB 4BB7A 3I56Q 4B9XA 2K33A 2MO1A 2DN8A 1FVIA 4M7DF 1B3QA 2LNVA 2E12A 1WI5A 4RG1A 1QWEA 2YRVA 2O2LD 2Y4YA 1SNOA 4H0LC 3QJYA 2P0KA 1OXTA 1GL5A 3SK8A 1L1OA 2O5IC 4G4KA 3F70A 1CTMA 1SMYC 5EPJA 4JYAL 3Q6SA 4MMKA 4XXEA 2RF0A 2AQ2B 6AT1B 2CWAA 1WTHA 4GOPA 3WVEB 2E2JH 5E1FA 2EYXA 1TUCA 5GAN2 2EYLA 2FZGB 3NGPA 3NSWA 1G3YA 3T13A 3JCMh 1Y1WG 1K8MA 1SE3A 2Q2UA 1STGA 1UJ0A 1X6GA 4OEMB 1YJ9A 3FLGA 3K0XA 5CKDA 2MPXC 3UT1A 2JNGA 2ICEC 3R3OA 4LD6A 4LF6L 3KOJA 1PKTA 1W6XA 4AG2C 2H1EA 3S1RH 1X3FA 1JJ2S 3CMEQ 4M7AF 4A3FG 5C4XB 4E7HA 1A3TA 2ES2A 1VQNQ 4MTNA 1PXUA 4OMLA 2FPFA 2ZPBB 2L8DA 5FRMA 2F3WA 3VYSA 4N9PA 2UXCQ 2XI9A 1FNWA 2VUBA 2BUDA 2RQXA 3VR3A 1VF7A 5LL6S 4PFPA 4DV2L 2R61A 3NMZC 4WTOB 1TWAB 2SNSA 1Y1VB 5GANg 1YHAA 1SG5A 2NWMA 2QDLA 2G5DA 5CBEE 4D6WA 1NR4A 4KGVB 1H9SA 1UWVA 1XX8A 3GTQH 4BY6B 2DXTA 4EQ5A 4DV1Q 1C1AA 1B8AA 2JS0A 2C0TA 4DGZA 3M4OB 2RQWA 2KENA 2R7ZB 5IYDH 3KUPA 1NJIR 3PGZA 1WTOA 1D2BA 1IRXA 5HK3A 2AKWB 3O5ZA 3QZ9B 1SMYD 1TWFB 1WGSA 2JE6I 4QF4A 4GKKQ 1J8IA 3MXPA 1C6VX 2JMAA 1KDBA 2LT1A 3TQ7P 1KLUD 1YVCA 2EYJA 2K1BA 2WSCE 5LL6X 3CCQA 1KABA 1BIBA 3FDRA 2PQAB 1TY0A 4J9EA 1K9AA 3DWQA 4E2FB 2AQ1B 2WKDA 3QWXX 5IT9E 1H9SB 1SR3A 5IOCA 4OMPA 4YCUA 2HBPA 3HKSA 2JMCA 4A3JB 1H8KA 1AVZC 2CP5A 5G3LD 3T56B 2HMAA 3ME9A 2A36A 2F4IA 2KRNA 4IUPA 2K79A 5M5YB 4I7ZC 3NENA 3GO5A 4TQUS 3I91A 1SNPA 4L5GA 2JTMA 1PFSA 3CBMA 4GLKA 2DJQA 2G3RA 2NVTB 3ULJA 3E2UA 1Q12A 1PZJD 2A6HD 2EQUA 3VJPA 4JI8Q 4LF8Q 4QL5A 2QCPX 3OYJA 1SEBD 1W2BP 4QUFA 1ZEQX 4J83A 4B3RL 2D0NA 3CCRT 1VQ9A 2JW4A 3VUZA 5KYYA 2J6KA 3DWAA 1STYA 3PNWC 1BK2A 1NBWA 5GANf 2XWBB 4RKLA 1PH3A 1YI2A 4FNFA 2WAQG 1YZ6A 1OOTA 1WLPB 4F14A 1P8LA 4B6MA 3V7CA 3HKZB 4HEDA 2JJQA 3QG1A 2L3PA 3HOXG 3I2ZA 3QDFA 3SWNC 1NAPA 3F2UA 4G7ZC 4JBJA 1N5ZA 1WQWA 1HXYD 4CKBA 4ME3A 4O6JA 4C3JB 1CUKA 5GQOA 5ELBA 2DE0X 3ULRB 4C8QG 3CHBD 4H02A 3MEVA 3PCOB 3OSVA 3EJIA 4K8IA 5GMKm 1VQMT 4RCOA 1GFDA 3KDFB 4X65L 2UUCQ 5KYXB 5FW9A 5KYYB 3IKJA 1JXMA 1HZAA 3CBPA 1N9SA 1D5XC 2YTXA 3K81C 3TP5A 5GAMj 2R58A 3QPHA 2VKNA 3CQTA 2H5XA 3DM1A 4QQBX 4PQXA 1AFPA 5FU7C 5KYLA 1C8CA 1PFBA 1JBMA 2EQIA 1EY6A 4DBRA 2QQ9A 4HCZA 3PVLA 3RR5A 4XYQA 3VYRA 2IJ0A 4TVAB 3S6WA 4L8JA 1LT6D 3S17H 5GAMh 3MXNB 4UHVA 1S5ED 3JB9F 1HHVA 1IZ6A 1WHJA 1WXBA 5T1IA 1S72Q 2D0QB 5KCHA 1WCMG 3AFPA 1VQKA 3NXWA 4KLKA 1WTPA 3L7ZC 2KQWA 1PRMC 5IN1A 4JRPA 2RDFA 1YJWA 3HOWG 2LVMA 1G3TA 3CMEA 4DXFA 5ELNA 5IGDA 4JBKA 2XK0A 4XT3B 2IL8A 2XDDA 1NR2A 3F2DA 1PA6A 2DA9A 1V1CA 5AT1B 3H9NA 1HR0W 1X2QA 4KGZB 7AT1B 1BIAA 5TSSA 2YSQA 4QVZA 1D8LA 1JWSD 4E7ZA 5I11A 4OWTB 2TMPA 3EGUA 1XNIA 4B3SL 3A54A 1AEYA 4O2DA 2PQEA 2JA6B 2HBWA 2GN5A 3BDOA 2WAQE 3X28B 4RH6A 3T1YL 4ME7A 3V05A 2TSSA 3U50C 2HEQA 1XQHA 1WHGA 2L2PA 3CXCS 4PFOA 3DB4A 4RCCA 3VV0A 4BBSB 2KROA 1SBBB 2FXQA 2CSIA 1CSQA 1UB4A 3GTKH 4BY1B 4C8QE 4EIKA 1HFNA 2KECA 2E4HA 2RJEA 3H94A 1LCKA 5CCAA 4UPAA 1GUTA 2VS1A 3SVMA 4K0KL 1SNDA 5FO8B 5KGUA 5CVIA 5CC4A 4DR3Q 5C4XG 2CT4A 4DV4L 3PO3B 1XNQQ 3L3OC 2FINB 1VQMQ 4ZKBB 1C0MA 2COZA 3A8KE 4LF5L 2SRCA 1BCPB 3O13A 4R1JA 5CR3A 2YRCA 5I9PA 1ASZA 3HSBA 5ELCA 4OWXB 2AHJB 2RSNA 1WTWA 2DX1A 2EKHA 3MP1A 3VS6A 1Y1VG 4M78E 5FLMG 2JM8A 3VS3A 4LNQA 1Y1WH 1C4QA 4RAUC 4FU6A 4E7SA 2HKQB 4ZUJA 2BH8A 3RDVA 1F2YA 3ND8A 4IZ8A 3OW2A 3WWVA 2KDSA 3CCUQ 2KYMA 1B9MA 2FMCA 4WRDA 1PM3A 3UE0A 3I9QA 3S9WA 3I72A 2JT4A 1G5VA 2R7ZG 1TG0A 4RGMA 2ASBA 1VQLQ 3QYGB 4A3FH 5C3EB 1K1ZA 3J81E 1F9QA 3KFUA 2B2VA 3NWTA 4M77A 2EY5A 2A68D 3SXHA 5FWBA 1AE3A 4A93B 1AZGB 1X75C 1A15A 1WZOA 1MBYA 1WFQA 2AMCB 3PQIA 4UAIA 4EQNA 1PFMA 2IWHA 4M8AA 2IPKD 3HOZB 2LRQA 5GMKi 1S3OA 5GROA 4RKBA 2NVQH 1U4PA 1K0XA 2VB3X 4OGQC 4EDUA 2ZCFB 5M3FB 1M30A 5GJVB 4A4KA 4M7AD 4NL2A 5E3FA 1BNZA 3SB2A 1PC0A 3CMAT 2X6LA 3GLXA 4A3JG 2NUTA 3X20B 5I22A 4BD3A 2L55A 1KJWA 4ALPA 3VS1A 3PE0A 4H7BA 3F8TA 1K3RA 4X62L 1Y7XA 2YLBA 2RA4A 1GCPA 1VQCA 2EYHA 4MNOA 4PJOC 3JAME 3OBYA 5D65A 3T9NA 3BG3A 1CI3M 2HQHA 1Z6HA 4KBMB 5DAUA 4GLVB 1WJRA 4DU9A 1NCVA 4M77F 4E7KA 1KL9A 3GTPB 3HOVB 1JCKB 1BI0A 2LXJA 3A55A 3GBQA 2RJDA 1ZUKA 1EQTA 1K83H 5M5XH 2CCZA 2E6NA 3K7AB 4DV0Q 2B2TC 2V1RA 1ZKOA 3EN2A 3A8OB 2F0LA 4CKCA 2NUTB 4OO1I 1XMOQ 2VNUD 1H3ZA 1XNRL 3G1JA 2EVBA 1SSHA 2O9SA 4R4IA 4DUZL 2VGMA 4KY7A 4X1VA 1Q95G 1TT2A 1TY2A 3M3YH 1I50B 1S72A 5EQ0A 1KDCA 3QOJA 1TU0B 4QJFA 1LLRD 2CSQA 2KMTA 4FT4A 3CCET 1JB3A 4C3JG 3S1NB 2B8FA 4X64L 4ATOA 1JJ2P 3OYDA 4DOWA 2MP1A 2NWGA 1OV3A 3RMQA 1QE6A 5LJ5e 2NVXB 2NTTA 1EWCA 1A8VA 2QDBA 2EJFC 2RVLA 1QUQA 1B7TA 4DBHA 2K7VA 3PMIA 2B2WA 2C35B 1ET6A 1ZSGA 1VQ7A 1H92A 1SYGA 1YN8A 1SXTA 2PQWA 2VXWA 4C3IH 2F52A 2XU8A 1PHTA 2K4YA 2K57A 1GCQA 3K5NA 2COWA 4ZGDB 5L37A 4J7FA 2Z1CA 4S3SA 3QIIA 3QJ6A 4LDYA 2MF2A 4KJOA 1M5Q1 4HCKA 3UI2A 2DEQA 2I0QA 1N9RA 4PJOD 3G7LA 1I3QB 1ENFA 3GV6A 2PUOB 4JS5A 1M8MA 2F4VQ 3PUXA 2J7IA 1OO9B 2Q2HA 1HNWQ 1F77A 1STNA 3TZUA 4Y52H 2LQNA 3MFGA 2EQKA 5CKEA 1B70B 1II3A 4PMWA 1K0RA 1QUQB 1Y14B 2LC4A 1BI3A 1PTOC 3S3OA 3H3VI 1PMRA 2F0FA 2UXCL 1KQSA 4ZLTF 4C92A 1EIYB 1ONLA 3EIVA 2CW0C 2CKZB 4DV3Q 3CRLC 3TDQA 1TVXA 3NBIA 2JA6G 1EWIA 5LJ5g 2L3QA 2E3IA 4XTWA 1CT1D 4ANJA 2A37A 5L8RE 1GKHA 1UGQB 2M16A 1U5KA 3HKZE 5JOBA 2MO0A 3NQIA 3I70A 3NE5B 1B2TA 4X3KA 2QGGA 3FJPA 2EQSA 5C0XG 4BBSG 2RI3A 2CQAA 1KXLA 3FPUB 2PUKB 2XRSD 3T51B 3HS0C 1H641 1OU9A 2DL5A 2I2LA 2MMPA 3CCUA 1EY4A 3FMCA 4BY1G 1O7ZA 1V1PB 3VS0A 4DV1L 1WJSA 1HUMA 1IBLQ 2ZAEA 1VQ4T 3HOWH 5IWAQ 5KCOA 1VQLA 1X56A 4OMNA 1HZCA 3OSSC 4OMMA 1VQBA 3CCMT 1M90R 3BDUA 2K3XA 4RTTA 1AW7A 1Z47A 1F2ZA 3MKDA 2D5DA 4F7XA 1M3AA 2BH2A 2V1CC 3Q8DA 4C92F 2K50A 4BE0A 1HNZQ 3CBOA 3JCMW 5FLXL 2DXBA 4XTVA 5CIUA 1QNKA 1D3BA 5KIXA 1MMDA 4DFAA 5M3MB 1RAEB 1ET9A 1LTBD 4CDCC 1I4PA 2P84A 1W6KA 1PRLC 3LWHA 2YDLA 1X2KA 4A3IB 2J6FA 3MZ5A 3R2IA 3DUZA 2F3VA 3QBYA 1CK1A 1PTOD 4KHPQ 4CC4B 3M53A 4IUNA 4F7UA 4RUGA 5AJ3Q 5C0MA 1QVFS 3MEHA 4CKEA 2HUGA 4R4TA 1M3BA 2WINB 5C3EG 2JVVA 4M75C 4QVDA 2PW7A 3CCVT 4XQJA 3SEMA 1B7YB 4JI8L 2F3IA 5C3WA 3E0JA 4LF8L 5LJ5d 1NSNS 1X27A 5GAOp 1UDLA 2QTXA 2EY6A 2RHZA 2R3ZA 4J5YA 1S4ZA 1D3BB 1ZSZA 1I4GA 1VIFA 5LJ5f 1K73U 1V8QA 2Q8TA 1Z9FA 3T4AC 1S1NA 2F5KA 1M1KR 1BCMA 4BBRG 1TOVA 5GAN5 2AUKA 4ILWA 4WJ4A 3I5RA 1J3TA 3CC4Q 5FLMH 2CZ7B 3OWEB 1XPOA 1N36Q 1AZEA 1D5MC 3I4MB 4FXGC 4F7UB 2RHQB 5IIFA 3BVZA 1AHJB 1Q46A 3MA2B 1B44D 3M0PA 4R4QA 1NYFA 4DXGA 2CWPA 1FNVA 1O75A 3VYUA 3H0HA 1EOTA 5GAN4 3GDEA 1TWFH 2EYFA 2ICIA 1HSQA 1VQ4Q 2GA4B 3HOVG 4AYBB 3PIPA 1GVPA 1QP2A 4CI0C 2XDBA 4MZMA 2JYOA 2ZT9C 4EQOA 4A3DB 2EPBA 3PF5A 2XMFA 2PTKA 1F2LA 1QVGA 1NY4A 1VA7A 3J7ZC 3CCSA 2DILA 4K11A 3CXCP 1Y69U 1YFNA 5IP9G 4A3JH 1V9PA 1JJCB 2R93B 1DD2A 1AWWA 1R0CB 2HNIA 3BY7A 2CH4W 2P0PA 2V8KA 1I4QA 3FVQA 2ZPHB 2NZOA 4M75D 1RTOA 2DETA 2O4XA 1XJWB 3OYGA 1SYBA 1EFID 3OYKA 3H41A 2K5QA 4L63B 2K2MA 1G3WA 3E1SA 4JDSA 3JC66 3MO8A 4NXNQ 1IO6A 4BACA 2J7ZA 4JRIA 4OMFB 2JN0A 5GAOl 5M5WH 1ZBJA 3TSZA 5G3LF 2M0YA 1OZ3A 2DL8A 2KXCA 2X35A 1K73C 2YUPA 3O8VA 5ELOA 3CCVQ 3OYBA 3G4ST 2UXDQ 5CV5A 4XAXB 2RDHA 1IBKQ 2O2OA 1QKWA 1FX7A 2D9UA 1LACA 2DNCA 2EXZA 4DA2A 2K01A 2L11A 3NWSA 2C9OA 2FJ2A 2F2WA 3DXJC 4ZTFA 3KLSA 3J81j 1H9KA 4A3EB 2RDGA 1HUNA 4KY6A 2ZM6Q 5IGFA 2QG9B 3GQBA 3K80C 4DNTB 5CR2A 4PLIA 2ZZDA 4OONA 4YY3Q 2ENMA 1JRIA 4IFDI 4ODGA 2DL7A 3CC7T 4C3JH 1PV4A 1D7QA 4A3KB 4M77E 1RACB 2DM1A 3LW5E 1I0CA 2A8VA 5A2QL 2ZTEA 3FIFA 2KSSA 2EJGC 5JEAG 4PJMA 1A2UA 4C0DB 2E1HA 1YJNQ 4DR3L 1IBMQ 4ZTJA 2PZTA 1OYXA 2MWOA 3L1AA 2KCMA 3VYGA 2C0IA 2HDAA 1NMGA 2MPMA 4X3TA 3RN2A 1XNQL 2CP7A 1G3SA 1SAPA 3A5UA 3BDLA 3M0QA 1U06A 4JI5Q 1JO8A 3S16B 1EWHA 4DKAC 4A4GA 3H91A 1BXTA 3C4SA 2MYSA 2XD0A 4L5RC 3IRBA 4N0AC 4LAAA 5K36G 2ECZA 1JB7A 2WV6D 2PNHA 1WJQA 2HQLA 4QY7A 3M85A 5CV9A 4J6XA 1VQOT 1PH7A 5GMKe 1XTCD 5AFWA 2PMZB 3SR1A 3P8HA 1KHCA 4PMCA 2PZWA 1T0HA 4N4HA 4ZRZA 1PYBA 4RTWA 4UP9A 4J6WA 2X69A 8ATCB 4X34A 3I3CA 1KRSA 1PYWD 1XXGA 3VR4A 1WNLA 4BY7B 3W1BA 1ILPA 5LJ3e 3G7ZA 2FRYA 1BQQT 1FD7D 1JORA 1IW7C 3BE3A 1SE2A 2PI2A 4MZ9A 4HIKA 3J80E 3QXEB 1PZKD 1RJTA 1TQOA 3CD6T 1JEGA 4JW0A 3PUVA 2NUCA 1VQ8T 2N49A 2ZJPA 1J6QA 3JB9I 3E9GA 1VF5C 4JOIC 2JA6H 2NLUA 1QKXA 3MJXA 4IURA 1YHQQ 5I4DA 3G6ET 3CC4A 2VB2X 3GNGA 2FPEA 1MV0B 3G71A 3OBWA 1X3QA 3CW2C 3LGJA 4GN3B 1JOQA 3TS0A 1V1OA 1JC7A 3FKIG 2KHIA 1LUZA 5C0XH 4BBSH 4KUDK 3NHNA 4YTLA 1X6BA 5IYCG 4A3IG 3J7AV 3S2DH 4YIJA 3W5OA 5EBCA 3N5BB 1XPRA 4C0FA 2YV5A 4KKSA 5FK9C 3NK9A 3S15B 1TUGB 1YIJQ 1WQ7A 5GANj 5KYUB 2DJZA 3V96A 4YWMA 2F1LA 3AFQA 2QEXT 1WIEA 3CC7Q 5H1SE 2CUBA 4GNXA 2CZ1B 1ML0D 2QEJC 2E6ZA 4BI8B 4XU0A 5GAN3 3A8MB 5JJZA 2AIRB 4M7DA 2MWPA 2JA5B 3EFXD 4WJWA 5FWCA 2K03A 4LUEA 1KG1A 4PMBA 5JVH3 5GANh 2A3LA 1TKWB 3ITPA 3I73A 4DV0L 3FDTA 3E5SA 1RDPD 4MDWA 4XYOA 2BA0A 1M9SA 1T0JA 1LYLA 1KK7A 2DPPB 4A3MH 1F9RA 3K58A 1XMOL 1SN8A 3J7AF 2R7DA 1RUWA 1UJYA 4JJDA 2R92B 1M4ZA 1HRJA 5DEHA 2X6GA 4OB1B 5C6AA 2GBQA 3I4MG 1I5LA 1GXDC 3OIQA 3U9OA 3KXTA 1AT1B 1PFNA 4LF7Q 1NTGA 1NZ9A 5ELFA 1IB8A 4M1UB 3DEOA 4GNXB 3GTMH 2AZSA 2PNIA 1VQOQ 2BE5D 4IJHA 1IW7D 4M7DB 4JI7Q 4P75A 3M54A 3JCMQ 1UNSA 4C92E 4QT7A 1ENCA 2F0VA 4IPDA 5GAOq 1EUJA 5C3EH 2RHIA 1UECA 3M0TA 3H0GB 4M7AA 4MIUA 3J7YW 4FF4A 3I4LA 4AYBG 4A3DG 1JOKA 2DIGA 4DNRB 4VUBA 2L5TA 1Q8IA 2FHDA 4X9DA 4K2LA 3CCJT 3VS5A 1KAAA 3D0FA 1K4US 3OSOA 2G9HD 1OU8A 5GAN8 4JCVE 3S2HB 1D0ZA 1M90U 5A0DA 4EVOA 1YWOA 4BBRH 4K5XA 4BDZA 3HOYB 3PIOA 2DYIA 3CD6Q 1Q82R 1ZA1B 2NYSA 4LUVA 2NUPA 2R93G 1Q81U 4UC4A 2BIVA 1U0LA 1QLYA 1YNJC 1PH9A 1YWPA 1FL0A 3ZYYX 1FNUA 4A3BB 1YITT 3VKIA 5K5PA 3I55A 3UDXA 2F4VL 1HNWL 1O7IA 2RI2A 4ZN1A 1RABB 4ZGJB 1BBUA 2GFUA 4M7AB 4AMCA 1E6GA 2A28A 4HXJA 5E7NA 4HIDA 2FZCB 3CKIB 1YJNA 2SDFA 1UHCA 3GTPH 1L1OB 1SLJA 1TWGB 3HOVH 1Q7YR 2QEXQ 5BN3A 5I9OA 3PO2H 3MP8A 4DAVA 4CJ2C 5LJ3d 2IX1A 3WOFA 2CYZB 3ER0A 4HA8A 4GOPB 2J0TD 2EWNA 2XGTA 1U8RA 4DV3L 2XDPA 5LJ3f 2E10A 4A4EA 5CKFA 3BJUA 5BN4A 5IP9H 4Z88A 4A76A 1PRTC 3QR8A 3TMEA 4A3EG 1UE5A 4F7UE 2E2DC 2OXPA 3VR2A 4OO1G 1HZBA 1U4MA 1I50H 4ZNXA 4HAEA 1M1KU 2A7YA 2EYWA 4MHEA 2HCKA 3MWYW 3DHQA 4KTAA 3S1NH 4A3KG 3W1GA 1IBLL 1QVFP 1AE2A 4XIGS 1E24A 5FO7B 5IWAL 1NPPA 3GV3A 1K8GA 4DNIA 2AKLA 2LDMA 2NVXH 1XOVA 3NTIA 3I7FA 2YU9H 5J1ZA 4FM4B 4AYBE 1LVKA 2K5VA 4PNOA 2GNCA 2JQOA 1BBWA 3BVMA 2DD5A 4JLGA 1KSWA 1Y57A 4AH6A 3FHWA 3PFSA 2FRWA 3KBGA 2QASA 1M90C 3MXGA 1HNZL 1RAGB 1YHQA 1YNJD 2HSEB 2GVAA 1G8ZD 1TIID 1RLQC 3TSSA 1GUWA 4J9DA 2EGEA 4J9BA 3BVGA 5CV7A 1QWFA 2O31A 3C3LA 1Q81C 3RMHA 2PYKA 4O42A 3Q23A 2ZJQA 4HVWA 1M2OA 3M4YA 3OYEA 1Q90A 1I3QH 1YCYA 5J22A 2VUMH 4FT2A 3VA7A 2DNUA 1YIJA 5KNBA 3EHRA 1MIUA 3HEJA 3EGDA 1D1BA 2HIXA 3KK7A 2Y0SB 1VQEA 5C4JB 1U4RA 4KHPL 3OMGA 1EQQA 2B3GA 1PH6A 1SNCA 3T1HQ 2HD3A 1PH5A 4OF1A 1YITQ 1QCFA 5JEAH 1XTDA 1BUVT 1JOOA 1SDFA 4J1MA 2K5IA 1VQPT 5IT9c 1TS3A 4C2MH 1NM7A 3QB3A 1KLGD 1JWMD 2ZPIB 5KYIA 1J5EQ 3Q22A 1WHHA 3V7RA 4PJOF 2LCCA 1PRTD 5D14A 3R93A 1PD1A 1SE8A 4QQ6A 4OGCA 2D62A 2RJCA 1HH2P 4KHVA 4JI3Q 3X24B 4C3HB 3GTGB 3I4NB 2NUZA 3CPWS 4ZK9B 1PVOA 2KGTA 4IUUA 2CHBD 2IT1A 4LF4Q 1CZWA 1KFZA 3ICEA 4X9CA 5K36H 3EG1A 2DY8A 3EGDB 1JB0E 2RM4A 1M1KC 1QZGA 1N36L 4RG2A 3UDIA 1UTIA 5I2MA 3MXUA 3OS1A 2O5JC 3IQLA 3DB3A 3RNUA 3KJPA 3HRUA 4K6DA 1MMGA 3A8IE 3H09A 4DEYA 2ZTDA 3ND9A 3I56A 4XU2A 1A2TA 1KHIA 1VQAA 3JCMV 1QCBD 4R4CA 4LFCQ 1Z9QA 2EGCA 1B9NA 2DBMA 2RBMA 1CKAA 1IGQA 3GOXA 3QO2A 5JPNC 2HT1A 4A3GH 5JEAJ 2RJFA 4X6AH 1X01A 2K3YA 5FU6C 2CS7A 5IGEA 3DLMA 4L6V5 2XIDA 3CQZB 2HZYA 4FSSA 3UA7A 4C8QC 4DV5Q 2RD1A 1HXDA 1D0XA 4GN4B 3EH2A 3T53B 4J9IA 3FKIH 4KHZA 4CDFC 5IGBA 4HJ8A 4LF9Q 2MQHA 2PMZE 4PJJA 2RHYA 5IYCH 4A3IH 1HD3A 4DR2Q 2SOBA 4M78G 1IYUA 3CCLT 3C94A 2EJ9A 1VQ6T 4AFSC 2NB0A 1TSFA 4RFBA 1OPKA 5GADC 4M7DG 3TSWA 1GD7A 3KJOA 3TEEA 1GUSA 4CBVA 5EPLA 3H0GG 4NXNL 1K73R 2Z6KC 3QSUA 1VQNA 2NZHA 4XTZA 3RZOB 2AUJD 3VRZA 4CC3A 2J6OA 1AZQA 4YWLA 2LT4A 2EGAA 2QYZA 2RA2A 4M78C 1CHPD 1OULA 3PUZA 3ULPA 1TWBA 2UXDL 5KE2A 1PTOF 2OQ0A 1YP5A 3QWNA 2LJ3A 3P7JA 1IBKL 4DA4A 1AWOA 1F2MA 1MMAA 1X3PA 3JCMd 4DK3C 3HOYG 3QWYA 4J9GA 3U58A 3CCRQ 4P5NA 1E2ZA 1EZZB 1RD9D 4HT8A 3I4MH 2FG0A 2ZM6L 2KRSA 2EQMA 3HFZB 2RHSB 1DYQA 3TP7A 4YY3L 4A3BG 3M5AA 1MKHA 3C12A 2DJGC 2GTOA 2ZPGB 1KNEA 2PI2E 4A3CG 2NYZD 2E5KA 3ERSX 2E2HB 3M4PA 1EL0A 2WB1B 3DM3A 4CRIA 4B08A 1HNXQ 4H44C 4CGYB 2W10A 4HCBA 3D31A 3R2TA 4RGOS 1IBML 1L0XB 4A3DH 2RO0A 4Q0FA 2I5HA 2F0KA 2KJXA 2LS01 4JI1Q 1D1KA 4C8QD 3KFVA 3INZA 2DGYA 2BKDN 5FROA 1DXMA 1JU5C 1YHBA 2KYBA 1PSEA 1I07A 1WJJA 3M4QA 4JI5L 2F0OA 3JCMb 4U673 2ALYB 2W0ZA 4R8NA 4LDWA 4AT1B 1WDXA 2M51A 4M75A 2K5FA 2AHOB 2B29A 1NBEB 2R93H 2RCNA 2EYQA 3MTSA 3D3RA 3CC2T 4A63B 3LWUA 3RZDH 1W3SA 4M7DE 3F1ZA 4HSVA 1DOMA 4LJZC 4N8FA 2A5HA 2MFIA 1PCXA 2O88A 3CCLQ 2A1AA 1R9TB 1ACMB 1VQ6Q 5EKKA 5KE3A 3E9HA 5L23A 2GQIA 1VQIA 4LUZA 1LNXA 3M0RA 4EMKA 2XNAC 3NP8A 3X26B 2HCIA 3MP6A 5IHIA 2WKCA 2IW3A 4MZPA 1BKBA 3THKA 3LWIA 1N33Q 4GKKL 4BY6C 4M75F 4AFQC 2KVMA 2VZAA 3DWPA 4MTKA 2LMJA 1HCZA 1E2VA 4IJLA 2VQFQ 1B4OA 4A3EH 1QG7A 3UDFA 3BS1A 2D9TA 1TH7A 4NKLA 3EGXA 2DEUA 1MNDA 4RMFA 3J81c 3F2CA 4J9CA 3JSCA 5LJ5j 3SHWA 3HTRA 1Q82U 3QIAA 1RLPC 4M7AE 1X55A 2OF1A 4IQZA 2IY5B 1I6HB 2Z4IA 1IHZA 4EMKB 4DV6Q 1AWXA 4IFDG 4M77B 3RKYA 4L5QA 1IHWA 2CUDA 4C5GA 4LNPA 1B3AA 3TS2A 2DXCA 1SROA 1MGSA 5LJ5h 2X3XD 1PG5B 1U9RA 1VQ5T 5EAYA 2ABLA 4J7IA 3FC3A 3NELA 2J4XA 5KYWA 2Q8RE 3J81i 2E2JB 3S16H 4BA1I 1EQVA 1RAIB 3V8JA 1SYDA 4C3HG 1SJED 3I4NG 2EVRA 1Q7YU 3U4ZA 3JAMc 1PH4A 2UU9Q 2M02A 1CKOA 1I5FA 1L0YB 2B2UA 3NUCA 3GP8A 2QQAA 4DR1Q 1W2BA 1DOKA 2BOSA 1NG2A 4OELB 1WTVA 4ID6A 2GFAA 3X3NA 3LH5A 1Z7TA 4BUGA 3HKZG 4Y7NH 3E0EA 3SDZA 3KF6A 4LF7L 1EFNA 1E0BA 3M9BA 2R5MA 1GUNA 3C1EA 1WD1A 1LTSD 2NVYH 4DAMA 1TWCH 4JI7L 3M4OH 1D0YA 3LH0A 4BY7H 2F69A 4Q5WA 3VS2A 5KH6A 4HCCA 4PJNA 5KYWB 4PG3A 1A3VA 3JAMi 4FW1A 5GAN7 1HJPA 1UGSB 1Y8PB 4P2CB 2EY1A 4IUTA 2RI5A 4XU3A 3LGLA 5HY6A 3BZDB 1FMWA 1SJHD 1TS5A 1QP3A 3AMUA 2EJGA 1TTHB 2RHUA 2KOLA 3NQTA 1A3UA 3CCRA 4NOYA 1DJ7B 4KUIA 5IHNA 3IFDA 3GTQB 3JB9G 4CDDC 2KVQG 2D0PA 4FO2A 3LX0A 3L2WA 1S5BD 2OAWA 2BA1A 1BI2A 3OWFA 1VS0A 2UUBQ 1SRLA 3HOXH 2N8NA 4Z89A 3PSIA 3X25B 2PVOB 1Q82C 2Y0SE 3CMAQ 4APVA 1JE5A 4GLXA 2E65A 5KNCA 4WJ3M 3CP0A 1XWEA 4RWSC 2EW3A 2K28A 4I65A 4OWWB 2DVJA 3OYMA 2EPDA 5CO7A 1SYEA 1QZHA 2UXBQ 2RQVA 4J6YA 1YNNC 4JJCA 1PKSA 2H8HA 1EYAA 2PW5A 1W1FA 2RHXA 3G6JB 1KC8R 1CM9A 3IFTA 1VQMA 4X3SA 2JXBA 4HMIA 4HMJA 2AK5A 3KLRA 4RGTA 5COYA 2F0DA 4FW2A 3VYTA 4LFBQ 1KAWA 1E7ZA 4E7LA 1KQ2A 2DTIA 4ULLA 4R0KA 1Q7YC 5CV8A 1WTRA 2BE9B 3C95A 4OL7A 2I0NA 1LTID 4L5SA 5ELEA 4NP5A 1GM5A 1PNJA 3PIP3 2KY9A 1WHMA 1T3SA 1EZ6A 3OW7A 4GKJQ 2FL7A 2KBTA 1WCMH 3ASKA 2E3HA 2I5LX 4LDVA 4NL3A 2HKNA 1VQ6A 1UUEA 3RR6A 3VR6A 4MZTA 3TP6A 1G6PA 2K5DA 2WB1G 1DZ1A 1SF9A 1H9RA 3H0GH 5I6WA 3S3MA 1PD0A 3CCEQ 4PK4A 4C92B 2F0WA 2B8GA 1A0IA 4Z8AA
chains in the Genus database with same CATH topology
2ECZA 2JS0A 2C0TA 2RQWA 2X3WD 2ED0A 1T0HA 3O5ZA 2DL3A 2JMAA 4RTWA 3UATA 4RTYA 2O9VA 1UGVA 1RI9A 1MUZA 1VYVA 4J9EA 1K9AA 2FRYA 2K9GA 2YT6A 1WXTA 3QWXX 4RTXA 1VYTA 4OMPA 2F2VA 2JMCA 1JEGA 1H8KA 1AVZC 4OMQA 4ORZA 1QKXA 2A36A 2KRNA 2K79A 2FPEA 1MV0B 2OI3A 4OMOA 1K76A 3I5SA 1JXOA 3REBB 2HSPA 3NHNA 1X6BA 2DJQA 4F17A 2K6DA 1WIEA 2D0NA 4RTZA 2CUBA 2JW4A 2J6KA 1BK2A 5ECAA 3RNJA 1A0NB 2EBPA 5FWCA 4LUEA 3U23A 1OOTA 1WLPB 3EG2A 4F14A 1T0JA 2L3PA 1ZUUA 1N5ZA 1HJDA 1KIKA 1RUWA 1UJYA 4JJDA 2DE0X 3ULRB 2ESWA 1M27C 2MOXA 2GBQA 1Z9ZA 1GFDA 1WXUA 5FW9A 2JS2A 2MIOA 1JXMA 2AZSA 2PNIA 2KNBB 2VKNA 3CQTA 4QT7A 1UECA 3M0TA 1WYXA 2EQIA 2LQWA 3PVLA 2KXDA 3VS5A 3I35A 1K4US 2RN8A 2PZ1A 1YWOA 2RNAA 1WXBA 1E6HA 5HCKA 1PRMC 2KE9A 1QLYA 2CT3A 4GLMA 1YWPA 4CC2A 1ABQA 2DA9A 1V1CA 1SEMA 3EG3A 1FMKA 1X2QA 2ROTA 2YSQA 1E6GA 4DEXA 2SEMA 2A28A 4HXJA 5I11A 2DMOA 1UHCA 2D1XA 3EGUA 4LUDA 5IHKA 1AEYA 2HBWA 4AFZC 3JV3A 2HEQA 2L2PA 4HVUA 2KROA 2CSIA 2YUOA 4EIKA 2CREA 4Z88A 1LCKA 5GJWB 4ZNXA 2EYWA 2HCKA 4LN2A 2D8JA 2LNHB 2CT4A 2KRMA 4GBQA 2BZYA 2AKLA 1XOVA 1NYGA 2SRCA 2DBKA 4WCIA 2GNCA 1GCQC 1BBZA 2BZXA 2ED1A 5EC7A 1G2BA 2C0OA 1KSWA 1Y57A 2DX1A 2EKHA 3VS6A 2FRWA 2KT1A 2JM8A 3VS3A 2LP5A 2CDTA 4JZ4A 2J06A 1RLQC 4ESRA 4J9DA 2EGEA 4J9BA 1GBRA 1QWFA 2O31A 1NLOC 2KYMA 3I9QA 4HVWA 2ROLA 2JT4A 1TG0A 1SPKA 2DNUA 3VS7A 4D8KA 1K1ZA 3EHRA 3H0IA 5FWBA 4AG1C 1AZGB 2RQTA 1QCFA 2BTTA 1W70A 1NM7A 1K0XA 1M30A 5GJVB 3C0CA 1UE9A 5I22A 1KJWA 3VS1A 3PE0A 1H3HA 2NUZA 3EG0A 2KGTA 1KFZA 1GCPA 3EG1A 5IXBA 1TUDA 1Y0MA 1UTIA 1JQQA 3IQLA 1ZLMA 2G6FX 3GBQA 1ZUKA 4DEYA 4M4ZA 2K3BA 2V1RA 4JPBW 1U3OA 2L3SA 1Z9QA 2EGCA 1SSHA 2O9SA 4RTUA 2DBMA 2AKKA 1CKAA 2EYYA 1CKBA 4X1VA 4E6RA 3ZL7C 4FSSA 3UA7A 2CSQA 4J9IA 2FEIA 2A08A 1HD3A 1OV3A 1AD5A 1WA7A 1X69A 4AFSC 1GRIA 1UG1A 2KT8A 1OPKA 2P4RA 2LJ0A 1ZSGA 3TSWA 1H92A 1YN8A 1PHTA 1GCQA 3VRZA 4CC3A 2J6OA 1ABOA 4HCKA 2EGAA 3M0SA 1ARKA 1YP5A 2LJ3A 1M8MA 1AWOA 2J7IA 3UF4A 3QWYA 4J9GA 2LQNA 2FG0A 2KRSA 1WX6A 3UA6A 1U5SA 2GTOA 2AZVA 2E5KA 1BB9A 2YUNA 2W10A 3EHQA 5IXFA 1M3CA 2L3QA 2A37A 1MV3A 3KFVA 4F16A 1JU5C 2KYBA 1I07A 3NPFA 2W0ZA 4AFUC 1WDXA 2M51A 2DL5A 1T3LA 3VS0A 2LJ1A 4IIMA 4OMNA 2LX7A 4A63B 4OMMA 4RTTA 1GFCA 1M3AA 2DLPA 2L0AA 2O88A 1ZX6A 2DRMA 1BU1A 5L23A 2GQIA 3M0RA 2KR3A 2VVKA 2JTEA 1E7OA 2MCNA 1NLPC 2GGRA 1CSKA 5IHIA 1VYUA 1PRLC 4RTVA 3THKA 2YDLA 1X2KA 2F2XA 2RQRA 1YNZA 2J6FA 4AFQC 4CC7A 2LMJA 1GBQA 4CC4B 4RUGA 4J9CA 2LCSA 3M0UA 1M3BA 4LE9A 3SHWA 1RLPC 4KRTA 3SEMA 1SHFA 2RPNA 3VS4A 1WI7A 3H0FA 1AWXA 1X27A 1UDLA 2K7AA 1OEBA 2CUDA 1AWJA 4LNPA 3REAB 1S1NA 2JM9A 2X3XD 1UHFA 1ZUYA 2ABLA 3I5RA 1J3TA 3VRYA 2FPDA 2RMOA 1K0SA 1AZEA 2J05A 2EVRA 4D8DA 3M0PA 1NYFA 1FYNA 4HVVA 4Y92A 1NG2A 3LH5A 1NEBA 3H0HA 2KEAA 4J9HA 2DYBA 1EFNA 1HSQA 3A98A 1NEGA 2D8HA 1B07A 2LZ6B 2DL4A 1SHGA 2XMFA 2PTKA 3FJ5A 3TVTA 1YCSB 3VS2A 1VA7A 2VWFA 2EYZA 2DF6A 2DILA 4K11A 3RBBB 2B86A 3PVQA 1PWTA 1AWWA 2RQUA 4IIOA 2CH4W 1SRMA 1B3QA 5IHNA 1QWEA 2OAWA 3H41A 1SRLA 2K2MA 1GL5A 4Z89A 4JJBA 3R6NA 1IO6A 2RF0A 1ZBJA 3TSZA 2EW3A 1X43A 2DVJA 2EPDA 2M0YA 2DL8A 1TUCA 2EYXA 2KXCA 2YUPA 2RQVA 3NGPA 4JJCA 1PKSA 2H8HA 2O2OA 1W1FA 1QKWA 1UJ0A 1X6GA 2JXBA 4JZ3A 2AK5A 5IH2A 2F2WA 2IIMA 2V1QA 2YUQA 4R0KA 1PKTA 1W6XA 4AG2C 2ENMA 2I0NA 2DL7A 1PNJA 2DM1A 1I0CA 2CH4A 2FPFA 2FO0A 4OMLA 2BZ8A 1T3SA 1AOJA 1OPLA 2KBTA 1WFWA 2DRKA 3NMZC 2GTJA 2C0IA 2HDAA 1UUEA 3M0QA 1I1JA 1U06A 1JO8A 1G83A 2NWMA 2QDLA 2OJ2A 4J9FA 4Z8AA 1UFFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2ECZ A;  2JS0 A;  2C0T A;  2RQW A;  2X3W D;  2ED0 A;  1T0H A;  3O5Z A;  2DL3 A;  2JMA A;  4RTW A;  3UAT A;  4RTY A;  2O9V A;  1UGV A;  1RI9 A;  1MUZ A;  1VYV A;  4J9E A;  1K9A A;  2FRY A;  2K9G A;  2YT6 A;  1WXT A;  3QWX X;  4RTX A;  1VYT A;  4OMP A;  2F2V A;  2JMC A;  1JEG A;  1H8K A;  1AVZ C;  4OMQ A;  4ORZ A;  1QKX A;  2A36 A;  2KRN A;  2K79 A;  2FPE A;  1MV0 B;  2OI3 A;  4OMO A;  1K76 A;  3I5S A;  1JXO A;  3REB B;  2HSP A;  3NHN A;  1X6B A;  2DJQ A;  4F17 A;  2K6D A;  1WIE A;  2D0N A;  4RTZ A;  2CUB A;  2JW4 A;  2J6K A;  1BK2 A;  5ECA A;  3RNJ A;  1A0N B;  2EBP A;  5FWC A;  4LUE A;  3U23 A;  1OOT A;  1WLP B;  3EG2 A;  4F14 A;  1T0J A;  2L3P A;  1ZUU A;  1N5Z A;  1HJD A;  1KIK A;  1RUW A;  1UJY A;  4JJD A;  2DE0 X;  3ULR B;  2ESW A;  1M27 C;  2MOX A;  2GBQ A;  1Z9Z A;  1GFD A;  1WXU A;  5FW9 A;  2JS2 A;  2MIO A;  1JXM A;  2AZS A;  2PNI A;  2KNB B;  2VKN A;  3CQT A;  4QT7 A;  1UEC A;  3M0T A;  1WYX A;  2EQI A;  2LQW A;  3PVL A;  2KXD A;  3VS5 A;  3I35 A;  1K4U S;  2RN8 A;  2PZ1 A;  1YWO A;  2RNA A;  1WXB A;  1E6H A;  5HCK A;  1PRM C;  2KE9 A;  1QLY A;  2CT3 A;  4GLM A;  1YWP A;  4CC2 A;  1ABQ A;  2DA9 A;  1V1C A;  1SEM A;  3EG3 A;  1FMK A;  1X2Q A;  2ROT A;  2YSQ A;  1E6G A;  4DEX A;  2SEM A;  2A28 A;  4HXJ A;  5I11 A;  2DMO A;  1UHC A;  2D1X A;  3EGU A;  4LUD A;  5IHK A;  1AEY A;  2HBW A;  4AFZ C;  3JV3 A;  2HEQ A;  2L2P A;  4HVU A;  2KRO A;  2CSI A;  2YUO A;  4EIK A;  2CRE A;  4Z88 A;  1LCK A;  5GJW B;  4ZNX A;  2EYW A;  2HCK A;  4LN2 A;  2D8J A;  2LNH B;  2CT4 A;  2KRM A;  4GBQ A;  2BZY A;  2AKL A;  1XOV A;  1NYG A;  2SRC A;  2DBK A;  4WCI A;  2GNC A;  1GCQ C;  1BBZ A;  2BZX A;  2ED1 A;  5EC7 A;  1G2B A;  2C0O A;  1KSW A;  1Y57 A;  2DX1 A;  2EKH A;  3VS6 A;  2FRW A;  2KT1 A;  2JM8 A;  3VS3 A;  2LP5 A;  2CDT A;  4JZ4 A;  2J06 A;  1RLQ C;  4ESR A;  4J9D A;  2EGE A;  4J9B A;  1GBR A;  1QWF A;  2O31 A;  1NLO C;  2KYM A;  3I9Q A;  4HVW A;  2ROL A;  2JT4 A;  1TG0 A;  1SPK A;  2DNU A;  3VS7 A;  4D8K A;  1K1Z A;  3EHR A;  3H0I A;  5FWB A;  4AG1 C;  1AZG B;  2RQT A;  1QCF A;  2BTT A;  1W70 A;  1NM7 A;  1K0X A;  1M30 A;  5GJV B;  3C0C A;  1UE9 A;  5I22 A;  1KJW A;  3VS1 A;  3PE0 A;  1H3H A;  2NUZ A;  3EG0 A;  2KGT A;  1KFZ A;  1GCP A;  3EG1 A;  5IXB A;  1TUD A;  1Y0M A;  1UTI A;  1JQQ A;  3IQL A;  1ZLM A;  2G6F X;  3GBQ A;  1ZUK A;  4DEY A;  4M4Z A;  2K3B A;  2V1R A;  4JPB W;  1U3O A;  2L3S A;  1Z9Q A;  2EGC A;  1SSH A;  2O9S A;  4RTU A;  2DBM A;  2AKK A;  1CKA A;  2EYY A;  1CKB A;  4X1V A;  4E6R A;  3ZL7 C;  4FSS A;  3UA7 A;  2CSQ A;  4J9I A;  2FEI A;  2A08 A;  1HD3 A;  1OV3 A;  1AD5 A;  1WA7 A;  1X69 A;  4AFS C;  1GRI A;  1UG1 A;  2KT8 A;  1OPK A;  2P4R A;  2LJ0 A;  1ZSG A;  3TSW A;  1H92 A;  1YN8 A;  1PHT A;  1GCQ A;  3VRZ A;  4CC3 A;  2J6O A;  1ABO A;  4HCK A;  2EGA A;  3M0S A;  1ARK A;  1YP5 A;  2LJ3 A;  1M8M A;  1AWO A;  2J7I A;  3UF4 A;  3QWY A;  4J9G A;  2LQN A;  2FG0 A;  2KRS A;  1WX6 A;  3UA6 A;  1U5S A;  2GTO A;  2AZV A;  2E5K A;  1BB9 A;  2YUN A;  2W10 A;  3EHQ A;  5IXF A;  1M3C A;  2L3Q A;  2A37 A;  1MV3 A;  3KFV A;  4F16 A;  1JU5 C;  2KYB A;  1I07 A;  3NPF A;  2W0Z A;  4AFU C;  1WDX A;  2M51 A;  2DL5 A;  1T3L A;  3VS0 A;  2LJ1 A;  4IIM A;  4OMN A;  2LX7 A;  4A63 B;  4OMM A;  4RTT A;  1GFC A;  1M3A A;  2DLP A;  2L0A A;  2O88 A;  1ZX6 A;  2DRM A;  1BU1 A;  5L23 A;  2GQI A;  3M0R A;  2KR3 A;  2VVK A;  2JTE A;  1E7O A;  2MCN A;  1NLP C;  2GGR A;  1CSK A;  5IHI A;  1VYU A;  1PRL C;  4RTV A;  3THK A;  2YDL A;  1X2K A;  2F2X A;  2RQR A;  1YNZ A;  2J6F A;  4AFQ C;  4CC7 A;  2LMJ A;  1GBQ A;  4CC4 B;  4RUG A;  4J9C A;  2LCS A;  3M0U A;  1M3B A;  4LE9 A;  3SHW A;  1RLP C;  4KRT A;  3SEM A;  1SHF A;  2RPN A;  3VS4 A;  1WI7 A;  3H0F A;  1AWX A;  1X27 A;  1UDL A;  2K7A A;  1OEB A;  2CUD A;  1AWJ A;  4LNP A;  3REA B;  1S1N A;  2JM9 A;  2X3X D;  1UHF A;  1ZUY A;  2ABL A;  3I5R A;  1J3T A;  3VRY A;  2FPD A;  2RMO A;  1K0S A;  1AZE A;  2J05 A;  2EVR A;  4D8D A;  3M0P A;  1NYF A;  1FYN A;  4HVV A;  4Y92 A;  1NG2 A;  3LH5 A;  1NEB A;  3H0H A;  2KEA A;  4J9H A;  2DYB A;  1EFN A;  1HSQ A;  3A98 A;  1NEG A;  2D8H A;  1B07 A;  2LZ6 B;  2DL4 A;  1SHG A;  2XMF A;  2PTK A;  3FJ5 A;  3TVT A;  1YCS B;  3VS2 A;  1VA7 A;  2VWF A;  2EYZ A;  2DF6 A;  2DIL A;  4K11 A;  3RBB B;  2B86 A;  3PVQ A;  1PWT A;  1AWW A;  2RQU A;  4IIO A;  2CH4 W;  1SRM A;  1B3Q A;  5IHN A;  1QWE A;  2OAW A;  3H41 A;  1SRL A;  2K2M A;  1GL5 A;  4Z89 A;  4JJB A;  3R6N A;  1IO6 A;  2RF0 A;  1ZBJ A;  3TSZ A;  2EW3 A;  1X43 A;  2DVJ A;  2EPD A;  2M0Y A;  2DL8 A;  1TUC A;  2EYX A;  2KXC A;  2YUP A;  2RQV A;  3NGP A;  4JJC A;  1PKS A;  2H8H A;  2O2O A;  1W1F A;  1QKW A;  1UJ0 A;  1X6G A;  2JXB A;  4JZ3 A;  2AK5 A;  5IH2 A;  2F2W A;  2IIM A;  2V1Q A;  2YUQ A;  4R0K A;  1PKT A;  1W6X A;  4AG2 C;  2ENM A;  2I0N A;  2DL7 A;  1PNJ A;  2DM1 A;  1I0C A;  2CH4 A;  2FPF A;  2FO0 A;  4OML A;  2BZ8 A;  1T3S A;  1AOJ A;  1OPL A;  2KBT A;  1WFW A;  2DRK A;  3NMZ C;  2GTJ A;  2C0I A;  2HDA A;  1UUE A;  3M0Q A;  1I1J A;  1U06 A;  1JO8 A;  1G83 A;  2NWM A;  2QDL A;  2OJ2 A;  4J9F A;  4Z8A A;  1UFF A; 
#chains in the Genus database with same CATH topology
 2A73 B;  4IPH A;  2DXU A;  2VAS A;  3QHS A;  3EAE A;  3CPW P;  2FYK A;  1Q81 R;  4J6H A;  4A4F A;  4V2S A;  1JIC A;  1SKU B;  2X3W D;  3HOY H;  2QA4 T;  4KJN A;  4POG A;  3M59 A;  4GY5 A;  3FRP B;  4RCN A;  1EYG A;  2P4T A;  2R5A A;  2JN4 A;  2QXF A;  4KKU A;  2Q8I B;  2PVG B;  3UAT A;  2VW9 A;  2H3J A;  1EQR A;  1UUP A;  3NTK A;  1D6E C;  5EGT A;  5CMD A;  4A3B H;  2L15 A;  4ZKC B;  1MNE A;  1VYV A;  1YNN D;  2VL6 A;  4JLI A;  2KK4 A;  1Y8N B;  2E41 A;  3KYH C;  4DK1 A;  2H3E B;  2DTH A;  3L2Z A;  1VYT A;  3NFC A;  4JK1 C;  5HGQ A;  4RHR A;  3T1H L;  1ZHI A;  1JWU D;  2SNM A;  1BCP C;  3PUW A;  4JI6 Q;  1HR0 Q;  1FGU A;  4R56 A;  5C4X H;  5C44 B;  1TWG H;  2CW0 D;  4ZAI A;  1J5E L;  2UUA Q;  1N9W A;  1EOV A;  1QB5 D;  2CZ6 B;  2E5Q A;  3AHU A;  3VA5 A;  2OI3 A;  2Z9H A;  4A93 G;  4PJL A;  2K14 A;  4OMO A;  1UGR B;  3OW2 S;  2DAQ A;  3I5S A;  2XTI A;  2GF7 A;  3HFN A;  4PL6 A;  5LMU Q;  1G6Z A;  3REB B;  3MHB A;  3STB C;  3HOZ G;  1ZQ1 A;  1X54 A;  4JI3 L;  5JPM C;  4F8M A;  3MHX A;  1IHV A;  1TR5 A;  4P73 A;  3RD4 A;  3S17 B;  5M3F G;  2WAC A;  4LF4 L;  1OXS C;  4GLA C;  1TWA H;  1Y1V H;  5KRU A;  3BW1 A;  4F17 A;  2HHH Q;  4RTZ A;  3MEU A;  2FHT A;  4OB3 B;  4C5I A;  1I8F A;  5ECA A;  1WYD A;  3RNJ A;  1A0N B;  3GP7 A;  4V19 0;  2KCC A;  2EBP A;  2WB1 E;  1KNA A;  3ZFJ A;  2ZXP A;  4M77 G;  2R7Z H;  3U23 A;  1W6J A;  2K5H A;  1M2V A;  2F0I A;  2I07 B;  1K8O A;  1ZSZ B;  3GIB A;  1KD1 R;  1KIK A;  2CQO A;  4A4I A;  4LFC L;  1U1T A;  4NS5 A;  2K32 A;  4BWG B;  1STH A;  1L0W A;  1EIH A;  1M27 C;  1OQK A;  2MOX A;  5D7U A;  3ZBD A;  1Z9Z A;  3CCM Q;  4L59 A;  1VQF A;  5GMK l;  3JRZ A;  3CU7 A;  2M9U A;  2K4K A;  2EE1 A;  1FGB D;  2JS2 A;  2R7F A;  4DV5 L;  2B2V C;  2JXM B;  4C1N I;  4ME5 A;  1OXX K;  2VQE Q;  3GTK B;  4LF9 L;  1Q1B A;  1O7L A;  4J8Q A;  2KNB B;  2QA4 Q;  2JZ2 A;  3CMA A;  4DR2 L;  1BCP D;  4BI4 A;  1FWZ A;  5M5Y H;  1M2V B;  1RI0 A;  2X4X A;  3ERQ A;  3L0O A;  2ENB A;  1G8X A;  4IFD H;  2KXD A;  2G9D A;  2M9V A;  3BU2 A;  5FLX E;  4DR5 Q;  4NXM Q;  2RN8 A;  3KLW A;  2K2V A;  3X3M A;  2NVT H;  2PZ1 A;  1IYJ B;  1N32 Q;  2F0E A;  4CJ0 B;  1BOS A;  2QKI C;  3STB D;  3SK6 A;  4FXK C;  4HJA A;  4H13 C;  2K6A A;  1SFO B;  1EYC A;  4JRQ A;  3FRN A;  1RCV D;  2EIF A;  3A7A B;  2IX3 A;  4FF1 A;  5EBD A;  1JJ2 A;  2IHF A;  2CT3 A;  4OX9 Q;  3GTG H;  4BI3 A;  1EY9 A;  3SHL A;  3I4N H;  4KY5 A;  4C5H A;  1KTK A;  1O7Y A;  2K52 A;  1P92 A;  4N8X 1;  4ZYS A;  1PZI D;  5FLX c;  4XT1 B;  3OS2 A;  3M58 A;  1FMK A;  5BN5 A;  1BR9 A;  2I5M X;  2ROT A;  2WSE E;  3W2D A;  5LMN W;  1B1Z A;  1NPR A;  2SEM A;  1OX8 A;  4DEX A;  3SGI A;  2DMO A;  2O4X B;  2KI7 A;  2ZPE B;  2D1X A;  3M55 A;  5IHK A;  2HL3 A;  5GMK h;  2M2L A;  3HPW A;  3QUI A;  2EQJ A;  4AFZ C;  1PRT F;  2NTS A;  1I4K 1;  3JV3 A;  4KGX B;  1OX9 A;  4FYV B;  3CCQ T;  2P5Z X;  1EY5 A;  8AT1 B;  3CCE A;  1EU4 A;  2EOT A;  4OIK A;  3VU3 C;  2L0C A;  2Y4X A;  1HNX L;  1STE A;  2YUO A;  3FEW X;  3A1P A;  3D4R A;  4DAP A;  2NVQ B;  1A63 A;  1HQM C;  1E22 A;  4JI1 L;  3A5Z B;  4IFD J;  4A75 A;  4QQG A;  2L89 A;  4RGN A;  1P16 A;  4DR7 Q;  3BFM A;  1EEF D;  2AQ3 B;  4II1 A;  1N34 Q;  4LN2 A;  4G7O C;  1UEB A;  2D8J A;  3BYY B;  3EBE A;  2XVS A;  5D3D A;  3JB9 H;  2V4D A;  4JI4 Q;  2Z0W A;  1ESF A;  1NNX A;  2OQK A;  4HT9 A;  4R55 A;  1IRE B;  1FJG Q;  3CRK C;  1DGS A;  1KQS S;  1NYG A;  3DEP A;  3RLN A;  3CAM A;  1GCQ C;  4QCL A;  3OQ5 A;  1BBZ A;  2VY3 A;  2YHT A;  2ED1 A;  5IP7 G;  3I90 A;  4K5W A;  2C0O A;  3AYH B;  3L2U A;  1XJV A;  1VQ9 T;  1TXY A;  2KT1 A;  1SMX A;  5AJ3 L;  4JZ4 A;  3AU7 A;  4C92 G;  3SWN A;  4ESR A;  1TWH B;  2HL5 C;  1GBR A;  1YI2 T;  1G2S A;  1I4H A;  4DUY Q;  2FVU A;  2XG8 D;  2Z4H A;  4G7H C;  4FXD A;  2EYM A;  1XPU A;  5E4W C;  1H9M A;  4KN7 C;  2ROL A;  2K75 A;  2YTY A;  5DLO A;  3ERO A;  2CVR A;  4JBM A;  1EU3 A;  1N33 L;  1PHJ A;  1WHL A;  2JA9 A;  2VQF L;  3H0I A;  3G4S Q;  1RAF B;  5M3M G;  1N6A A;  1C9O A;  1B50 A;  3A0J A;  2BTT A;  2KCT A;  4YHH Q;  2OTL T;  1SNM A;  1W70 A;  1WOC A;  2ID0 A;  2LKV A;  1RIP A;  3J80 c;  4BY1 H;  2GQV A;  1S40 A;  1IL2 A;  3JB9 J;  1K8A R;  2KHS A;  5I6Y A;  3SWN B;  4RMO A;  2E2H H;  4DV6 L;  2FMM A;  4XQ3 A;  4A4H A;  1VQ4 A;  4C3I B;  4QVC A;  5C44 G;  1H3H A;  4LXC A;  3EG0 A;  4EMG A;  1HA5 A;  5GAH C;  1GXI E;  3GF5 A;  5A0G A;  1Y71 A;  1ICW A;  3CCM A;  2AWO A;  1PH2 A;  2LCL A;  2KA7 A;  3HGB A;  2A74 C;  1TUD A;  1WTX A;  2HAX A;  5GAO n;  4HN7 A;  1E1T A;  2E64 A;  4HTH A;  4QQD A;  4QKU A;  4MDX A;  1LJO A;  1KQ1 A;  4FSX A;  4KT0 E;  1KC8 U;  1VQK T;  2Z6K A;  4AQY Q;  2L12 A;  1XYI A;  1SRU A;  1X32 A;  2UU9 L;  1ZLM A;  2G6F X;  5A2Q E;  5FU7 B;  4KI0 A;  1YJW T;  5LJ3 g;  4IKF A;  3DKM A;  4DR1 L;  1LT4 D;  2D0O A;  4M4Z A;  1MSH A;  2K3B A;  3FEO A;  4F7U G;  4ZN3 A;  3M9Q A;  4JPB W;  1L2F A;  2ZXR A;  2JA8 B;  4OVA A;  4C8Q F;  4QGU A;  3HHT B;  4QIW E;  2L3S A;  1G91 A;  5CQX A;  1HZ9 A;  4JRK A;  4FCY A;  3RUZ A;  3S14 B;  2CP0 A;  3F2B A;  2EYY A;  1CKB A;  3QKJ A;  4YWK A;  3OYY A;  1M4V A;  3HP9 A;  2JEB I;  3A7L A;  3OS5 A;  3OYH A;  3TCJ A;  3ZL7 C;  3MVV A;  4KV6 A;  3VDY A;  2DNE A;  5A35 A;  1JMC A;  4A93 H;  3S24 A;  2YRD A;  2OTJ T;  2VXE A;  1BI1 A;  3OYL A;  3CCV A;  1CKM A;  1X3G A;  5C0X I;  2FEI A;  2IX0 A;  3HOZ H;  4B3M Q;  1HFG A;  4WFN 3;  3MFY A;  4KH0 B;  3P8D A;  5M3F H;  1X69 A;  4JV5 Q;  1VQ8 Q;  2KT8 A;  2QF7 A;  5LHY 1;  1GHK A;  5C3X A;  1Y96 A;  3PTA A;  3A56 A;  4M78 F;  3OPO A;  3G6E Q;  2UUB L;  2X4Y A;  3GNF B;  3KF8 A;  1QVG S;  1I6H H;  5CAI A;  1O80 A;  2EZV A;  4PZ7 A;  5J3B A;  2OTL Q;  5GAN e;  3CXC A;  4JG2 A;  3TQY A;  4IOC A;  3BZC A;  1YNX A;  2UXB L;  1UE6 A;  1MSG A;  4TRD A;  1OZ2 A;  1C48 A;  4RKU E;  2N78 A;  2RCF A;  3HZX A;  3LNN A;  4JI2 Q;  1I94 Q;  2F0U A;  4FIB A;  4JI0 Q;  4R4O A;  3UF4 A;  4O1N A;  2ZXO A;  3OA6 A;  2NN6 I;  1D1I A;  1E1O A;  1WVL A;  5JAV A;  1M1G A;  3K7A H;  3P1H A;  4PZ6 A;  4LFB L;  4JJN K;  3N6R A;  3OY9 A;  3K7U C;  3U4V A;  3UA6 A;  1KC8 C;  1Q3L A;  2NUP B;  4ELZ C;  2B8A A;  1U5S A;  1Y96 B;  5DY9 A;  3H6M A;  4KD3 A;  1FR3 A;  2ATW A;  5D3I B;  3KF8 B;  1BB9 A;  1VQK Q;  4FL6 A;  4PFZ A;  1VMC A;  2YUN A;  2WSF E;  1YJW Q;  1X3E A;  5IXF A;  4HCE A;  4GKJ L;  4HJ7 A;  2D6F A;  3K5M A;  1M3C A;  3HFO A;  4XQN A;  3Q24 A;  1MV3 A;  2IHE A;  4OIJ A;  4F16 A;  3R6O A;  3E9I A;  3S1M B;  3K8A A;  2AT1 B;  2VV5 A;  3MEF A;  5F2D A;  2E5L Q;  3K59 A;  1C0A A;  4YCW A;  2A6H C;  4AFU C;  3OW2 P;  4DPG A;  2RSO A;  5COR A;  2CP6 A;  2HQE A;  2X4W A;  4PJO A;  1OI1 A;  2YWW A;  3M4G A;  2KEE A;  4NW2 A;  1QW1 A;  1AP0 A;  2PQA A;  3JCM e;  2B2Y C;  2N55 A;  3ONA B;  5J26 A;  4CDE C;  2OTJ Q;  2LX7 A;  1KD1 U;  4OB2 B;  3G4S A;  3CCJ Q;  1NE3 A;  1GFC A;  2DVE A;  4LUO A;  5EKL A;  1STA A;  1J9O A;  2E70 A;  2L0A A;  2B2T A;  4C0D C;  1LAB A;  4XU1 A;  2DRM A;  1BU1 A;  2N3S A;  1VUB A;  2RK1 A;  2VVK A;  1LTL A;  3KLS X;  1E7O A;  2MCN A;  3G48 A;  4IAL A;  1BO0 A;  4E6I A;  1KIX A;  1R0B G;  4BE1 A;  3CC7 A;  2KHJ A;  3MEW A;  2GGR A;  3M56 A;  1CSK A;  3EA6 A;  3GD7 A;  4JI6 L;  1LOJ A;  1VYU A;  1TS9 A;  3SFM A;  4PJO B;  5D6W A;  4DN4 M;  2F2X A;  1YEZ A;  5GAE C;  1HR0 L;  2OAU A;  3GTO B;  2EYO A;  2UUA L;  3URG A;  4I7A A;  5CBA E;  5LMN Q;  4HKE A;  3KUF A;  4R8I A;  5FO9 B;  2R6G A;  3RLF A;  1LT5 D;  5LMU L;  4BS9 A;  1N8R U;  3UPU A;  1S72 T;  4HJ5 A;  2E8G A;  1CZG A;  2EKO A;  4GN5 A;  1PSF A;  2LCS A;  3M0U A;  1R4P B;  2B63 B;  1SE4 A;  1Y07 A;  1QCO A;  3NTH A;  2EJF A;  5AYF A;  4KRT A;  3SE0 A;  1SHF A;  2RPN A;  4XTX A;  5I21 A;  2OT2 A;  5EG2 A;  1PYS B;  4NPS A;  1C7Y A;  4QW2 A;  2K7A A;  1CKN A;  1G51 A;  3CEY A;  3HRT A;  2RK2 A;  3QOL A;  3E3X A;  1TS4 A;  2HHH L;  1OEB A;  1AWJ A;  3REA B;  1KDA A;  3JCM g;  2JM9 A;  2X9H A;  4HIO A;  1VQO A;  5IP7 H;  2E75 C;  1ZUY A;  4Z02 A;  1VQ7 T;  5DM6 3;  2FPD A;  2RMO A;  5KEE A;  5M5W B;  1AZP A;  2DTO A;  3D6W A;  3H3V C;  2LQ8 A;  3KDF A;  1O9S A;  1K28 A;  5KYX A;  1M8V A;  4IUV A;  1IKL A;  1VQJ A;  4UDU C;  5GAN d;  4C3I G;  1BF4 A;  4J8O A;  2KCN A;  3LGF A;  4D8D A;  1Q86 R;  2JA5 G;  1U1S A;  1FYN A;  4HVV A;  4Y92 A;  5CKH A;  2BDN A;  3PGG A;  1EY7 A;  3GTL B;  1KD1 C;  1ZYR C;  1PH8 A;  1CKN B;  3CD6 A;  3LLR A;  1B34 A;  1VQ8 A;  2XRQ D;  4UP7 A;  1NEG A;  2R92 G;  5M3M H;  2VQE L;  2D8H A;  1OXV A;  3IL8 A;  3G6E A;  2ZJR A;  2LZ6 B;  1K9M U;  3MXN A;  1SHG A;  1X65 A;  4QMG A;  2ATC B;  3GPL A;  2VWF A;  2E76 C;  2EYZ A;  5GAN 6;  1SNQ A;  2JA8 G;  2OTL A;  1KRT A;  3RBB B;  5HKC A;  3NBH A;  2B86 A;  1EYD A;  3R8B A;  4JUV A;  2F0P A;  3SD4 A;  3PVQ A;  2PCF B;  2MUY A;  4TSS A;  1RAA B;  2JP1 A;  1PWT A;  4DR5 L;  4NXM L;  2GCX A;  3I4O A;  4CHT B;  5C44 H;  3S1Q B;  2KQ3 A;  2RQU A;  3A74 A;  4IIO A;  2QEX A;  4FVM A;  1N32 L;  4MN3 A;  3HOU B;  4A3L G;  2JA7 B;  1SRM A;  1PTO B;  3L9A X;  4X66 Q;  1B34 B;  1LPL A;  2DFU A;  2LTO A;  4B9W A;  1VQP Q;  1N8R C;  1NUC A;  2DIQ A;  2K5N A;  3J81 L;  3K5L A;  2YLC A;  1EX4 A;  1RHP A;  4OX9 L;  1BCO A;  3Q0A A;  4JJB A;  3CCU T;  4GNX C;  5FJ8 G;  3R6N A;  4F04 B;  1FXX A;  3GTJ B;  1LTR D;  1UGP B;  4M7D C;  5GAO m;  1VQL T;  1X43 A;  2A0F B;  1KQS P;  3PMT A;  3JCM f;  4FF2 A;  2C06 A;  1WPY A;  2L4N A;  3NBH B;  4MML A;  4DR6 Q;  1V43 A;  5C5M A;  3AT1 B;  3PT9 A;  3FP9 A;  1WTQ A;  2FB7 A;  4B3T Q;  3CPF A;  4DF7 A;  2ZGW A;  2QAZ A;  4JZ3 A;  5IH2 A;  4M7A G;  1CFM A;  2IIM A;  2V1Q A;  2YUQ A;  2XIW A;  4LFA Q;  2CKK A;  2EY2 A;  1LO5 D;  3Q1J A;  1VQ7 Q;  5GAG C;  2O01 E;  3JAM L;  5CGK A;  1ZYR D;  1K8A U;  2A68 C;  1E3P A;  4K14 A;  3B6Y A;  2CH4 A;  2FO0 A;  4E47 A;  2HIV A;  1GHJ A;  3EVQ A;  2E2I B;  3E19 A;  2BZ8 A;  2XKO C;  2FZK B;  4RCB A;  5GAM e;  2OTJ A;  4YCV A;  4DR7 L;  2C5C A;  3CCJ A;  1EIF A;  4OXP A;  1N34 L;  1AOJ A;  1OPL A;  2OEO A;  3S2D B;  1WFW A;  1RAD B;  4LD9 K;  4M7A C;  2DRK A;  3OYC A;  4JI4 L;  2GTJ A;  1K9M C;  2MNA A;  1F9P A;  4K6L A;  4DOV A;  2N88 A;  1STB A;  5JVG 3;  1FJG L;  1I1J A;  2EDG A;  1L1O C;  1G83 A;  3TZD A;  2L9H A;  4OB0 B;  1FMV A;  4HCS A;  4ELY C;  2OJ2 A;  4J9F A;  1EIG A;  3H15 A;  1UFF A;  1YIT A;  1UE1 A;  4DV7 Q;  4GOP C;  1JQY D;  4BDY A;  2IVW A;  1OTC A;  4M78 D;  1MGQ A;  2WFW A;  4DBF A;  2PZU A;  4K5V A;  2ED0 A;  1SFO H;  2DL3 A;  4DUY L;  4A3M B;  3AEV A;  4M75 B;  5CYU A;  4M7D D;  2XIC A;  1XMQ Q;  2D2C C;  1QVF A;  4A53 A;  1BCP F;  4RTY A;  3L2P A;  1M8A A;  2IPO B;  2O9V A;  1UGV A;  3BDC A;  3RER A;  1RI9 A;  4P74 A;  3D7S B;  1MUZ A;  5HK0 A;  4N9T A;  2HQX A;  2PPB C;  1G2T A;  2K9G A;  3TRE A;  2YT6 A;  1WXT A;  1SYC A;  4EQP A;  4IOA A;  1LT3 D;  4OO1 H;  4RTX A;  2IG0 A;  3MCA B;  2HDM A;  2RKS A;  2KUM A;  2F2V A;  3GTM B;  4OMQ A;  4ORZ A;  1G29 1;  1GUO A;  4DK0 A;  4YHH L;  5D6X A;  5GAM g;  1GOZ A;  4Z9C B;  4A3K H;  1PLF A;  2Y0S G;  4J15 A;  1HQR D;  4GS3 A;  2VB6 A;  3H8Z A;  1LM0 A;  3ZEH A;  4EPC A;  1K76 A;  1Q1E A;  1V1Q A;  2F0J A;  2MK5 A;  1JXO A;  2DZ9 A;  2DER A;  5C4H A;  1HPC A;  5C4Z A;  2HSP A;  4PJO G;  1K8A C;  3CCS T;  3M57 A;  3VR5 A;  2Z8L A;  3OYA A;  1LTT D;  4BBR B;  1PDQ A;  1V29 B;  3W3A A;  4X3U A;  3D4D A;  2K6D A;  1PH1 A;  4XTY A;  2B63 G;  1VIE A;  3EGX B;  3RKW A;  4AQY L;  2QI2 A;  3MAQ A;  2LMC B;  2CP2 A;  1AEX A;  5A0L A;  3HP3 A;  1QVG P;  2K04 A;  3EG2 A;  4CJ1 B;  1ZUU A;  3S1R B;  2F03 A;  2ZPF B;  2YYZ A;  1HJD A;  2F0M A;  3EG9 A;  2F0T A;  1HK9 A;  2K05 A;  3D4W A;  2ESW A;  2VYT A;  3EFR A;  3CC2 Q;  4XTU A;  1BDO A;  5EPK A;  3PO2 B;  5KND A;  1TS2 A;  3ULL A;  4EX5 A;  4DR4 Q;  1CA5 A;  1TWH H;  1WXU A;  3E9F A;  3P75 A;  4HSP A;  1VQP A;  2MIO A;  1ZA2 B;  3NHH A;  3EFO A;  2B39 A;  3NEM A;  1JE4 A;  3J7A 5;  1D5Z C;  3E6Z X;  1BVS A;  3LWE A;  4AIM A;  3H3V H;  4B3M L;  1YBY A;  3FB9 A;  2F5T X;  2A6E C;  2FFK B;  2H4O A;  3OTO Q;  3P8B B;  5GAM d;  2V8I A;  5BR8 Q;  1R8O B;  1WYX A;  3KF6 B;  4XTC S;  4JV5 L;  3MEA A;  1D09 B;  2LQW A;  1VQD A;  2F0N A;  3D8G A;  3FPP A;  3I35 A;  5GAM f;  3RKX A;  2F0H A;  3EG9 B;  4ZCK A;  2MHV A;  2YU9 B;  3S15 H;  2RNA A;  2BE7 D;  3NPP A;  4HR7 B;  4RHS A;  3UDG A;  4N0A A;  1E6H A;  3TP8 A;  3A8L B;  5HCK A;  4PJO E;  3V8L A;  2L1B A;  3MC0 B;  1T5E A;  3PO3 G;  2L3R A;  2KE9 A;  5ELD A;  4JI2 L;  1NJI U;  3EFO B;  4GLM A;  1I94 L;  1IGU A;  2X51 A;  4JI0 L;  4CC2 A;  2JA5 H;  3UE1 A;  3HOU G;  4JYA Q;  3JCM X;  2Y90 A;  1ABQ A;  2JA7 G;  2RF4 A;  3QDR B;  1SEM A;  3EG3 A;  3K5O A;  4DQ2 A;  3CCS Q;  4K8J A;  5ISR A;  1MHN A;  2QDY B;  3DLL A;  4BE2 A;  1TXQ A;  1VQ5 Q;  2VUM B;  3M7G A;  3PUY A;  4RA8 A;  5I2X A;  1IL8 A;  4LUD A;  4Q5V A;  4A54 A;  2R92 H;  2QK0 A;  4KUL A;  1X6O A;  5GAO r;  2GVB A;  2HD0 A;  2LSS A;  2MAM A;  2QTV A;  2Q2T A;  4LF6 Q;  4IN3 A;  2YXY A;  4LDU A;  2XHC A;  4HVU A;  4JOI A;  2JA8 H;  1V1P A;  5FRN A;  4L6T B;  4C2M B;  1MJE A;  4IUQ A;  2CRE A;  3CCL A;  2M0O A;  4JS4 A;  3S14 H;  4XQQ A;  3DMU A;  4WF2 A;  4QIW B;  4C0G A;  4QUC A;  2M1H A;  5JJI A;  3U9S A;  2HCC A;  2E5L L;  5GJW B;  5DNF A;  3BZK A;  5DLQ E;  2KAF A;  3CC4 T;  3G71 T;  4A3L H;  1QNU A;  3L2Q A;  2A6E D;  2LNH B;  4DV2 Q;  2MI6 A;  2KRM A;  4GBQ A;  5CK9 A;  3S2H H;  5FKA C;  2BZY A;  3L2V A;  5FJ8 H;  2SEB D;  4JC0 A;  1Q86 U;  4KN4 C;  2DBK A;  3URY A;  2WII B;  4WCI A;  4E7J A;  1CHQ D;  2DY7 A;  3N52 A;  2BZX A;  5EC7 A;  1G2B A;  2EJM A;  1CQV A;  3OIP A;  1HA6 A;  3EQL C;  4P71 A;  3TN2 A;  1MI2 A;  2Q2I A;  4FYX B;  2KBN A;  3V7S A;  2I46 A;  2LP5 A;  4ABN A;  2CDT A;  3BYT B;  1Q8K A;  2DD4 A;  2J06 A;  1A6X A;  4A3C H;  4E7I A;  3JB9 D;  3SK5 A;  2DO3 A;  3PMF A;  1JJG A;  1NLO C;  1I5O B;  1NMF A;  1NJI C;  1IKM A;  1EZ8 A;  4EMH A;  3A8H B;  1V76 A;  1SPK A;  1GO3 E;  4A3G B;  3JCM c;  3VS7 A;  4D8K A;  2LY7 A;  2QQB A;  3HRZ C;  1SYF A;  2DJF C;  1ICF B;  4LDX A;  4JVZ A;  4R9W A;  5LMN L;  1RAH B;  4A3M G;  4M75 G;  4AG1 C;  2RQT A;  3OHX C;  5IE8 A;  3FKI B;  1VCI A;  4PZ8 A;  2CZ0 B;  2NN6 G;  1QQJ A;  4BXX G;  2XWJ B;  2JTF A;  4FP5 D;  1LTA D;  2P0Q A;  5CV6 A;  1RKN A;  3V2T A;  5IGG A;  3M7N A;  4GZY C;  5EKI A;  4F87 A;  3C0C A;  5CKB A;  2COY A;  1UE9 A;  2EYP A;  5IYB G;  2OWO A;  4K2K A;  1ROD A;  1DJR D;  4FYD A;  2CFM A;  1QWY A;  3CC2 A;  3EFS A;  3SK4 A;  4F88 A;  3QZ5 B;  3S1M H;  3C46 A;  4FYW B;  5IXB A;  5EJW A;  1Y0M A;  3RMS A;  1S5F D;  1CA6 A;  1Y8O B;  3L2R A;  4B3R Q;  1D1A A;  1VQG A;  1MMN A;  1AN8 A;  1JQQ A;  2EAY A;  1RF2 D;  1T9H A;  1ZXT A;  5IAY A;  5KYN A;  4NB3 A;  1EEI D;  1R77 A;  4QB4 A;  1LTG D;  3G71 Q;  3RIR A;  4IPC A;  1DON A;  2E74 C;  3OB9 A;  1Q86 C;  4O5V A;  3I55 T;  1HYO A;  4XDX A;  1YJ9 T;  3LX7 A;  3SEB A;  1TU2 B;  5T1G A;  1U3O A;  4EMK C;  2Z6B A;  2DUD A;  4M77 C;  1ILQ A;  4N4I A;  4RTU A;  2AKK A;  4F7U F;  1YJN T;  4WOR A;  4C56 C;  4OHJ A;  4E6R A;  2NZ1 D;  4X65 Q;  3K57 A;  1K3B C;  1A62 A;  3MET A;  5C4J H;  1VDZ A;  1N27 A;  1S5C D;  3PO2 G;  3MPU B;  5FOB B;  2A08 A;  3VYH B;  3OMC A;  4KMU C;  1N8R R;  1ASY A;  1W2B S;  3GTO H;  4FYY B;  1AD5 A;  1WA7 A;  1X9N A;  4M75 E;  2EXD A;  1W4S A;  4U68 A;  1QMC A;  2NBF A;  1GRI A;  1UG1 A;  2F1M A;  2ZTC A;  4X66 L;  4JBW A;  5I2Y A;  2P4R A;  2UUC L;  2LJ0 A;  1VQ5 A;  1HTL D;  5NUC A;  3J80 L;  4POF A;  4C3H H;  2EFI A;  5GMK j;  4KKT A;  1QVP A;  2XSC A;  5C5L A;  2B63 H;  2A69 C;  1Y1W B;  2RB6 A;  3P20 A;  3RZD B;  4KD4 A;  2JK8 A;  1BBX C;  1ABO A;  3TRZ A;  4OGE A;  4PNY A;  1PRT B;  5I2S A;  2B2Y A;  4LWC A;  3UDC A;  3RUX A;  3I8Z A;  3CF5 A;  3M0S A;  4DR6 L;  1ARK A;  5IYD G;  5LJ3 j;  5IY0 A;  2LXK A;  1VOM A;  1CSP A;  4A3F B;  1GJX A;  4B3T L;  2B2U C;  2MGS A;  4V0B A;  5E4X A;  1OXU A;  1JT8 A;  2QGF B;  2DKG A;  4LFA L;  2MJ8 A;  1YHQ T;  1WX6 A;  1JR0 D;  1H9J A;  2QIL A;  4HJ9 A;  1ENA A;  4N4G A;  2PVD B;  5DM7 R;  1IXD A;  1B53 A;  4LW1 A;  4B3S Q;  3OS0 A;  5LJ3 h;  3LYI A;  4EGV A;  3T1Y Q;  4LMQ D;  2F0S A;  2AZV A;  5IGC A;  4DAY A;  1EFW A;  4M77 D;  4NDX A;  4TKO B;  5DM7 3;  3GTL H;  1K9M R;  1YIJ T;  2VUM G;  4PKC C;  3AB9 A;  2VC8 A;  3CQZ H;  1I4R A;  3EHQ A;  3A8G B;  4KK7 A;  2JOY A;  5C6S A;  3HRS A;  3C1F A;  1ZBX A;  2BCO A;  1F9S A;  3I55 Q;  2B2W C;  1YJ9 Q;  3T16 A;  4LK1 C;  2L5Q A;  4K0K Q;  3QYH B;  2K5L A;  3WDN A;  3HL8 A;  3C2P A;  3NPF A;  3PF4 A;  3V8K A;  3A8J E;  4IO9 A;  1WHK A;  3PIO 3;  3EH1 A;  4DV4 Q;  1T3L A;  1IYV A;  4TVR A;  4C0Z A;  3PO3 H;  4DV7 L;  3WOE A;  3RES A;  2LJ1 A;  4IIM A;  3OOC A;  3S1Q H;  5M5X B;  1K83 B;  1SSO A;  4BA2 I;  4DAY B;  4LF5 Q;  3HOU H;  1UAP A;  4HIM A;  4Y91 A;  3RZO H;  2JA7 H;  1T5X D;  2LFN A;  1PTO H;  2A69 D;  3AQQ A;  3TBI B;  1DCZ A;  5JJL A;  2DLP A;  4IPG A;  1XMQ L;  1R4Q B;  1RL2 A;  2PNR C;  5HUR A;  1ZX6 A;  4ZQ3 A;  2BDO A;  4G57 A;  1I81 A;  2XN9 C;  4ZUI A;  5JJK A;  3GTJ H;  5M9O A;  1QJO A;  4Y7N B;  1CQF A;  3M3Y B;  1EY8 A;  2KR3 A;  1DOL A;  1F1B B;  4UY8 C;  2JTE A;  1QIL A;  3I56 T;  1UEA B;  2JJ9 A;  2LX9 A;  2X4J A;  5J39 A;  1NLP C;  3TU4 K;  1LV9 A;  2NVY B;  2RH2 A;  2V8J A;  3H6Z A;  2VGN A;  4C92 C;  2R57 A;  4RTV A;  3CPW A;  1O78 A;  1TWC B;  1VMP A;  4PLL A;  2RQR A;  3PV0 A;  1HTP A;  1YNZ A;  4PV1 C;  5KYU A;  4CC7 A;  4C8Q A;  4RG8 A;  1EY0 A;  2BE5 C;  2WP8 J;  1GBQ A;  3OYI A;  3RLO A;  4Y28 E;  1H95 A;  3WXM B;  2V26 A;  2PO4 A;  4L5T A;  1AH9 A;  5IOD A;  3JCM J;  3RN5 A;  4P72 A;  2DZC A;  2QQS A;  1QCN A;  2JSO A;  2OCE A;  4DK6 C;  5HGT A;  2HDL A;  4A3G G;  3CCQ Q;  4ZGE B;  3HG9 A;  4LE9 A;  2YTV A;  1MD2 D;  1DM0 B;  3VS4 A;  3JCM P;  2KED A;  2E2I H;  1WI7 A;  3UWN A;  4DBQ A;  1M1F A;  3H0F A;  2WAQ B;  4KH1 B;  2QGQ A;  2QQR A;  3WVD B;  2JEA I;  3J80 i;  3QO3 A;  1BYM A;  3TEH B;  1E2W A;  3HOX B;  3D6C A;  4X62 Q;  2CGH A;  5FU6 B;  1UHF A;  3VUB A;  2QA4 A;  1ESR A;  3VRY A;  1MHW C;  2PU9 B;  1S5D D;  4C8Q B;  3CME T;  1MJC A;  2AWN A;  4M78 A;  1K0S A;  3KBX A;  2CP3 A;  1VQN T;  1QVC A;  2M00 A;  2J05 A;  1UE7 A;  1FYC A;  1VQH A;  2F0Q A;  4XK8 E;  3ZJY C;  2VXF A;  2Z0S A;  1R9T H;  1D1C A;  5CQY A;  5CV4 A;  1SSF A;  2LQK A;  1RTN A;  3L42 A;  1NEB A;  4OP0 A;  2KEA A;  4FF3 A;  4J9H A;  4DR4 L;  2DYB A;  4O0A A;  1VQ9 Q;  3A98 A;  2JUF A;  9ATC B;  1XNR Q;  2K5W A;  2QW7 A;  1B07 A;  2F0G A;  4BXX H;  2DL4 A;  2NN6 H;  3FJ5 A;  4DUZ Q;  3TVT A;  1YCS B;  1YI2 Q;  1GUG A;  1I6V C;  3IAY A;  4C5E A;  4C92 D;  3K0Y A;  4M78 B;  3OYF A;  3S3N A;  3OTO L;  2DF6 A;  1IXR A;  5BR8 L;  1NE8 A;  5D6Y A;  1I4X A;  1WCM B;  1WD0 A;  2A19 A;  4C1N K;  4X64 Q;  2OX7 A;  1U4L A;  4NMZ A;  5IT9 L;  2DK3 A;  5IYB H;  4BY7 G;  3OYN A;  1QOH A;  1ZSZ C;  3K6O A;  4FDB A;  4UP8 A;  5C0X J;  3HOW B;  4BB7 A;  3I56 Q;  4B9X A;  2K33 A;  2MO1 A;  2DN8 A;  1FVI A;  4M7D F;  1B3Q A;  2LNV A;  2E12 A;  1WI5 A;  4RG1 A;  1QWE A;  2YRV A;  2O2L D;  2Y4Y A;  1SNO A;  4H0L C;  3QJY A;  2P0K A;  1OXT A;  1GL5 A;  3SK8 A;  1L1O A;  2O5I C;  4G4K A;  3F70 A;  1CTM A;  1SMY C;  5EPJ A;  4JYA L;  3Q6S A;  4MMK A;  4XXE A;  2RF0 A;  2AQ2 B;  6AT1 B;  2CWA A;  1WTH A;  4GOP A;  3WVE B;  2E2J H;  5E1F A;  2EYX A;  1TUC A;  5GAN 2;  2EYL A;  2FZG B;  3NGP A;  3NSW A;  1G3Y A;  3T13 A;  3JCM h;  1Y1W G;  1K8M A;  1SE3 A;  2Q2U A;  1STG A;  1UJ0 A;  1X6G A;  4OEM B;  1YJ9 A;  3FLG A;  3K0X A;  5CKD A;  2MPX C;  3UT1 A;  2JNG A;  2ICE C;  3R3O A;  4LD6 A;  4LF6 L;  3KOJ A;  1PKT A;  1W6X A;  4AG2 C;  2H1E A;  3S1R H;  1X3F A;  1JJ2 S;  3CME Q;  4M7A F;  4A3F G;  5C4X B;  4E7H A;  1A3T A;  2ES2 A;  1VQN Q;  4MTN A;  1PXU A;  4OML A;  2FPF A;  2ZPB B;  2L8D A;  5FRM A;  2F3W A;  3VYS A;  4N9P A;  2UXC Q;  2XI9 A;  1FNW A;  2VUB A;  2BUD A;  2RQX A;  3VR3 A;  1VF7 A;  5LL6 S;  4PFP A;  4DV2 L;  2R61 A;  3NMZ C;  4WTO B;  1TWA B;  2SNS A;  1Y1V B;  5GAN g;  1YHA A;  1SG5 A;  2NWM A;  2QDL A;  2G5D A;  5CBE E;  4D6W A;  1NR4 A;  4KGV B;  1H9S A;  1UWV A;  1XX8 A;  3GTQ H;  4BY6 B;  2DXT A;  4EQ5 A;  4DV1 Q;  1C1A A;  1B8A A;  2JS0 A;  2C0T A;  4DGZ A;  3M4O B;  2RQW A;  2KEN A;  2R7Z B;  5IYD H;  3KUP A;  1NJI R;  3PGZ A;  1WTO A;  1D2B A;  1IRX A;  5HK3 A;  2AKW B;  3O5Z A;  3QZ9 B;  1SMY D;  1TWF B;  1WGS A;  2JE6 I;  4QF4 A;  4GKK Q;  1J8I A;  3MXP A;  1C6V X;  2JMA A;  1KDB A;  2LT1 A;  3TQ7 P;  1KLU D;  1YVC A;  2EYJ A;  2K1B A;  2WSC E;  5LL6 X;  3CCQ A;  1KAB A;  1BIB A;  3FDR A;  2PQA B;  1TY0 A;  4J9E A;  1K9A A;  3DWQ A;  4E2F B;  2AQ1 B;  2WKD A;  3QWX X;  5IT9 E;  1H9S B;  1SR3 A;  5IOC A;  4OMP A;  4YCU A;  2HBP A;  3HKS A;  2JMC A;  4A3J B;  1H8K A;  1AVZ C;  2CP5 A;  5G3L D;  3T56 B;  2HMA A;  3ME9 A;  2A36 A;  2F4I A;  2KRN A;  4IUP A;  2K79 A;  5M5Y B;  4I7Z C;  3NEN A;  3GO5 A;  4TQU S;  3I91 A;  1SNP A;  4L5G A;  2JTM A;  1PFS A;  3CBM A;  4GLK A;  2DJQ A;  2G3R A;  2NVT B;  3ULJ A;  3E2U A;  1Q12 A;  1PZJ D;  2A6H D;  2EQU A;  3VJP A;  4JI8 Q;  4LF8 Q;  4QL5 A;  2QCP X;  3OYJ A;  1SEB D;  1W2B P;  4QUF A;  1ZEQ X;  4J83 A;  4B3R L;  2D0N A;  3CCR T;  1VQ9 A;  2JW4 A;  3VUZ A;  5KYY A;  2J6K A;  3DWA A;  1STY A;  3PNW C;  1BK2 A;  1NBW A;  5GAN f;  2XWB B;  4RKL A;  1PH3 A;  1YI2 A;  4FNF A;  2WAQ G;  1YZ6 A;  1OOT A;  1WLP B;  4F14 A;  1P8L A;  4B6M A;  3V7C A;  3HKZ B;  4HED A;  2JJQ A;  3QG1 A;  2L3P A;  3HOX G;  3I2Z A;  3QDF A;  3SWN C;  1NAP A;  3F2U A;  4G7Z C;  4JBJ A;  1N5Z A;  1WQW A;  1HXY D;  4CKB A;  4ME3 A;  4O6J A;  4C3J B;  1CUK A;  5GQO A;  5ELB A;  2DE0 X;  3ULR B;  4C8Q G;  3CHB D;  4H02 A;  3MEV A;  3PCO B;  3OSV A;  3EJI A;  4K8I A;  5GMK m;  1VQM T;  4RCO A;  1GFD A;  3KDF B;  4X65 L;  2UUC Q;  5KYX B;  5FW9 A;  5KYY B;  3IKJ A;  1JXM A;  1HZA A;  3CBP A;  1N9S A;  1D5X C;  2YTX A;  3K81 C;  3TP5 A;  5GAM j;  2R58 A;  3QPH A;  2VKN A;  3CQT A;  2H5X A;  3DM1 A;  4QQB X;  4PQX A;  1AFP A;  5FU7 C;  5KYL A;  1C8C A;  1PFB A;  1JBM A;  2EQI A;  1EY6 A;  4DBR A;  2QQ9 A;  4HCZ A;  3PVL A;  3RR5 A;  4XYQ A;  3VYR A;  2IJ0 A;  4TVA B;  3S6W A;  4L8J A;  1LT6 D;  3S17 H;  5GAM h;  3MXN B;  4UHV A;  1S5E D;  3JB9 F;  1HHV A;  1IZ6 A;  1WHJ A;  1WXB A;  5T1I A;  1S72 Q;  2D0Q B;  5KCH A;  1WCM G;  3AFP A;  1VQK A;  3NXW A;  4KLK A;  1WTP A;  3L7Z C;  2KQW A;  1PRM C;  5IN1 A;  4JRP A;  2RDF A;  1YJW A;  3HOW G;  2LVM A;  1G3T A;  3CME A;  4DXF A;  5ELN A;  5IGD A;  4JBK A;  2XK0 A;  4XT3 B;  2IL8 A;  2XDD A;  1NR2 A;  3F2D A;  1PA6 A;  2DA9 A;  1V1C A;  5AT1 B;  3H9N A;  1HR0 W;  1X2Q A;  4KGZ B;  7AT1 B;  1BIA A;  5TSS A;  2YSQ A;  4QVZ A;  1D8L A;  1JWS D;  4E7Z A;  5I11 A;  4OWT B;  2TMP A;  3EGU A;  1XNI A;  4B3S L;  3A54 A;  1AEY A;  4O2D A;  2PQE A;  2JA6 B;  2HBW A;  2GN5 A;  3BDO A;  2WAQ E;  3X28 B;  4RH6 A;  3T1Y L;  4ME7 A;  3V05 A;  2TSS A;  3U50 C;  2HEQ A;  1XQH A;  1WHG A;  2L2P A;  3CXC S;  4PFO A;  3DB4 A;  4RCC A;  3VV0 A;  4BBS B;  2KRO A;  1SBB B;  2FXQ A;  2CSI A;  1CSQ A;  1UB4 A;  3GTK H;  4BY1 B;  4C8Q E;  4EIK A;  1HFN A;  2KEC A;  2E4H A;  2RJE A;  3H94 A;  1LCK A;  5CCA A;  4UPA A;  1GUT A;  2VS1 A;  3SVM A;  4K0K L;  1SND A;  5FO8 B;  5KGU A;  5CVI A;  5CC4 A;  4DR3 Q;  5C4X G;  2CT4 A;  4DV4 L;  3PO3 B;  1XNQ Q;  3L3O C;  2FIN B;  1VQM Q;  4ZKB B;  1C0M A;  2COZ A;  3A8K E;  4LF5 L;  2SRC A;  1BCP B;  3O13 A;  4R1J A;  5CR3 A;  2YRC A;  5I9P A;  1ASZ A;  3HSB A;  5ELC A;  4OWX B;  2AHJ B;  2RSN A;  1WTW A;  2DX1 A;  2EKH A;  3MP1 A;  3VS6 A;  1Y1V G;  4M78 E;  5FLM G;  2JM8 A;  3VS3 A;  4LNQ A;  1Y1W H;  1C4Q A;  4RAU C;  4FU6 A;  4E7S A;  2HKQ B;  4ZUJ A;  2BH8 A;  3RDV A;  1F2Y A;  3ND8 A;  4IZ8 A;  3OW2 A;  3WWV A;  2KDS A;  3CCU Q;  2KYM A;  1B9M A;  2FMC A;  4WRD A;  1PM3 A;  3UE0 A;  3I9Q A;  3S9W A;  3I72 A;  2JT4 A;  1G5V A;  2R7Z G;  1TG0 A;  4RGM A;  2ASB A;  1VQL Q;  3QYG B;  4A3F H;  5C3E B;  1K1Z A;  3J81 E;  1F9Q A;  3KFU A;  2B2V A;  3NWT A;  4M77 A;  2EY5 A;  2A68 D;  3SXH A;  5FWB A;  1AE3 A;  4A93 B;  1AZG B;  1X75 C;  1A15 A;  1WZO A;  1MBY A;  1WFQ A;  2AMC B;  3PQI A;  4UAI A;  4EQN A;  1PFM A;  2IWH A;  4M8A A;  2IPK D;  3HOZ B;  2LRQ A;  5GMK i;  1S3O A;  5GRO A;  4RKB A;  2NVQ H;  1U4P A;  1K0X A;  2VB3 X;  4OGQ C;  4EDU A;  2ZCF B;  5M3F B;  1M30 A;  5GJV B;  4A4K A;  4M7A D;  4NL2 A;  5E3F A;  1BNZ A;  3SB2 A;  1PC0 A;  3CMA T;  2X6L A;  3GLX A;  4A3J G;  2NUT A;  3X20 B;  5I22 A;  4BD3 A;  2L55 A;  1KJW A;  4ALP A;  3VS1 A;  3PE0 A;  4H7B A;  3F8T A;  1K3R A;  4X62 L;  1Y7X A;  2YLB A;  2RA4 A;  1GCP A;  1VQC A;  2EYH A;  4MNO A;  4PJO C;  3JAM E;  3OBY A;  5D65 A;  3T9N A;  3BG3 A;  1CI3 M;  2HQH A;  1Z6H A;  4KBM B;  5DAU A;  4GLV B;  1WJR A;  4DU9 A;  1NCV A;  4M77 F;  4E7K A;  1KL9 A;  3GTP B;  3HOV B;  1JCK B;  1BI0 A;  2LXJ A;  3A55 A;  3GBQ A;  2RJD A;  1ZUK A;  1EQT A;  1K83 H;  5M5X H;  2CCZ A;  2E6N A;  3K7A B;  4DV0 Q;  2B2T C;  2V1R A;  1ZKO A;  3EN2 A;  3A8O B;  2F0L A;  4CKC A;  2NUT B;  4OO1 I;  1XMO Q;  2VNU D;  1H3Z A;  1XNR L;  3G1J A;  2EVB A;  1SSH A;  2O9S A;  4R4I A;  4DUZ L;  2VGM A;  4KY7 A;  4X1V A;  1Q95 G;  1TT2 A;  1TY2 A;  3M3Y H;  1I50 B;  1S72 A;  5EQ0 A;  1KDC A;  3QOJ A;  1TU0 B;  4QJF A;  1LLR D;  2CSQ A;  2KMT A;  4FT4 A;  3CCE T;  1JB3 A;  4C3J G;  3S1N B;  2B8F A;  4X64 L;  4ATO A;  1JJ2 P;  3OYD A;  4DOW A;  2MP1 A;  2NWG A;  1OV3 A;  3RMQ A;  1QE6 A;  5LJ5 e;  2NVX B;  2NTT A;  1EWC A;  1A8V A;  2QDB A;  2EJF C;  2RVL A;  1QUQ A;  1B7T A;  4DBH A;  2K7V A;  3PMI A;  2B2W A;  2C35 B;  1ET6 A;  1ZSG A;  1VQ7 A;  1H92 A;  1SYG A;  1YN8 A;  1SXT A;  2PQW A;  2VXW A;  4C3I H;  2F52 A;  2XU8 A;  1PHT A;  2K4Y A;  2K57 A;  1GCQ A;  3K5N A;  2COW A;  4ZGD B;  5L37 A;  4J7F A;  2Z1C A;  4S3S A;  3QII A;  3QJ6 A;  4LDY A;  2MF2 A;  4KJO A;  1M5Q 1;  4HCK A;  3UI2 A;  2DEQ A;  2I0Q A;  1N9R A;  4PJO D;  3G7L A;  1I3Q B;  1ENF A;  3GV6 A;  2PUO B;  4JS5 A;  1M8M A;  2F4V Q;  3PUX A;  2J7I A;  1OO9 B;  2Q2H A;  1HNW Q;  1F77 A;  1STN A;  3TZU A;  4Y52 H;  2LQN A;  3MFG A;  2EQK A;  5CKE A;  1B70 B;  1II3 A;  4PMW A;  1K0R A;  1QUQ B;  1Y14 B;  2LC4 A;  1BI3 A;  1PTO C;  3S3O A;  3H3V I;  1PMR A;  2F0F A;  2UXC L;  1KQS A;  4ZLT F;  4C92 A;  1EIY B;  1ONL A;  3EIV A;  2CW0 C;  2CKZ B;  4DV3 Q;  3CRL C;  3TDQ A;  1TVX A;  3NBI A;  2JA6 G;  1EWI A;  5LJ5 g;  2L3Q A;  2E3I A;  4XTW A;  1CT1 D;  4ANJ A;  2A37 A;  5L8R E;  1GKH A;  1UGQ B;  2M16 A;  1U5K A;  3HKZ E;  5JOB A;  2MO0 A;  3NQI A;  3I70 A;  3NE5 B;  1B2T A;  4X3K A;  2QGG A;  3FJP A;  2EQS A;  5C0X G;  4BBS G;  2RI3 A;  2CQA A;  1KXL A;  3FPU B;  2PUK B;  2XRS D;  3T51 B;  3HS0 C;  1H64 1;  1OU9 A;  2DL5 A;  2I2L A;  2MMP A;  3CCU A;  1EY4 A;  3FMC A;  4BY1 G;  1O7Z A;  1V1P B;  3VS0 A;  4DV1 L;  1WJS A;  1HUM A;  1IBL Q;  2ZAE A;  1VQ4 T;  3HOW H;  5IWA Q;  5KCO A;  1VQL A;  1X56 A;  4OMN A;  1HZC A;  3OSS C;  4OMM A;  1VQB A;  3CCM T;  1M90 R;  3BDU A;  2K3X A;  4RTT A;  1AW7 A;  1Z47 A;  1F2Z A;  3MKD A;  2D5D A;  4F7X A;  1M3A A;  2BH2 A;  2V1C C;  3Q8D A;  4C92 F;  2K50 A;  4BE0 A;  1HNZ Q;  3CBO A;  3JCM W;  5FLX L;  2DXB A;  4XTV A;  5CIU A;  1QNK A;  1D3B A;  5KIX A;  1MMD A;  4DFA A;  5M3M B;  1RAE B;  1ET9 A;  1LTB D;  4CDC C;  1I4P A;  2P84 A;  1W6K A;  1PRL C;  3LWH A;  2YDL A;  1X2K A;  4A3I B;  2J6F A;  3MZ5 A;  3R2I A;  3DUZ A;  2F3V A;  3QBY A;  1CK1 A;  1PTO D;  4KHP Q;  4CC4 B;  3M53 A;  4IUN A;  4F7U A;  4RUG A;  5AJ3 Q;  5C0M A;  1QVF S;  3MEH A;  4CKE A;  2HUG A;  4R4T A;  1M3B A;  2WIN B;  5C3E G;  2JVV A;  4M75 C;  4QVD A;  2PW7 A;  3CCV T;  4XQJ A;  3SEM A;  1B7Y B;  4JI8 L;  2F3I A;  5C3W A;  3E0J A;  4LF8 L;  5LJ5 d;  1NSN S;  1X27 A;  5GAO p;  1UDL A;  2QTX A;  2EY6 A;  2RHZ A;  2R3Z A;  4J5Y A;  1S4Z A;  1D3B B;  1ZSZ A;  1I4G A;  1VIF A;  5LJ5 f;  1K73 U;  1V8Q A;  2Q8T A;  1Z9F A;  3T4A C;  1S1N A;  2F5K A;  1M1K R;  1BCM A;  4BBR G;  1TOV A;  5GAN 5;  2AUK A;  4ILW A;  4WJ4 A;  3I5R A;  1J3T A;  3CC4 Q;  5FLM H;  2CZ7 B;  3OWE B;  1XPO A;  1N36 Q;  1AZE A;  1D5M C;  3I4M B;  4FXG C;  4F7U B;  2RHQ B;  5IIF A;  3BVZ A;  1AHJ B;  1Q46 A;  3MA2 B;  1B44 D;  3M0P A;  4R4Q A;  1NYF A;  4DXG A;  2CWP A;  1FNV A;  1O75 A;  3VYU A;  3H0H A;  1EOT A;  5GAN 4;  3GDE A;  1TWF H;  2EYF A;  2ICI A;  1HSQ A;  1VQ4 Q;  2GA4 B;  3HOV G;  4AYB B;  3PIP A;  1GVP A;  1QP2 A;  4CI0 C;  2XDB A;  4MZM A;  2JYO A;  2ZT9 C;  4EQO A;  4A3D B;  2EPB A;  3PF5 A;  2XMF A;  2PTK A;  1F2L A;  1QVG A;  1NY4 A;  1VA7 A;  3J7Z C;  3CCS A;  2DIL A;  4K11 A;  3CXC P;  1Y69 U;  1YFN A;  5IP9 G;  4A3J H;  1V9P A;  1JJC B;  2R93 B;  1DD2 A;  1AWW A;  1R0C B;  2HNI A;  3BY7 A;  2CH4 W;  2P0P A;  2V8K A;  1I4Q A;  3FVQ A;  2ZPH B;  2NZO A;  4M75 D;  1RTO A;  2DET A;  2O4X A;  1XJW B;  3OYG A;  1SYB A;  1EFI D;  3OYK A;  3H41 A;  2K5Q A;  4L63 B;  2K2M A;  1G3W A;  3E1S A;  4JDS A;  3JC6 6;  3MO8 A;  4NXN Q;  1IO6 A;  4BAC A;  2J7Z A;  4JRI A;  4OMF B;  2JN0 A;  5GAO l;  5M5W H;  1ZBJ A;  3TSZ A;  5G3L F;  2M0Y A;  1OZ3 A;  2DL8 A;  2KXC A;  2X35 A;  1K73 C;  2YUP A;  3O8V A;  5ELO A;  3CCV Q;  3OYB A;  3G4S T;  2UXD Q;  5CV5 A;  4XAX B;  2RDH A;  1IBK Q;  2O2O A;  1QKW A;  1FX7 A;  2D9U A;  1LAC A;  2DNC A;  2EXZ A;  4DA2 A;  2K01 A;  2L11 A;  3NWS A;  2C9O A;  2FJ2 A;  2F2W A;  3DXJ C;  4ZTF A;  3KLS A;  3J81 j;  1H9K A;  4A3E B;  2RDG A;  1HUN A;  4KY6 A;  2ZM6 Q;  5IGF A;  2QG9 B;  3GQB A;  3K80 C;  4DNT B;  5CR2 A;  4PLI A;  2ZZD A;  4OON A;  4YY3 Q;  2ENM A;  1JRI A;  4IFD I;  4ODG A;  2DL7 A;  3CC7 T;  4C3J H;  1PV4 A;  1D7Q A;  4A3K B;  4M77 E;  1RAC B;  2DM1 A;  3LW5 E;  1I0C A;  2A8V A;  5A2Q L;  2ZTE A;  3FIF A;  2KSS A;  2EJG C;  5JEA G;  4PJM A;  1A2U A;  4C0D B;  2E1H A;  1YJN Q;  4DR3 L;  1IBM Q;  4ZTJ A;  2PZT A;  1OYX A;  2MWO A;  3L1A A;  2KCM A;  3VYG A;  2C0I A;  2HDA A;  1NMG A;  2MPM A;  4X3T A;  3RN2 A;  1XNQ L;  2CP7 A;  1G3S A;  1SAP A;  3A5U A;  3BDL A;  3M0Q A;  1U06 A;  4JI5 Q;  1JO8 A;  3S16 B;  1EWH A;  4DKA C;  4A4G A;  3H91 A;  1BXT A;  3C4S A;  2MYS A;  2XD0 A;  4L5R C;  3IRB A;  4N0A C;  4LAA A;  5K36 G;  2ECZ A;  1JB7 A;  2WV6 D;  2PNH A;  1WJQ A;  2HQL A;  4QY7 A;  3M85 A;  5CV9 A;  4J6X A;  1VQO T;  1PH7 A;  5GMK e;  1XTC D;  5AFW A;  2PMZ B;  3SR1 A;  3P8H A;  1KHC A;  4PMC A;  2PZW A;  1T0H A;  4N4H A;  4ZRZ A;  1PYB A;  4RTW A;  4UP9 A;  4J6W A;  2X69 A;  8ATC B;  4X34 A;  3I3C A;  1KRS A;  1PYW D;  1XXG A;  3VR4 A;  1WNL A;  4BY7 B;  3W1B A;  1ILP A;  5LJ3 e;  3G7Z A;  2FRY A;  1BQQ T;  1FD7 D;  1JOR A;  1IW7 C;  3BE3 A;  1SE2 A;  2PI2 A;  4MZ9 A;  4HIK A;  3J80 E;  3QXE B;  1PZK D;  1RJT A;  1TQO A;  3CD6 T;  1JEG A;  4JW0 A;  3PUV A;  2NUC A;  1VQ8 T;  2N49 A;  2ZJP A;  1J6Q A;  3JB9 I;  3E9G A;  1VF5 C;  4JOI C;  2JA6 H;  2NLU A;  1QKX A;  3MJX A;  4IUR A;  1YHQ Q;  5I4D A;  3G6E T;  3CC4 A;  2VB2 X;  3GNG A;  2FPE A;  1MV0 B;  3G71 A;  3OBW A;  1X3Q A;  3CW2 C;  3LGJ A;  4GN3 B;  1JOQ A;  3TS0 A;  1V1O A;  1JC7 A;  3FKI G;  2KHI A;  1LUZ A;  5C0X H;  4BBS H;  4KUD K;  3NHN A;  4YTL A;  1X6B A;  5IYC G;  4A3I G;  3J7A V;  3S2D H;  4YIJ A;  3W5O A;  5EBC A;  3N5B B;  1XPR A;  4C0F A;  2YV5 A;  4KKS A;  5FK9 C;  3NK9 A;  3S15 B;  1TUG B;  1YIJ Q;  1WQ7 A;  5GAN j;  5KYU B;  2DJZ A;  3V96 A;  4YWM A;  2F1L A;  3AFQ A;  2QEX T;  1WIE A;  3CC7 Q;  5H1S E;  2CUB A;  4GNX A;  2CZ1 B;  1ML0 D;  2QEJ C;  2E6Z A;  4BI8 B;  4XU0 A;  5GAN 3;  3A8M B;  5JJZ A;  2AIR B;  4M7D A;  2MWP A;  2JA5 B;  3EFX D;  4WJW A;  5FWC A;  2K03 A;  4LUE A;  1KG1 A;  4PMB A;  5JVH 3;  5GAN h;  2A3L A;  1TKW B;  3ITP A;  3I73 A;  4DV0 L;  3FDT A;  3E5S A;  1RDP D;  4MDW A;  4XYO A;  2BA0 A;  1M9S A;  1T0J A;  1LYL A;  1KK7 A;  2DPP B;  4A3M H;  1F9R A;  3K58 A;  1XMO L;  1SN8 A;  3J7A F;  2R7D A;  1RUW A;  1UJY A;  4JJD A;  2R92 B;  1M4Z A;  1HRJ A;  5DEH A;  2X6G A;  4OB1 B;  5C6A A;  2GBQ A;  3I4M G;  1I5L A;  1GXD C;  3OIQ A;  3U9O A;  3KXT A;  1AT1 B;  1PFN A;  4LF7 Q;  1NTG A;  1NZ9 A;  5ELF A;  1IB8 A;  4M1U B;  3DEO A;  4GNX B;  3GTM H;  2AZS A;  2PNI A;  1VQO Q;  2BE5 D;  4IJH A;  1IW7 D;  4M7D B;  4JI7 Q;  4P75 A;  3M54 A;  3JCM Q;  1UNS A;  4C92 E;  4QT7 A;  1ENC A;  2F0V A;  4IPD A;  5GAO q;  1EUJ A;  5C3E H;  2RHI A;  1UEC A;  3M0T A;  3H0G B;  4M7A A;  4MIU A;  3J7Y W;  4FF4 A;  3I4L A;  4AYB G;  4A3D G;  1JOK A;  2DIG A;  4DNR B;  4VUB A;  2L5T A;  1Q8I A;  2FHD A;  4X9D A;  4K2L A;  3CCJ T;  3VS5 A;  1KAA A;  3D0F A;  1K4U S;  3OSO A;  2G9H D;  1OU8 A;  5GAN 8;  4JCV E;  3S2H B;  1D0Z A;  1M90 U;  5A0D A;  4EVO A;  1YWO A;  4BBR H;  4K5X A;  4BDZ A;  3HOY B;  3PIO A;  2DYI A;  3CD6 Q;  1Q82 R;  1ZA1 B;  2NYS A;  4LUV A;  2NUP A;  2R93 G;  1Q81 U;  4UC4 A;  2BIV A;  1U0L A;  1QLY A;  1YNJ C;  1PH9 A;  1YWP A;  1FL0 A;  3ZYY X;  1FNU A;  4A3B B;  1YIT T;  3VKI A;  5K5P A;  3I55 A;  3UDX A;  2F4V L;  1HNW L;  1O7I A;  2RI2 A;  4ZN1 A;  1RAB B;  4ZGJ B;  1BBU A;  2GFU A;  4M7A B;  4AMC A;  1E6G A;  2A28 A;  4HXJ A;  5E7N A;  4HID A;  2FZC B;  3CKI B;  1YJN A;  2SDF A;  1UHC A;  3GTP H;  1L1O B;  1SLJ A;  1TWG B;  3HOV H;  1Q7Y R;  2QEX Q;  5BN3 A;  5I9O A;  3PO2 H;  3MP8 A;  4DAV A;  4CJ2 C;  5LJ3 d;  2IX1 A;  3WOF A;  2CYZ B;  3ER0 A;  4HA8 A;  4GOP B;  2J0T D;  2EWN A;  2XGT A;  1U8R A;  4DV3 L;  2XDP A;  5LJ3 f;  2E10 A;  4A4E A;  5CKF A;  3BJU A;  5BN4 A;  5IP9 H;  4Z88 A;  4A76 A;  1PRT C;  3QR8 A;  3TME A;  4A3E G;  1UE5 A;  4F7U E;  2E2D C;  2OXP A;  3VR2 A;  4OO1 G;  1HZB A;  1U4M A;  1I50 H;  4ZNX A;  4HAE A;  1M1K U;  2A7Y A;  2EYW A;  4MHE A;  2HCK A;  3MWY W;  3DHQ A;  4KTA A;  3S1N H;  4A3K G;  3W1G A;  1IBL L;  1QVF P;  1AE2 A;  4XIG S;  1E24 A;  5FO7 B;  5IWA L;  1NPP A;  3GV3 A;  1K8G A;  4DNI A;  2AKL A;  2LDM A;  2NVX H;  1XOV A;  3NTI A;  3I7F A;  2YU9 H;  5J1Z A;  4FM4 B;  4AYB E;  1LVK A;  2K5V A;  4PNO A;  2GNC A;  2JQO A;  1BBW A;  3BVM A;  2DD5 A;  4JLG A;  1KSW A;  1Y57 A;  4AH6 A;  3FHW A;  3PFS A;  2FRW A;  3KBG A;  2QAS A;  1M90 C;  3MXG A;  1HNZ L;  1RAG B;  1YHQ A;  1YNJ D;  2HSE B;  2GVA A;  1G8Z D;  1TII D;  1RLQ C;  3TSS A;  1GUW A;  4J9D A;  2EGE A;  4J9B A;  3BVG A;  5CV7 A;  1QWF A;  2O31 A;  3C3L A;  1Q81 C;  3RMH A;  2PYK A;  4O42 A;  3Q23 A;  2ZJQ A;  4HVW A;  1M2O A;  3M4Y A;  3OYE A;  1Q90 A;  1I3Q H;  1YCY A;  5J22 A;  2VUM H;  4FT2 A;  3VA7 A;  2DNU A;  1YIJ A;  5KNB A;  3EHR A;  1MIU A;  3HEJ A;  3EGD A;  1D1B A;  2HIX A;  3KK7 A;  2Y0S B;  1VQE A;  5C4J B;  1U4R A;  4KHP L;  3OMG A;  1EQQ A;  2B3G A;  1PH6 A;  1SNC A;  3T1H Q;  2HD3 A;  1PH5 A;  4OF1 A;  1YIT Q;  1QCF A;  5JEA H;  1XTD A;  1BUV T;  1JOO A;  1SDF A;  4J1M A;  2K5I A;  1VQP T;  5IT9 c;  1TS3 A;  4C2M H;  1NM7 A;  3QB3 A;  1KLG D;  1JWM D;  2ZPI B;  5KYI A;  1J5E Q;  3Q22 A;  1WHH A;  3V7R A;  4PJO F;  2LCC A;  1PRT D;  5D14 A;  3R93 A;  1PD1 A;  1SE8 A;  4QQ6 A;  4OGC A;  2D62 A;  2RJC A;  1HH2 P;  4KHV A;  4JI3 Q;  3X24 B;  4C3H B;  3GTG B;  3I4N B;  2NUZ A;  3CPW S;  4ZK9 B;  1PVO A;  2KGT A;  4IUU A;  2CHB D;  2IT1 A;  4LF4 Q;  1CZW A;  1KFZ A;  3ICE A;  4X9C A;  5K36 H;  3EG1 A;  2DY8 A;  3EGD B;  1JB0 E;  2RM4 A;  1M1K C;  1QZG A;  1N36 L;  4RG2 A;  3UDI A;  1UTI A;  5I2M A;  3MXU A;  3OS1 A;  2O5J C;  3IQL A;  3DB3 A;  3RNU A;  3KJP A;  3HRU A;  4K6D A;  1MMG A;  3A8I E;  3H09 A;  4DEY A;  2ZTD A;  3ND9 A;  3I56 A;  4XU2 A;  1A2T A;  1KHI A;  1VQA A;  3JCM V;  1QCB D;  4R4C A;  4LFC Q;  1Z9Q A;  2EGC A;  1B9N A;  2DBM A;  2RBM A;  1CKA A;  1IGQ A;  3GOX A;  3QO2 A;  5JPN C;  2HT1 A;  4A3G H;  5JEA J;  2RJF A;  4X6A H;  1X01 A;  2K3Y A;  5FU6 C;  2CS7 A;  5IGE A;  3DLM A;  4L6V 5;  2XID A;  3CQZ B;  2HZY A;  4FSS A;  3UA7 A;  4C8Q C;  4DV5 Q;  2RD1 A;  1HXD A;  1D0X A;  4GN4 B;  3EH2 A;  3T53 B;  4J9I A;  3FKI H;  4KHZ A;  4CDF C;  5IGB A;  4HJ8 A;  4LF9 Q;  2MQH A;  2PMZ E;  4PJJ A;  2RHY A;  5IYC H;  4A3I H;  1HD3 A;  4DR2 Q;  2SOB A;  4M78 G;  1IYU A;  3CCL T;  3C94 A;  2EJ9 A;  1VQ6 T;  4AFS C;  2NB0 A;  1TSF A;  4RFB A;  1OPK A;  5GAD C;  4M7D G;  3TSW A;  1GD7 A;  3KJO A;  3TEE A;  1GUS A;  4CBV A;  5EPL A;  3H0G G;  4NXN L;  1K73 R;  2Z6K C;  3QSU A;  1VQN A;  2NZH A;  4XTZ A;  3RZO B;  2AUJ D;  3VRZ A;  4CC3 A;  2J6O A;  1AZQ A;  4YWL A;  2LT4 A;  2EGA A;  2QYZ A;  2RA2 A;  4M78 C;  1CHP D;  1OUL A;  3PUZ A;  3ULP A;  1TWB A;  2UXD L;  5KE2 A;  1PTO F;  2OQ0 A;  1YP5 A;  3QWN A;  2LJ3 A;  3P7J A;  1IBK L;  4DA4 A;  1AWO A;  1F2M A;  1MMA A;  1X3P A;  3JCM d;  4DK3 C;  3HOY G;  3QWY A;  4J9G A;  3U58 A;  3CCR Q;  4P5N A;  1E2Z A;  1EZZ B;  1RD9 D;  4HT8 A;  3I4M H;  2FG0 A;  2ZM6 L;  2KRS A;  2EQM A;  3HFZ B;  2RHS B;  1DYQ A;  3TP7 A;  4YY3 L;  4A3B G;  3M5A A;  1MKH A;  3C12 A;  2DJG C;  2GTO A;  2ZPG B;  1KNE A;  2PI2 E;  4A3C G;  2NYZ D;  2E5K A;  3ERS X;  2E2H B;  3M4P A;  1EL0 A;  2WB1 B;  3DM3 A;  4CRI A;  4B08 A;  1HNX Q;  4H44 C;  4CGY B;  2W10 A;  4HCB A;  3D31 A;  3R2T A;  4RGO S;  1IBM L;  1L0X B;  4A3D H;  2RO0 A;  4Q0F A;  2I5H A;  2F0K A;  2KJX A;  2LS0 1;  4JI1 Q;  1D1K A;  4C8Q D;  3KFV A;  3INZ A;  2DGY A;  2BKD N;  5FRO A;  1DXM A;  1JU5 C;  1YHB A;  2KYB A;  1PSE A;  1I07 A;  1WJJ A;  3M4Q A;  4JI5 L;  2F0O A;  3JCM b;  4U67 3;  2ALY B;  2W0Z A;  4R8N A;  4LDW A;  4AT1 B;  1WDX A;  2M51 A;  4M75 A;  2K5F A;  2AHO B;  2B29 A;  1NBE B;  2R93 H;  2RCN A;  2EYQ A;  3MTS A;  3D3R A;  3CC2 T;  4A63 B;  3LWU A;  3RZD H;  1W3S A;  4M7D E;  3F1Z A;  4HSV A;  1DOM A;  4LJZ C;  4N8F A;  2A5H A;  2MFI A;  1PCX A;  2O88 A;  3CCL Q;  2A1A A;  1R9T B;  1ACM B;  1VQ6 Q;  5EKK A;  5KE3 A;  3E9H A;  5L23 A;  2GQI A;  1VQI A;  4LUZ A;  1LNX A;  3M0R A;  4EMK A;  2XNA C;  3NP8 A;  3X26 B;  2HCI A;  3MP6 A;  5IHI A;  2WKC A;  2IW3 A;  4MZP A;  1BKB A;  3THK A;  3LWI A;  1N33 Q;  4GKK L;  4BY6 C;  4M75 F;  4AFQ C;  2KVM A;  2VZA A;  3DWP A;  4MTK A;  2LMJ A;  1HCZ A;  1E2V A;  4IJL A;  2VQF Q;  1B4O A;  4A3E H;  1QG7 A;  3UDF A;  3BS1 A;  2D9T A;  1TH7 A;  4NKL A;  3EGX A;  2DEU A;  1MND A;  4RMF A;  3J81 c;  3F2C A;  4J9C A;  3JSC A;  5LJ5 j;  3SHW A;  3HTR A;  1Q82 U;  3QIA A;  1RLP C;  4M7A E;  1X55 A;  2OF1 A;  4IQZ A;  2IY5 B;  1I6H B;  2Z4I A;  1IHZ A;  4EMK B;  4DV6 Q;  1AWX A;  4IFD G;  4M77 B;  3RKY A;  4L5Q A;  1IHW A;  2CUD A;  4C5G A;  4LNP A;  1B3A A;  3TS2 A;  2DXC A;  1SRO A;  1MGS A;  5LJ5 h;  2X3X D;  1PG5 B;  1U9R A;  1VQ5 T;  5EAY A;  2ABL A;  4J7I A;  3FC3 A;  3NEL A;  2J4X A;  5KYW A;  2Q8R E;  3J81 i;  2E2J B;  3S16 H;  4BA1 I;  1EQV A;  1RAI B;  3V8J A;  1SYD A;  4C3H G;  1SJE D;  3I4N G;  2EVR A;  1Q7Y U;  3U4Z A;  3JAM c;  1PH4 A;  2UU9 Q;  2M02 A;  1CKO A;  1I5F A;  1L0Y B;  2B2U A;  3NUC A;  3GP8 A;  2QQA A;  4DR1 Q;  1W2B A;  1DOK A;  2BOS A;  1NG2 A;  4OEL B;  1WTV A;  4ID6 A;  2GFA A;  3X3N A;  3LH5 A;  1Z7T A;  4BUG A;  3HKZ G;  4Y7N H;  3E0E A;  3SDZ A;  3KF6 A;  4LF7 L;  1EFN A;  1E0B A;  3M9B A;  2R5M A;  1GUN A;  3C1E A;  1WD1 A;  1LTS D;  2NVY H;  4DAM A;  1TWC H;  4JI7 L;  3M4O H;  1D0Y A;  3LH0 A;  4BY7 H;  2F69 A;  4Q5W A;  3VS2 A;  5KH6 A;  4HCC A;  4PJN A;  5KYW B;  4PG3 A;  1A3V A;  3JAM i;  4FW1 A;  5GAN 7;  1HJP A;  1UGS B;  1Y8P B;  4P2C B;  2EY1 A;  4IUT A;  2RI5 A;  4XU3 A;  3LGL A;  5HY6 A;  3BZD B;  1FMW A;  1SJH D;  1TS5 A;  1QP3 A;  3AMU A;  2EJG A;  1TTH B;  2RHU A;  2KOL A;  3NQT A;  1A3U A;  3CCR A;  4NOY A;  1DJ7 B;  4KUI A;  5IHN A;  3IFD A;  3GTQ B;  3JB9 G;  4CDD C;  2KVQ G;  2D0P A;  4FO2 A;  3LX0 A;  3L2W A;  1S5B D;  2OAW A;  2BA1 A;  1BI2 A;  3OWF A;  1VS0 A;  2UUB Q;  1SRL A;  3HOX H;  2N8N A;  4Z89 A;  3PSI A;  3X25 B;  2PVO B;  1Q82 C;  2Y0S E;  3CMA Q;  4APV A;  1JE5 A;  4GLX A;  2E65 A;  5KNC A;  4WJ3 M;  3CP0 A;  1XWE A;  4RWS C;  2EW3 A;  2K28 A;  4I65 A;  4OWW B;  2DVJ A;  3OYM A;  2EPD A;  5CO7 A;  1SYE A;  1QZH A;  2UXB Q;  2RQV A;  4J6Y A;  1YNN C;  4JJC A;  1PKS A;  2H8H A;  1EYA A;  2PW5 A;  1W1F A;  2RHX A;  3G6J B;  1KC8 R;  1CM9 A;  3IFT A;  1VQM A;  4X3S A;  2JXB A;  4HMI A;  4HMJ A;  2AK5 A;  3KLR A;  4RGT A;  5COY A;  2F0D A;  4FW2 A;  3VYT A;  4LFB Q;  1KAW A;  1E7Z A;  4E7L A;  1KQ2 A;  2DTI A;  4ULL A;  4R0K A;  1Q7Y C;  5CV8 A;  1WTR A;  2BE9 B;  3C95 A;  4OL7 A;  2I0N A;  1LTI D;  4L5S A;  5ELE A;  4NP5 A;  1GM5 A;  1PNJ A;  3PIP 3;  2KY9 A;  1WHM A;  1T3S A;  1EZ6 A;  3OW7 A;  4GKJ Q;  2FL7 A;  2KBT A;  1WCM H;  3ASK A;  2E3H A;  2I5L X;  4LDV A;  4NL3 A;  2HKN A;  1VQ6 A;  1UUE A;  3RR6 A;  3VR6 A;  4MZT A;  3TP6 A;  1G6P A;  2K5D A;  2WB1 G;  1DZ1 A;  1SF9 A;  1H9R A;  3H0G H;  5I6W A;  3S3M A;  1PD0 A;  3CCE Q;  4PK4 A;  4C92 B;  2F0W A;  2B8G A;  1A0I A;  4Z8A A; 
#chains in the Genus database with same CATH homology
 2ECZ A;  2JS0 A;  2C0T A;  2RQW A;  2X3W D;  2ED0 A;  1T0H A;  3O5Z A;  2DL3 A;  2JMA A;  4RTW A;  3UAT A;  4RTY A;  2O9V A;  1UGV A;  1RI9 A;  1MUZ A;  1VYV A;  4J9E A;  1K9A A;  2FRY A;  2K9G A;  2YT6 A;  1WXT A;  3QWX X;  4RTX A;  1VYT A;  4OMP A;  2F2V A;  2JMC A;  1JEG A;  1H8K A;  1AVZ C;  4OMQ A;  4ORZ A;  1QKX A;  2A36 A;  2KRN A;  2K79 A;  2FPE A;  1MV0 B;  2OI3 A;  4OMO A;  1K76 A;  3I5S A;  1JXO A;  3REB B;  2HSP A;  3NHN A;  1X6B A;  2DJQ A;  4F17 A;  2K6D A;  1WIE A;  2D0N A;  4RTZ A;  2CUB A;  2JW4 A;  2J6K A;  1BK2 A;  5ECA A;  3RNJ A;  1A0N B;  2EBP A;  5FWC A;  4LUE A;  3U23 A;  1OOT A;  1WLP B;  3EG2 A;  4F14 A;  1T0J A;  2L3P A;  1ZUU A;  1N5Z A;  1HJD A;  1KIK A;  1RUW A;  1UJY A;  4JJD A;  2DE0 X;  3ULR B;  2ESW A;  1M27 C;  2MOX A;  2GBQ A;  1Z9Z A;  1GFD A;  1WXU A;  5FW9 A;  2JS2 A;  2MIO A;  1JXM A;  2AZS A;  2PNI A;  2KNB B;  2VKN A;  3CQT A;  4QT7 A;  1UEC A;  3M0T A;  1WYX A;  2EQI A;  2LQW A;  3PVL A;  2KXD A;  3VS5 A;  3I35 A;  1K4U S;  2RN8 A;  2PZ1 A;  1YWO A;  2RNA A;  1WXB A;  1E6H A;  5HCK A;  1PRM C;  2KE9 A;  1QLY A;  2CT3 A;  4GLM A;  1YWP A;  4CC2 A;  1ABQ A;  2DA9 A;  1V1C A;  1SEM A;  3EG3 A;  1FMK A;  1X2Q A;  2ROT A;  2YSQ A;  1E6G A;  4DEX A;  2SEM A;  2A28 A;  4HXJ A;  5I11 A;  2DMO A;  1UHC A;  2D1X A;  3EGU A;  4LUD A;  5IHK A;  1AEY A;  2HBW A;  4AFZ C;  3JV3 A;  2HEQ A;  2L2P A;  4HVU A;  2KRO A;  2CSI A;  2YUO A;  4EIK A;  2CRE A;  4Z88 A;  1LCK A;  5GJW B;  4ZNX A;  2EYW A;  2HCK A;  4LN2 A;  2D8J A;  2LNH B;  2CT4 A;  2KRM A;  4GBQ A;  2BZY A;  2AKL A;  1XOV A;  1NYG A;  2SRC A;  2DBK A;  4WCI A;  2GNC A;  1GCQ C;  1BBZ A;  2BZX A;  2ED1 A;  5EC7 A;  1G2B A;  2C0O A;  1KSW A;  1Y57 A;  2DX1 A;  2EKH A;  3VS6 A;  2FRW A;  2KT1 A;  2JM8 A;  3VS3 A;  2LP5 A;  2CDT A;  4JZ4 A;  2J06 A;  1RLQ C;  4ESR A;  4J9D A;  2EGE A;  4J9B A;  1GBR A;  1QWF A;  2O31 A;  1NLO C;  2KYM A;  3I9Q A;  4HVW A;  2ROL A;  2JT4 A;  1TG0 A;  1SPK A;  2DNU A;  3VS7 A;  4D8K A;  1K1Z A;  3EHR A;  3H0I A;  5FWB A;  4AG1 C;  1AZG B;  2RQT A;  1QCF A;  2BTT A;  1W70 A;  1NM7 A;  1K0X A;  1M30 A;  5GJV B;  3C0C A;  1UE9 A;  5I22 A;  1KJW A;  3VS1 A;  3PE0 A;  1H3H A;  2NUZ A;  3EG0 A;  2KGT A;  1KFZ A;  1GCP A;  3EG1 A;  5IXB A;  1TUD A;  1Y0M A;  1UTI A;  1JQQ A;  3IQL A;  1ZLM A;  2G6F X;  3GBQ A;  1ZUK A;  4DEY A;  4M4Z A;  2K3B A;  2V1R A;  4JPB W;  1U3O A;  2L3S A;  1Z9Q A;  2EGC A;  1SSH A;  2O9S A;  4RTU A;  2DBM A;  2AKK A;  1CKA A;  2EYY A;  1CKB A;  4X1V A;  4E6R A;  3ZL7 C;  4FSS A;  3UA7 A;  2CSQ A;  4J9I A;  2FEI A;  2A08 A;  1HD3 A;  1OV3 A;  1AD5 A;  1WA7 A;  1X69 A;  4AFS C;  1GRI A;  1UG1 A;  2KT8 A;  1OPK A;  2P4R A;  2LJ0 A;  1ZSG A;  3TSW A;  1H92 A;  1YN8 A;  1PHT A;  1GCQ A;  3VRZ A;  4CC3 A;  2J6O A;  1ABO A;  4HCK A;  2EGA A;  3M0S A;  1ARK A;  1YP5 A;  2LJ3 A;  1M8M A;  1AWO A;  2J7I A;  3UF4 A;  3QWY A;  4J9G A;  2LQN A;  2FG0 A;  2KRS A;  1WX6 A;  3UA6 A;  1U5S A;  2GTO A;  2AZV A;  2E5K A;  1BB9 A;  2YUN A;  2W10 A;  3EHQ A;  5IXF A;  1M3C A;  2L3Q A;  2A37 A;  1MV3 A;  3KFV A;  4F16 A;  1JU5 C;  2KYB A;  1I07 A;  3NPF A;  2W0Z A;  4AFU C;  1WDX A;  2M51 A;  2DL5 A;  1T3L A;  3VS0 A;  2LJ1 A;  4IIM A;  4OMN A;  2LX7 A;  4A63 B;  4OMM A;  4RTT A;  1GFC A;  1M3A A;  2DLP A;  2L0A A;  2O88 A;  1ZX6 A;  2DRM A;  1BU1 A;  5L23 A;  2GQI A;  3M0R A;  2KR3 A;  2VVK A;  2JTE A;  1E7O A;  2MCN A;  1NLP C;  2GGR A;  1CSK A;  5IHI A;  1VYU A;  1PRL C;  4RTV A;  3THK A;  2YDL A;  1X2K A;  2F2X A;  2RQR A;  1YNZ A;  2J6F A;  4AFQ C;  4CC7 A;  2LMJ A;  1GBQ A;  4CC4 B;  4RUG A;  4J9C A;  2LCS A;  3M0U A;  1M3B A;  4LE9 A;  3SHW A;  1RLP C;  4KRT A;  3SEM A;  1SHF A;  2RPN A;  3VS4 A;  1WI7 A;  3H0F A;  1AWX A;  1X27 A;  1UDL A;  2K7A A;  1OEB A;  2CUD A;  1AWJ A;  4LNP A;  3REA B;  1S1N A;  2JM9 A;  2X3X D;  1UHF A;  1ZUY A;  2ABL A;  3I5R A;  1J3T A;  3VRY A;  2FPD A;  2RMO A;  1K0S A;  1AZE A;  2J05 A;  2EVR A;  4D8D A;  3M0P A;  1NYF A;  1FYN A;  4HVV A;  4Y92 A;  1NG2 A;  3LH5 A;  1NEB A;  3H0H A;  2KEA A;  4J9H A;  2DYB A;  1EFN A;  1HSQ A;  3A98 A;  1NEG A;  2D8H A;  1B07 A;  2LZ6 B;  2DL4 A;  1SHG A;  2XMF A;  2PTK A;  3FJ5 A;  3TVT A;  1YCS B;  3VS2 A;  1VA7 A;  2VWF A;  2EYZ A;  2DF6 A;  2DIL A;  4K11 A;  3RBB B;  2B86 A;  3PVQ A;  1PWT A;  1AWW A;  2RQU A;  4IIO A;  2CH4 W;  1SRM A;  1B3Q A;  5IHN A;  1QWE A;  2OAW A;  3H41 A;  1SRL A;  2K2M A;  1GL5 A;  4Z89 A;  4JJB A;  3R6N A;  1IO6 A;  2RF0 A;  1ZBJ A;  3TSZ A;  2EW3 A;  1X43 A;  2DVJ A;  2EPD A;  2M0Y A;  2DL8 A;  1TUC A;  2EYX A;  2KXC A;  2YUP A;  2RQV A;  3NGP A;  4JJC A;  1PKS A;  2H8H A;  2O2O A;  1W1F A;  1QKW A;  1UJ0 A;  1X6G A;  2JXB A;  4JZ3 A;  2AK5 A;  5IH2 A;  2F2W A;  2IIM A;  2V1Q A;  2YUQ A;  4R0K A;  1PKT A;  1W6X A;  4AG2 C;  2ENM A;  2I0N A;  2DL7 A;  1PNJ A;  2DM1 A;  1I0C A;  2CH4 A;  2FPF A;  2FO0 A;  4OML A;  2BZ8 A;  1T3S A;  1AOJ A;  1OPL A;  2KBT A;  1WFW A;  2DRK A;  3NMZ C;  2GTJ A;  2C0I A;  2HDA A;  1UUE A;  3M0Q A;  1I1J A;  1U06 A;  1JO8 A;  1G83 A;  2NWM A;  2QDL A;  2OJ2 A;  4J9F A;  4Z8A A;  1UFF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...