1K12A

Fucose binding lectin
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
158
structure length
158
Chain Sequence
VIPEGYTQENVAVRGKATQSAQLRGEHAANSEASNAIDGNRDSNFYHGSCTHSSGQANPWWRVDLLQVYTITSVTITNRGDCCGERISGAEINIGQHLASNGVNNPECSVIGSMATGETKTFHCPAPMIGRYVVTYLPTSESLHLCEVEVNVDKPAAA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A novel fucose recognition fold involved in innate immunity.
pubmed rcsb
molecule tags Sugar binding protein
molecule keywords LECTIN
total genus 37
structure length 158
sequence length 158
ec nomenclature
pdb deposition date 2001-09-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00754 F5_F8_type_C F5/8 type C domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.260 Mainly Beta Sandwich Jelly Rolls Galactose-binding domain-like 1k12A00
2Y64A 3C7HA 4CU7A 2VCBA 4P5YA 4YPJA 3UESA 2WUHA 5EJZB 1K45A 3JXSA 5C70A 4CU8A 1W0NA 3THDA 3MBWA 1UY3A 3P6BA 2VCAA 4OMCA 5DMYA 4DEQA 4UAPA 4JX0A 4Z2AA 2DCKA 3NNGA 3NRUA 3OGRA 4JHZA 5C71A 4XUNA 1CIYA 2C9KA 4MOAA 2WZEA 4LKSA 1O59A 3OB8A 5LA1A 1GOFA 3K4AA 1CZSA 3THCA 4XURA 3HPNA 2Y8KA 3C7FA 4A3ZA 1I5PA 4D0QA 2VL4A 2WAOA 2Z4FA 2BZDA 4XUTA 2W1SA 2BGOA 3T2OA 3VD5A 5HXMA 3ABZA 2ZEXA 4QX1A 3U37A 4P02B 3K4DA 5DPNA 4ZY9A 1T2XA 2VZPA 3PUHA 3WNLA 3IDAA 5IYYA 1JU3A 3IAPA 4ZZ5A 1XNAA 4KMQA 4MGSA 4OUEA 3K75B 5EJ1B 4MGQA 2EICA 3ETPA 3VD9A 3D3AA 4KI5M 5C7GA 4MADA 4CU9A 5IFTA 5JR2A 1JZ8A 1JYNA 2JD9A 1L7RA 1H6XA 1JZ2A 4MO3M 1EUUA 2V72A 4ZXEA 4D8MA 3CZUA 5JXGA 2WYSA 2J1SA 3VDBA 3IAQA 5F7UA 4DXRA 3I2HA 2X10A 3I97A 4GWJA 4CUCA 2J1TA 1O8SA 1UXXX 3IB3A 1O8PA 3T0BA 2XQXA 5LA2A 1ULPA 1UY1A 4DEVA 3CQOA 1CX1A 3WNPA 3FL7A 1DP0A 3UNPA 2X05A 4W50A 4GZ9A 1CZTA 4LPLA 2ZEWA 3T0DA 1SDDB 3VDAA 5I0DA 2WBKA 5LCWL 2W3JA 3LEKA 2QQJA 4DXSA 4A45A 3AC0A 2VMDA 2W1QA 1CZVA 2QQKA 2WABA 3FN9A 5DQ0A 5IFPA 3OEBA 1TVGA 1EUTA 1SHWB 2L9LA 4GWIA 3C7OA 4P08A 3PUIA 3WF0A 2CDOA 5IJRA 5LA0A 4CVUA 3ACGA 5IHRA 2J1RA 3HOBA 4QX2A 1JZ7A 4A42A 1K42A 2VR4A 1ULOA 4A4AA 2RVAA 2VMEA 4BK5A 2VJXA 2E26A 2QQIA 3I3BA 2JKXA 3LEIA 3HNBM 2VZOA 3LQCA 2W87A 5JXHA 1JZ3A 1JYVA 2J1UA 2ID4A 2RJ2A 3I2GA 2VQUA 3OBAA 5HPOA 1JYWA 2YC4A 3DYOA 4UI9L 4QAWA 3E1F1 2VMFA 2VZUA 4QDRA 4W8JA 2VQTA 4XUQA 3WEZA 3MO4A 3SKVA 2CDPA 1JI6A 5B4XA 3T08A 1JHJA 1NUKA 2HLEA 4ZZ8A 3F2ZA 5A1AA 4ARYA 3FHQA 4QDQA 4P00B 3W5NA 3A22A 4RN5A 2ZXQA 5CZKA 2WZ8A 1KGYA 3WNKA 2VZ1A 3VD3A 2E32A 2VOTA 4ET7A 2WO2A 2J1VA 4JKKA 2W9XA 1OF3A 2QBXA 4A6OA 3ACIA 2W46A 2W47A 1W8OA 3C7GA 2B4KA 2PQSA 1K3IA 4L0PA 2BGPA 4XZUG 1NKGA 2KD7A 2VZSA 3ZM8A 1WKYA 5G05L 2QQMA 2Y6GA 3GM8A 2E31A 2DDUA 1UX7A 1GOGA 3EYPA 3I3DA 3HNYM 3VD4A 1TG7A 2DCJA 3C8XA 1KEXA 2YFZA 5JUVA 4JKMA 2QQLA 1UMIA 3NQHA 2JDAA 3ACHA 4HG6B 4PQQA 1UYZA 5CYYA 2WO1A 3VDCA 3T2QA 3CKHA 2WQ8A 2XHNA 4KWUA 1F4HA 1UY4A 3CMGA 2BBAA 1HN1A 2J1AA 3HN3A 2VZQA 5FUIA 4QDSA 4QPWA 3OGSA 1NX9A 4AG4A 1US2A 2EIBA 2LW8A 2VM9A 2Y6HA 3K4ZA 3OEAA 3WSOA 5DN2A 4DUWA 3SEEA 3T0AA 2QQNA 2VCCA 3MV11 2E33A 1W9TA 1J84A 1P8JA 1PMJX 4PT6A 3K46A 2VZ3A 1XC6A 3CZJA 1PMHX 1K12A 2ORZA 3DYMA 1D7PM 1LNSA 4OZOA 1W9WA 2WDBA 4CUBA 3GGLA 1XNTA 3LPGA 1UXZA 3WQBA 3K77A 1UYYA 1UY2A 1GU3A 2JE8A 3T09A 3WNOA 2W1UA 5JXIA 3EB7A 3SKJE 2Y6JA 1L7QA 2YB7A 3WNNA 4OYUA 1OT5A 4A41A 2VTFA 1W9SA 4E8DA 3A23A 3I2JA 2YC2A 2YFUA 3W5MA 3BN6A 1PX3A 2RV9A 4W4ZA 2W95A 1IQDC 3MUZ1 3DECA 1OH4A 3I2FA 1JZ5A 1W8NA 2VZVA 5EIYB 3BGAA 4QB6A 2WAAA 3T2PA 4BJ0A 1UYXA 1UWWA 5J1XA 1F4AA 3J7HA 3I2KA 1GOHA 5JXJA 3SEPA 4FI9A 4QX3A 2W94A 3HJRA 2C4XA 4QB2A 2Y6KA 1US3A 2ZEZA 4UOJA 2WO3A 3LEGA 4DUVA 2W1WA 1JYXA 2BERA 1SG3A 1UZ0A 3ACFA 3C7EA 2XOMA 3VD7A 2W92A 1WCQA 2YG0A 3LPFA 3MV01 4XUPA 4ARXA 4DUXA 1BHGA 5B4NA 1RYYA 2V5DA 1JU4A 2VZRA 2ZEYA 2J7MA 1DYOA 4DXTA 3FHAA 1OF4A 3WF2A 2LS6A 3NJXA 2WN3A 2W91A 3A7QA 1XPWA 4QX0A 2OKXA 2QQOA 1H6YA 3IIIA 2VMCA 3UETA 3MUY1 4XUOA 1JZ4A 2J22A 5JMOA 2B9VA 3HNMA 2VZTA 2EIEA 2XONA 3P1IA 1UY0A 4IUGA 3WF3A 3WF4A 4M4PA 4CUAA 1R64A 2ORXA 3CDZB 3DYPA 4AAXA 2EIDA 1JZ6A 3OGVA 1GUIA 1PX4A 3HEIA 5G04L 3WF1A 3NJVA 4RYDA 1OD3A 3A21A 1MPXA 1GMMA 2VO5A 4A44A 3I3EA 3ECQA 2J1EA 2Y6LA 1UMHA 4BXSV 4LQRA 4M4RA 2VC9A 4TXWA 4LHSA 3OG2A 2WN2A 3CIHA 4OMDA 4E8CA 4QB1A 1YQ2A 3GDBA 1GQPA 4PF1A 3I2IA 4JKLA 4CU6A 2V4VA 2R7EB 1J83A 1NAEA 2C26A 3LE0A 2HYXA 2W5FA 3WNMA 4BDVB 4TTGA 1DLCA 2X09A 4XVHA 3GXUA 1GNYA 4BK4A 1W99A
chains in the Genus database with same CATH superfamily
4OQ8A 1S0BA 2E63A 5FDBA 4L2NA 4JCKA 3BCWA 3OGJA 4IV3C 5CG9A 2WUHA 1SACA 3O0WA 5EJZB 3TOJA 3W21A 5FZDA 3B93A 3M70A 3V65A 1F35A 1V0AA 4AQ2A 1QWRA 3AMPA 4CU8A 1LOAA 1D0HA 1Q8VA 2ENRA 4URAA 5D8AB 1YXWA 4JDNA 5HBAA 4MGYE 4ZONA 4LK6A 1AHSA 1FOD3 2B7YA 3IWZA 4CEYB 5DUUA 1DGRN 2VUDA 2VCAA 5I0UA 4JRLA 4CDWA 1EV12 1D4VB 4RA0A 2NLRA 1RIRA 5DG2A 4HN0A 1O3TA 2P1BA 2GNDA 1E5SA 1T6BX 4LHKA 2WLPA 2BP6A 5LA9A 3KF3A 4XBNA 1Q8PA 1QJX3 3ST7A 3H50A 3ORJA 4JHZA 3H9AA 4EWDA 3U07A 1JMUB 1NE6A 4FPLA 4RD7A 1RTVA 2FMDA 3PDQA 4HANA 1RUI3 2YMZA 4LBMA 4IEQA 1XU2A 4BXFA 1GOFA 1RUOA 3FBMA 2JDPA 1KDKA 3CU7A 4XFBA 5FY4A 3T1MA 1Y9MA 4MGTA 4B4RA 3C7FA 1NY72 4CDQC 2IFWA 2ADDA 4EN6B 3WD5A 4XJZA 1YQ6A 1QH6A 4QGNA 4A3ZA 1LGNA 3LWCA 1GR3A 2DCZA 3IMMA 1Q3EA 4M3CF 3SISA 1CPMA 2CWMA 1RL3A 2XDVA 1OH3A 3T2OA 2BGOA 2I2SA 3IT8A 3ABZA 1HN0A 4QX1A 1W04A 5FMOS 4B3NA 4Q4W2 1OLMA 4AQSA 1GKBA 1TMF1 2JDUA 2P3IA 4BPZA 1GLHA 5I0RA 3RMXA 3KLSA 4P02B 3VBUC 1U12A 4BM8A 5DPNA 5FCCA 5FXVA 3PUHA 4COZA 3TWIA 3IDAA 5IYYA 4E9KA 3KQRA 3IAPA 4XF9A 1JS9A 5A3NA 1XNAA 1LENA 1MZ6A 4OULA 4OUEA 3K75B 1S0JA 1VBB2 2PAEA 5FZ0A 4BQ5A 3HQUA 2VG9A 3D3AA 4ASMB 2G9FA 3BTYA 2RM23 2LM3A 5L9RA 1JODA 4W6YA 4LOSA 2XBO3 2XHKA 2O1QA 1CAWA 3BALA 4Q0VA 3SH4A 1QH7A 3V56A 1H6XA 5GLVA 3VKNA 2MEV3 1LJ7A 3WY6A 5GZDA 5JOYA 2WQZC 3VZNA 3ZO0B 1GBGA 4JGYA 4DS0A 1RUJ2 4D8MA 1UW8A 2RM21 4K9SA 1CGPA 5JSRA 1LECA 3KF5A 1AYN3 4YW7A 1C57A 1YYNA 3IAQA 4DXRA 2PHDA 4GULA 3UT0A 3I97A 4CP0A 2VXJA 2ZOEB 4GWJA 1EY2A 3QLQA 1WMEA 2MHFA 2VNOA 4TN7A 4NPLA 4AW7A 4EZHA 4CUCA 3LZZA 2R1BA 2ZGPA 1RMU2 2V5YA 3ZIWA 1O8PA 2TEPA 3NO8A 5C5UA 4NHXA 2XQXA 1DGWA 2D6OX 5FYYA 3VBUA 3OY8A 4N43A 1UY1A 5JMCA 5CAZA 4PI0A 4EN9B 4Q4V1 2R041 4W50A 5GKAC 3ZN6A 1J3PA 4YW1A 1ALYA 4LNVA 1CZTA 1XE7A 1MS4A 5F37A 1LR5A 3QOPA 5FIXA 3O1TA 3T0DA 2JDZA 3ZVXA 1D0GA 2WBKA 2W3JA 2RR12 3W20A 1URXA 4GXLA 3PUQA 4DXSA 5CKNA 4A45A 2W2IA 5SV8A 1UL9A 2WL1A 1W6QA 4YM1A 2QQKA 3J9SA 1W05A 1H2MA 1QNWA 3KSCA 2KXLA 5DQ0A 4YVSA 5EV7A 3ZXAC 5KR7A 1RC6A 1SHWB 3SMHA 3PUIA 3DPRC 5FYIA 1VBC2 1YQCA 2RS11 4LBOA 1H2KA 3I2OA 1GP5A 4NHYA 1H1MA 4R52A 5DAXA 2CV6A 4DMIA 5K9YA 3THPA 5IHRA 4FSJA 2A6ZA 2VR4A 3WX5A 1NXMA 2VMEA 2YGMA 4RR3C 4RS5C 4BK5A 5L7OA 1RITA 2QQIA 1OBNA 1C4RA 1CAUA 4YW2A 2WS92 2JKXA 3DN7A 4EN0A 3LEIA 1VBE3 1YCIA 3B9IA 2WNEA 1QJY2 3HNBM 4ZS2A 5IAXA 1UD1A 2VAUA 4E4ZA 1AJKA 4K1ZA 3IIAA 4FPOB 1ASJ2 3WXPA 2GMEA 5DZEA 5CA6A 2NPIA 1HJGA 1JZ3A 4QU2A 3GBGA 5FBZA 3VBFA 4Y4RA 4PLMA 1FNYA 1ACCA 3KV5A 3OBAA 4ZS3A 1O3SA 2FZ2A 4FCAA 1MS3A 5ABJA 4KH9A 2YC4A 5FV3A 2DUOA 1WCKA 1LRHA 4QKDA 1ULDA 4QAWA 1HRI2 3OCPA 3GJAA 4Y20B 2DCYA 3V0AB 1VAMA 3BUCA 2VXRA 4LBQA 3O12A 3WW3A 5J09A 1CAVB 2ZGNA 2PA7A 1OOPC 3LFMA 4QD2A 3S7EA 1W6NA 2PLV2 2ZGTA 4HT1T 5T5OA 3ZFEB 2QKDA 2A6YA 2IUWA 4IV3A 3LSEA 5C3OA 5JZGC 2YGLA 4BU2A 4ZZ8A 3AZVA 3ITQA 4GJYA 1G9DA 3OGGA 4AEMA 2RG4A 3FHQA 2GAUA 4L97A 4QDQA 5FZIA 3ZXKA 5JOXA 4P00B 2QDNA 2AC1A 2IVIB 1JW6A 1IHMA 2YBSA 4NE9A 4CXXA 5CZKA 4EJRA 4A6SA 2XG3A 1KGYA 3B00A 5FXWA 3WNKA 4YM0A 2CY6A 2E32A 1W9YA 1LU2A 2W08A 2NP0A 2ARXA 3DV8A 5A6QA 1FMD1 3VBFC 3O1MA 2WYFA 3JD72 4JKKA 1W6PB 4NN0A 4CXWA 1OF3A 5DG1A 3ACIA 4H14A 1DU3D 2ZHNA 4A6OA 4COWA 3R4UA 3NMBA 1SLBA 1LODA 2GALA 2HWD2 2PQSA 3J26N 5C33A 2Q30A 3VBSB 1BMV1 1NKGA 4IE5A 4KGQA 2R0HA 1TNRA 1QOOA 2VZSA 5D2AA 5C6CA 1WA6X 4ISQA 2WA3A 2F4PA 4B8EA 4IEOA 4O9EA 4Y24A 1U5YA 5EPAA 2IWGB 1FMD2 3NAPB 4GA9A 4I2OA 2ARAA 5AVPA 4AI9A 2QFEA 1KXGA 3IDEA 4Q2FA 2WZR3 4W6WA 1IG3A 2I45A 3CF6E 1UIKA 2G1MA 3P3PA 1SLAA 2ET7A 1ULCA 3KVBA 1LOFA 2JG8A 5A33A 3NQHA 5DXDA 2I74A 4IEZA 1WW4A 1MS1A 5ACA2 3VHPA 4BZ4A 3ACHA 4PQQA 3VBRB 1UYZA 4DINB 4HPKB 1N47A 1OA4A 4V1PA 4MGKE 5CYYA 1JYTA 1PVXA 1TNFA 3NL1A 4MUVA 1LHNA 3VBFB 4LIUA 1FYUA 3CBNA 2XHNA 4KWUA 1F4HA 3JB8A 4HLTA 2BBAA 4RGGA 4C8DA 1V6KA 2RS13 3NSTA 3HN3A 1PO22 1VRH2 4LOTA 1XQNA 5FMDA 5L73A 4DRRA 3PUAA 2ZKNA 1WD3A 2P5BA 2R1DA 2HWD3 2JE7A 2VY0A 3B01A 4QM8A 1SLTA 2LW8A 4XYXA 4I0AA 5GZCA 3VL8A 3WSOA 4PHZA 3ZXFA 1FV2A 1AX2A 1MEC3 2VCMA 1W2OA 4IW3A 3BKZA 1ZBE1 4PIZA 2X5IB 2D5HA 4QU1A 3VBHA 1YIFA 1XC6A 1BEV1 3OD0A 4HK8A 4HN1A 1XE8A 4WVMA 4NMIA 4HVQA 1WCDJ 1ND2A 1XBFA 2XJSA 2OW4A 4AGRA 2EXIA 5JR7B 4OZOA 2UURA 1TMF2 1YI7A 2V4AA 5F8PA 3E5XA 3I2DA 1MQTC 2Z42A 3M3EA 4D7TA 1ZZ9A 4R9CA 4CEYA 5LRRA 2WA4A 1W6PA 1PK6C 3EB7A 2IXKA 3AKSA 1UPIA 5FOJB 4HONA 3IM0A 4CE8A 1ZRRA 4LUKA 5FPBA 5I8TA 1ZZBA 4A41A 3OUHA 3K51A 4JC1A 3TB0A 3ZFFB 1BBT1 4WV8A 1PO13 4ZU5A 2F6BA 2Y33A 3W5MA 2OZJA 3WDTA 2AEZA 1ONAA 1SZBA 2W95A 4W4ZA 4JQTA 3RS6A 1NG0A 3LSDA 1IQDC 4GMP0 1VE0A 1ZZ8A 5FR3A 1WLCA 1IS4A 1WZXA 3MUZ1 1DIWA 1OH4A 2MEV1 2VMGA 3HT2A 2VBBA 5A3PA 3MIFA 3UKNA 3WP3A 1AXZA 2VZVA 5J48A 2CAUA 3TYJA 4LIVA 3BGAA 4NR1A 1W0OA 1H2LA 1QDCA 2C24A 3RVHA 4YYOA 1UWWA 4JTNA 1CIWA 3DXUA 1W6OA 1F4AA 2FQPA 1ZRCA 3J7HA 3BTAA 4QX5A 1VBA2 1YWKA 2W94A 2WZPP 2VQAA 1L7LA 4I30A 1DGLA 2R042 2GH8A 3GHNA 2NN8A 3AYCA 3LEGA 1D4M3 4LO5B 2P34A 1CESA 3ACFA 5HCAA 3M2MA 4WM8A 3VB9A 1ENRA 5LBCA 1N1VA 4LE3A 3PHMA 1X82A 1UKRA 4HZFA 4I02A 2YG0A 1HV1A 2EXHA 2Z5WA 3DXTA 3MHZA 3A0KA 1LAJA 3R6SA 2FDFA 1SEFA 1R081 1BHGA 2PFWA 2DVAA 2JWPA 1LKNA 2V5DA 3QH7A 4S2HA 2VZRA 1LESA 2ZEYA 3GF6A 4TWTA 5LB6A 2RS31 2ZX3A 5HCHA 1PGSA 2JG9A 4LXLA 4Z2WA 5F3EA 4FFHA 4LKDA 1FX5A 5HI0A 3O14A 4KU7A 2K0GA 4M01A 1HV0A 1NA1A 2OVUA 4CUGA 3AKRA 5FO8B 5FUNA 5FYBA 4N53B 5J37A 4AI2A 4QQLA 4CDXA 1RVF3 5BNOC 4O7XA 4NROA 3EJKA 2J22A 1W03A 3FZ3A 5FYUA 5BUVA 3L2YA 4WM7C 4COVA 2VZTA 2HWE2 2QZ3A 2WS91 5IW0A 4XBLA 2EIEA 2XONA 2OX0A 4FAGA 1Y3TA 3QACA 4EZ4A 3WF4A 5C9AC 2FZ1A 1R64A 4GB33 3M7AA 4Q0SA 2PAKA 4RQPB 1FOD2 3KHCA 5IUQA 1B35B 5F39A 5FZEA 2D44A 4MLOA 4AQTA 4FQZA 1GZWB 5FZMA 4QQHA 3RWNA 4FT8A 4KGGA 2WQ4A 1RINA 1NOVA 1Y9GA 3NJVA 1J3RA 1JTZX 1OD3A 4XAAA 1MPXA 4XQ4A 1DHKB 4AOCA 1SFNA 2GU9A 2BNOA 3J7LA 4GJZA 5T52A 2CWSA 3TEXA 1Q8QA 1D2SA 2VOXA 3MIBA 4CP2A 2ZCWA 3H3UA 3OPTA 3EXUA 4XF4A 2V73A 4CEWB 3CNAA 2VC9A 4FTBA 1UU5A 2WIIB 3RYRA 1AR63 1TME1 3LDKA 3OG2A 4XFIA 2QE3A 3UYJA 2WJSA 4P9WA 2ZX4A 1EAH3 5FY9A 5A7WA 1NCRA 1YQ2A 4QB1A 3N3HA 3GDBA 4BCUA 1GQPA 3PUSA 2NM1A 4D6QA 4U36A 4WM7B 4GIQA 4JKLA 4AVBA 2R7EB 1J83A 2BRTA 4UW4A 1POV3 4N43B 3B5LB 2RMU3 3WNMA 1TME2 3ATGA 4BDVB 2VOWA 3B02A 5A3OA 3U78A 1QOSA 3KQ4B 1HRI1 4TTGA 1PMIA 4ZU7A 2R30A 4XVHA 5FZFA 4CSWA 1GNYA 1VBB3 2BEOA 4ITCA 1MZFA 3KT7A 1FPN1 5E1RA 1W99A 3LCPA 1JYXA 4LA2A 4QKNA 5FYCA 2VCBA 2Y0OA 4XAEA 2ZMKA 3UESA 1JXNA 5KHKA 3VN4A 2CGPA 1GYKA 4XXPA 1JH5A 1COV2 1ND3C 4F3JA 3JXSA 5ABJC 1OC1A 1OUXA 1AUYA 2D40A 3VKMA 1YQ5A 3P6BA 1WWYA 1BK0A 3OOXA 1AR72 2AR6A 3TEZA 2HWF2 3DKQA 4MHUA 4HBNA 1Q5OA 1ND3B 1WCSA 4HVRA 5DMYA 3DEMA 4DEQA 4UAPA 2YY1A 3PNAA 4JX0A 1H8VA 2QTWB 5IK4A 3WG3A 2ZGLA 4FOWA 5LZ6A 5FY0A 4C0BA 4OHWA 5LBFA 4LK7A 1RUD1 1TE1B 5L7OB 3WR0A 3VZJA 1J1TA 2IXLA 3MLJA 1COV3 1Z78A 1CIYA 2C9KA 1WLWA 2ZX1A 4LHLA 4MOAA 3U4SA 4YFWA 3M3IA 4KQ7A 3TAYA 4WZCA 2E6VA 1AR93 2DU1A 3VBRA 3OB8A 4J25A 2YYOA 4NUBA 2ZACA 5A32A 5GZGA 3PJQA 2YPJA 1RUD2 1PVC2 2D43A 1DLLA 2A71A 4XW3A 3ZYBA 1YFUA 4YW3A 4E2GA 3IZOA 5I93A 1YJKA 4UFMA 1SDWA 4KBBA 5ERLA 1XNCA 4LBKA 1Q43A 1BZWA 2BOJA 4D0QA 1DYPA 2WAOA 4QX7A 3BU7A 2O8OA 1RUC2 5M0TA 3U4XA 3ZPOA 1MEC1 1LHOA 3RZGA 5HXMA 1YJLA 2ZEXA 4CCLA 2ZMLA 3OD4A 3VDDA 2R6QA 5HXVA 1JYIA 1RUF1 1C8NA 2UWCA 1WW7A 3N9OA 3ZX7A 4Y26A 5FYSA 3UKVA 2RS52 1HXS2 1N3PA 3DGTA 4UFJA 2Y26A 3HAGA 1DGWX 5FZ3A 2RDRA 1QJX2 4AE2A 1ULEA 1RUC1 3AL6A 3ES4A 2HEWF 2WS93 3ZN6B 2D6NA 1W3VA 3H1YA 3MW3A 1G7YA 3NKGA 4AFCA 1B35C 4R9AA 4ZZ5A 3S5AA 1C8M3 1U5ZA 2VW2A 5FP4A 5K0UC 5EJ1B 2EICA 1ZA4A 3ETPA 2PHTA 4KI5M 5C7GA 4IQPA 4MADA 4BMEA 5C8CB 2AENA 4JV4A 3LA3A 2K46A 1A34A 1JOBA 1JYNA 2JD9A 3E6DA 2DFCA 2XL7A 2GP3A 5C3RA 4K8FA 4YVSB 4AI8A 4X8NA 4MO3M 5A7WB 3OF1A 4ZXEA 3M1HA 1OQ1A 5BNOB 4QPIB 2VU9A 3CZUA 4INDA 5GLZA 2J1SA 5JPNB 3VDBA 4IE6A 3A0NA 4MV2A 2OYZA 4IL7A 4W6XA 1DQ4A 3OJBA 1R083 4CP9A 5CFCB 2FD8A 2X10A 4YVSC 3GZTB 3K3OA 3D6EA 4L9BA 3I4IA 3WHTA 2DTYA 3N4MA 2XUMA 1UXXX 1PM4A 3DPRA 4IXLA 3ZYPA 2QQVA 2EF6A 4DZGA 3ES1A 1YFWA 1BCXA 5E88A 4QHOA 5LA2A 3VBHC 1VBC3 2HKXA 3CQOA 1CX1A 2Y0IA 3WNPA 3ENRA 2QQUA 2X05A 1AJOA 1J59A 1GP6A 3E5UA 1PIV1 4LPLA 1BBT2 2JDYA 2DYCA 4CPBD 3HQRA 5FTTC 4UYBA 3VHOA 1UZZA 5BPXA 5A7NA 4ES9A 5JAXA 1NLSA 3N9NA 5KC6A 1O4ZA 4Q8KA 4A7KA 1H0BA 2A1XA 2HYKA 4V2WA 2VH9A 4Q0UA 4YVWC 1NZCA 4QPIC 3NNLA 2Y34A 1OUSA 3ZOIA 5IAVA 2BW8A 3OEBA 2WFF1 5IFPA 2PHWA 3KM5A 1PIV2 4IE0A 4LKEA 3ROUA 5A70A 2L9LA 1D2QA 2OT7A 2XJUA 4FVVA 3C7OA 3WG2A 3VBOC 3WF0A 3NV4A 2OS2A 3AZZA 3PMEA 3WLUA 2G9ZA 2PYTA 4CVUA 3ACGA 5FQ0A 4QXHA 2P6HA 5FYTA 1BBT3 2E7QA 3FC0A 4NAOA 4UFLA 2ILMA 1W6MA 3HOBA 4D3WA 4A42A 3FJSA 4K6BA 3RPQA 2XMLA 1ULOA 4GKXA 4LE4A 2RVAA 1MZEA 4CCJA 5KHGA 1W6OB 2VMIA 3RYPA 3INAA 2VJXA 5HV0A 4RL7A 3S6PA 2E26A 3AMHA 3PVNA 3I3BA 4YLZA 1QDOA 4AFAA 2OIIA 3RJ2X 1QJY3 3KD4A 2OPWA 4CDUA 4IGPA 4I0BA 4XBQA 4DOUA 2JIGA 3O5SA 4S2DA 5IVCA 2JJ6A 4MZUA 5I0SA 1ZYBA 4OHXA 4JGZA 1DQ1A 5IATA 3HIFA 3ZXGA 2A6VA 1XXNA 1QQP3 4N53A 1H30A 3AB0A 1W8ZA 2VQUA 5K0UB 3FX3A 4S2FA 4QPIA 1G9CA 4D6SA 4UI9L 1PNFA 3JB4C 2VOKA 2VZUA 4AEDA 1AR81 3EQEA 2FMYA 2GSYA 1ZM1A 1N3OA 2VQTA 4XUQA 4ZHNA 3WEZA 3MO4A 1F2NA 4CA9A 1GZWA 1V6OA 4KG0A 4BB3A 4BQ1A 4NVPA 4EE2A 1RMU1 2FDGA 2VTXA 3H7YA 3N7LA 2HWE1 3HBKA 5B4XA 2WNUC 3T08A 1QNYA 2BUKA 3NVCA 2ZTNA 1NUKA 2HLEA 2JG9B 2TUNA 3F2ZA 1LU1A 5A1AA 2Q5TA 4HVOA 3KT4A 3AP7A 1RUG3 3OPZA 1W9FA 4FP3A 3W5NA 1SPPB 4AK3A 2ZAAA 3AVRA 5CISA 4RR3A 4BLIA 2BNMA 2A7AA 2N7GA 4YGDA 1LOBA 1JOPA 1RUG1 3TBDA 3J7MA 1X8MA 4RS5B 5FREA 4Q4Y2 2Q4SA 4SLIA 4RQPA 2GNMA 5CEHA 1UPSA 4DNYA 5FZOA 3QBQA 2WO2A 4FXKB 4MGIE 3JBG2 4PDWC 2PTMA 3ZFFC 4NOTA 1X8EA 3FE5A 5A3UA 5ABJB 2BWCA 3PIJA 5AVAA 4HKWA 3AKTA 4H3WA 2D6MA 2A6XA 4JVAA 1JOJA 2D6LX 5FZAA 1RUG2 2D97A 2KD7A 3LB9A 3WCRA 4B1LA 4LUMA 3OTFA 1GFF2 2PHLA 3BYWA 1WKYA 5G05L 4Y1ZA 2ZPXA 4L92A 3USUA 3H7JA 3GM8A 3QH6A 1YLLA 2AGSA 2E31A 4ZPIA 5LASA 2JKBA 4RFRB 1UX7A 4P9JA 5AC93 1LHWA 2B39A 1FOD1 3HNYM 3I3DA 4AHYA 4CDUC 2YFZA 2P3KA 3HR9A 3R4SA 1VPHA 2JICA 1GZ9A 3JCIA 4JKMA 4Q0QA 4QPYA 4IV1A 5JUVA 2PLV1 1SQ4A 5FLIA 2O0OA 1QJY1 1Z7S2 2VD7A 3VKOA 4HG6B 4NIAA 4CDQA 1RVF1 2X5IC 4LEJA 2Z79A 2EA7A 2EXJA 5DDJ2 5E8AA 3BIEA 2WO1A 4ATEA 1XU1A 3LDRA 4FFFA 3L2HA 3ZSEA 3CJIB 4BA6A 1PGW2 3MIHA 1HN1A 4YW5A 3B94A 4CYDA 3NJZA 1NE4A 4X6QB 1AXYA 2VZQA 3RZKA 3S30A 4WBBA 3OPWA 4FPYA 4QDSA 1K5MC 5A7PA 3D0JA 2X8KA 1NX9A 4D94A 2EIBA 1S2BA 1PGL1 1UO9A 2VM9A 2Y6HA 4OI2A 5IVYA 4LA3A 3AK0A 3OEAA 1W2UA 1ND2B 3ZYFA 4UF0B 3SEEA 1Z7S3 2JEMA 3N7MA 3MV11 3LIHA 1X50A 1W9TA 1OA3A 2E33A 5FY8A 3AZYA 4OI1A 1DDLA 1DQ6A 3ZLIA 2HBTA 4XJAA 4I09A 4KWLA 4YM2A 1OOPB 1VBD3 3CZJA 5FZ1A 4XACA 1U0AA 1D7PM 1GV9A 1LNSA 5CG8A 3WDXA 1RUF2 1W9WA 2CSGA 3POYA 3J8F1 2WR9A 3GGLA 4ZXKA 1MZ5A 2RS51 5C3PA 1UYYA 1F8VA 3B9CA 5C4WA 3LAGA 2JE8A 4QT6A 3ZKUA 3DCQA 3NAPC 5JXIA 2HBUA 4Y5TA 2Q1ZB 1L7QA 1Q8OA 2YB7A 2PHUA 5L7OC 1OT5A 3PVOA 4RQPC 4E8DA 1EPZA 4H7LA 3A23A 1K5MA 2YC2A 2D93A 3I2JA 1ZNPA 3R05A 4LKFA 5F5AA 5LK5A 4AYUA 2XGXA 2LTNA 1EV11 1PX3A 1YQ8A 2A70A 1IKQA 2ZX0A 1PO21 2ZGOA 3APBA 5FJKA 4RHV1 2PAMA 5D21A 2Z2SB 3BB6A 1AL22 5FXZA 5LBBA 4FPJA 4EN8B 5FFOC 1RHI1 4XF3A 1ASJ3 1LHVA 2AYHA 1S2EA 3H0OA 2VOVA 2ZGKA 4L8QA 5J7MA 3SCHA 3F95A 4AI1A 1AYM1 4LO6B 2YBPA 1LOFC 2JG9C 2WAAA 1GQGA 1FV3A 1U5XA 1UYXA 2W68A 1V6MA 4TYSA 5J1XA 1YC61 5CFCA 4J1WA 1CQ9A 1PVC1 1GOHA 2HEYF 3AZWA 3KMHA 5JXJA 3U0ZA 4B1MA 2P3YA 1BJQA 5C9AA 3QCWA 1WBFA 5EQUA 3VDDC 2ZAHA 2C4XA 3O7OA 5T5LA 3WINE 2Y6KA 2ZEZA 3SC7X 4Q4V3 4DY5A 4XF1A 5CVRA 4F83A 4G4FA 3RNSA 4E4DX 5EP9A 2BERA 1SG3A 4K3UA 1MQTB 1Q8SA 2DBIA 2CTVA 1MACA 1UZ0A 1Y7BA 3GZUC 4N43C 2PHFA 5F5QA 3C7EA 2QQWA 4CP9B 3D5OA 4QPGB 3ZFGA 5B2GB 4OUSA 4MXVA 3VD7A 2RMU2 2R062 1WCQA 3WCSA 1TZOA 3SLIA 1W2TA 3LPFA 3AYAA 3ILRA 4XUPA 3WW4A 2YU2A 4ARXA 1S55A 2MNGA 4YSFA 1NQDA 1MVQA 1PHMA 3FBYA 1PM7A 3FHIB 3ILNA 4FTEA 2IFRA 2J7MA 3TN91 2ZGSA 4DXTA 2XQRA 4YGCA 2A73B 2R16A 4Q4Y3 3RJRA 1TEIA 2YZ4A 4CDWB 2LS6A 1Q56A 1NCQC 2BOIA 4XETA 4YG0A 5F2WA 1XJAA 5JCTA 1WMXA 3O1VA 2R073 2OKXA 3LA7A 5AC91 2NMOA 3IIIA 2GNTA 3O1OA 5FYZA 4Y3OA 2VMCA 2QJVA 1W28A 1UYPA 2VVDA 3DL3A 2Q8DA 5LY1A 1VP6A 5A33B 3WVJA 3FFQA 4G3YC 2HWE3 2W0XA 4N7UA 4S2GA 4YG6A 2AEYA 2HWC3 2UWAA 4LLOA 3D82A 4AQ6A 4FPEA 4CUAA 3PTRB 1YUDA 3UV9A 5FYMA 1A6CA 2WFF2 4AAXA 5ISLA 5KHIA 2EIDA 3HWJA 3ZXJA 1JZ6A 4FOQA 3O1PA 2VTXJ 4Q4W3 3RSJA 3OGVA 1GUIA 1ND2C 2DFBA 2ZBJA 1YIPA 4GWMA 4HMZA 1QQP1 2UU8A 3RZMA 1H9WA 1VBB1 4RYDA 4WVWA 5G04L 5F9TA 4AI0A 5TSWA 5DAPA 2AACA 2JDHA 2WNVA 3GZEA 5FKBA 4A44A 3ECQA 3ZXLA 3N9PA 5KWRA 4A7YA 1UMHA 4BXSV 1ZBA2 5JOZA 3LIGA 1W0PA 1NZIA 4M4RA 5FP3A 3VZLA 1RUJ1 2E53A 4LHSA 3T4HB 4BWOA 2VW1A 3WHUA 2WN2A 1POV1 3Q8FA 5DZGA 4TSVA 3E6CC 4OMDA 5A3MA 1M06G 1NQJA 2EALA 5BNQA 1ENQA 1EAH2 5FMBA 2XPJA 2ZGRA 3AYEA 2R0FA 4AHZA 4BISA 3NV1A 2XVKA 3POIA 4PF1A 1NYWA 2C6SA 2YPDA 3V0BA 1C5HA 5F2SA 1NAEA 4PLOA 1LOGA 1VBD2 2HYXA 3VBOA 2OZ6A 2RDSA 1OURA 1AR61 1REDA 1B35A 1TME3 2F4LA 5FRAA 5FZ8A 5GLUA 2ET1A 2WT1A 4Q8LA 5C8CC 4Z07A 2ZHLA 4BH9A 5JWPA 2FDIA 3C7HA 4XIKA 2OQ7A 4CU7A 2IXHA 3WDUA 2JX9A 3N36A 4YPJA 3AP5A 3OY8B 5LBEA 3KB5A 2P6CA 1UIJA 1G9AA 1K45A 1RUE3 4E4SA 3LOBA 2K9ZA 5BNNC 4GQ7A 3AL5A 1D4M2 3MW2A 5GZEA 4OVEA 3THDA 1SFYA 2ZJCA 4AVSA 2ZHMA 2Q8OA 1FNZA 3L9JT 2H6CA 4FPGA 2WLQA 2EIGA 3E5QA 1R093 1W3XA 3AFGA 3CL1A 2XXZA 4OMCA 1V6JA 3CHXA 1EV13 2O8QA 2W52A 4UWDA 3I59B 4EWAA 4Z2AA 2DCKA 3B3QE 3N35A 3POBA 3D8CA 4BOWA 1XSQA 2OQ6A 3NNGA 5L36A 3U14A 3ETQA 3OGRA 2FCTA 4XEZA 3NNMA 4XUNA 5LATA 5JVVA 5C71A 5DUWA 2OPKA 1H1AA 1GANA 4JTOA 4XTPA 2WZEA 4I0WB 1ENXA 3O1UA 4Z82A 4CDQB 1W8WA 1UOBA 1MR5A 5LA1A 3HN1A 4Q5OA 4QKFA 1XSRA 3GALA 5FY1A 3V0AA 2JB8A 5JPMB 3J8F3 3THCA 5H9RA 4I01A 2R49A 4FXGB 5ANQA 1CAXA 3U1XA 2XBO2 3JQWA 2GN3A 3HPNA 4AVAA 3GCXA 5DABA 4Z92B 3VDDB 1I5PA 1CVNA 2VL4A 5HCFA 1ZBA3 1AYN2 2A75A 2D6PA 2VGDA 3OUJA 4Q4Y1 3ZPYA 3N7JA 1H8TB 2W1SA 4P9IA 1QJFA 4XUTA 2VNGA 3VD5A 2Q0AA 1F31A 1RXFA 2XKPA 3LGRA 5L9BA 3U37A 1I5ZA 3BOWA 2RDNA 4D7SA 1AVBA 1AR71 1QY4A 3K4DA 3NKTA 3VKFC 1UX6A 3J8F2 3WQ0A 3DF0A 4ZY9A 2CYFA 3WNLA 1ZRDA 1BEV3 2MPFA 5EXOA 3HMYA 3M3QA 1O91A 1JU3A 2XLFA 1ZX5A 2ZGUA 1Y4WA 3W9AA 4E27A 5HV4A 1LCLA 1W8HA 2BVVA 5GLWA 2ZZQA 5JSOA 4MGSA 1AR92 4JAAA 4Z8BA 3CJIC 1RJ8A 2VBDA 4MGQA 3URFA 1W6NB 3ZFEA 3U75A 5IFTA 4MGZE 2XJTA 3NWKA 2YHJA 1PVC3 1JZ8A 2WSVA 1L7RA 2XH6A 3CJIA 4YW6A 2X29A 3K48A 1RUE2 2BVBA 1IKPA 3KCCA 5CNAA 5EYXA 1EUUA 2V72A 3OYWA 4QM9A 4CCCA 4X6RB 2VVEA 4RHV2 5JSPA 4SBVA 5DDJ1 5A6XA 1AYM3 4V2VA 1Y9QA 1JHNA 3MFCA 2C9AA 4UFIA 3KS7A 4AF9A 5F7UA 1C1LA 3WDWA 1POQA 2X53S 2BGCA 3MIEA 2ARBA 3TRSB 1KD7A 2BPA2 3USSA 5EHDA 4XFGA 3RWKX 1NA1B 2ARCA 4LO8A 5T5JA 4H55A 3IDCB 1BQPA 2CAVA 3J7NA 4C0HA 2Q1MA 1PGL2 4XFCA 2G4IA 4K40A 5FY5A 2BYVE 3WW1A 2GH2A 2VVFA 3FL7A 1DP0A 1W90A 4IERA 3ZN5A 1ZZ7A 4D6RA 3BIWE 1HKDA 1C8M2 4KWJA 4Q27A 2G19A 1SDDB 5FZ6A 3RQ0A 3VDAA 5I0DA 2XR4A 4XABA 2RR13 5LCWL 3LEKA 4EROA 3U11A 2B45X 4LBQB 1OHFA 2P17A 2FCVA 3SH5A 1VMFA 4MVTA 2YDEA 4AVCA 4Y1XA 3FN9A 3ZSMA 3PIGA 4LMFA 3WG4A 3WDVA 2VMHA 3EO6A 1EUTA 1TVGA 1AYM2 1QF3A 4UW5A 3MGUA 5C9AB 2NQYA 1HRI3 1GZCA 2UWBA 4XPVA 4CCEA 3WP5A 4URTA 1WD4A 1HB3A 5LA0A 5FZHA 2EXKA 2XVGA 4QGMA 4CEWC 4AZZA 4LT5A 3ZSJA 2J1RA 3H1MA 1HB2A 3KGLA 4QX2A 3Q8AA 1K42A 4LTAA 5KXDA 4XHXA 5FO7B 4CDUB 1HXS1 4QPGC 5AC92 3BPSA 4IDZA 4HOOA 1V9U2 4FPCA 5BNPC 4M00A 4QMAA 4XFFA 1E5RA 2FDJA 5F6LB 1DZRA 5FP8A 2BU9A 1S0EA 2GMPA 2XLAA 4FPKA 2FBEA 2R061 3ZYJB 2VZOA 3LQCA 2VE1A 4FO9A 1LULA 1AR73 1LGBA 4MSVA 2WZR2 3PLQA 5JXHA 2VUJA 1V9U1 3KGZA 3H8RA 2IVJA 1JYVA 1H8TA 2RDQA 2ID4A 3I2GA 1OLME 1HB1A 1LOCA 4EWEA 4QX8A 5JLVA 3KV9A 3DYOA 4Y22B 3E1F1 2VMFA 3T30A 2XWJB 1S2KA 1IQAA 1WA4A 1O4TA 4PDWA 5FZ7A 4AI3A 3AXDA 2D3RA 3PJYA 4PQ9A 2H0VA 1OMIA 3SKVA 3UKTA 1HQWA 5IVBA 5K7PA 4K8RB 2CDPA 3I54A 3M3OA 2QNKA 4KBZA 1FMD3 2UY8A 4EV0A 1APNA 2A6WA 1VRH3 2B46X 1F9KA 1VMHA 1YO8A 3AM2A 4XHBA 5H9PA 4NHMA 2QUOA 4KG8A 4D7YA 5A6YA 4K7JA 2B5HA 4P9GA 3Q8BA 3PTYA 5CB7A 2MEV2 2Y38A 4ARYA 2WNUB 1WMFA 1WLTA 1ULFA 2C0ZA 4Y4YA 5F5IA 3TN92 3GCWA 4IEUA 1KFUL 1RUJ3 3A22A 4RN5A 3OUIA 5JZGA 2O14A 4NJ4A 5FZKA 1OVSA 2ZXQA 5T5PA 2WZ8A 2ZKLA 3ZYRA 2CHHA 4NIHA 3DUIA 4IE4A 2D3PA 2RS33 2ZABA 1K5JA 1N3QA 2VOTA 1SLCA 5JIUA 4OZXA 4ET7A 3FWEA 5FZ9A 2D5FA 2WC2A 2QBXA 2WFPA 5KC5A 5A3WA 2W46A 3NNFA 3KZ4C 1W8OA 5CFDB 1RJ7A 1GP4A 3C7GA 2B4KA 1OI6A 4L0PA 4XZUG 3ZDVA 1UKGA 2FCUA 3IN9A 2P3JA 3UGGA 4BIFA 4I3GA 3D0SA 4QQPA 4YZ5A 3ZM8A 4Q1PA 2FDKA 1UF2C 4ONUA 4CDXB 2QQMA 2YU1A 5DUXA 3ZFGC 2PLV3 1AR82 4LLFA 3WW2A 4HSJA 1G86A 3EYPA 1GOGA 1SBDA 2GNBA 1VALA 1MVEA 1RB8G 1TG7A 4IGQA 3C8XA 4GH4B 4NHKA 1V6IA 2IC1A 2K2SA 2RS32 1YEWA 5A1FA 2QQLA 4F7ZA 4EQVA 2NMNA 4LO4B 4A3XA 4WVZA 4NWVA 4Q4X2 2JDAA 3GYDA 1FAYA 1IPKA 1NXD1 1W06A 1MS9A 1REFA 2GDFA 1QOTA 2GC1A 3O0XA 4M3CA 3VBSA 1AL0G 4IV3B 4XE9A 3ZFFA 1HJFA 1O7FA 2DUPA 2XUEA 3B7MA 3T2QA 3S57A 2WQ8A 4J6GA 3VBOB 1DGRA 2E7AA 5FZOB 1OFNA 2R071 2HWC1 4IESA 3RYKA 2J1AA 3NW4A 3UGFA 2RS12 3TN93 4YZ2A 1PK6B 5FUIA 5BNPA 4QPWA 4DQAA 1D4M1 3OGSA 1IZ3A 4AG4A 1HW5A 1PO12 5LW9A 1HRV2 4A7ZA 2R043 4EYUA 4BQWA 2DURA 2VULA 4CEWA 4DUWA 1YNAA 2VCCA 4FPHA 1J58A 2QCSB 5EJ3A 2IXJA 2RR11 1CJPA 4PT6A 4XJ8A 4YVWA 2VZ3A 1C28A 4LORA 2XKOA 1XE0A 5LY2A 3AP4A 3KWVA 1PMHX 3PVBB 3PU3A 3BODA 1B09A 2JECA 2ORZA 3DYMA 4FOYA 4XTMA 1X33A 2HEVF 3IPVA 4FFIA 3WP6A 5F3CA 3PU8A 4OLLA 1TMF3 1WBLA 3KT1A 1XNTA 1QJU1 2JD4A 1UXZA 3AXEA 3LPGA 5T3NA 4C90A 1R1ZA 4B29A 4CRQA 3GJBA 1H9PA 3M3CA 1PZ9A 4NIDA 3V64A 1UOFA 3T09A 1K5MB 3WNOA 3OSDA 2BTVC 1LEDA 2W1UA 1QMJA 4ISRA 4CDXC 1SCRA 1J1LA 1BVP1 1H2NA 2JG8B 1GWLA 2ZX2A 3ME2A 3R4DB 3SKJE 2Y6JA 4C1WA 4LBLA 1QKQA 3IBMA 3LDBA 4DXZA 2VTFA 2BNNA 4PJYA 1UZVA 2YFUA 2DVDA 1UOGA 1CAXB 2Q8CA 4OHYA 5AFEA 2WT2A 3POEA 1UU4A 3I8TA 3O1SA 2P37A 5F1RA 5ACA3 3FUOA 1S0DA 3ZMOA 3WUDA 3FLPA 2EAAA 3DECA 3ZN4A 1NT0A 1YFXA 3I2FA 2JIJA 5GLTA 4ORFA 2PELA 4OCTA 5FLHA 1JZ5A 5FWJA 5C5TA 1VB2A 4I3PA 3RI9A 5JDBA 2WSUA 3Q8EA 4IEWA 2AH2A 1F15A 4MX3A 5EWSA 3JD73 5EIYB 4GWNA 1H8TC 4RFT0 3T2PA 1PO23 3RFRA 4BJ0A 1RUI2 2RJKA 1V6LA 2OUJA 1RVF2 3Q9OA 1MS8A 4Q29A 4HFSA 2JG8C 4FQ4A 4OHVA 4BLJA 5FKCA 3SEPA 4FI9A 1AF9A 3HJRA 5L19A 1OQEA 1OVPA 4UOJA 4CCNA 1GZTA 4YW4A 1PK6A 2IZWA 2ADEA 3H42B 4QGLA 1C8M1 2HWD1 3SITA 4B7KA 5JIAA 4ES8A 4AGVA 4MG2A 1O3QA 2XOMA 2QDRA 5FWEA 2E51A 3OBZA 2LALA 3MV01 1R1A2 3K2OA 4HL0A 3JZVA 1CWPA 4XCBA 3H8XA 3MZHA 1RXGA 4IEVA 5FP9A 3AP6A 5FZ4A 4P14A 1RYYA 1H4GA 4BHPA 3T4VA 1RHI3 2GP5A 2Y60A 3UJQA 4XDPA 2IXCA 2YBKA 5T50A 3OBTA 1OF4A 1IGOA 2W91A 4JGYC 4AXOA 1NLQA 2HWB1 4XILA 3JD71 1XPWA 4QX0A 4WM7A 3IKWA 1ZREA 4C1XA 2QQOA 1H6YA 5FO9B 2XJRA 4N9HA 1XNDA 2ZMNA 1VBA3 3MIDA 2CNAA 1HLCA 3MUY1 3RZHA 2E9QA 3RDIA 1O5LA 3HNMA 3T2TA 1VRH1 4OI0A 1SPPA 3P1IA 1MEC2 3ZMNA 1JYCA 1VMJA 4MXWA 1UY0A 4IUGA 4P5HA 2HWB2 3C2UA 4DRVA 1IG0A 1GWMA 3TEYA 2ORXA 3VBHB 3VGIA 3VHRA 1I1EA 1XYPA 3DYPA 2R063 4UT5A 4XJUA 3ZXEA 1JUHA 3MLLA 1VJ2A 4Y5SA 1CONA 1R1A3 1S0FA 2BFUL 2KM2A 5FMOL 3VLBB 4Q4X3 1OPMA 4X8PA 4BQ4A 2VW0A 5A3TA 1AX0A 1HIXA 1PX4A 3VHNA 3R0RA 1BK1A 3VL9A 2P2KA 1HXS3 5BNNA 1RHI2 3AP9A 4JDOA 1QXRA 5D1IA 3CO2A 5IK8A 3A21A 1C1FA 1J3QA 2ZHKA 1GMMA 4N53C 4N9IA 4YZ3A 4AVVA 1LEMA 4LULA 4F8AA 2RJLA 1WUVA 1KITA 3POFA 3G7DA 2Y6LA 3ACLA 3EBRA 5GALA 3ZSLA 1W8TA 4LQRA 4GALA 5FZGA 4UBGA 3V0BB 2WNOA 3LOIA 1OXCA 5EFUA 3SXWA 3WG1A 4BQXA 3CIHA 2PN5A 4A2UA 2ZGQA 1AL23 1GWKA 3MPBA 1G9BA 3SQOA 4QKBA 3I2IA 1QJEA 1POV0 2V4VA 4CU6A 4GB32 5A32B 4TZDA 4U2AA 4COYA 4XFHA 4MHRA 2C26A 4AEDC 3LE0A 1BEV2 3JU9A 2W5FA 1F5JA 4QWNA 3WNXA 1EPWA 2RE9A 5EYYA 2OUHA 5FYHA 1CPNA 1DLCA 3PL0A 2X09A 3GHMA 3LA2A 1RMU3 4XZPA 5BXXA 4IEXA 4BK4A 2B8MA 1RGSA 1HX6A 3GBWA 3VBSC 2GC2A 2Y64A 3I7DA 5KXCA 4NIGA 4OUMA 4R8HA 4LBNA 4P5YA 5C4WC 4EN7B 2WNUA 3AVSA 5FBJA 5F6KA 4O61A 4NO4A 5FK7A 3WOGA 1H1IA 2QVSB 3POGA 4PDWB 1GSLA 4FFGA 4DO0A 4YFZA 4PI2A 1N1SA 4CCOA 5C70A 1W0NA 4HSLA 3EMRA 1SLLA 2P4EA 3MBWA 4Q4W1 4FTSA 4O65A 4META 3HQXA 1UY3A 4QHZA 5DAQA 3S0MA 1LTEA 2BQPA 1FPN3 2JDMA 5FLJA 3RZZA 3JQXA 4TLFA 5J96B 5IT6A 1AX1A 4XMIA 4XXAA 4ATFA 5A6ZA 3WUCA 2IXIA 1KFXL 1OA2A 1DZQA 4GMP1 3KHBA 4Q4X1 2B9UA 4BE3A 3WP4A 5JZGB 2I07B 4CTEA 3BI3A 3MPPG 2DTWA 1KS5A 4XCAA 5C8CA 3AFKA 1KDMA 4K21A 5DAWA 1R082 1FXZA 3NRUA 1EAH1 3RGBA 2YC0A 1KQRA 4LKSA 1S1AA 2KA3A 1O59A 2R072 4M3CE 4NRPA 5I8SA 2JE9A 3WQ7A 1QU0A 1U5IA 4TLGA 1DYKA 3K4AA 4MH0E 4B7EA 1CZSA 4P9LA 1AR62 2RM22 4R9BA 4XURA 4CEYC 1VBA1 4E4HA 4YARA 4Q0PA 4R4XA 4XDOA 1ODMA 2Y8KA 2ATFA 4PIYA 4AEKA 1TQ5A 3OYWB 1PZ8A 5FAXA 1G6NA 4M3CB 1XNBA 3NAPA 5IVJA 3WZ1A 5A80A 5GZFA 2UYAA 1ZBA1 3POWA 2D98A 4AEJA 1UZYA 2DVGA 2YROA 2Z4FA 2BZDA 2Q1FA 3ZXDA 4L11A 4Q26A 4WM8C 2F17A 1PZ7A 3RZLA 4JZRA 3ELNA 2B42B 1IPJA 2DWRA 1BVVA 3BOPA 3KCXA 3LEMA 3POJA 3SHRA 4AVTA 2A5ZA 3E6BA 2EAKA 5IK5A 1PIV3 2XB6C 4BMBA 1DBNA 5D8AC 1IPSA 3N7KA 4XQDA 3T3YA 2GN7A 1T2XA 2VZPA 4JHTA 5DZFA 4D69A 2PHRA 1VBD1 3LFIA 3FMGA 2XVLA 1ULGA 1YFYA 2ZA9A 4GH4A 1MS5A 3VV1A 3IPVB 2XJVA 1I9RA 3WQ1A 4KMQA 1QEXA 4PBPA 4FOVA 5EZWA 3VD9A 1ASJ1 1HRV1 4LO7A 3DPRB 1QHDA 1S0IA 1M4WA 2A3XA 4CU9A 5IVVA 1S0GA 4YWAA 4AWDA 5JR2A 4XC9A 1JZ2A 1L3JA 4Y33A 4YG3A 1HQNA 1IOAA 1GNHA 2E7TA 2GMMA 5CKQA 1C3HA 1XYOA 4KWKA 1ST8A 2SLIA 4NWWA 1LHUA 4RHV3 3SCGA 1AXKA 1UQXA 3ILFA 5JXGA 2WYSA 5BNPB 2WFF3 3I2HA 3KV4A 3MIGA 3N9MA 2BDRA 3FFZA 4LBQD 4PLNA 1YRZA 1QJU2 1CJDA 1PGW1 2XL9A 5FXXA 5JI7A 1BLZA 3ZR6A 2J1TA 2ZZJA 1O8SA 1WW5A 3IB3A 5DUVA 5FPZA 4B4QA 1DZTA 3T0BA 1WMDA 3N9QA 5KBFA 2RS53 3MF9A 5SV5A 2Z69A 4BYYA 5FOBB 4R9DA 5F3GA 1PO11 1R091 3MYXA 1OLRA 1ULPA 1GQHA 2DVFA 4W65A 4DEVA 3H3ZA 1QIQA 4IV1C 1CAUB 4IGOA 3UNPA 3S7IA 4N8MA 4J1XA 1DG6A 4GZ9A 3J4UH 4YZ1A 2ZEWA 3H8UA 4UFKA 3USUB 5H9QA 2VUCA 1CR7A 1RUC3 2QQJA 5FY7A 1Z7S1 2VECA 4JGZC 5ANNA 1R092 3AC0A 3RRDA 2VMDA 1QJU3 2W1QA 1CZVA 2WABA 3RG0A 1SCSA 4CXYA 1QXJA 4KU8A 1W2AX 2CU5A 3UGHA 2HWF1 4M0NA 4Y22A 5CFDC 4GWIA 1WGPA 1I3HA 5KXBA 2WWJA 4P08A 2VUAA 4PBOA 5FUPA 4BIOA 2D3SA 5IK7A 1BMV2 2CDOA 5I91A 1W8FA 1W6QB 1EYBA 2WINB 5IJRA 1CX4A 1KS4A 5FPVA 2G9GA 3D4KA 2ERFA 3H8OA 1UZWA 5FYVA 1ZZCA 5E16A 5FZLA 4AFDA 1JZ7A 3POSA 5IWFA 4NIIA 5CBLA 4A4AA 3VZMA 4UW3A 3MI8A 3BTXA 4FAHA 3O1RA 5FPAA 2Q8EA 1UU6A 4ASKA 1FATA 4Y5Z0 1XNKA 4AL9A 2UY9A 2YUEA 3H3LA 4P9XA 5LK7B 1ZA7A 4UW6A 2JENA 1XB9A 4XIOA 3AKQA 4CCKA 5ACA1 2A3WA 1WCUA 2W87A 1QJZA 2XWBB 4WM8B 3ZDSA 4R4ZA 5FZBA 1O4YA 3AJZA 4M0HA 2C1FA 4QHBA 1VAVA 3GNEA 2J1UA 2HH9A 3JUUA 3NV2A 2RJ2A 4MXWB 2DVBA 3WV6A 2XLGA 5F3IA 4OQ9A 5LWBA 5HPOA 1S0CA 4FPFA 2OA2A 1VIWB 1VAKA 2GC0A 1JYWA 5D8AA 1X36A 3W58A 4RR3B 1WW6A 1X9PA 1VR3A 4C91A 5FPUA 4QDRA 2V09A 1A3KA 1EP0A 4W8JA 2WKKA 5J36A 3BVCA 4DPNA 3NJYA 3MEPA 4RS5A 2WWUA 2ZGMA 4Y1YA 4UBHA 2BBVA 1JI6A 3HT1A 3M4FA 5FP7A 2TNFA 4PF5A 4K1YA 4CZSA 1W8UA 4Q1RA 3NNJA 1JHJA 2AZ5A 1AL21 2RMU1 3LKJA 3ZFEC 1F5FA 3NV3A 4YNIA 3QD6A 4IEYA 4QQOA 1HB4A 2ETEA 3FUQA 3VZKA 2JB4A 2DF7A 3ZYHA 4AEDB 1OKOA 4HXCA 1ZRIA 1W6MB 4LHNA 1AR83 4XQWA 4CPBA 5BNOA 2CGNA 2RHPA 1OPOA 3FLRA 5A7SA 4CCDA 1MS0A 4IETA 5CFDA 4GMP3 5H9SA 2VZ1A 1X9TA 4N90A 3VD3A 3WT3A 1T6GC 3G6JB 3ZKYA 1X7NA 2J1VA 3JBG3 2W9XA 5FMCA 2WZR1 3N9LA 2VPVA 3CLPA 3RZJA 1JBCA 2W47A 4HK9A 4XDQA 2VNVA 3MDPA 1E5HA 1K3IA 1HQLA 1QJX1 2BGPA 1JN2P 3WDYA 1AZDA 3U10A 2GC3A 4NPRA 2J42A 3EHKA 5HCBA 3BPZA 1JUIA 2PMWB 3HVDA 1RUNA 5A7OA 2ZS6B 1FI2A 2WWSA 3ON7A 2A3YA 2QZ2A 2Y6GA 2GZWA 3DKWA 4K20A 2DDUA 4YVWB 3O0VA 5LRSA 1E57A 4UFHA 5CU1A 2YV8A 5J98B 4QPGA 3ZFGB 3VD4A 2DCJA 1E5IA 1GICA 1KEXA 1CN1A 4LBJA 1SBFA 3ZIXA 2VQ0A 4GB31 1DCSA 1DFQA 1DQ2A 1LGCA 1N1YA 1STMA 2DCTA 1UMIA 2KR2A 4YRDA 1IS6A 1NCRB 1VBE2 1QGLA 2LUWA 2D6KA 2VBPA 3AMQA 4DB5A 3LF7A 3SH3A 3VDCA 4YGBA 3ZYGA 3CKHA 1NA1C 1DF0A 4AHXA 4Y1VA 1UY4A 1NCRC 3CMGA 3P3NA 5T54A 1O5UA 1QXPA 4IEPA 3TNQA 2PQQA 4NPMA 5KXEA 1VBE1 2OXBA 5C3SA 5E6HA 3VKLA 4BQ3A 3KCYA 2JXAA 4GH4C 1UOJA 5IVFA 1US2A 5FPXA 2DUQA 1NY71 3Q8CA 5CIRA 1OKQA 1HRV3 3ASIA 3K4ZA 4Q4V2 2PHXA 5DN2A 5K0UA 1SLIA 4CDWC 3FLTA 5LEKA 3T0AA 2QQNA 3IMNA 4PCRA 1J84A 3MLKA 3ALQA 4COUA 1P8JA 3T1LA 1PMJX 5E89A 3AMMA 3K46A 4BQ2A 3I49A 3PMSA 4HKOA 1ND3A 1QQP2 1K12A 1VLNA 2H0BA 2YXSA 1BYHA 4WVVA 2HJIA 4NRMA 1YHFA 1KJRA 2WRAA 2WO7A 4HKLA 2R32A 2WDBA 1RUF3 4CUBA 1KRIA 5CFCC 2ES3A 3WQBA 3PVEA 4XFAA 1ZZ6A 3K77A 4HPKA 4L99A 1LB2A 3A4UA 1VBC1 1UY2A 1GU3A 4XMAA 3TEWA 1CAWB 4RSUA 5FZCA 1XYNA 1RUH3 4YGEA 5CKMA 4MYEA 3CEWA 4JGYB 2W39A 4GAZA 3WNNA 1I6XA 1OSGA 4OYUA 3S5QA 1V9U3 1W9SA 1WLDA 4AFBA 5C8WA 4NHLA 3AJYA 3AX4A 5AFBA 3ZR5A 3BN6A 3H1WA 2C5DA 2RV9A 4NRQA 4AHWA 3VBRC 5BV6A 2WNVC 1ZVFA 1ZRFA 3AYDA 1Y43B 1IS3A 1W39A 5K8SA 1OLQA 4JQRA 3SCFA 2EVXA 4G9SB 4FBFA 1W8NA 3VBUB 3THTA 5A7QA 4P9YA 5J3UA 1NCQA 3AKPA 1BXHA 1SFPA 4LJHA 3AZXA 2FHRA 4QB6A 2PXJA 5DAVA 4H7MA 1DQ5A 3B69A 1VB4A 3I2KA 3VZOA 4HETA 1SBEA 3JBG1 3OBRA 4XOGA 4QX3A 4QB2A 2BJSA 1US3A 1XRUA 3KV6A 2CL2A 2Y6FA 2WO3A 1BKZA 4IE7A 4DUVA 1UN1A 5GJ6A 2W1WA 2HWC2 4QXCA 5K4LA 4BQYA 1ZBE3 4AR2A 3HBZA 2W92A 3GZAA 1XOYA 2WNVB 1OFSA 1REEA 4YM3A 1O6UA 1UMZA 3VUOA 1VRBA 4DUXA 2VNRA 3UJOA 5BNNB 4O9GA 5B4NA 3X29B 3MF6A 4NAMA 1ODNA 3IDBB 1JU4A 4JDMA 4LITA 4JRAA 2H6BA 5DDJ3 1DYOA 4XJWA 4N7IA 3FHAA 5C3QA 1H4HA 1LOEA 4KL1A 3WF2A 2FDHA 5I8YA 5IVEA 1PNGA 3LD8A 1COV1 3BTZA 1CAVA 3NJXA 2WN3A 3UL2A 3A7QA 1UCXA 2XBO1 1GNZA 3E97A 1AR91 4QXKA 3ZSKA 5A1LA 4RGAA 1Z0HA 5KHHA 4OFGA 2DBNA 3P5BA 3UETA 1G9FA 4Y20A 4XUOA 5APAA 3RMYA 3ZYIB 1JZ4A 2CGOA 3PURA 1RUD3 4WZFA 2B9VA 1AYN1 4QQ2A 5JMOA 5LEJA 1RUI1 3W59A 1RUH2 5L9VA 3TNPB 4H2AA 5GM0A 4GD4A 4IV1B 2BV4A 3WF3A 5FPLA 4M4PA 1V70A 5BY5A 5JI9A 1V6NA 2AREA 3CDZB 1OOPA 1FPN2 5KHJA 2JDKA 4OI4A 5I0TA 3AMNA 4RGKA 5C4WB 1A8MA 2LRPA 5FJHA 4XJ9A 4E2QA 4CP1A 2DV9A 5F32A 1SMVA 1RUH1 1KJLA 1OQDA 3C3VA 1FT9A 4ZU4A 3RI8A 3I3MA 5FK8A 2QQPA 1A8DA 1OD5A 5BYNA 2XJPA 3HEIA 4Y1UA 2NZ9A 3WF1A 1CD3G 4LR4A 5CADA 4WVMB 1N1TA 2XJQA 4XF0A 2VO5A 4YZ4A 1DQ0A 3I3EA 4UXAA 2J1EA 1V00A 2SBAA 3I59A 4FP2A 5FQ0B 4ZKTB 4AAPA 1ENSA 1IS5A 2NYYA 3MFAA 1C5IA 1RUE1 3SNMA 4GKYA 4UF0A 4ASLA 1S4CA 5A3LA 3BU0A 4QXBA 4TXWA 4AFMA 4DIQA 2HWF3 3KVAA 4CCMA 1A78A 3M8LA 5T55A 2JDNA 2TBVA 2WT0A 3K3NA 3MICA 4E8CA 3MW4A 4B4PA 1O3RA 4OHZA 2HWB3 4Z1VA 5F5CA 2AUYA 3GBFA 4E2SA 3HD8B 1ZBE2 2D7FA 4KNCA 3CJXA 4DFSA 4DY3A 4AGGA 3I3QA 4JGZB 3UK9A 5JOWA 4PIXA 1NCQB 2LROA 1NLRA 1R1A1 2BWAA 2UYBA 1G8WA 1HDKA 1W2NA 1UAIA 1YI9A 3GXUA 1UNBA 2BFUS 2X5IA 2DU0A 1MQTA
chains in the Genus database with same CATH topology
2Y64A 3C7HA 4CU7A 2VCBA 4P5YA 4YPJA 3UESA 2WUHA 5EJZB 1K45A 3JXSA 5C70A 4CU8A 1W0NA 3THDA 3MBWA 1UY3A 3P6BA 2VCAA 4OMCA 5DMYA 4DEQA 4UAPA 4JX0A 4Z2AA 2DCKA 3NNGA 3NRUA 3OGRA 4JHZA 5C71A 4XUNA 1CIYA 2C9KA 4MOAA 2WZEA 4LKSA 1O59A 3OB8A 5LA1A 1GOFA 3K4AA 1CZSA 3THCA 4XURA 3HPNA 2Y8KA 3C7FA 4A3ZA 1I5PA 4D0QA 2VL4A 2WAOA 2Z4FA 2BZDA 4XUTA 2W1SA 2BGOA 3T2OA 3VD5A 5HXMA 3ABZA 2ZEXA 4QX1A 3U37A 4P02B 3K4DA 5DPNA 4ZY9A 1T2XA 2VZPA 3PUHA 3WNLA 3IDAA 5IYYA 1JU3A 3IAPA 4ZZ5A 1XNAA 4KMQA 4MGSA 4OUEA 3K75B 5EJ1B 4MGQA 2EICA 3ETPA 3VD9A 3D3AA 4KI5M 5C7GA 4MADA 4CU9A 5IFTA 5JR2A 1JZ8A 1JYNA 2JD9A 1L7RA 1H6XA 1JZ2A 4MO3M 1EUUA 2V72A 4ZXEA 4D8MA 3CZUA 5JXGA 2WYSA 2J1SA 3VDBA 3IAQA 5F7UA 4DXRA 3I2HA 2X10A 3I97A 4GWJA 4CUCA 2J1TA 1O8SA 1UXXX 3IB3A 1O8PA 3T0BA 2XQXA 5LA2A 1ULPA 1UY1A 4DEVA 3CQOA 1CX1A 3WNPA 3FL7A 1DP0A 3UNPA 2X05A 4W50A 4GZ9A 1CZTA 4LPLA 2ZEWA 3T0DA 1SDDB 3VDAA 5I0DA 2WBKA 5LCWL 2W3JA 3LEKA 2QQJA 4DXSA 4A45A 3AC0A 2VMDA 2W1QA 1CZVA 2QQKA 2WABA 3FN9A 5DQ0A 5IFPA 3OEBA 1TVGA 1EUTA 1SHWB 2L9LA 4GWIA 3C7OA 4P08A 3PUIA 3WF0A 2CDOA 5IJRA 5LA0A 4CVUA 3ACGA 5IHRA 2J1RA 3HOBA 4QX2A 1JZ7A 4A42A 1K42A 2VR4A 1ULOA 4A4AA 2RVAA 2VMEA 4BK5A 2VJXA 2E26A 2QQIA 3I3BA 2JKXA 3LEIA 3HNBM 2VZOA 3LQCA 2W87A 5JXHA 1JZ3A 1JYVA 2J1UA 2ID4A 2RJ2A 3I2GA 2VQUA 3OBAA 5HPOA 1JYWA 2YC4A 3DYOA 4UI9L 4QAWA 3E1F1 2VMFA 2VZUA 4QDRA 4W8JA 2VQTA 4XUQA 3WEZA 3MO4A 3SKVA 2CDPA 1JI6A 5B4XA 3T08A 1JHJA 1NUKA 2HLEA 4ZZ8A 3F2ZA 5A1AA 4ARYA 3FHQA 4QDQA 4P00B 3W5NA 3A22A 4RN5A 2ZXQA 5CZKA 2WZ8A 1KGYA 3WNKA 2VZ1A 3VD3A 2E32A 2VOTA 4ET7A 2WO2A 2J1VA 4JKKA 2W9XA 1OF3A 2QBXA 4A6OA 3ACIA 2W46A 2W47A 1W8OA 3C7GA 2B4KA 2PQSA 1K3IA 4L0PA 2BGPA 4XZUG 1NKGA 2KD7A 2VZSA 3ZM8A 1WKYA 5G05L 2QQMA 2Y6GA 3GM8A 2E31A 2DDUA 1UX7A 1GOGA 3EYPA 3I3DA 3HNYM 3VD4A 1TG7A 2DCJA 3C8XA 1KEXA 2YFZA 5JUVA 4JKMA 2QQLA 1UMIA 3NQHA 2JDAA 3ACHA 4HG6B 4PQQA 1UYZA 5CYYA 2WO1A 3VDCA 3T2QA 3CKHA 2WQ8A 2XHNA 4KWUA 1F4HA 1UY4A 3CMGA 2BBAA 1HN1A 2J1AA 3HN3A 2VZQA 5FUIA 4QDSA 4QPWA 3OGSA 1NX9A 4AG4A 1US2A 2EIBA 2LW8A 2VM9A 2Y6HA 3K4ZA 3OEAA 3WSOA 5DN2A 4DUWA 3SEEA 3T0AA 2QQNA 2VCCA 3MV11 2E33A 1W9TA 1J84A 1P8JA 1PMJX 4PT6A 3K46A 2VZ3A 1XC6A 3CZJA 1PMHX 1K12A 2ORZA 3DYMA 1D7PM 1LNSA 4OZOA 1W9WA 2WDBA 4CUBA 3GGLA 1XNTA 3LPGA 1UXZA 3WQBA 3K77A 1UYYA 1UY2A 1GU3A 2JE8A 3T09A 3WNOA 2W1UA 5JXIA 3EB7A 3SKJE 2Y6JA 1L7QA 2YB7A 3WNNA 4OYUA 1OT5A 4A41A 2VTFA 1W9SA 4E8DA 3A23A 3I2JA 2YC2A 2YFUA 3W5MA 3BN6A 1PX3A 2RV9A 4W4ZA 2W95A 1IQDC 3MUZ1 3DECA 1OH4A 3I2FA 1JZ5A 1W8NA 2VZVA 5EIYB 3BGAA 4QB6A 2WAAA 3T2PA 4BJ0A 1UYXA 1UWWA 5J1XA 1F4AA 3J7HA 3I2KA 1GOHA 5JXJA 3SEPA 4FI9A 4QX3A 2W94A 3HJRA 2C4XA 4QB2A 2Y6KA 1US3A 2ZEZA 4UOJA 2WO3A 3LEGA 4DUVA 2W1WA 1JYXA 2BERA 1SG3A 1UZ0A 3ACFA 3C7EA 2XOMA 3VD7A 2W92A 1WCQA 2YG0A 3LPFA 3MV01 4XUPA 4ARXA 4DUXA 1BHGA 5B4NA 1RYYA 2V5DA 1JU4A 2VZRA 2ZEYA 2J7MA 1DYOA 4DXTA 3FHAA 1OF4A 3WF2A 2LS6A 3NJXA 2WN3A 2W91A 3A7QA 1XPWA 4QX0A 2OKXA 2QQOA 1H6YA 3IIIA 2VMCA 3UETA 3MUY1 4XUOA 1JZ4A 2J22A 5JMOA 2B9VA 3HNMA 2VZTA 2EIEA 2XONA 3P1IA 1UY0A 4IUGA 3WF3A 3WF4A 4M4PA 4CUAA 1R64A 2ORXA 3CDZB 3DYPA 4AAXA 2EIDA 1JZ6A 3OGVA 1GUIA 1PX4A 3HEIA 5G04L 3WF1A 3NJVA 4RYDA 1OD3A 3A21A 1MPXA 1GMMA 2VO5A 4A44A 3I3EA 3ECQA 2J1EA 2Y6LA 1UMHA 4BXSV 4LQRA 4M4RA 2VC9A 4TXWA 4LHSA 3OG2A 2WN2A 3CIHA 4OMDA 4E8CA 4QB1A 1YQ2A 3GDBA 1GQPA 4PF1A 3I2IA 4JKLA 4CU6A 2V4VA 2R7EB 1J83A 1NAEA 2C26A 3LE0A 2HYXA 2W5FA 3WNMA 4BDVB 4TTGA 1DLCA 2X09A 4XVHA 3GXUA 1GNYA 4BK4A 1W99A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2Y64 A;  3C7H A;  4CU7 A;  2VCB A;  4P5Y A;  4YPJ A;  3UES A;  2WUH A;  5EJZ B;  1K45 A;  3JXS A;  5C70 A;  4CU8 A;  1W0N A;  3THD A;  3MBW A;  1UY3 A;  3P6B A;  2VCA A;  4OMC A;  5DMY A;  4DEQ A;  4UAP A;  4JX0 A;  4Z2A A;  2DCK A;  3NNG A;  3NRU A;  3OGR A;  4JHZ A;  5C71 A;  4XUN A;  1CIY A;  2C9K A;  4MOA A;  2WZE A;  4LKS A;  1O59 A;  3OB8 A;  5LA1 A;  1GOF A;  3K4A A;  1CZS A;  3THC A;  4XUR A;  3HPN A;  2Y8K A;  3C7F A;  4A3Z A;  1I5P A;  4D0Q A;  2VL4 A;  2WAO A;  2Z4F A;  2BZD A;  4XUT A;  2W1S A;  2BGO A;  3T2O A;  3VD5 A;  5HXM A;  3ABZ A;  2ZEX A;  4QX1 A;  3U37 A;  4P02 B;  3K4D A;  5DPN A;  4ZY9 A;  1T2X A;  2VZP A;  3PUH A;  3WNL A;  3IDA A;  5IYY A;  1JU3 A;  3IAP A;  4ZZ5 A;  1XNA A;  4KMQ A;  4MGS A;  4OUE A;  3K75 B;  5EJ1 B;  4MGQ A;  2EIC A;  3ETP A;  3VD9 A;  3D3A A;  4KI5 M;  5C7G A;  4MAD A;  4CU9 A;  5IFT A;  5JR2 A;  1JZ8 A;  1JYN A;  2JD9 A;  1L7R A;  1H6X A;  1JZ2 A;  4MO3 M;  1EUU A;  2V72 A;  4ZXE A;  4D8M A;  3CZU A;  5JXG A;  2WYS A;  2J1S A;  3VDB A;  3IAQ A;  5F7U A;  4DXR A;  3I2H A;  2X10 A;  3I97 A;  4GWJ A;  4CUC A;  2J1T A;  1O8S A;  1UXX X;  3IB3 A;  1O8P A;  3T0B A;  2XQX A;  5LA2 A;  1ULP A;  1UY1 A;  4DEV A;  3CQO A;  1CX1 A;  3WNP A;  3FL7 A;  1DP0 A;  3UNP A;  2X05 A;  4W50 A;  4GZ9 A;  1CZT A;  4LPL A;  2ZEW A;  3T0D A;  1SDD B;  3VDA A;  5I0D A;  2WBK A;  5LCW L;  2W3J A;  3LEK A;  2QQJ A;  4DXS A;  4A45 A;  3AC0 A;  2VMD A;  2W1Q A;  1CZV A;  2QQK A;  2WAB A;  3FN9 A;  5DQ0 A;  5IFP A;  3OEB A;  1TVG A;  1EUT A;  1SHW B;  2L9L A;  4GWI A;  3C7O A;  4P08 A;  3PUI A;  3WF0 A;  2CDO A;  5IJR A;  5LA0 A;  4CVU A;  3ACG A;  5IHR A;  2J1R A;  3HOB A;  4QX2 A;  1JZ7 A;  4A42 A;  1K42 A;  2VR4 A;  1ULO A;  4A4A A;  2RVA A;  2VME A;  4BK5 A;  2VJX A;  2E26 A;  2QQI A;  3I3B A;  2JKX A;  3LEI A;  3HNB M;  2VZO A;  3LQC A;  2W87 A;  5JXH A;  1JZ3 A;  1JYV A;  2J1U A;  2ID4 A;  2RJ2 A;  3I2G A;  2VQU A;  3OBA A;  5HPO A;  1JYW A;  2YC4 A;  3DYO A;  4UI9 L;  4QAW A;  3E1F 1;  2VMF A;  2VZU A;  4QDR A;  4W8J A;  2VQT A;  4XUQ A;  3WEZ A;  3MO4 A;  3SKV A;  2CDP A;  1JI6 A;  5B4X A;  3T08 A;  1JHJ A;  1NUK A;  2HLE A;  4ZZ8 A;  3F2Z A;  5A1A A;  4ARY A;  3FHQ A;  4QDQ A;  4P00 B;  3W5N A;  3A22 A;  4RN5 A;  2ZXQ A;  5CZK A;  2WZ8 A;  1KGY A;  3WNK A;  2VZ1 A;  3VD3 A;  2E32 A;  2VOT A;  4ET7 A;  2WO2 A;  2J1V A;  4JKK A;  2W9X A;  1OF3 A;  2QBX A;  4A6O A;  3ACI A;  2W46 A;  2W47 A;  1W8O A;  3C7G A;  2B4K A;  2PQS A;  1K3I A;  4L0P A;  2BGP A;  4XZU G;  1NKG A;  2KD7 A;  2VZS A;  3ZM8 A;  1WKY A;  5G05 L;  2QQM A;  2Y6G A;  3GM8 A;  2E31 A;  2DDU A;  1UX7 A;  1GOG A;  3EYP A;  3I3D A;  3HNY M;  3VD4 A;  1TG7 A;  2DCJ A;  3C8X A;  1KEX A;  2YFZ A;  5JUV A;  4JKM A;  2QQL A;  1UMI A;  3NQH A;  2JDA A;  3ACH A;  4HG6 B;  4PQQ A;  1UYZ A;  5CYY A;  2WO1 A;  3VDC A;  3T2Q A;  3CKH A;  2WQ8 A;  2XHN A;  4KWU A;  1F4H A;  1UY4 A;  3CMG A;  2BBA A;  1HN1 A;  2J1A A;  3HN3 A;  2VZQ A;  5FUI A;  4QDS A;  4QPW A;  3OGS A;  1NX9 A;  4AG4 A;  1US2 A;  2EIB A;  2LW8 A;  2VM9 A;  2Y6H A;  3K4Z A;  3OEA A;  3WSO A;  5DN2 A;  4DUW A;  3SEE A;  3T0A A;  2QQN A;  2VCC A;  3MV1 1;  2E33 A;  1W9T A;  1J84 A;  1P8J A;  1PMJ X;  4PT6 A;  3K46 A;  2VZ3 A;  1XC6 A;  3CZJ A;  1PMH X;  1K12 A;  2ORZ A;  3DYM A;  1D7P M;  1LNS A;  4OZO A;  1W9W A;  2WDB A;  4CUB A;  3GGL A;  1XNT A;  3LPG A;  1UXZ A;  3WQB A;  3K77 A;  1UYY A;  1UY2 A;  1GU3 A;  2JE8 A;  3T09 A;  3WNO A;  2W1U A;  5JXI A;  3EB7 A;  3SKJ E;  2Y6J A;  1L7Q A;  2YB7 A;  3WNN A;  4OYU A;  1OT5 A;  4A41 A;  2VTF A;  1W9S A;  4E8D A;  3A23 A;  3I2J A;  2YC2 A;  2YFU A;  3W5M A;  3BN6 A;  1PX3 A;  2RV9 A;  4W4Z A;  2W95 A;  1IQD C;  3MUZ 1;  3DEC A;  1OH4 A;  3I2F A;  1JZ5 A;  1W8N A;  2VZV A;  5EIY B;  3BGA A;  4QB6 A;  2WAA A;  3T2P A;  4BJ0 A;  1UYX A;  1UWW A;  5J1X A;  1F4A A;  3J7H A;  3I2K A;  1GOH A;  5JXJ A;  3SEP A;  4FI9 A;  4QX3 A;  2W94 A;  3HJR A;  2C4X A;  4QB2 A;  2Y6K A;  1US3 A;  2ZEZ A;  4UOJ A;  2WO3 A;  3LEG A;  4DUV A;  2W1W A;  1JYX A;  2BER A;  1SG3 A;  1UZ0 A;  3ACF A;  3C7E A;  2XOM A;  3VD7 A;  2W92 A;  1WCQ A;  2YG0 A;  3LPF A;  3MV0 1;  4XUP A;  4ARX A;  4DUX A;  1BHG A;  5B4N A;  1RYY A;  2V5D A;  1JU4 A;  2VZR A;  2ZEY A;  2J7M A;  1DYO A;  4DXT A;  3FHA A;  1OF4 A;  3WF2 A;  2LS6 A;  3NJX A;  2WN3 A;  2W91 A;  3A7Q A;  1XPW A;  4QX0 A;  2OKX A;  2QQO A;  1H6Y A;  3III A;  2VMC A;  3UET A;  3MUY 1;  4XUO A;  1JZ4 A;  2J22 A;  5JMO A;  2B9V A;  3HNM A;  2VZT A;  2EIE A;  2XON A;  3P1I A;  1UY0 A;  4IUG A;  3WF3 A;  3WF4 A;  4M4P A;  4CUA A;  1R64 A;  2ORX A;  3CDZ B;  3DYP A;  4AAX A;  2EID A;  1JZ6 A;  3OGV A;  1GUI A;  1PX4 A;  3HEI A;  5G04 L;  3WF1 A;  3NJV A;  4RYD A;  1OD3 A;  3A21 A;  1MPX A;  1GMM A;  2VO5 A;  4A44 A;  3I3E A;  3ECQ A;  2J1E A;  2Y6L A;  1UMH A;  4BXS V;  4LQR A;  4M4R A;  2VC9 A;  4TXW A;  4LHS A;  3OG2 A;  2WN2 A;  3CIH A;  4OMD A;  4E8C A;  4QB1 A;  1YQ2 A;  3GDB A;  1GQP A;  4PF1 A;  3I2I A;  4JKL A;  4CU6 A;  2V4V A;  2R7E B;  1J83 A;  1NAE A;  2C26 A;  3LE0 A;  2HYX A;  2W5F A;  3WNM A;  4BDV B;  4TTG A;  1DLC A;  2X09 A;  4XVH A;  3GXU A;  1GNY A;  4BK4 A;  1W99 A; 
#chains in the Genus database with same CATH topology
 4OQ8 A;  1S0B A;  2E63 A;  5FDB A;  4L2N A;  4JCK A;  3BCW A;  3OGJ A;  4IV3 C;  5CG9 A;  2WUH A;  1SAC A;  3O0W A;  5EJZ B;  3TOJ A;  3W21 A;  5FZD A;  3B93 A;  3M70 A;  3V65 A;  1F35 A;  1V0A A;  4AQ2 A;  1QWR A;  3AMP A;  4CU8 A;  1LOA A;  1D0H A;  1Q8V A;  2ENR A;  4URA A;  5D8A B;  1YXW A;  4JDN A;  5HBA A;  4MGY E;  4ZON A;  4LK6 A;  1AHS A;  1FOD 3;  2B7Y A;  3IWZ A;  4CEY B;  5DUU A;  1DGR N;  2VUD A;  2VCA A;  5I0U A;  4JRL A;  4CDW A;  1EV1 2;  1D4V B;  4RA0 A;  2NLR A;  1RIR A;  5DG2 A;  4HN0 A;  1O3T A;  2P1B A;  2GND A;  1E5S A;  1T6B X;  4LHK A;  2WLP A;  2BP6 A;  5LA9 A;  3KF3 A;  4XBN A;  1Q8P A;  1QJX 3;  3ST7 A;  3H50 A;  3ORJ A;  4JHZ A;  3H9A A;  4EWD A;  3U07 A;  1JMU B;  1NE6 A;  4FPL A;  4RD7 A;  1RTV A;  2FMD A;  3PDQ A;  4HAN A;  1RUI 3;  2YMZ A;  4LBM A;  4IEQ A;  1XU2 A;  4BXF A;  1GOF A;  1RUO A;  3FBM A;  2JDP A;  1KDK A;  3CU7 A;  4XFB A;  5FY4 A;  3T1M A;  1Y9M A;  4MGT A;  4B4R A;  3C7F A;  1NY7 2;  4CDQ C;  2IFW A;  2ADD A;  4EN6 B;  3WD5 A;  4XJZ A;  1YQ6 A;  1QH6 A;  4QGN A;  4A3Z A;  1LGN A;  3LWC A;  1GR3 A;  2DCZ A;  3IMM A;  1Q3E A;  4M3C F;  3SIS A;  1CPM A;  2CWM A;  1RL3 A;  2XDV A;  1OH3 A;  3T2O A;  2BGO A;  2I2S A;  3IT8 A;  3ABZ A;  1HN0 A;  4QX1 A;  1W04 A;  5FMO S;  4B3N A;  4Q4W 2;  1OLM A;  4AQS A;  1GKB A;  1TMF 1;  2JDU A;  2P3I A;  4BPZ A;  1GLH A;  5I0R A;  3RMX A;  3KLS A;  4P02 B;  3VBU C;  1U12 A;  4BM8 A;  5DPN A;  5FCC A;  5FXV A;  3PUH A;  4COZ A;  3TWI A;  3IDA A;  5IYY A;  4E9K A;  3KQR A;  3IAP A;  4XF9 A;  1JS9 A;  5A3N A;  1XNA A;  1LEN A;  1MZ6 A;  4OUL A;  4OUE A;  3K75 B;  1S0J A;  1VBB 2;  2PAE A;  5FZ0 A;  4BQ5 A;  3HQU A;  2VG9 A;  3D3A A;  4ASM B;  2G9F A;  3BTY A;  2RM2 3;  2LM3 A;  5L9R A;  1JOD A;  4W6Y A;  4LOS A;  2XBO 3;  2XHK A;  2O1Q A;  1CAW A;  3BAL A;  4Q0V A;  3SH4 A;  1QH7 A;  3V56 A;  1H6X A;  5GLV A;  3VKN A;  2MEV 3;  1LJ7 A;  3WY6 A;  5GZD A;  5JOY A;  2WQZ C;  3VZN A;  3ZO0 B;  1GBG A;  4JGY A;  4DS0 A;  1RUJ 2;  4D8M A;  1UW8 A;  2RM2 1;  4K9S A;  1CGP A;  5JSR A;  1LEC A;  3KF5 A;  1AYN 3;  4YW7 A;  1C57 A;  1YYN A;  3IAQ A;  4DXR A;  2PHD A;  4GUL A;  3UT0 A;  3I97 A;  4CP0 A;  2VXJ A;  2ZOE B;  4GWJ A;  1EY2 A;  3QLQ A;  1WME A;  2MHF A;  2VNO A;  4TN7 A;  4NPL A;  4AW7 A;  4EZH A;  4CUC A;  3LZZ A;  2R1B A;  2ZGP A;  1RMU 2;  2V5Y A;  3ZIW A;  1O8P A;  2TEP A;  3NO8 A;  5C5U A;  4NHX A;  2XQX A;  1DGW A;  2D6O X;  5FYY A;  3VBU A;  3OY8 A;  4N43 A;  1UY1 A;  5JMC A;  5CAZ A;  4PI0 A;  4EN9 B;  4Q4V 1;  2R04 1;  4W50 A;  5GKA C;  3ZN6 A;  1J3P A;  4YW1 A;  1ALY A;  4LNV A;  1CZT A;  1XE7 A;  1MS4 A;  5F37 A;  1LR5 A;  3QOP A;  5FIX A;  3O1T A;  3T0D A;  2JDZ A;  3ZVX A;  1D0G A;  2WBK A;  2W3J A;  2RR1 2;  3W20 A;  1URX A;  4GXL A;  3PUQ A;  4DXS A;  5CKN A;  4A45 A;  2W2I A;  5SV8 A;  1UL9 A;  2WL1 A;  1W6Q A;  4YM1 A;  2QQK A;  3J9S A;  1W05 A;  1H2M A;  1QNW A;  3KSC A;  2KXL A;  5DQ0 A;  4YVS A;  5EV7 A;  3ZXA C;  5KR7 A;  1RC6 A;  1SHW B;  3SMH A;  3PUI A;  3DPR C;  5FYI A;  1VBC 2;  1YQC A;  2RS1 1;  4LBO A;  1H2K A;  3I2O A;  1GP5 A;  4NHY A;  1H1M A;  4R52 A;  5DAX A;  2CV6 A;  4DMI A;  5K9Y A;  3THP A;  5IHR A;  4FSJ A;  2A6Z A;  2VR4 A;  3WX5 A;  1NXM A;  2VME A;  2YGM A;  4RR3 C;  4RS5 C;  4BK5 A;  5L7O A;  1RIT A;  2QQI A;  1OBN A;  1C4R A;  1CAU A;  4YW2 A;  2WS9 2;  2JKX A;  3DN7 A;  4EN0 A;  3LEI A;  1VBE 3;  1YCI A;  3B9I A;  2WNE A;  1QJY 2;  3HNB M;  4ZS2 A;  5IAX A;  1UD1 A;  2VAU A;  4E4Z A;  1AJK A;  4K1Z A;  3IIA A;  4FPO B;  1ASJ 2;  3WXP A;  2GME A;  5DZE A;  5CA6 A;  2NPI A;  1HJG A;  1JZ3 A;  4QU2 A;  3GBG A;  5FBZ A;  3VBF A;  4Y4R A;  4PLM A;  1FNY A;  1ACC A;  3KV5 A;  3OBA A;  4ZS3 A;  1O3S A;  2FZ2 A;  4FCA A;  1MS3 A;  5ABJ A;  4KH9 A;  2YC4 A;  5FV3 A;  2DUO A;  1WCK A;  1LRH A;  4QKD A;  1ULD A;  4QAW A;  1HRI 2;  3OCP A;  3GJA A;  4Y20 B;  2DCY A;  3V0A B;  1VAM A;  3BUC A;  2VXR A;  4LBQ A;  3O12 A;  3WW3 A;  5J09 A;  1CAV B;  2ZGN A;  2PA7 A;  1OOP C;  3LFM A;  4QD2 A;  3S7E A;  1W6N A;  2PLV 2;  2ZGT A;  4HT1 T;  5T5O A;  3ZFE B;  2QKD A;  2A6Y A;  2IUW A;  4IV3 A;  3LSE A;  5C3O A;  5JZG C;  2YGL A;  4BU2 A;  4ZZ8 A;  3AZV A;  3ITQ A;  4GJY A;  1G9D A;  3OGG A;  4AEM A;  2RG4 A;  3FHQ A;  2GAU A;  4L97 A;  4QDQ A;  5FZI A;  3ZXK A;  5JOX A;  4P00 B;  2QDN A;  2AC1 A;  2IVI B;  1JW6 A;  1IHM A;  2YBS A;  4NE9 A;  4CXX A;  5CZK A;  4EJR A;  4A6S A;  2XG3 A;  1KGY A;  3B00 A;  5FXW A;  3WNK A;  4YM0 A;  2CY6 A;  2E32 A;  1W9Y A;  1LU2 A;  2W08 A;  2NP0 A;  2ARX A;  3DV8 A;  5A6Q A;  1FMD 1;  3VBF C;  3O1M A;  2WYF A;  3JD7 2;  4JKK A;  1W6P B;  4NN0 A;  4CXW A;  1OF3 A;  5DG1 A;  3ACI A;  4H14 A;  1DU3 D;  2ZHN A;  4A6O A;  4COW A;  3R4U A;  3NMB A;  1SLB A;  1LOD A;  2GAL A;  2HWD 2;  2PQS A;  3J26 N;  5C33 A;  2Q30 A;  3VBS B;  1BMV 1;  1NKG A;  4IE5 A;  4KGQ A;  2R0H A;  1TNR A;  1QOO A;  2VZS A;  5D2A A;  5C6C A;  1WA6 X;  4ISQ A;  2WA3 A;  2F4P A;  4B8E A;  4IEO A;  4O9E A;  4Y24 A;  1U5Y A;  5EPA A;  2IWG B;  1FMD 2;  3NAP B;  4GA9 A;  4I2O A;  2ARA A;  5AVP A;  4AI9 A;  2QFE A;  1KXG A;  3IDE A;  4Q2F A;  2WZR 3;  4W6W A;  1IG3 A;  2I45 A;  3CF6 E;  1UIK A;  2G1M A;  3P3P A;  1SLA A;  2ET7 A;  1ULC A;  3KVB A;  1LOF A;  2JG8 A;  5A33 A;  3NQH A;  5DXD A;  2I74 A;  4IEZ A;  1WW4 A;  1MS1 A;  5ACA 2;  3VHP A;  4BZ4 A;  3ACH A;  4PQQ A;  3VBR B;  1UYZ A;  4DIN B;  4HPK B;  1N47 A;  1OA4 A;  4V1P A;  4MGK E;  5CYY A;  1JYT A;  1PVX A;  1TNF A;  3NL1 A;  4MUV A;  1LHN A;  3VBF B;  4LIU A;  1FYU A;  3CBN A;  2XHN A;  4KWU A;  1F4H A;  3JB8 A;  4HLT A;  2BBA A;  4RGG A;  4C8D A;  1V6K A;  2RS1 3;  3NST A;  3HN3 A;  1PO2 2;  1VRH 2;  4LOT A;  1XQN A;  5FMD A;  5L73 A;  4DRR A;  3PUA A;  2ZKN A;  1WD3 A;  2P5B A;  2R1D A;  2HWD 3;  2JE7 A;  2VY0 A;  3B01 A;  4QM8 A;  1SLT A;  2LW8 A;  4XYX A;  4I0A A;  5GZC A;  3VL8 A;  3WSO A;  4PHZ A;  3ZXF A;  1FV2 A;  1AX2 A;  1MEC 3;  2VCM A;  1W2O A;  4IW3 A;  3BKZ A;  1ZBE 1;  4PIZ A;  2X5I B;  2D5H A;  4QU1 A;  3VBH A;  1YIF A;  1XC6 A;  1BEV 1;  3OD0 A;  4HK8 A;  4HN1 A;  1XE8 A;  4WVM A;  4NMI A;  4HVQ A;  1WCD J;  1ND2 A;  1XBF A;  2XJS A;  2OW4 A;  4AGR A;  2EXI A;  5JR7 B;  4OZO A;  2UUR A;  1TMF 2;  1YI7 A;  2V4A A;  5F8P A;  3E5X A;  3I2D A;  1MQT C;  2Z42 A;  3M3E A;  4D7T A;  1ZZ9 A;  4R9C A;  4CEY A;  5LRR A;  2WA4 A;  1W6P A;  1PK6 C;  3EB7 A;  2IXK A;  3AKS A;  1UPI A;  5FOJ B;  4HON A;  3IM0 A;  4CE8 A;  1ZRR A;  4LUK A;  5FPB A;  5I8T A;  1ZZB A;  4A41 A;  3OUH A;  3K51 A;  4JC1 A;  3TB0 A;  3ZFF B;  1BBT 1;  4WV8 A;  1PO1 3;  4ZU5 A;  2F6B A;  2Y33 A;  3W5M A;  2OZJ A;  3WDT A;  2AEZ A;  1ONA A;  1SZB A;  2W95 A;  4W4Z A;  4JQT A;  3RS6 A;  1NG0 A;  3LSD A;  1IQD C;  4GMP 0;  1VE0 A;  1ZZ8 A;  5FR3 A;  1WLC A;  1IS4 A;  1WZX A;  3MUZ 1;  1DIW A;  1OH4 A;  2MEV 1;  2VMG A;  3HT2 A;  2VBB A;  5A3P A;  3MIF A;  3UKN A;  3WP3 A;  1AXZ A;  2VZV A;  5J48 A;  2CAU A;  3TYJ A;  4LIV A;  3BGA A;  4NR1 A;  1W0O A;  1H2L A;  1QDC A;  2C24 A;  3RVH A;  4YYO A;  1UWW A;  4JTN A;  1CIW A;  3DXU A;  1W6O A;  1F4A A;  2FQP A;  1ZRC A;  3J7H A;  3BTA A;  4QX5 A;  1VBA 2;  1YWK A;  2W94 A;  2WZP P;  2VQA A;  1L7L A;  4I30 A;  1DGL A;  2R04 2;  2GH8 A;  3GHN A;  2NN8 A;  3AYC A;  3LEG A;  1D4M 3;  4LO5 B;  2P34 A;  1CES A;  3ACF A;  5HCA A;  3M2M A;  4WM8 A;  3VB9 A;  1ENR A;  5LBC A;  1N1V A;  4LE3 A;  3PHM A;  1X82 A;  1UKR A;  4HZF A;  4I02 A;  2YG0 A;  1HV1 A;  2EXH A;  2Z5W A;  3DXT A;  3MHZ A;  3A0K A;  1LAJ A;  3R6S A;  2FDF A;  1SEF A;  1R08 1;  1BHG A;  2PFW A;  2DVA A;  2JWP A;  1LKN A;  2V5D A;  3QH7 A;  4S2H A;  2VZR A;  1LES A;  2ZEY A;  3GF6 A;  4TWT A;  5LB6 A;  2RS3 1;  2ZX3 A;  5HCH A;  1PGS A;  2JG9 A;  4LXL A;  4Z2W A;  5F3E A;  4FFH A;  4LKD A;  1FX5 A;  5HI0 A;  3O14 A;  4KU7 A;  2K0G A;  4M01 A;  1HV0 A;  1NA1 A;  2OVU A;  4CUG A;  3AKR A;  5FO8 B;  5FUN A;  5FYB A;  4N53 B;  5J37 A;  4AI2 A;  4QQL A;  4CDX A;  1RVF 3;  5BNO C;  4O7X A;  4NRO A;  3EJK A;  2J22 A;  1W03 A;  3FZ3 A;  5FYU A;  5BUV A;  3L2Y A;  4WM7 C;  4COV A;  2VZT A;  2HWE 2;  2QZ3 A;  2WS9 1;  5IW0 A;  4XBL A;  2EIE A;  2XON A;  2OX0 A;  4FAG A;  1Y3T A;  3QAC A;  4EZ4 A;  3WF4 A;  5C9A C;  2FZ1 A;  1R64 A;  4GB3 3;  3M7A A;  4Q0S A;  2PAK A;  4RQP B;  1FOD 2;  3KHC A;  5IUQ A;  1B35 B;  5F39 A;  5FZE A;  2D44 A;  4MLO A;  4AQT A;  4FQZ A;  1GZW B;  5FZM A;  4QQH A;  3RWN A;  4FT8 A;  4KGG A;  2WQ4 A;  1RIN A;  1NOV A;  1Y9G A;  3NJV A;  1J3R A;  1JTZ X;  1OD3 A;  4XAA A;  1MPX A;  4XQ4 A;  1DHK B;  4AOC A;  1SFN A;  2GU9 A;  2BNO A;  3J7L A;  4GJZ A;  5T52 A;  2CWS A;  3TEX A;  1Q8Q A;  1D2S A;  2VOX A;  3MIB A;  4CP2 A;  2ZCW A;  3H3U A;  3OPT A;  3EXU A;  4XF4 A;  2V73 A;  4CEW B;  3CNA A;  2VC9 A;  4FTB A;  1UU5 A;  2WII B;  3RYR A;  1AR6 3;  1TME 1;  3LDK A;  3OG2 A;  4XFI A;  2QE3 A;  3UYJ A;  2WJS A;  4P9W A;  2ZX4 A;  1EAH 3;  5FY9 A;  5A7W A;  1NCR A;  1YQ2 A;  4QB1 A;  3N3H A;  3GDB A;  4BCU A;  1GQP A;  3PUS A;  2NM1 A;  4D6Q A;  4U36 A;  4WM7 B;  4GIQ A;  4JKL A;  4AVB A;  2R7E B;  1J83 A;  2BRT A;  4UW4 A;  1POV 3;  4N43 B;  3B5L B;  2RMU 3;  3WNM A;  1TME 2;  3ATG A;  4BDV B;  2VOW A;  3B02 A;  5A3O A;  3U78 A;  1QOS A;  3KQ4 B;  1HRI 1;  4TTG A;  1PMI A;  4ZU7 A;  2R30 A;  4XVH A;  5FZF A;  4CSW A;  1GNY A;  1VBB 3;  2BEO A;  4ITC A;  1MZF A;  3KT7 A;  1FPN 1;  5E1R A;  1W99 A;  3LCP A;  1JYX A;  4LA2 A;  4QKN A;  5FYC A;  2VCB A;  2Y0O A;  4XAE A;  2ZMK A;  3UES A;  1JXN A;  5KHK A;  3VN4 A;  2CGP A;  1GYK A;  4XXP A;  1JH5 A;  1COV 2;  1ND3 C;  4F3J A;  3JXS A;  5ABJ C;  1OC1 A;  1OUX A;  1AUY A;  2D40 A;  3VKM A;  1YQ5 A;  3P6B A;  1WWY A;  1BK0 A;  3OOX A;  1AR7 2;  2AR6 A;  3TEZ A;  2HWF 2;  3DKQ A;  4MHU A;  4HBN A;  1Q5O A;  1ND3 B;  1WCS A;  4HVR A;  5DMY A;  3DEM A;  4DEQ A;  4UAP A;  2YY1 A;  3PNA A;  4JX0 A;  1H8V A;  2QTW B;  5IK4 A;  3WG3 A;  2ZGL A;  4FOW A;  5LZ6 A;  5FY0 A;  4C0B A;  4OHW A;  5LBF A;  4LK7 A;  1RUD 1;  1TE1 B;  5L7O B;  3WR0 A;  3VZJ A;  1J1T A;  2IXL A;  3MLJ A;  1COV 3;  1Z78 A;  1CIY A;  2C9K A;  1WLW A;  2ZX1 A;  4LHL A;  4MOA A;  3U4S A;  4YFW A;  3M3I A;  4KQ7 A;  3TAY A;  4WZC A;  2E6V A;  1AR9 3;  2DU1 A;  3VBR A;  3OB8 A;  4J25 A;  2YYO A;  4NUB A;  2ZAC A;  5A32 A;  5GZG A;  3PJQ A;  2YPJ A;  1RUD 2;  1PVC 2;  2D43 A;  1DLL A;  2A71 A;  4XW3 A;  3ZYB A;  1YFU A;  4YW3 A;  4E2G A;  3IZO A;  5I93 A;  1YJK A;  4UFM A;  1SDW A;  4KBB A;  5ERL A;  1XNC A;  4LBK A;  1Q43 A;  1BZW A;  2BOJ A;  4D0Q A;  1DYP A;  2WAO A;  4QX7 A;  3BU7 A;  2O8O A;  1RUC 2;  5M0T A;  3U4X A;  3ZPO A;  1MEC 1;  1LHO A;  3RZG A;  5HXM A;  1YJL A;  2ZEX A;  4CCL A;  2ZML A;  3OD4 A;  3VDD A;  2R6Q A;  5HXV A;  1JYI A;  1RUF 1;  1C8N A;  2UWC A;  1WW7 A;  3N9O A;  3ZX7 A;  4Y26 A;  5FYS A;  3UKV A;  2RS5 2;  1HXS 2;  1N3P A;  3DGT A;  4UFJ A;  2Y26 A;  3HAG A;  1DGW X;  5FZ3 A;  2RDR A;  1QJX 2;  4AE2 A;  1ULE A;  1RUC 1;  3AL6 A;  3ES4 A;  2HEW F;  2WS9 3;  3ZN6 B;  2D6N A;  1W3V A;  3H1Y A;  3MW3 A;  1G7Y A;  3NKG A;  4AFC A;  1B35 C;  4R9A A;  4ZZ5 A;  3S5A A;  1C8M 3;  1U5Z A;  2VW2 A;  5FP4 A;  5K0U C;  5EJ1 B;  2EIC A;  1ZA4 A;  3ETP A;  2PHT A;  4KI5 M;  5C7G A;  4IQP A;  4MAD A;  4BME A;  5C8C B;  2AEN A;  4JV4 A;  3LA3 A;  2K46 A;  1A34 A;  1JOB A;  1JYN A;  2JD9 A;  3E6D A;  2DFC A;  2XL7 A;  2GP3 A;  5C3R A;  4K8F A;  4YVS B;  4AI8 A;  4X8N A;  4MO3 M;  5A7W B;  3OF1 A;  4ZXE A;  3M1H A;  1OQ1 A;  5BNO B;  4QPI B;  2VU9 A;  3CZU A;  4IND A;  5GLZ A;  2J1S A;  5JPN B;  3VDB A;  4IE6 A;  3A0N A;  4MV2 A;  2OYZ A;  4IL7 A;  4W6X A;  1DQ4 A;  3OJB A;  1R08 3;  4CP9 A;  5CFC B;  2FD8 A;  2X10 A;  4YVS C;  3GZT B;  3K3O A;  3D6E A;  4L9B A;  3I4I A;  3WHT A;  2DTY A;  3N4M A;  2XUM A;  1UXX X;  1PM4 A;  3DPR A;  4IXL A;  3ZYP A;  2QQV A;  2EF6 A;  4DZG A;  3ES1 A;  1YFW A;  1BCX A;  5E88 A;  4QHO A;  5LA2 A;  3VBH C;  1VBC 3;  2HKX A;  3CQO A;  1CX1 A;  2Y0I A;  3WNP A;  3ENR A;  2QQU A;  2X05 A;  1AJO A;  1J59 A;  1GP6 A;  3E5U A;  1PIV 1;  4LPL A;  1BBT 2;  2JDY A;  2DYC A;  4CPB D;  3HQR A;  5FTT C;  4UYB A;  3VHO A;  1UZZ A;  5BPX A;  5A7N A;  4ES9 A;  5JAX A;  1NLS A;  3N9N A;  5KC6 A;  1O4Z A;  4Q8K A;  4A7K A;  1H0B A;  2A1X A;  2HYK A;  4V2W A;  2VH9 A;  4Q0U A;  4YVW C;  1NZC A;  4QPI C;  3NNL A;  2Y34 A;  1OUS A;  3ZOI A;  5IAV A;  2BW8 A;  3OEB A;  2WFF 1;  5IFP A;  2PHW A;  3KM5 A;  1PIV 2;  4IE0 A;  4LKE A;  3ROU A;  5A70 A;  2L9L A;  1D2Q A;  2OT7 A;  2XJU A;  4FVV A;  3C7O A;  3WG2 A;  3VBO C;  3WF0 A;  3NV4 A;  2OS2 A;  3AZZ A;  3PME A;  3WLU A;  2G9Z A;  2PYT A;  4CVU A;  3ACG A;  5FQ0 A;  4QXH A;  2P6H A;  5FYT A;  1BBT 3;  2E7Q A;  3FC0 A;  4NAO A;  4UFL A;  2ILM A;  1W6M A;  3HOB A;  4D3W A;  4A42 A;  3FJS A;  4K6B A;  3RPQ A;  2XML A;  1ULO A;  4GKX A;  4LE4 A;  2RVA A;  1MZE A;  4CCJ A;  5KHG A;  1W6O B;  2VMI A;  3RYP A;  3INA A;  2VJX A;  5HV0 A;  4RL7 A;  3S6P A;  2E26 A;  3AMH A;  3PVN A;  3I3B A;  4YLZ A;  1QDO A;  4AFA A;  2OII A;  3RJ2 X;  1QJY 3;  3KD4 A;  2OPW A;  4CDU A;  4IGP A;  4I0B A;  4XBQ A;  4DOU A;  2JIG A;  3O5S A;  4S2D A;  5IVC A;  2JJ6 A;  4MZU A;  5I0S A;  1ZYB A;  4OHX A;  4JGZ A;  1DQ1 A;  5IAT A;  3HIF A;  3ZXG A;  2A6V A;  1XXN A;  1QQP 3;  4N53 A;  1H30 A;  3AB0 A;  1W8Z A;  2VQU A;  5K0U B;  3FX3 A;  4S2F A;  4QPI A;  1G9C A;  4D6S A;  4UI9 L;  1PNF A;  3JB4 C;  2VOK A;  2VZU A;  4AED A;  1AR8 1;  3EQE A;  2FMY A;  2GSY A;  1ZM1 A;  1N3O A;  2VQT A;  4XUQ A;  4ZHN A;  3WEZ A;  3MO4 A;  1F2N A;  4CA9 A;  1GZW A;  1V6O A;  4KG0 A;  4BB3 A;  4BQ1 A;  4NVP A;  4EE2 A;  1RMU 1;  2FDG A;  2VTX A;  3H7Y A;  3N7L A;  2HWE 1;  3HBK A;  5B4X A;  2WNU C;  3T08 A;  1QNY A;  2BUK A;  3NVC A;  2ZTN A;  1NUK A;  2HLE A;  2JG9 B;  2TUN A;  3F2Z A;  1LU1 A;  5A1A A;  2Q5T A;  4HVO A;  3KT4 A;  3AP7 A;  1RUG 3;  3OPZ A;  1W9F A;  4FP3 A;  3W5N A;  1SPP B;  4AK3 A;  2ZAA A;  3AVR A;  5CIS A;  4RR3 A;  4BLI A;  2BNM A;  2A7A A;  2N7G A;  4YGD A;  1LOB A;  1JOP A;  1RUG 1;  3TBD A;  3J7M A;  1X8M A;  4RS5 B;  5FRE A;  4Q4Y 2;  2Q4S A;  4SLI A;  4RQP A;  2GNM A;  5CEH A;  1UPS A;  4DNY A;  5FZO A;  3QBQ A;  2WO2 A;  4FXK B;  4MGI E;  3JBG 2;  4PDW C;  2PTM A;  3ZFF C;  4NOT A;  1X8E A;  3FE5 A;  5A3U A;  5ABJ B;  2BWC A;  3PIJ A;  5AVA A;  4HKW A;  3AKT A;  4H3W A;  2D6M A;  2A6X A;  4JVA A;  1JOJ A;  2D6L X;  5FZA A;  1RUG 2;  2D97 A;  2KD7 A;  3LB9 A;  3WCR A;  4B1L A;  4LUM A;  3OTF A;  1GFF 2;  2PHL A;  3BYW A;  1WKY A;  5G05 L;  4Y1Z A;  2ZPX A;  4L92 A;  3USU A;  3H7J A;  3GM8 A;  3QH6 A;  1YLL A;  2AGS A;  2E31 A;  4ZPI A;  5LAS A;  2JKB A;  4RFR B;  1UX7 A;  4P9J A;  5AC9 3;  1LHW A;  2B39 A;  1FOD 1;  3HNY M;  3I3D A;  4AHY A;  4CDU C;  2YFZ A;  2P3K A;  3HR9 A;  3R4S A;  1VPH A;  2JIC A;  1GZ9 A;  3JCI A;  4JKM A;  4Q0Q A;  4QPY A;  4IV1 A;  5JUV A;  2PLV 1;  1SQ4 A;  5FLI A;  2O0O A;  1QJY 1;  1Z7S 2;  2VD7 A;  3VKO A;  4HG6 B;  4NIA A;  4CDQ A;  1RVF 1;  2X5I C;  4LEJ A;  2Z79 A;  2EA7 A;  2EXJ A;  5DDJ 2;  5E8A A;  3BIE A;  2WO1 A;  4ATE A;  1XU1 A;  3LDR A;  4FFF A;  3L2H A;  3ZSE A;  3CJI B;  4BA6 A;  1PGW 2;  3MIH A;  1HN1 A;  4YW5 A;  3B94 A;  4CYD A;  3NJZ A;  1NE4 A;  4X6Q B;  1AXY A;  2VZQ A;  3RZK A;  3S30 A;  4WBB A;  3OPW A;  4FPY A;  4QDS A;  1K5M C;  5A7P A;  3D0J A;  2X8K A;  1NX9 A;  4D94 A;  2EIB A;  1S2B A;  1PGL 1;  1UO9 A;  2VM9 A;  2Y6H A;  4OI2 A;  5IVY A;  4LA3 A;  3AK0 A;  3OEA A;  1W2U A;  1ND2 B;  3ZYF A;  4UF0 B;  3SEE A;  1Z7S 3;  2JEM A;  3N7M A;  3MV1 1;  3LIH A;  1X50 A;  1W9T A;  1OA3 A;  2E33 A;  5FY8 A;  3AZY A;  4OI1 A;  1DDL A;  1DQ6 A;  3ZLI A;  2HBT A;  4XJA A;  4I09 A;  4KWL A;  4YM2 A;  1OOP B;  1VBD 3;  3CZJ A;  5FZ1 A;  4XAC A;  1U0A A;  1D7P M;  1GV9 A;  1LNS A;  5CG8 A;  3WDX A;  1RUF 2;  1W9W A;  2CSG A;  3POY A;  3J8F 1;  2WR9 A;  3GGL A;  4ZXK A;  1MZ5 A;  2RS5 1;  5C3P A;  1UYY A;  1F8V A;  3B9C A;  5C4W A;  3LAG A;  2JE8 A;  4QT6 A;  3ZKU A;  3DCQ A;  3NAP C;  5JXI A;  2HBU A;  4Y5T A;  2Q1Z B;  1L7Q A;  1Q8O A;  2YB7 A;  2PHU A;  5L7O C;  1OT5 A;  3PVO A;  4RQP C;  4E8D A;  1EPZ A;  4H7L A;  3A23 A;  1K5M A;  2YC2 A;  2D93 A;  3I2J A;  1ZNP A;  3R05 A;  4LKF A;  5F5A A;  5LK5 A;  4AYU A;  2XGX A;  2LTN A;  1EV1 1;  1PX3 A;  1YQ8 A;  2A70 A;  1IKQ A;  2ZX0 A;  1PO2 1;  2ZGO A;  3APB A;  5FJK A;  4RHV 1;  2PAM A;  5D21 A;  2Z2S B;  3BB6 A;  1AL2 2;  5FXZ A;  5LBB A;  4FPJ A;  4EN8 B;  5FFO C;  1RHI 1;  4XF3 A;  1ASJ 3;  1LHV A;  2AYH A;  1S2E A;  3H0O A;  2VOV A;  2ZGK A;  4L8Q A;  5J7M A;  3SCH A;  3F95 A;  4AI1 A;  1AYM 1;  4LO6 B;  2YBP A;  1LOF C;  2JG9 C;  2WAA A;  1GQG A;  1FV3 A;  1U5X A;  1UYX A;  2W68 A;  1V6M A;  4TYS A;  5J1X A;  1YC6 1;  5CFC A;  4J1W A;  1CQ9 A;  1PVC 1;  1GOH A;  2HEY F;  3AZW A;  3KMH A;  5JXJ A;  3U0Z A;  4B1M A;  2P3Y A;  1BJQ A;  5C9A A;  3QCW A;  1WBF A;  5EQU A;  3VDD C;  2ZAH A;  2C4X A;  3O7O A;  5T5L A;  3WIN E;  2Y6K A;  2ZEZ A;  3SC7 X;  4Q4V 3;  4DY5 A;  4XF1 A;  5CVR A;  4F83 A;  4G4F A;  3RNS A;  4E4D X;  5EP9 A;  2BER A;  1SG3 A;  4K3U A;  1MQT B;  1Q8S A;  2DBI A;  2CTV A;  1MAC A;  1UZ0 A;  1Y7B A;  3GZU C;  4N43 C;  2PHF A;  5F5Q A;  3C7E A;  2QQW A;  4CP9 B;  3D5O A;  4QPG B;  3ZFG A;  5B2G B;  4OUS A;  4MXV A;  3VD7 A;  2RMU 2;  2R06 2;  1WCQ A;  3WCS A;  1TZO A;  3SLI A;  1W2T A;  3LPF A;  3AYA A;  3ILR A;  4XUP A;  3WW4 A;  2YU2 A;  4ARX A;  1S55 A;  2MNG A;  4YSF A;  1NQD A;  1MVQ A;  1PHM A;  3FBY A;  1PM7 A;  3FHI B;  3ILN A;  4FTE A;  2IFR A;  2J7M A;  3TN9 1;  2ZGS A;  4DXT A;  2XQR A;  4YGC A;  2A73 B;  2R16 A;  4Q4Y 3;  3RJR A;  1TEI A;  2YZ4 A;  4CDW B;  2LS6 A;  1Q56 A;  1NCQ C;  2BOI A;  4XET A;  4YG0 A;  5F2W A;  1XJA A;  5JCT A;  1WMX A;  3O1V A;  2R07 3;  2OKX A;  3LA7 A;  5AC9 1;  2NMO A;  3III A;  2GNT A;  3O1O A;  5FYZ A;  4Y3O A;  2VMC A;  2QJV A;  1W28 A;  1UYP A;  2VVD A;  3DL3 A;  2Q8D A;  5LY1 A;  1VP6 A;  5A33 B;  3WVJ A;  3FFQ A;  4G3Y C;  2HWE 3;  2W0X A;  4N7U A;  4S2G A;  4YG6 A;  2AEY A;  2HWC 3;  2UWA A;  4LLO A;  3D82 A;  4AQ6 A;  4FPE A;  4CUA A;  3PTR B;  1YUD A;  3UV9 A;  5FYM A;  1A6C A;  2WFF 2;  4AAX A;  5ISL A;  5KHI A;  2EID A;  3HWJ A;  3ZXJ A;  1JZ6 A;  4FOQ A;  3O1P A;  2VTX J;  4Q4W 3;  3RSJ A;  3OGV A;  1GUI A;  1ND2 C;  2DFB A;  2ZBJ A;  1YIP A;  4GWM A;  4HMZ A;  1QQP 1;  2UU8 A;  3RZM A;  1H9W A;  1VBB 1;  4RYD A;  4WVW A;  5G04 L;  5F9T A;  4AI0 A;  5TSW A;  5DAP A;  2AAC A;  2JDH A;  2WNV A;  3GZE A;  5FKB A;  4A44 A;  3ECQ A;  3ZXL A;  3N9P A;  5KWR A;  4A7Y A;  1UMH A;  4BXS V;  1ZBA 2;  5JOZ A;  3LIG A;  1W0P A;  1NZI A;  4M4R A;  5FP3 A;  3VZL A;  1RUJ 1;  2E53 A;  4LHS A;  3T4H B;  4BWO A;  2VW1 A;  3WHU A;  2WN2 A;  1POV 1;  3Q8F A;  5DZG A;  4TSV A;  3E6C C;  4OMD A;  5A3M A;  1M06 G;  1NQJ A;  2EAL A;  5BNQ A;  1ENQ A;  1EAH 2;  5FMB A;  2XPJ A;  2ZGR A;  3AYE A;  2R0F A;  4AHZ A;  4BIS A;  3NV1 A;  2XVK A;  3POI A;  4PF1 A;  1NYW A;  2C6S A;  2YPD A;  3V0B A;  1C5H A;  5F2S A;  1NAE A;  4PLO A;  1LOG A;  1VBD 2;  2HYX A;  3VBO A;  2OZ6 A;  2RDS A;  1OUR A;  1AR6 1;  1RED A;  1B35 A;  1TME 3;  2F4L A;  5FRA A;  5FZ8 A;  5GLU A;  2ET1 A;  2WT1 A;  4Q8L A;  5C8C C;  4Z07 A;  2ZHL A;  4BH9 A;  5JWP A;  2FDI A;  3C7H A;  4XIK A;  2OQ7 A;  4CU7 A;  2IXH A;  3WDU A;  2JX9 A;  3N36 A;  4YPJ A;  3AP5 A;  3OY8 B;  5LBE A;  3KB5 A;  2P6C A;  1UIJ A;  1G9A A;  1K45 A;  1RUE 3;  4E4S A;  3LOB A;  2K9Z A;  5BNN C;  4GQ7 A;  3AL5 A;  1D4M 2;  3MW2 A;  5GZE A;  4OVE A;  3THD A;  1SFY A;  2ZJC A;  4AVS A;  2ZHM A;  2Q8O A;  1FNZ A;  3L9J T;  2H6C A;  4FPG A;  2WLQ A;  2EIG A;  3E5Q A;  1R09 3;  1W3X A;  3AFG A;  3CL1 A;  2XXZ A;  4OMC A;  1V6J A;  3CHX A;  1EV1 3;  2O8Q A;  2W52 A;  4UWD A;  3I59 B;  4EWA A;  4Z2A A;  2DCK A;  3B3Q E;  3N35 A;  3POB A;  3D8C A;  4BOW A;  1XSQ A;  2OQ6 A;  3NNG A;  5L36 A;  3U14 A;  3ETQ A;  3OGR A;  2FCT A;  4XEZ A;  3NNM A;  4XUN A;  5LAT A;  5JVV A;  5C71 A;  5DUW A;  2OPK A;  1H1A A;  1GAN A;  4JTO A;  4XTP A;  2WZE A;  4I0W B;  1ENX A;  3O1U A;  4Z82 A;  4CDQ B;  1W8W A;  1UOB A;  1MR5 A;  5LA1 A;  3HN1 A;  4Q5O A;  4QKF A;  1XSR A;  3GAL A;  5FY1 A;  3V0A A;  2JB8 A;  5JPM B;  3J8F 3;  3THC A;  5H9R A;  4I01 A;  2R49 A;  4FXG B;  5ANQ A;  1CAX A;  3U1X A;  2XBO 2;  3JQW A;  2GN3 A;  3HPN A;  4AVA A;  3GCX A;  5DAB A;  4Z92 B;  3VDD B;  1I5P A;  1CVN A;  2VL4 A;  5HCF A;  1ZBA 3;  1AYN 2;  2A75 A;  2D6P A;  2VGD A;  3OUJ A;  4Q4Y 1;  3ZPY A;  3N7J A;  1H8T B;  2W1S A;  4P9I A;  1QJF A;  4XUT A;  2VNG A;  3VD5 A;  2Q0A A;  1F31 A;  1RXF A;  2XKP A;  3LGR A;  5L9B A;  3U37 A;  1I5Z A;  3BOW A;  2RDN A;  4D7S A;  1AVB A;  1AR7 1;  1QY4 A;  3K4D A;  3NKT A;  3VKF C;  1UX6 A;  3J8F 2;  3WQ0 A;  3DF0 A;  4ZY9 A;  2CYF A;  3WNL A;  1ZRD A;  1BEV 3;  2MPF A;  5EXO A;  3HMY A;  3M3Q A;  1O91 A;  1JU3 A;  2XLF A;  1ZX5 A;  2ZGU A;  1Y4W A;  3W9A A;  4E27 A;  5HV4 A;  1LCL A;  1W8H A;  2BVV A;  5GLW A;  2ZZQ A;  5JSO A;  4MGS A;  1AR9 2;  4JAA A;  4Z8B A;  3CJI C;  1RJ8 A;  2VBD A;  4MGQ A;  3URF A;  1W6N B;  3ZFE A;  3U75 A;  5IFT A;  4MGZ E;  2XJT A;  3NWK A;  2YHJ A;  1PVC 3;  1JZ8 A;  2WSV A;  1L7R A;  2XH6 A;  3CJI A;  4YW6 A;  2X29 A;  3K48 A;  1RUE 2;  2BVB A;  1IKP A;  3KCC A;  5CNA A;  5EYX A;  1EUU A;  2V72 A;  3OYW A;  4QM9 A;  4CCC A;  4X6R B;  2VVE A;  4RHV 2;  5JSP A;  4SBV A;  5DDJ 1;  5A6X A;  1AYM 3;  4V2V A;  1Y9Q A;  1JHN A;  3MFC A;  2C9A A;  4UFI A;  3KS7 A;  4AF9 A;  5F7U A;  1C1L A;  3WDW A;  1POQ A;  2X53 S;  2BGC A;  3MIE A;  2ARB A;  3TRS B;  1KD7 A;  2BPA 2;  3USS A;  5EHD A;  4XFG A;  3RWK X;  1NA1 B;  2ARC A;  4LO8 A;  5T5J A;  4H55 A;  3IDC B;  1BQP A;  2CAV A;  3J7N A;  4C0H A;  2Q1M A;  1PGL 2;  4XFC A;  2G4I A;  4K40 A;  5FY5 A;  2BYV E;  3WW1 A;  2GH2 A;  2VVF A;  3FL7 A;  1DP0 A;  1W90 A;  4IER A;  3ZN5 A;  1ZZ7 A;  4D6R A;  3BIW E;  1HKD A;  1C8M 2;  4KWJ A;  4Q27 A;  2G19 A;  1SDD B;  5FZ6 A;  3RQ0 A;  3VDA A;  5I0D A;  2XR4 A;  4XAB A;  2RR1 3;  5LCW L;  3LEK A;  4ERO A;  3U11 A;  2B45 X;  4LBQ B;  1OHF A;  2P17 A;  2FCV A;  3SH5 A;  1VMF A;  4MVT A;  2YDE A;  4AVC A;  4Y1X A;  3FN9 A;  3ZSM A;  3PIG A;  4LMF A;  3WG4 A;  3WDV A;  2VMH A;  3EO6 A;  1EUT A;  1TVG A;  1AYM 2;  1QF3 A;  4UW5 A;  3MGU A;  5C9A B;  2NQY A;  1HRI 3;  1GZC A;  2UWB A;  4XPV A;  4CCE A;  3WP5 A;  4URT A;  1WD4 A;  1HB3 A;  5LA0 A;  5FZH A;  2EXK A;  2XVG A;  4QGM A;  4CEW C;  4AZZ A;  4LT5 A;  3ZSJ A;  2J1R A;  3H1M A;  1HB2 A;  3KGL A;  4QX2 A;  3Q8A A;  1K42 A;  4LTA A;  5KXD A;  4XHX A;  5FO7 B;  4CDU B;  1HXS 1;  4QPG C;  5AC9 2;  3BPS A;  4IDZ A;  4HOO A;  1V9U 2;  4FPC A;  5BNP C;  4M00 A;  4QMA A;  4XFF A;  1E5R A;  2FDJ A;  5F6L B;  1DZR A;  5FP8 A;  2BU9 A;  1S0E A;  2GMP A;  2XLA A;  4FPK A;  2FBE A;  2R06 1;  3ZYJ B;  2VZO A;  3LQC A;  2VE1 A;  4FO9 A;  1LUL A;  1AR7 3;  1LGB A;  4MSV A;  2WZR 2;  3PLQ A;  5JXH A;  2VUJ A;  1V9U 1;  3KGZ A;  3H8R A;  2IVJ A;  1JYV A;  1H8T A;  2RDQ A;  2ID4 A;  3I2G A;  1OLM E;  1HB1 A;  1LOC A;  4EWE A;  4QX8 A;  5JLV A;  3KV9 A;  3DYO A;  4Y22 B;  3E1F 1;  2VMF A;  3T30 A;  2XWJ B;  1S2K A;  1IQA A;  1WA4 A;  1O4T A;  4PDW A;  5FZ7 A;  4AI3 A;  3AXD A;  2D3R A;  3PJY A;  4PQ9 A;  2H0V A;  1OMI A;  3SKV A;  3UKT A;  1HQW A;  5IVB A;  5K7P A;  4K8R B;  2CDP A;  3I54 A;  3M3O A;  2QNK A;  4KBZ A;  1FMD 3;  2UY8 A;  4EV0 A;  1APN A;  2A6W A;  1VRH 3;  2B46 X;  1F9K A;  1VMH A;  1YO8 A;  3AM2 A;  4XHB A;  5H9P A;  4NHM A;  2QUO A;  4KG8 A;  4D7Y A;  5A6Y A;  4K7J A;  2B5H A;  4P9G A;  3Q8B A;  3PTY A;  5CB7 A;  2MEV 2;  2Y38 A;  4ARY A;  2WNU B;  1WMF A;  1WLT A;  1ULF A;  2C0Z A;  4Y4Y A;  5F5I A;  3TN9 2;  3GCW A;  4IEU A;  1KFU L;  1RUJ 3;  3A22 A;  4RN5 A;  3OUI A;  5JZG A;  2O14 A;  4NJ4 A;  5FZK A;  1OVS A;  2ZXQ A;  5T5P A;  2WZ8 A;  2ZKL A;  3ZYR A;  2CHH A;  4NIH A;  3DUI A;  4IE4 A;  2D3P A;  2RS3 3;  2ZAB A;  1K5J A;  1N3Q A;  2VOT A;  1SLC A;  5JIU A;  4OZX A;  4ET7 A;  3FWE A;  5FZ9 A;  2D5F A;  2WC2 A;  2QBX A;  2WFP A;  5KC5 A;  5A3W A;  2W46 A;  3NNF A;  3KZ4 C;  1W8O A;  5CFD B;  1RJ7 A;  1GP4 A;  3C7G A;  2B4K A;  1OI6 A;  4L0P A;  4XZU G;  3ZDV A;  1UKG A;  2FCU A;  3IN9 A;  2P3J A;  3UGG A;  4BIF A;  4I3G A;  3D0S A;  4QQP A;  4YZ5 A;  3ZM8 A;  4Q1P A;  2FDK A;  1UF2 C;  4ONU A;  4CDX B;  2QQM A;  2YU1 A;  5DUX A;  3ZFG C;  2PLV 3;  1AR8 2;  4LLF A;  3WW2 A;  4HSJ A;  1G86 A;  3EYP A;  1GOG A;  1SBD A;  2GNB A;  1VAL A;  1MVE A;  1RB8 G;  1TG7 A;  4IGQ A;  3C8X A;  4GH4 B;  4NHK A;  1V6I A;  2IC1 A;  2K2S A;  2RS3 2;  1YEW A;  5A1F A;  2QQL A;  4F7Z A;  4EQV A;  2NMN A;  4LO4 B;  4A3X A;  4WVZ A;  4NWV A;  4Q4X 2;  2JDA A;  3GYD A;  1FAY A;  1IPK A;  1NXD 1;  1W06 A;  1MS9 A;  1REF A;  2GDF A;  1QOT A;  2GC1 A;  3O0X A;  4M3C A;  3VBS A;  1AL0 G;  4IV3 B;  4XE9 A;  3ZFF A;  1HJF A;  1O7F A;  2DUP A;  2XUE A;  3B7M A;  3T2Q A;  3S57 A;  2WQ8 A;  4J6G A;  3VBO B;  1DGR A;  2E7A A;  5FZO B;  1OFN A;  2R07 1;  2HWC 1;  4IES A;  3RYK A;  2J1A A;  3NW4 A;  3UGF A;  2RS1 2;  3TN9 3;  4YZ2 A;  1PK6 B;  5FUI A;  5BNP A;  4QPW A;  4DQA A;  1D4M 1;  3OGS A;  1IZ3 A;  4AG4 A;  1HW5 A;  1PO1 2;  5LW9 A;  1HRV 2;  4A7Z A;  2R04 3;  4EYU A;  4BQW A;  2DUR A;  2VUL A;  4CEW A;  4DUW A;  1YNA A;  2VCC A;  4FPH A;  1J58 A;  2QCS B;  5EJ3 A;  2IXJ A;  2RR1 1;  1CJP A;  4PT6 A;  4XJ8 A;  4YVW A;  2VZ3 A;  1C28 A;  4LOR A;  2XKO A;  1XE0 A;  5LY2 A;  3AP4 A;  3KWV A;  1PMH X;  3PVB B;  3PU3 A;  3BOD A;  1B09 A;  2JEC A;  2ORZ A;  3DYM A;  4FOY A;  4XTM A;  1X33 A;  2HEV F;  3IPV A;  4FFI A;  3WP6 A;  5F3C A;  3PU8 A;  4OLL A;  1TMF 3;  1WBL A;  3KT1 A;  1XNT A;  1QJU 1;  2JD4 A;  1UXZ A;  3AXE A;  3LPG A;  5T3N A;  4C90 A;  1R1Z A;  4B29 A;  4CRQ A;  3GJB A;  1H9P A;  3M3C A;  1PZ9 A;  4NID A;  3V64 A;  1UOF A;  3T09 A;  1K5M B;  3WNO A;  3OSD A;  2BTV C;  1LED A;  2W1U A;  1QMJ A;  4ISR A;  4CDX C;  1SCR A;  1J1L A;  1BVP 1;  1H2N A;  2JG8 B;  1GWL A;  2ZX2 A;  3ME2 A;  3R4D B;  3SKJ E;  2Y6J A;  4C1W A;  4LBL A;  1QKQ A;  3IBM A;  3LDB A;  4DXZ A;  2VTF A;  2BNN A;  4PJY A;  1UZV A;  2YFU A;  2DVD A;  1UOG A;  1CAX B;  2Q8C A;  4OHY A;  5AFE A;  2WT2 A;  3POE A;  1UU4 A;  3I8T A;  3O1S A;  2P37 A;  5F1R A;  5ACA 3;  3FUO A;  1S0D A;  3ZMO A;  3WUD A;  3FLP A;  2EAA A;  3DEC A;  3ZN4 A;  1NT0 A;  1YFX A;  3I2F A;  2JIJ A;  5GLT A;  4ORF A;  2PEL A;  4OCT A;  5FLH A;  1JZ5 A;  5FWJ A;  5C5T A;  1VB2 A;  4I3P A;  3RI9 A;  5JDB A;  2WSU A;  3Q8E A;  4IEW A;  2AH2 A;  1F15 A;  4MX3 A;  5EWS A;  3JD7 3;  5EIY B;  4GWN A;  1H8T C;  4RFT 0;  3T2P A;  1PO2 3;  3RFR A;  4BJ0 A;  1RUI 2;  2RJK A;  1V6L A;  2OUJ A;  1RVF 2;  3Q9O A;  1MS8 A;  4Q29 A;  4HFS A;  2JG8 C;  4FQ4 A;  4OHV A;  4BLJ A;  5FKC A;  3SEP A;  4FI9 A;  1AF9 A;  3HJR A;  5L19 A;  1OQE A;  1OVP A;  4UOJ A;  4CCN A;  1GZT A;  4YW4 A;  1PK6 A;  2IZW A;  2ADE A;  3H42 B;  4QGL A;  1C8M 1;  2HWD 1;  3SIT A;  4B7K A;  5JIA A;  4ES8 A;  4AGV A;  4MG2 A;  1O3Q A;  2XOM A;  2QDR A;  5FWE A;  2E51 A;  3OBZ A;  2LAL A;  3MV0 1;  1R1A 2;  3K2O A;  4HL0 A;  3JZV A;  1CWP A;  4XCB A;  3H8X A;  3MZH A;  1RXG A;  4IEV A;  5FP9 A;  3AP6 A;  5FZ4 A;  4P14 A;  1RYY A;  1H4G A;  4BHP A;  3T4V A;  1RHI 3;  2GP5 A;  2Y60 A;  3UJQ A;  4XDP A;  2IXC A;  2YBK A;  5T50 A;  3OBT A;  1OF4 A;  1IGO A;  2W91 A;  4JGY C;  4AXO A;  1NLQ A;  2HWB 1;  4XIL A;  3JD7 1;  1XPW A;  4QX0 A;  4WM7 A;  3IKW A;  1ZRE A;  4C1X A;  2QQO A;  1H6Y A;  5FO9 B;  2XJR A;  4N9H A;  1XND A;  2ZMN A;  1VBA 3;  3MID A;  2CNA A;  1HLC A;  3MUY 1;  3RZH A;  2E9Q A;  3RDI A;  1O5L A;  3HNM A;  3T2T A;  1VRH 1;  4OI0 A;  1SPP A;  3P1I A;  1MEC 2;  3ZMN A;  1JYC A;  1VMJ A;  4MXW A;  1UY0 A;  4IUG A;  4P5H A;  2HWB 2;  3C2U A;  4DRV A;  1IG0 A;  1GWM A;  3TEY A;  2ORX A;  3VBH B;  3VGI A;  3VHR A;  1I1E A;  1XYP A;  3DYP A;  2R06 3;  4UT5 A;  4XJU A;  3ZXE A;  1JUH A;  3MLL A;  1VJ2 A;  4Y5S A;  1CON A;  1R1A 3;  1S0F A;  2BFU L;  2KM2 A;  5FMO L;  3VLB B;  4Q4X 3;  1OPM A;  4X8P A;  4BQ4 A;  2VW0 A;  5A3T A;  1AX0 A;  1HIX A;  1PX4 A;  3VHN A;  3R0R A;  1BK1 A;  3VL9 A;  2P2K A;  1HXS 3;  5BNN A;  1RHI 2;  3AP9 A;  4JDO A;  1QXR A;  5D1I A;  3CO2 A;  5IK8 A;  3A21 A;  1C1F A;  1J3Q A;  2ZHK A;  1GMM A;  4N53 C;  4N9I A;  4YZ3 A;  4AVV A;  1LEM A;  4LUL A;  4F8A A;  2RJL A;  1WUV A;  1KIT A;  3POF A;  3G7D A;  2Y6L A;  3ACL A;  3EBR A;  5GAL A;  3ZSL A;  1W8T A;  4LQR A;  4GAL A;  5FZG A;  4UBG A;  3V0B B;  2WNO A;  3LOI A;  1OXC A;  5EFU A;  3SXW A;  3WG1 A;  4BQX A;  3CIH A;  2PN5 A;  4A2U A;  2ZGQ A;  1AL2 3;  1GWK A;  3MPB A;  1G9B A;  3SQO A;  4QKB A;  3I2I A;  1QJE A;  1POV 0;  2V4V A;  4CU6 A;  4GB3 2;  5A32 B;  4TZD A;  4U2A A;  4COY A;  4XFH A;  4MHR A;  2C26 A;  4AED C;  3LE0 A;  1BEV 2;  3JU9 A;  2W5F A;  1F5J A;  4QWN A;  3WNX A;  1EPW A;  2RE9 A;  5EYY A;  2OUH A;  5FYH A;  1CPN A;  1DLC A;  3PL0 A;  2X09 A;  3GHM A;  3LA2 A;  1RMU 3;  4XZP A;  5BXX A;  4IEX A;  4BK4 A;  2B8M A;  1RGS A;  1HX6 A;  3GBW A;  3VBS C;  2GC2 A;  2Y64 A;  3I7D A;  5KXC A;  4NIG A;  4OUM A;  4R8H A;  4LBN A;  4P5Y A;  5C4W C;  4EN7 B;  2WNU A;  3AVS A;  5FBJ A;  5F6K A;  4O61 A;  4NO4 A;  5FK7 A;  3WOG A;  1H1I A;  2QVS B;  3POG A;  4PDW B;  1GSL A;  4FFG A;  4DO0 A;  4YFZ A;  4PI2 A;  1N1S A;  4CCO A;  5C70 A;  1W0N A;  4HSL A;  3EMR A;  1SLL A;  2P4E A;  3MBW A;  4Q4W 1;  4FTS A;  4O65 A;  4MET A;  3HQX A;  1UY3 A;  4QHZ A;  5DAQ A;  3S0M A;  1LTE A;  2BQP A;  1FPN 3;  2JDM A;  5FLJ A;  3RZZ A;  3JQX A;  4TLF A;  5J96 B;  5IT6 A;  1AX1 A;  4XMI A;  4XXA A;  4ATF A;  5A6Z A;  3WUC A;  2IXI A;  1KFX L;  1OA2 A;  1DZQ A;  4GMP 1;  3KHB A;  4Q4X 1;  2B9U A;  4BE3 A;  3WP4 A;  5JZG B;  2I07 B;  4CTE A;  3BI3 A;  3MPP G;  2DTW A;  1KS5 A;  4XCA A;  5C8C A;  3AFK A;  1KDM A;  4K21 A;  5DAW A;  1R08 2;  1FXZ A;  3NRU A;  1EAH 1;  3RGB A;  2YC0 A;  1KQR A;  4LKS A;  1S1A A;  2KA3 A;  1O59 A;  2R07 2;  4M3C E;  4NRP A;  5I8S A;  2JE9 A;  3WQ7 A;  1QU0 A;  1U5I A;  4TLG A;  1DYK A;  3K4A A;  4MH0 E;  4B7E A;  1CZS A;  4P9L A;  1AR6 2;  2RM2 2;  4R9B A;  4XUR A;  4CEY C;  1VBA 1;  4E4H A;  4YAR A;  4Q0P A;  4R4X A;  4XDO A;  1ODM A;  2Y8K A;  2ATF A;  4PIY A;  4AEK A;  1TQ5 A;  3OYW B;  1PZ8 A;  5FAX A;  1G6N A;  4M3C B;  1XNB A;  3NAP A;  5IVJ A;  3WZ1 A;  5A80 A;  5GZF A;  2UYA A;  1ZBA 1;  3POW A;  2D98 A;  4AEJ A;  1UZY A;  2DVG A;  2YRO A;  2Z4F A;  2BZD A;  2Q1F A;  3ZXD A;  4L11 A;  4Q26 A;  4WM8 C;  2F17 A;  1PZ7 A;  3RZL A;  4JZR A;  3ELN A;  2B42 B;  1IPJ A;  2DWR A;  1BVV A;  3BOP A;  3KCX A;  3LEM A;  3POJ A;  3SHR A;  4AVT A;  2A5Z A;  3E6B A;  2EAK A;  5IK5 A;  1PIV 3;  2XB6 C;  4BMB A;  1DBN A;  5D8A C;  1IPS A;  3N7K A;  4XQD A;  3T3Y A;  2GN7 A;  1T2X A;  2VZP A;  4JHT A;  5DZF A;  4D69 A;  2PHR A;  1VBD 1;  3LFI A;  3FMG A;  2XVL A;  1ULG A;  1YFY A;  2ZA9 A;  4GH4 A;  1MS5 A;  3VV1 A;  3IPV B;  2XJV A;  1I9R A;  3WQ1 A;  4KMQ A;  1QEX A;  4PBP A;  4FOV A;  5EZW A;  3VD9 A;  1ASJ 1;  1HRV 1;  4LO7 A;  3DPR B;  1QHD A;  1S0I A;  1M4W A;  2A3X A;  4CU9 A;  5IVV A;  1S0G A;  4YWA A;  4AWD A;  5JR2 A;  4XC9 A;  1JZ2 A;  1L3J A;  4Y33 A;  4YG3 A;  1HQN A;  1IOA A;  1GNH A;  2E7T A;  2GMM A;  5CKQ A;  1C3H A;  1XYO A;  4KWK A;  1ST8 A;  2SLI A;  4NWW A;  1LHU A;  4RHV 3;  3SCG A;  1AXK A;  1UQX A;  3ILF A;  5JXG A;  2WYS A;  5BNP B;  2WFF 3;  3I2H A;  3KV4 A;  3MIG A;  3N9M A;  2BDR A;  3FFZ A;  4LBQ D;  4PLN A;  1YRZ A;  1QJU 2;  1CJD A;  1PGW 1;  2XL9 A;  5FXX A;  5JI7 A;  1BLZ A;  3ZR6 A;  2J1T A;  2ZZJ A;  1O8S A;  1WW5 A;  3IB3 A;  5DUV A;  5FPZ A;  4B4Q A;  1DZT A;  3T0B A;  1WMD A;  3N9Q A;  5KBF A;  2RS5 3;  3MF9 A;  5SV5 A;  2Z69 A;  4BYY A;  5FOB B;  4R9D A;  5F3G A;  1PO1 1;  1R09 1;  3MYX A;  1OLR A;  1ULP A;  1GQH A;  2DVF A;  4W65 A;  4DEV A;  3H3Z A;  1QIQ A;  4IV1 C;  1CAU B;  4IGO A;  3UNP A;  3S7I A;  4N8M A;  4J1X A;  1DG6 A;  4GZ9 A;  3J4U H;  4YZ1 A;  2ZEW A;  3H8U A;  4UFK A;  3USU B;  5H9Q A;  2VUC A;  1CR7 A;  1RUC 3;  2QQJ A;  5FY7 A;  1Z7S 1;  2VEC A;  4JGZ C;  5ANN A;  1R09 2;  3AC0 A;  3RRD A;  2VMD A;  1QJU 3;  2W1Q A;  1CZV A;  2WAB A;  3RG0 A;  1SCS A;  4CXY A;  1QXJ A;  4KU8 A;  1W2A X;  2CU5 A;  3UGH A;  2HWF 1;  4M0N A;  4Y22 A;  5CFD C;  4GWI A;  1WGP A;  1I3H A;  5KXB A;  2WWJ A;  4P08 A;  2VUA A;  4PBO A;  5FUP A;  4BIO A;  2D3S A;  5IK7 A;  1BMV 2;  2CDO A;  5I91 A;  1W8F A;  1W6Q B;  1EYB A;  2WIN B;  5IJR A;  1CX4 A;  1KS4 A;  5FPV A;  2G9G A;  3D4K A;  2ERF A;  3H8O A;  1UZW A;  5FYV A;  1ZZC A;  5E16 A;  5FZL A;  4AFD A;  1JZ7 A;  3POS A;  5IWF A;  4NII A;  5CBL A;  4A4A A;  3VZM A;  4UW3 A;  3MI8 A;  3BTX A;  4FAH A;  3O1R A;  5FPA A;  2Q8E A;  1UU6 A;  4ASK A;  1FAT A;  4Y5Z 0;  1XNK A;  4AL9 A;  2UY9 A;  2YUE A;  3H3L A;  4P9X A;  5LK7 B;  1ZA7 A;  4UW6 A;  2JEN A;  1XB9 A;  4XIO A;  3AKQ A;  4CCK A;  5ACA 1;  2A3W A;  1WCU A;  2W87 A;  1QJZ A;  2XWB B;  4WM8 B;  3ZDS A;  4R4Z A;  5FZB A;  1O4Y A;  3AJZ A;  4M0H A;  2C1F A;  4QHB A;  1VAV A;  3GNE A;  2J1U A;  2HH9 A;  3JUU A;  3NV2 A;  2RJ2 A;  4MXW B;  2DVB A;  3WV6 A;  2XLG A;  5F3I A;  4OQ9 A;  5LWB A;  5HPO A;  1S0C A;  4FPF A;  2OA2 A;  1VIW B;  1VAK A;  2GC0 A;  1JYW A;  5D8A A;  1X36 A;  3W58 A;  4RR3 B;  1WW6 A;  1X9P A;  1VR3 A;  4C91 A;  5FPU A;  4QDR A;  2V09 A;  1A3K A;  1EP0 A;  4W8J A;  2WKK A;  5J36 A;  3BVC A;  4DPN A;  3NJY A;  3MEP A;  4RS5 A;  2WWU A;  2ZGM A;  4Y1Y A;  4UBH A;  2BBV A;  1JI6 A;  3HT1 A;  3M4F A;  5FP7 A;  2TNF A;  4PF5 A;  4K1Y A;  4CZS A;  1W8U A;  4Q1R A;  3NNJ A;  1JHJ A;  2AZ5 A;  1AL2 1;  2RMU 1;  3LKJ A;  3ZFE C;  1F5F A;  3NV3 A;  4YNI A;  3QD6 A;  4IEY A;  4QQO A;  1HB4 A;  2ETE A;  3FUQ A;  3VZK A;  2JB4 A;  2DF7 A;  3ZYH A;  4AED B;  1OKO A;  4HXC A;  1ZRI A;  1W6M B;  4LHN A;  1AR8 3;  4XQW A;  4CPB A;  5BNO A;  2CGN A;  2RHP A;  1OPO A;  3FLR A;  5A7S A;  4CCD A;  1MS0 A;  4IET A;  5CFD A;  4GMP 3;  5H9S A;  2VZ1 A;  1X9T A;  4N90 A;  3VD3 A;  3WT3 A;  1T6G C;  3G6J B;  3ZKY A;  1X7N A;  2J1V A;  3JBG 3;  2W9X A;  5FMC A;  2WZR 1;  3N9L A;  2VPV A;  3CLP A;  3RZJ A;  1JBC A;  2W47 A;  4HK9 A;  4XDQ A;  2VNV A;  3MDP A;  1E5H A;  1K3I A;  1HQL A;  1QJX 1;  2BGP A;  1JN2 P;  3WDY A;  1AZD A;  3U10 A;  2GC3 A;  4NPR A;  2J42 A;  3EHK A;  5HCB A;  3BPZ A;  1JUI A;  2PMW B;  3HVD A;  1RUN A;  5A7O A;  2ZS6 B;  1FI2 A;  2WWS A;  3ON7 A;  2A3Y A;  2QZ2 A;  2Y6G A;  2GZW A;  3DKW A;  4K20 A;  2DDU A;  4YVW B;  3O0V A;  5LRS A;  1E57 A;  4UFH A;  5CU1 A;  2YV8 A;  5J98 B;  4QPG A;  3ZFG B;  3VD4 A;  2DCJ A;  1E5I A;  1GIC A;  1KEX A;  1CN1 A;  4LBJ A;  1SBF A;  3ZIX A;  2VQ0 A;  4GB3 1;  1DCS A;  1DFQ A;  1DQ2 A;  1LGC A;  1N1Y A;  1STM A;  2DCT A;  1UMI A;  2KR2 A;  4YRD A;  1IS6 A;  1NCR B;  1VBE 2;  1QGL A;  2LUW A;  2D6K A;  2VBP A;  3AMQ A;  4DB5 A;  3LF7 A;  3SH3 A;  3VDC A;  4YGB A;  3ZYG A;  3CKH A;  1NA1 C;  1DF0 A;  4AHX A;  4Y1V A;  1UY4 A;  1NCR C;  3CMG A;  3P3N A;  5T54 A;  1O5U A;  1QXP A;  4IEP A;  3TNQ A;  2PQQ A;  4NPM A;  5KXE A;  1VBE 1;  2OXB A;  5C3S A;  5E6H A;  3VKL A;  4BQ3 A;  3KCY A;  2JXA A;  4GH4 C;  1UOJ A;  5IVF A;  1US2 A;  5FPX A;  2DUQ A;  1NY7 1;  3Q8C A;  5CIR A;  1OKQ A;  1HRV 3;  3ASI A;  3K4Z A;  4Q4V 2;  2PHX A;  5DN2 A;  5K0U A;  1SLI A;  4CDW C;  3FLT A;  5LEK A;  3T0A A;  2QQN A;  3IMN A;  4PCR A;  1J84 A;  3MLK A;  3ALQ A;  4COU A;  1P8J A;  3T1L A;  1PMJ X;  5E89 A;  3AMM A;  3K46 A;  4BQ2 A;  3I49 A;  3PMS A;  4HKO A;  1ND3 A;  1QQP 2;  1K12 A;  1VLN A;  2H0B A;  2YXS A;  1BYH A;  4WVV A;  2HJI A;  4NRM A;  1YHF A;  1KJR A;  2WRA A;  2WO7 A;  4HKL A;  2R32 A;  2WDB A;  1RUF 3;  4CUB A;  1KRI A;  5CFC C;  2ES3 A;  3WQB A;  3PVE A;  4XFA A;  1ZZ6 A;  3K77 A;  4HPK A;  4L99 A;  1LB2 A;  3A4U A;  1VBC 1;  1UY2 A;  1GU3 A;  4XMA A;  3TEW A;  1CAW B;  4RSU A;  5FZC A;  1XYN A;  1RUH 3;  4YGE A;  5CKM A;  4MYE A;  3CEW A;  4JGY B;  2W39 A;  4GAZ A;  3WNN A;  1I6X A;  1OSG A;  4OYU A;  3S5Q A;  1V9U 3;  1W9S A;  1WLD A;  4AFB A;  5C8W A;  4NHL A;  3AJY A;  3AX4 A;  5AFB A;  3ZR5 A;  3BN6 A;  3H1W A;  2C5D A;  2RV9 A;  4NRQ A;  4AHW A;  3VBR C;  5BV6 A;  2WNV C;  1ZVF A;  1ZRF A;  3AYD A;  1Y43 B;  1IS3 A;  1W39 A;  5K8S A;  1OLQ A;  4JQR A;  3SCF A;  2EVX A;  4G9S B;  4FBF A;  1W8N A;  3VBU B;  3THT A;  5A7Q A;  4P9Y A;  5J3U A;  1NCQ A;  3AKP A;  1BXH A;  1SFP A;  4LJH A;  3AZX A;  2FHR A;  4QB6 A;  2PXJ A;  5DAV A;  4H7M A;  1DQ5 A;  3B69 A;  1VB4 A;  3I2K A;  3VZO A;  4HET A;  1SBE A;  3JBG 1;  3OBR A;  4XOG A;  4QX3 A;  4QB2 A;  2BJS A;  1US3 A;  1XRU A;  3KV6 A;  2CL2 A;  2Y6F A;  2WO3 A;  1BKZ A;  4IE7 A;  4DUV A;  1UN1 A;  5GJ6 A;  2W1W A;  2HWC 2;  4QXC A;  5K4L A;  4BQY A;  1ZBE 3;  4AR2 A;  3HBZ A;  2W92 A;  3GZA A;  1XOY A;  2WNV B;  1OFS A;  1REE A;  4YM3 A;  1O6U A;  1UMZ A;  3VUO A;  1VRB A;  4DUX A;  2VNR A;  3UJO A;  5BNN B;  4O9G A;  5B4N A;  3X29 B;  3MF6 A;  4NAM A;  1ODN A;  3IDB B;  1JU4 A;  4JDM A;  4LIT A;  4JRA A;  2H6B A;  5DDJ 3;  1DYO A;  4XJW A;  4N7I A;  3FHA A;  5C3Q A;  1H4H A;  1LOE A;  4KL1 A;  3WF2 A;  2FDH A;  5I8Y A;  5IVE A;  1PNG A;  3LD8 A;  1COV 1;  3BTZ A;  1CAV A;  3NJX A;  2WN3 A;  3UL2 A;  3A7Q A;  1UCX A;  2XBO 1;  1GNZ A;  3E97 A;  1AR9 1;  4QXK A;  3ZSK A;  5A1L A;  4RGA A;  1Z0H A;  5KHH A;  4OFG A;  2DBN A;  3P5B A;  3UET A;  1G9F A;  4Y20 A;  4XUO A;  5APA A;  3RMY A;  3ZYI B;  1JZ4 A;  2CGO A;  3PUR A;  1RUD 3;  4WZF A;  2B9V A;  1AYN 1;  4QQ2 A;  5JMO A;  5LEJ A;  1RUI 1;  3W59 A;  1RUH 2;  5L9V A;  3TNP B;  4H2A A;  5GM0 A;  4GD4 A;  4IV1 B;  2BV4 A;  3WF3 A;  5FPL A;  4M4P A;  1V70 A;  5BY5 A;  5JI9 A;  1V6N A;  2ARE A;  3CDZ B;  1OOP A;  1FPN 2;  5KHJ A;  2JDK A;  4OI4 A;  5I0T A;  3AMN A;  4RGK A;  5C4W B;  1A8M A;  2LRP A;  5FJH A;  4XJ9 A;  4E2Q A;  4CP1 A;  2DV9 A;  5F32 A;  1SMV A;  1RUH 1;  1KJL A;  1OQD A;  3C3V A;  1FT9 A;  4ZU4 A;  3RI8 A;  3I3M A;  5FK8 A;  2QQP A;  1A8D A;  1OD5 A;  5BYN A;  2XJP A;  3HEI A;  4Y1U A;  2NZ9 A;  3WF1 A;  1CD3 G;  4LR4 A;  5CAD A;  4WVM B;  1N1T A;  2XJQ A;  4XF0 A;  2VO5 A;  4YZ4 A;  1DQ0 A;  3I3E A;  4UXA A;  2J1E A;  1V00 A;  2SBA A;  3I59 A;  4FP2 A;  5FQ0 B;  4ZKT B;  4AAP A;  1ENS A;  1IS5 A;  2NYY A;  3MFA A;  1C5I A;  1RUE 1;  3SNM A;  4GKY A;  4UF0 A;  4ASL A;  1S4C A;  5A3L A;  3BU0 A;  4QXB A;  4TXW A;  4AFM A;  4DIQ A;  2HWF 3;  3KVA A;  4CCM A;  1A78 A;  3M8L A;  5T55 A;  2JDN A;  2TBV A;  2WT0 A;  3K3N A;  3MIC A;  4E8C A;  3MW4 A;  4B4P A;  1O3R A;  4OHZ A;  2HWB 3;  4Z1V A;  5F5C A;  2AUY A;  3GBF A;  4E2S A;  3HD8 B;  1ZBE 2;  2D7F A;  4KNC A;  3CJX A;  4DFS A;  4DY3 A;  4AGG A;  3I3Q A;  4JGZ B;  3UK9 A;  5JOW A;  4PIX A;  1NCQ B;  2LRO A;  1NLR A;  1R1A 1;  2BWA A;  2UYB A;  1G8W A;  1HDK A;  1W2N A;  1UAI A;  1YI9 A;  3GXU A;  1UNB A;  2BFU S;  2X5I A;  2DU0 A;  1MQT A; 
#chains in the Genus database with same CATH homology
 2Y64 A;  3C7H A;  4CU7 A;  2VCB A;  4P5Y A;  4YPJ A;  3UES A;  2WUH A;  5EJZ B;  1K45 A;  3JXS A;  5C70 A;  4CU8 A;  1W0N A;  3THD A;  3MBW A;  1UY3 A;  3P6B A;  2VCA A;  4OMC A;  5DMY A;  4DEQ A;  4UAP A;  4JX0 A;  4Z2A A;  2DCK A;  3NNG A;  3NRU A;  3OGR A;  4JHZ A;  5C71 A;  4XUN A;  1CIY A;  2C9K A;  4MOA A;  2WZE A;  4LKS A;  1O59 A;  3OB8 A;  5LA1 A;  1GOF A;  3K4A A;  1CZS A;  3THC A;  4XUR A;  3HPN A;  2Y8K A;  3C7F A;  4A3Z A;  1I5P A;  4D0Q A;  2VL4 A;  2WAO A;  2Z4F A;  2BZD A;  4XUT A;  2W1S A;  2BGO A;  3T2O A;  3VD5 A;  5HXM A;  3ABZ A;  2ZEX A;  4QX1 A;  3U37 A;  4P02 B;  3K4D A;  5DPN A;  4ZY9 A;  1T2X A;  2VZP A;  3PUH A;  3WNL A;  3IDA A;  5IYY A;  1JU3 A;  3IAP A;  4ZZ5 A;  1XNA A;  4KMQ A;  4MGS A;  4OUE A;  3K75 B;  5EJ1 B;  4MGQ A;  2EIC A;  3ETP A;  3VD9 A;  3D3A A;  4KI5 M;  5C7G A;  4MAD A;  4CU9 A;  5IFT A;  5JR2 A;  1JZ8 A;  1JYN A;  2JD9 A;  1L7R A;  1H6X A;  1JZ2 A;  4MO3 M;  1EUU A;  2V72 A;  4ZXE A;  4D8M A;  3CZU A;  5JXG A;  2WYS A;  2J1S A;  3VDB A;  3IAQ A;  5F7U A;  4DXR A;  3I2H A;  2X10 A;  3I97 A;  4GWJ A;  4CUC A;  2J1T A;  1O8S A;  1UXX X;  3IB3 A;  1O8P A;  3T0B A;  2XQX A;  5LA2 A;  1ULP A;  1UY1 A;  4DEV A;  3CQO A;  1CX1 A;  3WNP A;  3FL7 A;  1DP0 A;  3UNP A;  2X05 A;  4W50 A;  4GZ9 A;  1CZT A;  4LPL A;  2ZEW A;  3T0D A;  1SDD B;  3VDA A;  5I0D A;  2WBK A;  5LCW L;  2W3J A;  3LEK A;  2QQJ A;  4DXS A;  4A45 A;  3AC0 A;  2VMD A;  2W1Q A;  1CZV A;  2QQK A;  2WAB A;  3FN9 A;  5DQ0 A;  5IFP A;  3OEB A;  1TVG A;  1EUT A;  1SHW B;  2L9L A;  4GWI A;  3C7O A;  4P08 A;  3PUI A;  3WF0 A;  2CDO A;  5IJR A;  5LA0 A;  4CVU A;  3ACG A;  5IHR A;  2J1R A;  3HOB A;  4QX2 A;  1JZ7 A;  4A42 A;  1K42 A;  2VR4 A;  1ULO A;  4A4A A;  2RVA A;  2VME A;  4BK5 A;  2VJX A;  2E26 A;  2QQI A;  3I3B A;  2JKX A;  3LEI A;  3HNB M;  2VZO A;  3LQC A;  2W87 A;  5JXH A;  1JZ3 A;  1JYV A;  2J1U A;  2ID4 A;  2RJ2 A;  3I2G A;  2VQU A;  3OBA A;  5HPO A;  1JYW A;  2YC4 A;  3DYO A;  4UI9 L;  4QAW A;  3E1F 1;  2VMF A;  2VZU A;  4QDR A;  4W8J A;  2VQT A;  4XUQ A;  3WEZ A;  3MO4 A;  3SKV A;  2CDP A;  1JI6 A;  5B4X A;  3T08 A;  1JHJ A;  1NUK A;  2HLE A;  4ZZ8 A;  3F2Z A;  5A1A A;  4ARY A;  3FHQ A;  4QDQ A;  4P00 B;  3W5N A;  3A22 A;  4RN5 A;  2ZXQ A;  5CZK A;  2WZ8 A;  1KGY A;  3WNK A;  2VZ1 A;  3VD3 A;  2E32 A;  2VOT A;  4ET7 A;  2WO2 A;  2J1V A;  4JKK A;  2W9X A;  1OF3 A;  2QBX A;  4A6O A;  3ACI A;  2W46 A;  2W47 A;  1W8O A;  3C7G A;  2B4K A;  2PQS A;  1K3I A;  4L0P A;  2BGP A;  4XZU G;  1NKG A;  2KD7 A;  2VZS A;  3ZM8 A;  1WKY A;  5G05 L;  2QQM A;  2Y6G A;  3GM8 A;  2E31 A;  2DDU A;  1UX7 A;  1GOG A;  3EYP A;  3I3D A;  3HNY M;  3VD4 A;  1TG7 A;  2DCJ A;  3C8X A;  1KEX A;  2YFZ A;  5JUV A;  4JKM A;  2QQL A;  1UMI A;  3NQH A;  2JDA A;  3ACH A;  4HG6 B;  4PQQ A;  1UYZ A;  5CYY A;  2WO1 A;  3VDC A;  3T2Q A;  3CKH A;  2WQ8 A;  2XHN A;  4KWU A;  1F4H A;  1UY4 A;  3CMG A;  2BBA A;  1HN1 A;  2J1A A;  3HN3 A;  2VZQ A;  5FUI A;  4QDS A;  4QPW A;  3OGS A;  1NX9 A;  4AG4 A;  1US2 A;  2EIB A;  2LW8 A;  2VM9 A;  2Y6H A;  3K4Z A;  3OEA A;  3WSO A;  5DN2 A;  4DUW A;  3SEE A;  3T0A A;  2QQN A;  2VCC A;  3MV1 1;  2E33 A;  1W9T A;  1J84 A;  1P8J A;  1PMJ X;  4PT6 A;  3K46 A;  2VZ3 A;  1XC6 A;  3CZJ A;  1PMH X;  1K12 A;  2ORZ A;  3DYM A;  1D7P M;  1LNS A;  4OZO A;  1W9W A;  2WDB A;  4CUB A;  3GGL A;  1XNT A;  3LPG A;  1UXZ A;  3WQB A;  3K77 A;  1UYY A;  1UY2 A;  1GU3 A;  2JE8 A;  3T09 A;  3WNO A;  2W1U A;  5JXI A;  3EB7 A;  3SKJ E;  2Y6J A;  1L7Q A;  2YB7 A;  3WNN A;  4OYU A;  1OT5 A;  4A41 A;  2VTF A;  1W9S A;  4E8D A;  3A23 A;  3I2J A;  2YC2 A;  2YFU A;  3W5M A;  3BN6 A;  1PX3 A;  2RV9 A;  4W4Z A;  2W95 A;  1IQD C;  3MUZ 1;  3DEC A;  1OH4 A;  3I2F A;  1JZ5 A;  1W8N A;  2VZV A;  5EIY B;  3BGA A;  4QB6 A;  2WAA A;  3T2P A;  4BJ0 A;  1UYX A;  1UWW A;  5J1X A;  1F4A A;  3J7H A;  3I2K A;  1GOH A;  5JXJ A;  3SEP A;  4FI9 A;  4QX3 A;  2W94 A;  3HJR A;  2C4X A;  4QB2 A;  2Y6K A;  1US3 A;  2ZEZ A;  4UOJ A;  2WO3 A;  3LEG A;  4DUV A;  2W1W A;  1JYX A;  2BER A;  1SG3 A;  1UZ0 A;  3ACF A;  3C7E A;  2XOM A;  3VD7 A;  2W92 A;  1WCQ A;  2YG0 A;  3LPF A;  3MV0 1;  4XUP A;  4ARX A;  4DUX A;  1BHG A;  5B4N A;  1RYY A;  2V5D A;  1JU4 A;  2VZR A;  2ZEY A;  2J7M A;  1DYO A;  4DXT A;  3FHA A;  1OF4 A;  3WF2 A;  2LS6 A;  3NJX A;  2WN3 A;  2W91 A;  3A7Q A;  1XPW A;  4QX0 A;  2OKX A;  2QQO A;  1H6Y A;  3III A;  2VMC A;  3UET A;  3MUY 1;  4XUO A;  1JZ4 A;  2J22 A;  5JMO A;  2B9V A;  3HNM A;  2VZT A;  2EIE A;  2XON A;  3P1I A;  1UY0 A;  4IUG A;  3WF3 A;  3WF4 A;  4M4P A;  4CUA A;  1R64 A;  2ORX A;  3CDZ B;  3DYP A;  4AAX A;  2EID A;  1JZ6 A;  3OGV A;  1GUI A;  1PX4 A;  3HEI A;  5G04 L;  3WF1 A;  3NJV A;  4RYD A;  1OD3 A;  3A21 A;  1MPX A;  1GMM A;  2VO5 A;  4A44 A;  3I3E A;  3ECQ A;  2J1E A;  2Y6L A;  1UMH A;  4BXS V;  4LQR A;  4M4R A;  2VC9 A;  4TXW A;  4LHS A;  3OG2 A;  2WN2 A;  3CIH A;  4OMD A;  4E8C A;  4QB1 A;  1YQ2 A;  3GDB A;  1GQP A;  4PF1 A;  3I2I A;  4JKL A;  4CU6 A;  2V4V A;  2R7E B;  1J83 A;  1NAE A;  2C26 A;  3LE0 A;  2HYX A;  2W5F A;  3WNM A;  4BDV B;  4TTG A;  1DLC A;  2X09 A;  4XVH A;  3GXU A;  1GNY A;  4BK4 A;  1W99 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...