1K1AA

Crystal structure of the ankyrin repeat domain of bcl-3: a unique member of the ikappab protein family
Total Genus 73
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
73
sequence length
228
structure length
228
Chain Sequence
EDGDTPLHIAVVQGNLPAVHRLVNLFQQGGRELDIYNNLRQTPLHLAVITTLPSVVRLLVTAGASPMALDRHGQTAAHLACEHRSPTCLRALLDSAAPGTLDLEARNYDGLTALHVAVNTECQETVQLLLERGADIDAVDIKSGRSPLIHAVENNSLSMVQLLLQHGANVNAQMYSGSSALHSASGRGLLPLVRTLVRSGADSSLKNCHNDTPLMVARSRRVIDILRG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords B-cell lymphoma 3-encoded protein
publication title Crystal structure of the ankyrin repeat domain of Bcl-3: a unique member of the IkappaB protein family.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription
total genus 73
structure length 228
sequence length 228
ec nomenclature
pdb deposition date 2001-09-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00023 Ank Ankyrin repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.20 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Ankyrin repeat-containing domain 1k1aA00
3J5QB 4BESA 4U8YD 1N11A 3AJIA 4N5QA 4BERA 5CECB 4JB8P 4B93B 3TWTA 5AAOA 3TWSA 4HRMB 2ZGGA 1AWCB 5AQ9A 4HLLA 1AP7A 1S70B 3NOCD 4J8YA 2B0OE 3EHRA 2DVWA 1MX2A 5EIDA 4DX2A 1IXVA 4U95D 3UTMA 3W9FA 5AQ7A 2QYJA 4BETA 3ZUVB 1G3NB 3LJNA 4DX5D 4F1PA 2F8XK 2XZTG 2DZNA 3TWVA 1SVXA 3SO8A 3J5PA 5ENOD 5BXOA 3HG0D 3F6QA 5KBAA 2XEHA 4QQIA 5HS0A 1QYMA 4RLYA 5D66A 5HRYA 3JXJA 4DRXE 4HNAD 1N0QA 1YYHA 2BKGA 4NIKA 5AN8A 2A5EA 4C48B 4DUIA 5FIOA 5CERB 2HE0A 2MYOA 2PNNA 3UXGA 1BI7B 1K1BA 2NYJA 3EU9A 5BXUA 5KWDA 1BI8B 3T8KA 4HBDA 5ITZF 4G8LA 3NBNB 1D9SA 4BSZB 4DX7D 5EILA 2RFMA 5EN5D 3TWQA 1MJ0A 1K3ZD 4OAVB 3JXIA 4K5CA 4K5BA 4LSZE 5EIBE 4TUMA 4O1OA 3KEAA 2V5QC 4O1PA 4YDWA 5AQBA 1NFIE 4ZHBA 2P2CP 1A5EA 4U8VD 4F6RD 5JA4D 1TR4A 4G8KA 4HI9A 4OAUC 4ATZD 1K1AA 3NOGD 3V31A 1DC2A 5ENQD 3TWRA 4DX6D 5JMND 4ZFHA 4HQDA 3ZNGA 2XEEA 1YMPA 2V4HC 1WG0A 3D9HA 5AQAA 3IXEA 5KNHD 2KBXA 3V30A 4CZ2D 2DWZA 3DEOA 3ZU7B 4LNUD 5CBOA 1IHBA 4K5AB 5CEDB 1MYOA 2RFAA 2L6BA 1MX6A 2F37A 2XENA 5ENPD 4HI8A 4HRNA 2J8SD 3TWWA 4J7WA 4A63B 2Y1LE 4DX1A 5EYLA 4BEPA 5ENSD 3TWXA 2XZDG 3B95A 1WDYA 4Z68A 2F8YA 1BLXB 1BD8A 1SW6A 4CYMD 3V79K 5ENTD 1OT8A 1YCSB 3V2OA 1OY3D 3V2XA 2ZGDA 5FINA 5CEAA 2AJAA 2JABA 4GMRA 4YDYA 5ENRD 2QC9A 2VGEA 4HB5A 3AAAC 4QFVA 3Q9UC 1BU9A 1N0RA 3B7BA 4O60A 3HRAA 4HRLA 5EYPF 3DEPA 5CBNA 2ETCA 3UI2A 1UOHA 3ZKJA 1DCQA 3TWUA 5KNGA 5AARA 3W9GA 3Q9NC 1IKND 2ETAA 3JUEA 2Y0BG 3C5RA 2DZOA 4LG6A 1MX4A 3EHQA 5HKPA 2BKKB 3T9KA 2FO1E 2ETBA 2KXPC 4UUCA 4U96D 4GPMA
chains in the Genus database with same CATH superfamily
2XPYA 2YHCA 2J9QA 4YVQC 3TWSA 3KSQA 1S70B 3PE3A 4DX2A 2Y4UA 4KVOA 3MEKA 3PZ3A 1TNZA 3PZDA 1G3NB 2ZXWE 4KZCA 4HVBA 5FQ7A 2H6GA 4Y6CA 4YDOA 5CERB 1TN8A 2NYJA 3O48A 2P9PG 5BNWA 2P58C 4GAAA 4BSZB 4Q69A 2WXIA 1TJCA 3CVLA 2XHEA 3TWQA 3HXDA 3C98A 3UX4A 4K5CA 2WQHA 2HM8A 3CHQA 2MOWA 4GZCA 1SZAA 3E33A 2MRIA 2P9SG 1TR4A 5EDSA 1RW2A 3NZSA 5HI7A 4CDMA 2VGXB 4AIFA 3LEWA 5CHEE 2VSNA 4GTMA 5CBOA 3QDNA 2IFUA 1MX6A 4EBAG 3ZW3A 3WXXA 5LP0A 4GMLA 2IEJA 3TJPA 5AENA 3FH7A 1ZB1A 3TL5A 1UW4B 2AWIA 4U63A 2Y3AA 3Q9UC 1BU9A 4O60A 4F53A 1MHQA 1X81A 1EYHA 4ANWA 4GB9A 1HE8A 3HYMB 4BX9A 3ZIMA 1E7UA 2Q7FA 4BESA 4V3IA 4L2YA 5FJYA 4WUYA 3QWWA 3JQ1A 1ZBPA 3FH5A 5FZQA 1QBQA 2B6CA 1DCEA 2WXMA 4DX5D 3R9MA 1HZ4A 5JJTA 5EX3A 1B89A 2KZTA 4QQIA 5HS0A 4ANVA 3IBEA 1Y8MA 3B7RL 1TJFA 3U3WA 4XIFA 3WG7E 1MZCA 3SQVA 4AP2A 3FUIA 5CCLA 2ZIRA 1RZ4A 1TYQG 5CMYA 1N4SA 2IJGX 5E76A 4ZFHA 4LNBA 4E85A 1S0PA 4IYPA 3MV3B 3V30A 4ACLA 2WXKA 3HXBA 1SA5A 2WQ7A 5ANRA 2FO7A 4UWGA 5LX8A 5ENSD 2I9CA 3UM2A 5C2YA 4G24A 1NZNA 3CKBA 1FT2A 3FUNA 4JPSA 3Q78A 4XI9A 3LXUX 4GTTA 3FU3A 2X6KA 1H2UA 2FEZA 1O1SA 3BU8A 3L82A 1OCZE 3L54A 2KATA 3QK0A 4GYWA 4AJWA 2WXOA 3CVWA 4HLLA 1N52A 3LVQE 3D9LA 4CEMA 2QZAA 4OYSA 3Q47B 4FU3A 1SVXA 3J5PA 1SZ9A 2J07A 3CHRA 4N5CA 4IULA 3ASDA 3JXJA 3IV0A 2BKGA 4Q96A 4KYOB 3L22A 3LKUA 4J0UA 4K03A 2A5UA 1HU3A 1H6OA 5G05C 4HORA 3PZ2A 4GTSA 1NI1A 3N71A 3OXFA 1H2TC 4TXQA 2VJ8A 1A5EA 3C3OA 3FTZA 1DVPA 5BUZA 3S7JA 2V4HC 3TXNA 4BT9A 3HVEB 3C3RA 4PH4B 2L6BA 2KC7A 3UT8A 4GA0A 4R7LA 1K8KG 4U0SA 3KS2A 1XGWA 4I1MA 1BD8A 4G26A 4MKTA 3RJVA 2AJAA 3O4ZA 2VYIA 2LSUA 3D9KA 1YA0A 5BV1A 2XRYA 4X8QA 5HKPA 1TN6A 3DSUA 3FULA 4LERA 4B93B 5AAOA 3RKVA 2R03A 2R2LA 4A55A 1MX2A 2PQRA 2GRQB 1IXVA 2KM4A 4B94A 4BTBA 4HOSA 3CHOA 1JUQA 3ML9A 3ASOE 2XZTG 3TWVA 1Z3XA 2CFZA 3U4TA 3MV2B 2WVIA 4GZDA 1BI8B 2OVFA 3JUIA 5FZRA 2H6IA 1MJ0A 1K3ZD 2C0MA 4DLOA 1W3BA 4KXKB 5JA4D 4HI9A 4OAUC 4AXHA 3D9PA 3V31A 4C0MA 1LD8A 3ZNGA 3PDNA 2XEEA 3QOUA 4U0ZA 3SY2A 4LNUD 1TNUA 3FY4A 4JHKA 2F37A 3PEUB 1TNOA 3Q4AB 2RD0A 2R02A 3QJZA 3DPYA 4DPRA 4JHJA 3B95A 3T8MA 2DIWA 3CK9A 1ELWA 4RQIA 3ULQA 5FT9A 5CMWA 1Z3YA 5FZSA 3AAAC 3MKQA 3RRNB 1D8EA 5A23A 4JHRA 5KNGA 4BWRA 3FUEA 3SF4A 3QARA 1NL4A 3LS8A 5CECB 4EPZA 3ISMC 1WM5A 3L16A 4J8SA 2EILE 5CRUA 4G23A 2IQCA 3AS4A 3OTNA 1N4PA 4C48B 4DUIA 5BW8C 1PAQA 1MQSA 3SFYA 4NQ0A 3ZYLA 4B8CB 3MZLB 2GROB 4IRUA 5EILA 5JJ7A 1N54A 3JXIA 4J6IA 1OWNA 3KEAA 3ZHEA 1V54E 5DIZA 3S2AA 5D0OD 3BUAA 1LD7A 1GW6A 5IY5E 1ELKA 5KNHD 2V4LA 3ZN3A 2GRNB 3ABME 1OUVA 2HR2A 4GCOA 4I9CA 3ULEG 4WAFA 1EDUA 3LY9A 4L7TA 3TWXA 3OXLA 3I3NA 4LUNU 1E7VA 3G2WA 1E8XA 5HQ8A 3EUVA 5FINA 3EDTB 4GMRA 3ZEFA 2GRPB 4YDYA 2QC9A 3B7BA 2I6HA 2OOEA 3PREA 5ENNA 3T9KA 5FQ8A 3ASHA 2KXPC 3U64A 2GRLA 3J5QB 3IKOB 5D2MC 3G2SA 4HRMB 2B0OE 2NSZA 4JEUA 2WXPA 2OEWA 2IO3C 4FHJA 1NA3A 3RO2A 4BY6A 2VTBB 3QWPA 4B8AA 1FVHA 3QC1A 3VLDA 2L0IA 2PM6A 2CHZA 1FT1A 3TXMA 1K1BA 3APFA 3DSXA 4HBDA 1D9SA 5EN5D 4N3CA 2UY1A 3TG4A 3DRAA 3ONKA 3R9AB 3IHVA 4MBGA 4YDEA 5LCWJ 3E4BA 3MJWA 3D9HA 3BQOA 3ABLE 1P5QA 1N4RA 4K0RA 3UQ3A 3FUHA 3L9TA 2DCPA 3KD7A 3JCKC 1SQMA 2LO6A 3Q75A 4ME2A 2XS8A 1BLXB 4HOUA 2L0TB 1OT8A 2AXUA 3PNLB 3I5PA 2XGMA 3PUKA 4CDRA 2V8SE 2UWJG 4CT0A 4WWNA 2P9IG 3E37A 5KJMA 3ZGQA 3C5RA 3U66A 4UUCA 4CRWA 4MS6A 1OWLA 3Q15A 3ESKA 4GA1A 1KT1A 4A1SA 4FLHA 4L23A 3QNKA 3LY7A 1O1RA 3CGHA 3RAUA 1FCHA 3FDHA 4UWKA 3ZYKA 4I6GA 3HG0D 3EHNA 3AG3E 3NF1A 3L17A 4JZYA 1S63A 5B3SE 4GZ6A 4NACA 3HDXA 5BT1A 5KWDA 2WXNA 1JCQA 2J08A 2XPZA 3Q73A 3HXFA 5LOZA 4ILGA 1Y6IA 4OVUA 2VGYA 3ZXPA 5EKQD 1N94A 3ONLA 3ZPJA 5AQAA 2X6FA 4K5AB 5G04J 4AEZC 4GTRA 3FP3A 2XGSA 1IQUA 1N4QA 3CVXA 5CRVA 3LCAA 4ATGA 3APDA 2A4ZA 3L08A 5CEAA 3CSFA 3C3QA 4CGVA 4F7AA 4FC8A 4YNDA 5H7PA 4HRLA 3CK7A 3U9WA 5CCMA 4FULA 1O5MA 3BG1B 1H6PA 5T3RA 3I4GA 2BTDA 3CQGB 1WAO1 2L6JA 5AQ9A 2AW6A 4GTPA 4WWOA 4L1BA 2V0PA 5J08A 3LYAA 3UTMA 1HX8A 2J4DA 2EQXA 1JPLA 3FUMA 1LTXA 4HNAD 4Y6WA 2A5EA 1HFAA 4FJZA 3SFXA 5FIOA 4TXRA 2PL2A 5T8IA 2IU1A 4JVSA 1FPPA 3EIQC 4G8LA 5KCMA 3GZ1A 4G1TA 4ANUA 1D8DA 4B0ZA 1OCRE 1H2VC 4FHKA 1NFIE 2Y4TA 4AM9A 3FH8A 2GW1A 5ENQD 3ASNE 4HQDA 2XEVA 2WXRA 4N3BA 4KVMA 5CEDB 4EZJA 3UMVA 3RO3A 5KJLA 1S64A 5FQ4A 3SI5A 4BEPA 3UT4A 2XZDG 4TXPA 2FI7A 1SW6A 4GMJA 1YCSB 3FTUA 1OY3D 3B7SA 3CVVA 4O6FA 4TV3A 4GZ3A 2EIME 3CV0A 5ENRD 2P9LG 3QB2A 3AG1E 3CR3A 1JCSA 4RVBA 4TUUA 3UI2A 1UOHA 3W9GA 1JCRA 1IKND 3DSSA 4KBQA 1OWOA 3QKYA 4APFA 3ZFWA 2X3MA 3JYSA 3ABKE 1UG3A 4LEUA 1U2VG 4N39A 2X6JA 3SD5A 3MA5A 3W9FA 5AQ7A 3S7FA 3SHFA 2CFUA 1TNYA 3ZUVB 3LJNA 1KT0A 2DZNA 2J49A 1E8ZA 1E8WA 5KBAA 1KPSB 3IEGA 4JA7A 3FUFA 4JC8A 1ZU2A 1TN7A 3OAWA 2R5SA 1UJJA 1V55E 2HE0A 3IHYA 2PNNA 4I1AA 2EIJE 4XI0A 1FVFA 1QZ2A 4KMOA 4CDNA 3NBNB 2RKKA 3AS8A 3MCXA 4WNGA 4U7EB 2VGXA 3CIAA 3CVNA 4ZHBA 2IY0C 4E6HA 5FWQA 4D10C 3NOGD 1DC2A 2HO1A 3EJNA 2AVPA 3KEZA 3ZYMA 3FUJA 4EZKA 3Q7AA 2RFAA 4KT6B 3CVQA 4HRNA 3TWWA 4PS7A 4HS2A 3D9OA 3VTYA 2F8YA 3DSWA 5T4YA 3V2XA 2ZGDA 1O1TA 4UQYA 4A3TA 1X5BA 1N9AA 4QFVA 4UQZA 4DK5A 2OEVA 3LJ3A 4IN3B 4CT4A 3PE4A 3UM1A 4U8YD 2C2LA 2QY7A 3CHMA 2X6IA 2C0LA 4FJYA 2QYJA 3RIBA 4BETA 2WXHA 4DI3A 4LRZA 3UM0A 5HRYA 1YYHA 5AN8A 2AXZA 3OXGA 4URKA 1E90A 2WQ6A 5J90A 2KZTB 4G25A 3RK6A 3G2TA 1DNPA 3CHPA 1TEZA 4U0UA 4LNGA 5EIBE 2WMNA 4YDWA 2YNQA 4ATZD 4H7YA 4J8DA 4UWHA 2PQNA 4DX6D 2GRRB 3D9NA 3T5VA 4G11A 3QWVA 3L13A 3ZU7B 3DEOA 1WY6A 4UI9J 3UUXA 4ABNA 3ESLA 2ZU6B 2E2EA 3FEXA 3D9JA 4NURA 2J09A 3FTXA 1WDYA 2H6FA 4J8FA 3SFZA 4N3AA 2JABA 2WXLA 5AJLA 4I17A 2YQ8A 3HRAA 5G55A 5CBNA 1IHGA 4W9RA 2F0YA 2VSXE 3G2VA 3UPVA 2ETBA 3MGBA 5KJKA 4U96D 3UIOC 1N11A 3GZSA 4JB8P 5AYWD 3TWTA 2XRZA 4MRUA 2OV8A 3X2QE 5EX0A 3CHSA 5EIDA 3ZRHA 2KCLA 2LUHA 4M3OA 3P2BA 4PUCA 3Q79A 3PH0C 3ENEA 1QQEA 3FFLA 2ZISA 5B1AE 3CSTA 2XEHA 4PS8A 5LFAA 4NIKA 4YVOA 3DBSA 3I4RB 4XKBA 1N95A 2CG2A 2V5FA 4C9BB 4DX7D 4JD2G 2MHKA 2WXFA 4HXIA 3D3MA 3T5XA 2CHXA 2XS1A 2XQ0A 3ML8A 3HVEA 4I1OB 2KBXA 5B1BE 2XCBA 1IHBA 1UN8A 2PZIA 5AIJA 4N2QA 4OVVA 3UIPC 3CQCB 3FTVA 4HI8A 5AJDA 3SGHA 4A63B 2Y1LE 4DX1A 3FUDA 1OCOE 4Z68A 4JXTA 5ENTD 2BUGA 4I9EA 4PDXA 1Q2ZA 3RRMB 3L6AA 4HOQA 3TAXA 1H0AA 3SBTB 2ETCA 4DLQA 3LVRE 3JUEA 2Y69E 3LPZA 1IYGA 3AU5A 3R7RA 2P9NG 4I2WA 4FA6A 2QFCA 4WNEA 4GCNA 4GYOA 2F8XK 5FQ6A 3AG2E 3C72A 3UKRG 5G04C 4F1SA 3GYZA 2CG3A 2I2OA 1EPUA 1L5JA 1BI7B 3EU9A 3P1UA 1HH8A 3ZVVA 4OAVB 4K5BA 4O1PA 3DWLG 4GPKA 2P2CP 4GTVA 2GRMA 4G8KA 1OCCE 2PM7A 3TWRA 2BF0X 3HXEA 3LY8A 3ZXSA 2LXMA 4GA2A 1KLXA 3FTWA 4CZ2D 4DI4A 2KCVA 4GZ5A 2ILRA 3MKRA 2CHWA 4ILHB 4J7WA 2P9UG 5A7DB 4EQFA 1UJKA 4U04A 4EBAA 2WXQA 3BEEA 3HHMA 2HYZA 4MLPA 1N0RA 3PZ4A 1NP7A 3DEPA 4L2LA 3FUKA 1HS6A 3UM3A 2Y0BG 3MKQB 3PUJA 2I1KA 4L9PA 1IQRA 2FBNA 4WWPA 4RG6A 4N5QA 2DYSE 2ZGGA 4CGWA 3E32A 4GU5A 4EECA 2DVWA 3UKUG 3LDZA 4H7XA 4F1PA 4Q94A 4PS3A 3B13A 5BXOA 4U8HA 3CKCA 2R05A 4GYYA 3FEYA 4U07A 2KCKA 3HIZA 4C0EA 3S7DA 4ILIA 2X6HA 4LSZE 4APOA 4O1OA 5AQBA 5C1DA 4KZ0A 1K1AA 3SBSA 3S7BA 4AVXA 4AY6A 5KJNA 3ZHEB 1KZOA 1WG0A 3MYVA 2J4BA 3QAQA 1MYOA 3SZ7A 3PS6A 5JHAA 4AY5A 4UQXA 2L9BA 2J8SD 3ASFA 2JLBA 2BEDA 4CYMD 3V2OA 4XKCA 1VDYA 3NAWA 5JJ6A 2QYUA 2VGEA 4I6JA 5EYPF 4AV7A 4FP7A 1OWPA 3B7UX 2XPIA 2RG8A 1MX4A 2FO1E 2DBAA 5BV0A 3CK8A 1AWCB 3BG0B 3G2UA 2ONDA 4FADA 1AP7A 3NOCD 4J8YA 3FTYA 2VTBA 1E8YA 3DPDA 5ENOD 1NA0A 3F6QA 4ACKA 4RLYA 5D66A 4DRXE 2OCCE 3PVLA 4UWFA 4WNFA 3T8KA 4XEIG 4I43A 2I1JA 4HLEA 3KAEA 4UWLA 3NQPA 2AXVA 5ARGA 2OVBA 4JL0A 2V5QC 3Q7FA 1HG2A 3D9IA 4TRQA 2FULA 2UY1B 1E96B 4GTOA 3RU0A 4N2SA 3DSTA 2DWZA 4F3VA 4FLBA 5M72A 4UI9K 3JQ0A 3AG4E 2LAIA 2XGOA 2IF4A 3V79K 1PY1A 3Q49B 3KSLA 3FU6A 2WXJA 3AS5A 1H19A 5G05J 3EHMA 4BSXA 1JWGA 2IO2C 1DCQA 2VSYA 3MX3A 3Q9NC 3HXCA 2IOSA 3VLFA 5JHBA 4I6EA 4EHMA 4GPMA 4BERA 2P9KG 4WNDA 1Z6TA 3EHRA 3E30A 1LF8A 5ANLA 1JWFA 4UI9C 1XNFA 2NXPA 3PEVB 4XZ4A 3CVPA 5ARFA 2R59A 3B7TA 3URZA 2MYOA 4RSYA 3UXGA 4M7CA 5ITZF 5G2NA 4HOTA 1OWMA 4ANXA 3UT7A 3EIJA 4BFRA 2E0IA 3TGOA 3VTXA 5FTPA 3FTSA 1H6KA 4BTAA 2EIKE 1A17A 5JMND 2WMOA 1YMPA 1ELRA 3FU5A 3ULYA 1QNFA 4JEHA 3FU0A 2WM9A 3R7QA 2XENA 2DYRE 5ENPD 4BX8A 3E34A 2JEKA 1SA4A 2XCCA 4HFGA 1UN9A 4AOFA 4P29A 5DBKA 4DJAA 4BT8A 3D9MA 1OXJA 3DXKG 2LXLA 2H6HA 4HB5A 4B89A 1HG5A 3TG5A 2YINA 3ZKJA 3FHEA 3TWUA 5AARA 1HF8A 2ETAA 2YHEA 4CCAA 3EHQA 1U3CA 1INZA 3K9IA 5BPPA 3GW4A 3AJIA 1HO8A 4JW1A 3CLJA 3PZ1A 2WXGA 2X38A 3GZ2A 4U95D 5A6CA 3CEQA 1KZPA 4J8EA 4A3VA 4LCTA 3DSVA 4XE0A 3SO8A 2IONA 4EZLA 1QYMA 1N0QA 2LSVA 4GTQA 4A1GA 3CVYA 2VSOE 3APCA 3PRZA 5D0QD 3UINC 5BXUA 3FWVA 1TNBA 3DXMG 5LCWC 3NZUA 2RFMA 2GGFA 4TUMA 2WPVA 3SNXA 3VLEA 4U8VD 3Q5MA 4F6RD 2LNIA 2LAHA 4I2ZA 3CVUA 4RG9A 5E75A 3IXEA 1HXIA 2WB2A 2EINE 3NB2A 4XX5A 1Z5SC 2VQ2A 1BPOA 2IOLA 5EYLA 4G2VA 3ZYQA 3AU4A 2R17C 2FF4A 4NRHB 3EU5A 4JA9A 1EF1C 3RRUA 1PC2A 3PNTB 3ASGA 2NC9A 3RSEG 2M63A 1U3DA 4LG6A 2DZOA 2BKKB
chains in the Genus database with same CATH topology
3J5QB 4BESA 4U8YD 1N11A 3AJIA 4N5QA 4BERA 5CECB 4JB8P 4B93B 3TWTA 5AAOA 3TWSA 4HRMB 2ZGGA 1AWCB 5AQ9A 4HLLA 1AP7A 1S70B 3NOCD 4J8YA 2B0OE 3EHRA 2DVWA 1MX2A 5EIDA 4DX2A 1IXVA 4U95D 3UTMA 3W9FA 5AQ7A 2QYJA 4BETA 3ZUVB 1G3NB 3LJNA 4DX5D 4F1PA 2F8XK 2XZTG 2DZNA 3TWVA 1SVXA 3SO8A 3J5PA 5ENOD 5BXOA 3HG0D 3F6QA 5KBAA 2XEHA 4QQIA 5HS0A 1QYMA 4RLYA 5D66A 5HRYA 3JXJA 4DRXE 4HNAD 1N0QA 1YYHA 2BKGA 4NIKA 5AN8A 2A5EA 4C48B 4DUIA 5FIOA 5CERB 2HE0A 2MYOA 2PNNA 3UXGA 1BI7B 1K1BA 2NYJA 3EU9A 5BXUA 5KWDA 1BI8B 3T8KA 4HBDA 5ITZF 4G8LA 3NBNB 1D9SA 4BSZB 4DX7D 5EILA 2RFMA 5EN5D 3TWQA 1MJ0A 1K3ZD 4OAVB 3JXIA 4K5CA 4K5BA 4LSZE 5EIBE 4TUMA 4O1OA 3KEAA 2V5QC 4O1PA 4YDWA 5AQBA 1NFIE 4ZHBA 2P2CP 1A5EA 4U8VD 4F6RD 5JA4D 1TR4A 4G8KA 4HI9A 4OAUC 4ATZD 1K1AA 3NOGD 3V31A 1DC2A 5ENQD 3TWRA 4DX6D 5JMND 4ZFHA 4HQDA 3ZNGA 2XEEA 1YMPA 2V4HC 1WG0A 3D9HA 5AQAA 3IXEA 5KNHD 2KBXA 3V30A 4CZ2D 2DWZA 3DEOA 3ZU7B 4LNUD 5CBOA 1IHBA 4K5AB 5CEDB 1MYOA 2RFAA 2L6BA 1MX6A 2F37A 2XENA 5ENPD 4HI8A 4HRNA 2J8SD 3TWWA 4J7WA 4A63B 2Y1LE 4DX1A 5EYLA 4BEPA 5ENSD 3TWXA 2XZDG 3B95A 1WDYA 4Z68A 2F8YA 1BLXB 1BD8A 1SW6A 4CYMD 3V79K 5ENTD 1OT8A 1YCSB 3V2OA 1OY3D 3V2XA 2ZGDA 5FINA 5CEAA 2AJAA 2JABA 4GMRA 4YDYA 5ENRD 2QC9A 2VGEA 4HB5A 3AAAC 4QFVA 3Q9UC 1BU9A 1N0RA 3B7BA 4O60A 3HRAA 4HRLA 5EYPF 3DEPA 5CBNA 2ETCA 3UI2A 1UOHA 3ZKJA 1DCQA 3TWUA 5KNGA 5AARA 3W9GA 3Q9NC 1IKND 2ETAA 3JUEA 2Y0BG 3C5RA 2DZOA 4LG6A 1MX4A 3EHQA 5HKPA 2BKKB 3T9KA 2FO1E 2ETBA 2KXPC 4UUCA 4U96D 4GPMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3J5Q B;  4BES A;  4U8Y D;  1N11 A;  3AJI A;  4N5Q A;  4BER A;  5CEC B;  4JB8 P;  4B93 B;  3TWT A;  5AAO A;  3TWS A;  4HRM B;  2ZGG A;  1AWC B;  5AQ9 A;  4HLL A;  1AP7 A;  1S70 B;  3NOC D;  4J8Y A;  2B0O E;  3EHR A;  2DVW A;  1MX2 A;  5EID A;  4DX2 A;  1IXV A;  4U95 D;  3UTM A;  3W9F A;  5AQ7 A;  2QYJ A;  4BET A;  3ZUV B;  1G3N B;  3LJN A;  4DX5 D;  4F1P A;  2F8X K;  2XZT G;  2DZN A;  3TWV A;  1SVX A;  3SO8 A;  3J5P A;  5ENO D;  5BXO A;  3HG0 D;  3F6Q A;  5KBA A;  2XEH A;  4QQI A;  5HS0 A;  1QYM A;  4RLY A;  5D66 A;  5HRY A;  3JXJ A;  4DRX E;  4HNA D;  1N0Q A;  1YYH A;  2BKG A;  4NIK A;  5AN8 A;  2A5E A;  4C48 B;  4DUI A;  5FIO A;  5CER B;  2HE0 A;  2MYO A;  2PNN A;  3UXG A;  1BI7 B;  1K1B A;  2NYJ A;  3EU9 A;  5BXU A;  5KWD A;  1BI8 B;  3T8K A;  4HBD A;  5ITZ F;  4G8L A;  3NBN B;  1D9S A;  4BSZ B;  4DX7 D;  5EIL A;  2RFM A;  5EN5 D;  3TWQ A;  1MJ0 A;  1K3Z D;  4OAV B;  3JXI A;  4K5C A;  4K5B A;  4LSZ E;  5EIB E;  4TUM A;  4O1O A;  3KEA A;  2V5Q C;  4O1P A;  4YDW A;  5AQB A;  1NFI E;  4ZHB A;  2P2C P;  1A5E A;  4U8V D;  4F6R D;  5JA4 D;  1TR4 A;  4G8K A;  4HI9 A;  4OAU C;  4ATZ D;  1K1A A;  3NOG D;  3V31 A;  1DC2 A;  5ENQ D;  3TWR A;  4DX6 D;  5JMN D;  4ZFH A;  4HQD A;  3ZNG A;  2XEE A;  1YMP A;  2V4H C;  1WG0 A;  3D9H A;  5AQA A;  3IXE A;  5KNH D;  2KBX A;  3V30 A;  4CZ2 D;  2DWZ A;  3DEO A;  3ZU7 B;  4LNU D;  5CBO A;  1IHB A;  4K5A B;  5CED B;  1MYO A;  2RFA A;  2L6B A;  1MX6 A;  2F37 A;  2XEN A;  5ENP D;  4HI8 A;  4HRN A;  2J8S D;  3TWW A;  4J7W A;  4A63 B;  2Y1L E;  4DX1 A;  5EYL A;  4BEP A;  5ENS D;  3TWX A;  2XZD G;  3B95 A;  1WDY A;  4Z68 A;  2F8Y A;  1BLX B;  1BD8 A;  1SW6 A;  4CYM D;  3V79 K;  5ENT D;  1OT8 A;  1YCS B;  3V2O A;  1OY3 D;  3V2X A;  2ZGD A;  5FIN A;  5CEA A;  2AJA A;  2JAB A;  4GMR A;  4YDY A;  5ENR D;  2QC9 A;  2VGE A;  4HB5 A;  3AAA C;  4QFV A;  3Q9U C;  1BU9 A;  1N0R A;  3B7B A;  4O60 A;  3HRA A;  4HRL A;  5EYP F;  3DEP A;  5CBN A;  2ETC A;  3UI2 A;  1UOH A;  3ZKJ A;  1DCQ A;  3TWU A;  5KNG A;  5AAR A;  3W9G A;  3Q9N C;  1IKN D;  2ETA A;  3JUE A;  2Y0B G;  3C5R A;  2DZO A;  4LG6 A;  1MX4 A;  3EHQ A;  5HKP A;  2BKK B;  3T9K A;  2FO1 E;  2ETB A;  2KXP C;  4UUC A;  4U96 D;  4GPM A; 
#chains in the Genus database with same CATH topology
 2XPY A;  2YHC A;  2J9Q A;  4YVQ C;  3TWS A;  3KSQ A;  1S70 B;  3PE3 A;  4DX2 A;  2Y4U A;  4KVO A;  3MEK A;  3PZ3 A;  1TNZ A;  3PZD A;  1G3N B;  2ZXW E;  4KZC A;  4HVB A;  5FQ7 A;  2H6G A;  4Y6C A;  4YDO A;  5CER B;  1TN8 A;  2NYJ A;  3O48 A;  2P9P G;  5BNW A;  2P58 C;  4GAA A;  4BSZ B;  4Q69 A;  2WXI A;  1TJC A;  3CVL A;  2XHE A;  3TWQ A;  3HXD A;  3C98 A;  3UX4 A;  4K5C A;  2WQH A;  2HM8 A;  3CHQ A;  2MOW A;  4GZC A;  1SZA A;  3E33 A;  2MRI A;  2P9S G;  1TR4 A;  5EDS A;  1RW2 A;  3NZS A;  5HI7 A;  4CDM A;  2VGX B;  4AIF A;  3LEW A;  5CHE E;  2VSN A;  4GTM A;  5CBO A;  3QDN A;  2IFU A;  1MX6 A;  4EBA G;  3ZW3 A;  3WXX A;  5LP0 A;  4GML A;  2IEJ A;  3TJP A;  5AEN A;  3FH7 A;  1ZB1 A;  3TL5 A;  1UW4 B;  2AWI A;  4U63 A;  2Y3A A;  3Q9U C;  1BU9 A;  4O60 A;  4F53 A;  1MHQ A;  1X81 A;  1EYH A;  4ANW A;  4GB9 A;  1HE8 A;  3HYM B;  4BX9 A;  3ZIM A;  1E7U A;  2Q7F A;  4BES A;  4V3I A;  4L2Y A;  5FJY A;  4WUY A;  3QWW A;  3JQ1 A;  1ZBP A;  3FH5 A;  5FZQ A;  1QBQ A;  2B6C A;  1DCE A;  2WXM A;  4DX5 D;  3R9M A;  1HZ4 A;  5JJT A;  5EX3 A;  1B89 A;  2KZT A;  4QQI A;  5HS0 A;  4ANV A;  3IBE A;  1Y8M A;  3B7R L;  1TJF A;  3U3W A;  4XIF A;  3WG7 E;  1MZC A;  3SQV A;  4AP2 A;  3FUI A;  5CCL A;  2ZIR A;  1RZ4 A;  1TYQ G;  5CMY A;  1N4S A;  2IJG X;  5E76 A;  4ZFH A;  4LNB A;  4E85 A;  1S0P A;  4IYP A;  3MV3 B;  3V30 A;  4ACL A;  2WXK A;  3HXB A;  1SA5 A;  2WQ7 A;  5ANR A;  2FO7 A;  4UWG A;  5LX8 A;  5ENS D;  2I9C A;  3UM2 A;  5C2Y A;  4G24 A;  1NZN A;  3CKB A;  1FT2 A;  3FUN A;  4JPS A;  3Q78 A;  4XI9 A;  3LXU X;  4GTT A;  3FU3 A;  2X6K A;  1H2U A;  2FEZ A;  1O1S A;  3BU8 A;  3L82 A;  1OCZ E;  3L54 A;  2KAT A;  3QK0 A;  4GYW A;  4AJW A;  2WXO A;  3CVW A;  4HLL A;  1N52 A;  3LVQ E;  3D9L A;  4CEM A;  2QZA A;  4OYS A;  3Q47 B;  4FU3 A;  1SVX A;  3J5P A;  1SZ9 A;  2J07 A;  3CHR A;  4N5C A;  4IUL A;  3ASD A;  3JXJ A;  3IV0 A;  2BKG A;  4Q96 A;  4KYO B;  3L22 A;  3LKU A;  4J0U A;  4K03 A;  2A5U A;  1HU3 A;  1H6O A;  5G05 C;  4HOR A;  3PZ2 A;  4GTS A;  1NI1 A;  3N71 A;  3OXF A;  1H2T C;  4TXQ A;  2VJ8 A;  1A5E A;  3C3O A;  3FTZ A;  1DVP A;  5BUZ A;  3S7J A;  2V4H C;  3TXN A;  4BT9 A;  3HVE B;  3C3R A;  4PH4 B;  2L6B A;  2KC7 A;  3UT8 A;  4GA0 A;  4R7L A;  1K8K G;  4U0S A;  3KS2 A;  1XGW A;  4I1M A;  1BD8 A;  4G26 A;  4MKT A;  3RJV A;  2AJA A;  3O4Z A;  2VYI A;  2LSU A;  3D9K A;  1YA0 A;  5BV1 A;  2XRY A;  4X8Q A;  5HKP A;  1TN6 A;  3DSU A;  3FUL A;  4LER A;  4B93 B;  5AAO A;  3RKV A;  2R03 A;  2R2L A;  4A55 A;  1MX2 A;  2PQR A;  2GRQ B;  1IXV A;  2KM4 A;  4B94 A;  4BTB A;  4HOS A;  3CHO A;  1JUQ A;  3ML9 A;  3ASO E;  2XZT G;  3TWV A;  1Z3X A;  2CFZ A;  3U4T A;  3MV2 B;  2WVI A;  4GZD A;  1BI8 B;  2OVF A;  3JUI A;  5FZR A;  2H6I A;  1MJ0 A;  1K3Z D;  2C0M A;  4DLO A;  1W3B A;  4KXK B;  5JA4 D;  4HI9 A;  4OAU C;  4AXH A;  3D9P A;  3V31 A;  4C0M A;  1LD8 A;  3ZNG A;  3PDN A;  2XEE A;  3QOU A;  4U0Z A;  3SY2 A;  4LNU D;  1TNU A;  3FY4 A;  4JHK A;  2F37 A;  3PEU B;  1TNO A;  3Q4A B;  2RD0 A;  2R02 A;  3QJZ A;  3DPY A;  4DPR A;  4JHJ A;  3B95 A;  3T8M A;  2DIW A;  3CK9 A;  1ELW A;  4RQI A;  3ULQ A;  5FT9 A;  5CMW A;  1Z3Y A;  5FZS A;  3AAA C;  3MKQ A;  3RRN B;  1D8E A;  5A23 A;  4JHR A;  5KNG A;  4BWR A;  3FUE A;  3SF4 A;  3QAR A;  1NL4 A;  3LS8 A;  5CEC B;  4EPZ A;  3ISM C;  1WM5 A;  3L16 A;  4J8S A;  2EIL E;  5CRU A;  4G23 A;  2IQC A;  3AS4 A;  3OTN A;  1N4P A;  4C48 B;  4DUI A;  5BW8 C;  1PAQ A;  1MQS A;  3SFY A;  4NQ0 A;  3ZYL A;  4B8C B;  3MZL B;  2GRO B;  4IRU A;  5EIL A;  5JJ7 A;  1N54 A;  3JXI A;  4J6I A;  1OWN A;  3KEA A;  3ZHE A;  1V54 E;  5DIZ A;  3S2A A;  5D0O D;  3BUA A;  1LD7 A;  1GW6 A;  5IY5 E;  1ELK A;  5KNH D;  2V4L A;  3ZN3 A;  2GRN B;  3ABM E;  1OUV A;  2HR2 A;  4GCO A;  4I9C A;  3ULE G;  4WAF A;  1EDU A;  3LY9 A;  4L7T A;  3TWX A;  3OXL A;  3I3N A;  4LUN U;  1E7V A;  3G2W A;  1E8X A;  5HQ8 A;  3EUV A;  5FIN A;  3EDT B;  4GMR A;  3ZEF A;  2GRP B;  4YDY A;  2QC9 A;  3B7B A;  2I6H A;  2OOE A;  3PRE A;  5ENN A;  3T9K A;  5FQ8 A;  3ASH A;  2KXP C;  3U64 A;  2GRL A;  3J5Q B;  3IKO B;  5D2M C;  3G2S A;  4HRM B;  2B0O E;  2NSZ A;  4JEU A;  2WXP A;  2OEW A;  2IO3 C;  4FHJ A;  1NA3 A;  3RO2 A;  4BY6 A;  2VTB B;  3QWP A;  4B8A A;  1FVH A;  3QC1 A;  3VLD A;  2L0I A;  2PM6 A;  2CHZ A;  1FT1 A;  3TXM A;  1K1B A;  3APF A;  3DSX A;  4HBD A;  1D9S A;  5EN5 D;  4N3C A;  2UY1 A;  3TG4 A;  3DRA A;  3ONK A;  3R9A B;  3IHV A;  4MBG A;  4YDE A;  5LCW J;  3E4B A;  3MJW A;  3D9H A;  3BQO A;  3ABL E;  1P5Q A;  1N4R A;  4K0R A;  3UQ3 A;  3FUH A;  3L9T A;  2DCP A;  3KD7 A;  3JCK C;  1SQM A;  2LO6 A;  3Q75 A;  4ME2 A;  2XS8 A;  1BLX B;  4HOU A;  2L0T B;  1OT8 A;  2AXU A;  3PNL B;  3I5P A;  2XGM A;  3PUK A;  4CDR A;  2V8S E;  2UWJ G;  4CT0 A;  4WWN A;  2P9I G;  3E37 A;  5KJM A;  3ZGQ A;  3C5R A;  3U66 A;  4UUC A;  4CRW A;  4MS6 A;  1OWL A;  3Q15 A;  3ESK A;  4GA1 A;  1KT1 A;  4A1S A;  4FLH A;  4L23 A;  3QNK A;  3LY7 A;  1O1R A;  3CGH A;  3RAU A;  1FCH A;  3FDH A;  4UWK A;  3ZYK A;  4I6G A;  3HG0 D;  3EHN A;  3AG3 E;  3NF1 A;  3L17 A;  4JZY A;  1S63 A;  5B3S E;  4GZ6 A;  4NAC A;  3HDX A;  5BT1 A;  5KWD A;  2WXN A;  1JCQ A;  2J08 A;  2XPZ A;  3Q73 A;  3HXF A;  5LOZ A;  4ILG A;  1Y6I A;  4OVU A;  2VGY A;  3ZXP A;  5EKQ D;  1N94 A;  3ONL A;  3ZPJ A;  5AQA A;  2X6F A;  4K5A B;  5G04 J;  4AEZ C;  4GTR A;  3FP3 A;  2XGS A;  1IQU A;  1N4Q A;  3CVX A;  5CRV A;  3LCA A;  4ATG A;  3APD A;  2A4Z A;  3L08 A;  5CEA A;  3CSF A;  3C3Q A;  4CGV A;  4F7A A;  4FC8 A;  4YND A;  5H7P A;  4HRL A;  3CK7 A;  3U9W A;  5CCM A;  4FUL A;  1O5M A;  3BG1 B;  1H6P A;  5T3R A;  3I4G A;  2BTD A;  3CQG B;  1WAO 1;  2L6J A;  5AQ9 A;  2AW6 A;  4GTP A;  4WWO A;  4L1B A;  2V0P A;  5J08 A;  3LYA A;  3UTM A;  1HX8 A;  2J4D A;  2EQX A;  1JPL A;  3FUM A;  1LTX A;  4HNA D;  4Y6W A;  2A5E A;  1HFA A;  4FJZ A;  3SFX A;  5FIO A;  4TXR A;  2PL2 A;  5T8I A;  2IU1 A;  4JVS A;  1FPP A;  3EIQ C;  4G8L A;  5KCM A;  3GZ1 A;  4G1T A;  4ANU A;  1D8D A;  4B0Z A;  1OCR E;  1H2V C;  4FHK A;  1NFI E;  2Y4T A;  4AM9 A;  3FH8 A;  2GW1 A;  5ENQ D;  3ASN E;  4HQD A;  2XEV A;  2WXR A;  4N3B A;  4KVM A;  5CED B;  4EZJ A;  3UMV A;  3RO3 A;  5KJL A;  1S64 A;  5FQ4 A;  3SI5 A;  4BEP A;  3UT4 A;  2XZD G;  4TXP A;  2FI7 A;  1SW6 A;  4GMJ A;  1YCS B;  3FTU A;  1OY3 D;  3B7S A;  3CVV A;  4O6F A;  4TV3 A;  4GZ3 A;  2EIM E;  3CV0 A;  5ENR D;  2P9L G;  3QB2 A;  3AG1 E;  3CR3 A;  1JCS A;  4RVB A;  4TUU A;  3UI2 A;  1UOH A;  3W9G A;  1JCR A;  1IKN D;  3DSS A;  4KBQ A;  1OWO A;  3QKY A;  4APF A;  3ZFW A;  2X3M A;  3JYS A;  3ABK E;  1UG3 A;  4LEU A;  1U2V G;  4N39 A;  2X6J A;  3SD5 A;  3MA5 A;  3W9F A;  5AQ7 A;  3S7F A;  3SHF A;  2CFU A;  1TNY A;  3ZUV B;  3LJN A;  1KT0 A;  2DZN A;  2J49 A;  1E8Z A;  1E8W A;  5KBA A;  1KPS B;  3IEG A;  4JA7 A;  3FUF A;  4JC8 A;  1ZU2 A;  1TN7 A;  3OAW A;  2R5S A;  1UJJ A;  1V55 E;  2HE0 A;  3IHY A;  2PNN A;  4I1A A;  2EIJ E;  4XI0 A;  1FVF A;  1QZ2 A;  4KMO A;  4CDN A;  3NBN B;  2RKK A;  3AS8 A;  3MCX A;  4WNG A;  4U7E B;  2VGX A;  3CIA A;  3CVN A;  4ZHB A;  2IY0 C;  4E6H A;  5FWQ A;  4D10 C;  3NOG D;  1DC2 A;  2HO1 A;  3EJN A;  2AVP A;  3KEZ A;  3ZYM A;  3FUJ A;  4EZK A;  3Q7A A;  2RFA A;  4KT6 B;  3CVQ A;  4HRN A;  3TWW A;  4PS7 A;  4HS2 A;  3D9O A;  3VTY A;  2F8Y A;  3DSW A;  5T4Y A;  3V2X A;  2ZGD A;  1O1T A;  4UQY A;  4A3T A;  1X5B A;  1N9A A;  4QFV A;  4UQZ A;  4DK5 A;  2OEV A;  3LJ3 A;  4IN3 B;  4CT4 A;  3PE4 A;  3UM1 A;  4U8Y D;  2C2L A;  2QY7 A;  3CHM A;  2X6I A;  2C0L A;  4FJY A;  2QYJ A;  3RIB A;  4BET A;  2WXH A;  4DI3 A;  4LRZ A;  3UM0 A;  5HRY A;  1YYH A;  5AN8 A;  2AXZ A;  3OXG A;  4URK A;  1E90 A;  2WQ6 A;  5J90 A;  2KZT B;  4G25 A;  3RK6 A;  3G2T A;  1DNP A;  3CHP A;  1TEZ A;  4U0U A;  4LNG A;  5EIB E;  2WMN A;  4YDW A;  2YNQ A;  4ATZ D;  4H7Y A;  4J8D A;  4UWH A;  2PQN A;  4DX6 D;  2GRR B;  3D9N A;  3T5V A;  4G11 A;  3QWV A;  3L13 A;  3ZU7 B;  3DEO A;  1WY6 A;  4UI9 J;  3UUX A;  4ABN A;  3ESL A;  2ZU6 B;  2E2E A;  3FEX A;  3D9J A;  4NUR A;  2J09 A;  3FTX A;  1WDY A;  2H6F A;  4J8F A;  3SFZ A;  4N3A A;  2JAB A;  2WXL A;  5AJL A;  4I17 A;  2YQ8 A;  3HRA A;  5G55 A;  5CBN A;  1IHG A;  4W9R A;  2F0Y A;  2VSX E;  3G2V A;  3UPV A;  2ETB A;  3MGB A;  5KJK A;  4U96 D;  3UIO C;  1N11 A;  3GZS A;  4JB8 P;  5AYW D;  3TWT A;  2XRZ A;  4MRU A;  2OV8 A;  3X2Q E;  5EX0 A;  3CHS A;  5EID A;  3ZRH A;  2KCL A;  2LUH A;  4M3O A;  3P2B A;  4PUC A;  3Q79 A;  3PH0 C;  3ENE A;  1QQE A;  3FFL A;  2ZIS A;  5B1A E;  3CST A;  2XEH A;  4PS8 A;  5LFA A;  4NIK A;  4YVO A;  3DBS A;  3I4R B;  4XKB A;  1N95 A;  2CG2 A;  2V5F A;  4C9B B;  4DX7 D;  4JD2 G;  2MHK A;  2WXF A;  4HXI A;  3D3M A;  3T5X A;  2CHX A;  2XS1 A;  2XQ0 A;  3ML8 A;  3HVE A;  4I1O B;  2KBX A;  5B1B E;  2XCB A;  1IHB A;  1UN8 A;  2PZI A;  5AIJ A;  4N2Q A;  4OVV A;  3UIP C;  3CQC B;  3FTV A;  4HI8 A;  5AJD A;  3SGH A;  4A63 B;  2Y1L E;  4DX1 A;  3FUD A;  1OCO E;  4Z68 A;  4JXT A;  5ENT D;  2BUG A;  4I9E A;  4PDX A;  1Q2Z A;  3RRM B;  3L6A A;  4HOQ A;  3TAX A;  1H0A A;  3SBT B;  2ETC A;  4DLQ A;  3LVR E;  3JUE A;  2Y69 E;  3LPZ A;  1IYG A;  3AU5 A;  3R7R A;  2P9N G;  4I2W A;  4FA6 A;  2QFC A;  4WNE A;  4GCN A;  4GYO A;  2F8X K;  5FQ6 A;  3AG2 E;  3C72 A;  3UKR G;  5G04 C;  4F1S A;  3GYZ A;  2CG3 A;  2I2O A;  1EPU A;  1L5J A;  1BI7 B;  3EU9 A;  3P1U A;  1HH8 A;  3ZVV A;  4OAV B;  4K5B A;  4O1P A;  3DWL G;  4GPK A;  2P2C P;  4GTV A;  2GRM A;  4G8K A;  1OCC E;  2PM7 A;  3TWR A;  2BF0 X;  3HXE A;  3LY8 A;  3ZXS A;  2LXM A;  4GA2 A;  1KLX A;  3FTW A;  4CZ2 D;  4DI4 A;  2KCV A;  4GZ5 A;  2ILR A;  3MKR A;  2CHW A;  4ILH B;  4J7W A;  2P9U G;  5A7D B;  4EQF A;  1UJK A;  4U04 A;  4EBA A;  2WXQ A;  3BEE A;  3HHM A;  2HYZ A;  4MLP A;  1N0R A;  3PZ4 A;  1NP7 A;  3DEP A;  4L2L A;  3FUK A;  1HS6 A;  3UM3 A;  2Y0B G;  3MKQ B;  3PUJ A;  2I1K A;  4L9P A;  1IQR A;  2FBN A;  4WWP A;  4RG6 A;  4N5Q A;  2DYS E;  2ZGG A;  4CGW A;  3E32 A;  4GU5 A;  4EEC A;  2DVW A;  3UKU G;  3LDZ A;  4H7X A;  4F1P A;  4Q94 A;  4PS3 A;  3B13 A;  5BXO A;  4U8H A;  3CKC A;  2R05 A;  4GYY A;  3FEY A;  4U07 A;  2KCK A;  3HIZ A;  4C0E A;  3S7D A;  4ILI A;  2X6H A;  4LSZ E;  4APO A;  4O1O A;  5AQB A;  5C1D A;  4KZ0 A;  1K1A A;  3SBS A;  3S7B A;  4AVX A;  4AY6 A;  5KJN A;  3ZHE B;  1KZO A;  1WG0 A;  3MYV A;  2J4B A;  3QAQ A;  1MYO A;  3SZ7 A;  3PS6 A;  5JHA A;  4AY5 A;  4UQX A;  2L9B A;  2J8S D;  3ASF A;  2JLB A;  2BED A;  4CYM D;  3V2O A;  4XKC A;  1VDY A;  3NAW A;  5JJ6 A;  2QYU A;  2VGE A;  4I6J A;  5EYP F;  4AV7 A;  4FP7 A;  1OWP A;  3B7U X;  2XPI A;  2RG8 A;  1MX4 A;  2FO1 E;  2DBA A;  5BV0 A;  3CK8 A;  1AWC B;  3BG0 B;  3G2U A;  2OND A;  4FAD A;  1AP7 A;  3NOC D;  4J8Y A;  3FTY A;  2VTB A;  1E8Y A;  3DPD A;  5ENO D;  1NA0 A;  3F6Q A;  4ACK A;  4RLY A;  5D66 A;  4DRX E;  2OCC E;  3PVL A;  4UWF A;  4WNF A;  3T8K A;  4XEI G;  4I43 A;  2I1J A;  4HLE A;  3KAE A;  4UWL A;  3NQP A;  2AXV A;  5ARG A;  2OVB A;  4JL0 A;  2V5Q C;  3Q7F A;  1HG2 A;  3D9I A;  4TRQ A;  2FUL A;  2UY1 B;  1E96 B;  4GTO A;  3RU0 A;  4N2S A;  3DST A;  2DWZ A;  4F3V A;  4FLB A;  5M72 A;  4UI9 K;  3JQ0 A;  3AG4 E;  2LAI A;  2XGO A;  2IF4 A;  3V79 K;  1PY1 A;  3Q49 B;  3KSL A;  3FU6 A;  2WXJ A;  3AS5 A;  1H19 A;  5G05 J;  3EHM A;  4BSX A;  1JWG A;  2IO2 C;  1DCQ A;  2VSY A;  3MX3 A;  3Q9N C;  3HXC A;  2IOS A;  3VLF A;  5JHB A;  4I6E A;  4EHM A;  4GPM A;  4BER A;  2P9K G;  4WND A;  1Z6T A;  3EHR A;  3E30 A;  1LF8 A;  5ANL A;  1JWF A;  4UI9 C;  1XNF A;  2NXP A;  3PEV B;  4XZ4 A;  3CVP A;  5ARF A;  2R59 A;  3B7T A;  3URZ A;  2MYO A;  4RSY A;  3UXG A;  4M7C A;  5ITZ F;  5G2N A;  4HOT A;  1OWM A;  4ANX A;  3UT7 A;  3EIJ A;  4BFR A;  2E0I A;  3TGO A;  3VTX A;  5FTP A;  3FTS A;  1H6K A;  4BTA A;  2EIK E;  1A17 A;  5JMN D;  2WMO A;  1YMP A;  1ELR A;  3FU5 A;  3ULY A;  1QNF A;  4JEH A;  3FU0 A;  2WM9 A;  3R7Q A;  2XEN A;  2DYR E;  5ENP D;  4BX8 A;  3E34 A;  2JEK A;  1SA4 A;  2XCC A;  4HFG A;  1UN9 A;  4AOF A;  4P29 A;  5DBK A;  4DJA A;  4BT8 A;  3D9M A;  1OXJ A;  3DXK G;  2LXL A;  2H6H A;  4HB5 A;  4B89 A;  1HG5 A;  3TG5 A;  2YIN A;  3ZKJ A;  3FHE A;  3TWU A;  5AAR A;  1HF8 A;  2ETA A;  2YHE A;  4CCA A;  3EHQ A;  1U3C A;  1INZ A;  3K9I A;  5BPP A;  3GW4 A;  3AJI A;  1HO8 A;  4JW1 A;  3CLJ A;  3PZ1 A;  2WXG A;  2X38 A;  3GZ2 A;  4U95 D;  5A6C A;  3CEQ A;  1KZP A;  4J8E A;  4A3V A;  4LCT A;  3DSV A;  4XE0 A;  3SO8 A;  2ION A;  4EZL A;  1QYM A;  1N0Q A;  2LSV A;  4GTQ A;  4A1G A;  3CVY A;  2VSO E;  3APC A;  3PRZ A;  5D0Q D;  3UIN C;  5BXU A;  3FWV A;  1TNB A;  3DXM G;  5LCW C;  3NZU A;  2RFM A;  2GGF A;  4TUM A;  2WPV A;  3SNX A;  3VLE A;  4U8V D;  3Q5M A;  4F6R D;  2LNI A;  2LAH A;  4I2Z A;  3CVU A;  4RG9 A;  5E75 A;  3IXE A;  1HXI A;  2WB2 A;  2EIN E;  3NB2 A;  4XX5 A;  1Z5S C;  2VQ2 A;  1BPO A;  2IOL A;  5EYL A;  4G2V A;  3ZYQ A;  3AU4 A;  2R17 C;  2FF4 A;  4NRH B;  3EU5 A;  4JA9 A;  1EF1 C;  3RRU A;  1PC2 A;  3PNT B;  3ASG A;  2NC9 A;  3RSE G;  2M63 A;  1U3D A;  4LG6 A;  2DZO A;  2BKK B; 
#chains in the Genus database with same CATH homology
 3J5Q B;  4BES A;  4U8Y D;  1N11 A;  3AJI A;  4N5Q A;  4BER A;  5CEC B;  4JB8 P;  4B93 B;  3TWT A;  5AAO A;  3TWS A;  4HRM B;  2ZGG A;  1AWC B;  5AQ9 A;  4HLL A;  1AP7 A;  1S70 B;  3NOC D;  4J8Y A;  2B0O E;  3EHR A;  2DVW A;  1MX2 A;  5EID A;  4DX2 A;  1IXV A;  4U95 D;  3UTM A;  3W9F A;  5AQ7 A;  2QYJ A;  4BET A;  3ZUV B;  1G3N B;  3LJN A;  4DX5 D;  4F1P A;  2F8X K;  2XZT G;  2DZN A;  3TWV A;  1SVX A;  3SO8 A;  3J5P A;  5ENO D;  5BXO A;  3HG0 D;  3F6Q A;  5KBA A;  2XEH A;  4QQI A;  5HS0 A;  1QYM A;  4RLY A;  5D66 A;  5HRY A;  3JXJ A;  4DRX E;  4HNA D;  1N0Q A;  1YYH A;  2BKG A;  4NIK A;  5AN8 A;  2A5E A;  4C48 B;  4DUI A;  5FIO A;  5CER B;  2HE0 A;  2MYO A;  2PNN A;  3UXG A;  1BI7 B;  1K1B A;  2NYJ A;  3EU9 A;  5BXU A;  5KWD A;  1BI8 B;  3T8K A;  4HBD A;  5ITZ F;  4G8L A;  3NBN B;  1D9S A;  4BSZ B;  4DX7 D;  5EIL A;  2RFM A;  5EN5 D;  3TWQ A;  1MJ0 A;  1K3Z D;  4OAV B;  3JXI A;  4K5C A;  4K5B A;  4LSZ E;  5EIB E;  4TUM A;  4O1O A;  3KEA A;  2V5Q C;  4O1P A;  4YDW A;  5AQB A;  1NFI E;  4ZHB A;  2P2C P;  1A5E A;  4U8V D;  4F6R D;  5JA4 D;  1TR4 A;  4G8K A;  4HI9 A;  4OAU C;  4ATZ D;  1K1A A;  3NOG D;  3V31 A;  1DC2 A;  5ENQ D;  3TWR A;  4DX6 D;  5JMN D;  4ZFH A;  4HQD A;  3ZNG A;  2XEE A;  1YMP A;  2V4H C;  1WG0 A;  3D9H A;  5AQA A;  3IXE A;  5KNH D;  2KBX A;  3V30 A;  4CZ2 D;  2DWZ A;  3DEO A;  3ZU7 B;  4LNU D;  5CBO A;  1IHB A;  4K5A B;  5CED B;  1MYO A;  2RFA A;  2L6B A;  1MX6 A;  2F37 A;  2XEN A;  5ENP D;  4HI8 A;  4HRN A;  2J8S D;  3TWW A;  4J7W A;  4A63 B;  2Y1L E;  4DX1 A;  5EYL A;  4BEP A;  5ENS D;  3TWX A;  2XZD G;  3B95 A;  1WDY A;  4Z68 A;  2F8Y A;  1BLX B;  1BD8 A;  1SW6 A;  4CYM D;  3V79 K;  5ENT D;  1OT8 A;  1YCS B;  3V2O A;  1OY3 D;  3V2X A;  2ZGD A;  5FIN A;  5CEA A;  2AJA A;  2JAB A;  4GMR A;  4YDY A;  5ENR D;  2QC9 A;  2VGE A;  4HB5 A;  3AAA C;  4QFV A;  3Q9U C;  1BU9 A;  1N0R A;  3B7B A;  4O60 A;  3HRA A;  4HRL A;  5EYP F;  3DEP A;  5CBN A;  2ETC A;  3UI2 A;  1UOH A;  3ZKJ A;  1DCQ A;  3TWU A;  5KNG A;  5AAR A;  3W9G A;  3Q9N C;  1IKN D;  2ETA A;  3JUE A;  2Y0B G;  3C5R A;  2DZO A;  4LG6 A;  1MX4 A;  3EHQ A;  5HKP A;  2BKK B;  3T9K A;  2FO1 E;  2ETB A;  2KXP C;  4UUC A;  4U96 D;  4GPM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...