1K1AA

Crystal structure of the ankyrin repeat domain of bcl-3: a unique member of the ikappab protein family
Total Genus 73
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
73
sequence length
228
structure length
228
Chain Sequence
EDGDTPLHIAVVQGNLPAVHRLVNLFQQGGRELDIYNNLRQTPLHLAVITTLPSVVRLLVTAGASPMALDRHGQTAAHLACEHRSPTCLRALLDSAAPGTLDLEARNYDGLTALHVAVNTECQETVQLLLERGADIDAVDIKSGRSPLIHAVENNSLSMVQLLLQHGANVNAQMYSGSSALHSASGRGLLPLVRTLVRSGADSSLKNCHNDTPLMVARSRRVIDILRG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of the ankyrin repeat domain of Bcl-3: a unique member of the IkappaB protein family.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription
molecule keywords B-cell lymphoma 3-encoded protein
total genus 73
structure length 228
sequence length 228
ec nomenclature
pdb deposition date 2001-09-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00023 Ank Ankyrin repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.20 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Ankyrin repeat-containing domain 1k1aA00
1YMPA 3TWRA 4HI8A 2ZGDA 4HRNA 5BXOA 5CBNA 4OAUC 1D9SA 3ZNGA 2DWZA 2PNNA 5AN8A 3J5PA 4HI9A 3Q9NC 1YYHA 3ZU7B 4GPMA 1IXVA 2J8SD 2ZGGA 4J7WA 3W9FA 3EHRA 2BKKB 4BSZB 5HRYA 5D66A 1BI8B 1QYMA 5FINA 2VGEA 3V2OA 4F6RD 4DX2A 2RFMA 5ENPD 3NBNB 3V79K 5AAOA 5EYPF 1N0QA 4K5AB 1BLXB 5HKPA 5CERB 4RLYA 2HE0A 1NFIE 5ENTD 3TWQA 3UI2A 1MX6A 4HB5A 4TUMA 3B95A 3F6QA 2Y0BG 1K3ZD 1WG0A 1K1AA 3TWUA 3LJNA 1YCSB 5KNHD 2V5QC 4HRLA 2QC9A 2DVWA 3ZKJA 1G3NB 5CECB 3ZUVB 2Y1LE 5ENOD 4O60A 4U8YD 3TWWA 4QQIA 5AQ7A 2DZNA 4UUCA 2DZOA 4U8VD 4BESA 4DX7D 2F37A 3V2XA 2XZTG 3T8KA 4HRMB 4J8YA 4GMRA 3V31A 3TWSA 5EIBE 3UXGA 1MX2A 1DC2A 2AJAA 5EYLA 4HBDA 1BU9A 1WDYA 1DCQA 2BKGA 2ETAA 1TR4A 3TWVA 2RFAA 5ENSD 2ETBA 3UTMA 4HNAD 4ZFHA 4O1PA 2XENA 4QFVA 1OY3D 3EU9A 1K1BA 3TWTA 4LSZE 2JABA 3KEAA 1AWCB 4N5QA 3AAAC 4O1OA 3W9GA 2NYJA 5BXUA 1N0RA 3NOCD 1UOHA 4K5CA 2P2CP 1SW6A 1A5EA 5ENRD 4K5BA 4CZ2D 2MYOA 5HS0A 3J5QB 2XEHA 3AJIA 4U95D 4YDWA 4BEPA 5EIDA 4DX1A 4C48B 1SVXA 4G8LA 5EILA 5AARA 1N11A 3HRAA 3TWXA 3JXIA 3C5RA 2KBXA 5AQBA 1OT8A 4DX6D 4DX5D 4LG6A 4U96D 2ETCA 3DEPA 4YDYA 2B0OE 4F1PA 2XEEA 4OAVB 2A5EA 4BERA 5FIOA 5CBOA 3JXJA 3D9HA 5JMND 3SO8A 1MYOA 4HLLA 4JB8P 4LNUD 4ATZD 5ENQD 3DEOA 3B7BA 4G8KA 2QYJA 2L6BA 3HG0D 1MX4A 1BI7B 1MJ0A 4ZHBA 3V30A 2FO1E 3Q9UC 4HQDA 3T9KA 5JA4D 1AP7A 2F8YA 4CYMD 3EHQA 5AQAA 1IKND 4DUIA 2V4HC 5ITZF 2F8XK 5AQ9A 4DRXE 3IXEA 5KBAA 2KXPC 5CEDB 5KNGA 2XZDG 5CEAA 3NOGD 1BD8A 1S70B 4A63B 3JUEA 4NIKA 4B93B 4Z68A 5EN5D 5KWDA 1IHBA 4BETA
chains in the Genus database with same CATH superfamily
4YDOA 1ZBPA 4HOTA 2PL2A 3ZRHA 5FZRA 3SY2A 2ZIRA 1YYHA 3OXFA 3G2VA 4NACA 5D66A 1FCHA 4DX2A 1EPUA 1OWMA 2WXHA 4LNBA 4CGWA 3ZPJA 4GZ3A 3TWQA 1OUVA 3B95A 2Y69E 4G11A 3I4RB 3ZUVB 4O60A 3QOUA 4A3TA 3C3QA 3NAWA 5FZSA 1D8EA 3UXGA 4G25A 3ENEA 3T8MA 3L9TA 2ETAA 4UQYA 1TR4A 2RFAA 2VGXB 5FZQA 2J4DA 4Q69A 3SD5A 4LEUA 4I6EA 3PZ2A 3KEAA 2YQ8A 2J07A 4GTMA 1A5EA 1IQRA 3G2UA 3SFYA 3B7UX 2VQ2A 2WMOA 3FFLA 2XEEA 2DYRE 5CBOA 3CK9A 1MYOA 5AIJA 3ESKA 3ML9A 1PY1A 4JHKA 4BX9A 4XI9A 3LKUA 3CKBA 1N9AA 4TV3A 1E7UA 4ILIA 3FTWA 4DRXE 2QY7A 2LNIA 3IXEA 2P9LG 3SQVA 2KCLA 3VTXA 5CEAA 2R05A 3HXDA 4HOQA 3RO3A 2GRMA 3FUFA 4Z68A 5KWDA 5CCMA 1IHBA 5B3SE 2GRNB 5G05J 2CG2A 4RQIA 3EHRA 2X3MA 2XEVA 1KZPA 3APCA 5BV1A 3AG1E 3F6QA 1NA3A 4ATGA 3CVYA 3FUJA 4ANVA 1W3BA 3VLDA 4A3VA 4GTQA 4GA2A 2XRZA 3ZFWA 2AJAA 4IULA 3CHOA 4QFVA 1HU3A 3CVNA 3ULYA 3HXCA 2X6JA 3N71A 3IEGA 4HOSA 2LSUA 2NYJA 3EUVA 1HO8A 3JCKC 3U3WA 2MYOA 5HS0A 4OAUC 5FQ7A 4JHRA 4JW1A 4U96D 3UIOC 1FVHA 1TNUA 1N4QA 2X38A 3T5XA 3LYAA 3B7BA 4XKCA 5KJKA 5BPPA 1OXJA 2IQCA 2OOEA 4L2LA 4FHJA 5KBAA 3FUNA 4AEZC 4ACKA 2WQ7A 1TNYA 5A23A 3QNKA 4AP2A 1OCCE 2P9UG 3FEYA 4BSXA 1IXVA 2LSVA 3RO2A 2XPYA 3QB2A 4F6RD 1L5JA 3CHPA 1BLXB 5FQ6A 2CHWA 4HFGA 3L16A 3BEEA 4IYPA 1WG0A 3TG5A 4L23A 3ZYLA 5BUZA 5CECB 5ENOD 3JYSA 4J6IA 3IKOB 3E33A 4QQIA 4FLBA 5CHEE 5ANLA 5D0OD 3ULEG 4GZ5A 1OWLA 1MX2A 1DC2A 3FTUA 4KVMA 2BKGA 4O1PA 4U7EB 2XENA 2Y3AA 1OCZE 2P9IG 2WXQA 3URZA 5JHAA 2AXUA 3ZIMA 1DCEA 3ZYKA 3EHMA 3ASDA 4OVUA 1HXIA 3JXIA 2C0MA 2KBXA 4DLQA 4B8CB 4OAVB 1QZ2A 1UN8A 3FH7A 3L22A 4WNFA 3SGHA 4JZYA 4G24A 3LCAA 4UI9K 4F53A 3TG4A 5A6CA 3MCXA 3SHFA 4ACLA 2RKKA 5JA4D 1HG5A 2WXLA 3HXBA 2GRLA 3UINC 2FULA 3CVLA 3CVVA 4KYOB 5BXOA 4HRNA 1D9SA 2IY0C 2V8SE 4FLHA 3DPDA 2NXPA 4WNDA 2XCBA 2AVPA 3NBNB 3E37A 4K5AB 2HE0A 1Z5SC 4HS2A 5M72A 4CRWA 3D9JA 2DBAA 1E7VA 3UIPC 3UMVA 3ASHA 1HX8A 1EF1C 3LJ3A 3D9MA 2Y1LE 1E96B 1BPOA 1Z3XA 2I6HA 4W9RA 3VLFA 1FT2A 1H19A 2EINE 3QWPA 4X8QA 3SF4A 1BU9A 4JVSA 4KBQA 3FDHA 3OAWA 4JA7A 2PQNA 2P2CP 3R7RA 3IHYA 4K5BA 3MA5A 4FC8A 3AJIA 3NZUA 3U9WA 3ZYMA 3SI5A 3HRAA 2VTBB 3TXNA 2CFZA 4F1SA 1PAQA 4TUUA 3RIBA 3IV0A 4BERA 5FIOA 2H6IA 2V4LA 1O5MA 2VGYA 2L6BA 2WM9A 2IEJA 3C3RA 3TAXA 3ASGA 5CMYA 3T9KA 2R59A 4MKTA 3NF1A 5CEDB 3LEWA 4A63B 2WXNA 3I3NA 3Q47B 3CK8A 4JHJA 4JC8A 5BNWA 2I1KA 3ZEFA 2X6KA 3UM3A 3APDA 4TRQA 5AAOA 3RSEG 5G04C 4I1OB 3WXXA 4TUMA 3L54A 1JCRA 1N4SA 3ZHEB 2EIME 3MJWA 2L0TB 3RRNB 4OVVA 3KSLA 4N2QA 4NRHB 2DZNA 4BFRA 2E2EA 4HRMB 4I6GA 2RG8A 5G2NA 4Q96A 4BTAA 3LPZA 3UTMA 2GRQB 4WNGA 1K1BA 3RAUA 3FULA 2Y4TA 3PRZA 5D0QD 4EBAA 1FPPA 3J5QB 3S7JA 4XZ4A 5B1AE 1UG3A 1SZAA 4ANUA 4I2ZA 2B0OE 5ARFA 2WXIA 3SNXA 3ABKE 2VJ8A 3HG0D 5FWQA 2XPIA 4GTOA 1V54E 4AIFA 3CQGB 3GZSA 4JL0A 3UPVA 4HQDA 4EZJA 3UM2A 5AQ9A 3GZ2A 2KXPC 2R03A 4GU5A 3UKRG 4BY6A 4HOUA 2WVIA 3Q4AB 2OVFA 3TWRA 5CBNA 3R7QA 3O4ZA 3W9FA 5LFAA 2WXJA 4GA1A 2ZU6B 3UM0A 3V79K 1N4RA 2P9KG 5T4YA 1MX6A 2Y0BG 4AY5A 1K1AA 4I2WA 3HXFA 1YCSB 3Q5MA 3I5PA 3EHNA 1G3NB 1X5BA 3PZDA 4Y6WA 4U8VD 3V2XA 3EIQC 4BT8A 1E90A 5J08A 1HE8A 3QWVA 3BG0B 4GMRA 3V31A 1OWPA 3VLEA 4XEIG 2KCKA 5AJDA 2BF0X 3AAAC 3PREA 4O1OA 3IHVA 2LAIA 5T8IA 4DX1A 5KJMA 5FJYA 2L0IA 3C5RA 2MRIA 2A5EA 3D9HA 1SA4A 1PC2A 4J0UA 4WWOA 2J4BA 3CKCA 5FQ4A 3RU0A 2XS1A 3ZVVA 4J8DA 4A55A 3EHQA 5AQAA 3EIJA 4C0MA 3ULQA 1KT1A 2UY1A 3CSTA 3OXGA 4AXHA 1FT1A 2PNNA 4GAAA 1H6KA 1S64A 4URKA 1H0AA 2UY1B 3CHMA 3QAQA 3DSTA 3ESLA 2VGEA 3GYZA 5LCWJ 2RFMA 5EYPF 2H6HA 1ZU2A 1N4PA 2OCCE 1TN8A 3NB2A 1OCOE 3MYVA 4HB5A 4LERA 1K3ZD 2VSNA 4WWPA 3LJNA 3HDXA 3GW4A 1O1RA 3Q49B 3FUKA 3TWWA 3U64A 4DX7D 4RVBA 3T8KA 4GCNA 4DI3A 3FU0A 5EIBE 3QC1A 2CFUA 4UQZA 3FUIA 4PH4B 3CSFA 2QFCA 2YHCA 3NOCD 5C2YA 4J8FA 3APFA 4PUCA 3TWXA 3FTSA 3LDZA 5AQBA 1UJKA 1RW2A 2P9SG 1MHQA 3QJZA 4L7TA 2FEZA 3CVPA 4GMJA 3QKYA 4G26A 3DXKG 3KSQA 3E4BA 1XNFA 2WXGA 2JLBA 3PVLA 1ELWA 3HVEB 1JWFA 3FUDA 2WXPA 3ASOE 4JEHA 4E85A 3NOGD 1S70B 4CDNA 2Y4UA 3CK7A 1ELKA 2PM7A 2IO3C 1TYQG 5BV0A 5BT1A 3LS8A 1TN6A 5G04J 3Q15A 2WPVA 3MZLB 3FTZA 2CG3A 4KT6B 1S63A 4BSZB 1BI8B 5FINA 2R2LA 3D9KA 2XRYA 1QBQA 1N0QA 3QWWA 5HKPA 4MBGA 4U0ZA 4AVXA 5KJLA 2CHZA 3HXEA 3AU5A 4MRUA 4XX5A 1KZOA 1MQSA 2AXZA 2MHKA 4FULA 4BTBA 2LXMA 4FP7A 4F3VA 2R17C 5HI7A 4UWFA 3HHMA 4GZDA 4O6FA 2MOWA 2JABA 4APFA 3MX3A 2KZTB 3ZGQA 3CR3A 4CZ2D 4KVOA 4U95D 3CVQA 4NQ0A 4DX5D 2XQ0A 2OV8A 4I1MA 1E8WA 2DCPA 3HYMB 2WXKA 5EX0A 3FU5A 2IFUA 2FO1E 4I17A 3ZHEA 3BG1B 1TJCA 5CCLA 5BW8C 3FP3A 3ZXPA 2YHEA 3L6AA 1X81A 4L2YA 4AOFA 1O1TA 4P29A 4NURA 2GW1A 4GTPA 4CDMA 2P58C 3OTNA 1VDYA 2RD0A 2J8SD 2ZGGA 3PZ4A 3D9LA 3ASFA 5HRYA 3UX4A 1HS6A 3FY4A 4XIFA 2EILE 3PNLB 5ENTD 3UT7A 2FBNA 3CVUA 4UQXA 4GTSA 2ZISA 4MS6A 1E8YA 1HFAA 4MLPA 1NZNA 5LP0A 1E8ZA 1EYHA 2LAHA 1MZCA 2ILRA 2XPZA 3EU9A 4G1TA 4TXPA 4BX8A 1AWCB 4PS8A 5BXUA 5FQ8A 3CHQA 1LTXA 3ZXSA 1SVXA 4J8EA 4GYOA 4AV7A 2IOSA 3PE3A 2HO1A 3AS8A 1Z6TA 4U8HA 3FTVA 3D9NA 1MX4A 4RSYA 3B13A 3Q9UC 4B94A 4HLEA 4BWRA 3DSSA 2F8YA 2QYUA 4CYMD 1IKND 4EQFA 2V4HC 1XGWA 3OXLA 3I4GA 4GMLA 4GZ6A 1WAO1 2GGFA 3JXJA 1H6OA 4R7LA 1K8KG 2DYSE 2DWZA 3J5PA 4HI9A 4U04A 3ZU7B 2KM4A 3UM1A 3P2BA 3FUEA 3UT4A 1DNPA 3FU6A 3TWUA 1NA0A 1U2VG 2Q7FA 3O48A 3UQ3A 3FU3A 3LVRE 2KATA 3D9OA 4ANWA 2WXRA 4LRZA 3HVEA 4C0EA 4CCAA 4Q94A 5DIZA 4KMOA 3S7BA 4GB9A 1OY3D 3DSWA 3MV3B 1NL4A 4YDWA 5EIDA 3Q75A 4I1AA 3KAEA 5D2MC 2YNQA 3KS2A 5JMND 5ANRA 2J49A 3PH0C 3PUKA 3DEOA 5CRVA 3D9IA 4IN3B 4N39A 4FU3A 4YNDA 3MV2B 3QK0A 3S2AA 2VSXE 3FH8A 2VTBA 3Q78A 3JUEA 5E75A 5A7DB 2FI7A 2V0PA 2KCVA 5ENNA 5AN8A 4B89A 1EDUA 4I9CA 3TXMA 3Q9NC 5LX8A 4CEMA 1OWNA 2UWJG 3AS4A 1IQUA 1JCQA 5KCMA 4EHMA 3DRAA 4UI9J 4V3IA 3Q73A 2ONDA 1HG2A 1IHGA 3PZ3A 3UI2A 1NFIE 2E0IA 3D3MA 3D9PA 4DPRA 2KZTA 1H2VC 5JJ6A 1UN9A 4FJZA 4UWHA 3CLJA 2WXFA 5J90A 3AG4E 1WDYA 4ANXA 4ZFHA 3X2QE 3G2WA 4M7CA 3L82A 1LF8A 4GCOA 4K5CA 3PUJA 3DWLG 1N11A 4H7YA 1H6PA 1OT8A 2YINA 4UWKA 3E32A 1SA5A 1KLXA 2KC7A 3SO8A 3NZSA 4ATZD 4JB8P 3TGOA 4GTRA 1TN7A 4CT4A 2XS8A 1BI7B 5JJTA 1MJ0A 3HIZA 2V5FA 3PS6A 3S7DA 2EQXA 4E6HA 4JEUA 4B93B 1TEZA 5EN5D 1SZ9A 4BETA 3U66A 2XGSA 2XCCA 4FJYA 4ABNA 4HI8A 4L9PA 2C2LA 3FUHA 3KEZA 4ILGA 3UKUG 4A1SA 3PEUB 5ENPD 4AM9A 3SBSA 1Z3YA 1DVPA 2H6FA 1Y8MA 4EECA 4YDEA 4Y6CA 3K9IA 4KZCA 4N3BA 2V5QC 3ZKJA 2XGOA 2FF4A 2VSYA 2VGXA 2EIKE 4UUCA 2DZOA 1SQMA 3IBEA 4GYYA 2VYIA 3ABLE 3C3OA 3TWSA 1QQEA 4EZLA 5EYLA 1RZ4A 4HNAD 2R5SA 2P9PG 4YVOA 4N2SA 5B1BE 4G23A 1U3CA 1UOHA 3RK6A 5FTPA 4BEPA 3AS5A 4G8LA 3UUXA 2PZIA 3JUIA 1WY6A 2DIWA 3L13A 2LUHA 4HORA 1HF8A 3Q79A 2L6JA 2I1JA 2M63A 4LNGA 5KNGA 3DSUA 3PDNA 2I2OA 3E34A 4HVBA 1N94A 3DPYA 3DSVA 3B7TA 2ZGDA 3LXUX 4GYWA 2BKKB 3ASNE 2OVBA 2J09A 1H2TC 5T3RA 2J08A 3RRMB 4ILHB 1INZA 3C72A 2QC9A 2JEKA 3RRUA 3R9MA 4U8YD 4GA0A 3PE4A 4U0UA 4WWNA 5EX3A 3BU8A 4J8YA 4CDRA 4HBDA 5KJNA 4BT9A 3TWTA 5LCWC 3ISMC 3W9GA 5CRUA 1UJJA 3BUAA 1D8DA 1AP7A 4XKBA 3QDNA 5EILA 4EPZA 1V55E 4EBAG 1OWOA 3E30A 3DEPA 1IYGA 5G05C 3PNTB 3SFXA 4LCTA 5AENA 2WXMA 3FEXA 2I9CA 4HLLA 2BTDA 3DBSA 2IF4A 2P9NG 3SBTB 4G8KA 2H6GA 1YA0A 4ZHBA 1JWGA 3AG3E 2IU1A 2WMNA 5G55A 4AY6A 4DUIA 4FA6A 2OEWA 4M3OA 4APOA 3MKRA 1GW6A 4J8SA 5AYWD 4NIKA 2IONA 3WG7E 4N3AA 3CGHA 2A5UA 3SFZA 3G2TA 1QYMA 3FWVA 5IY5E 5H7PA 4RLYA 3R9AB 4AJWA 3L17A 4KXKB 1WM5A 2AXVA 1Q2ZA 4C9BB 1N52A 3U4TA 3Q7AA 3FUMA 4H7XA 5EDSA 1S0PA 5AQ7A 4BESA 3P1UA 4WAFA 1LD8A 3QARA 1NP7A 1DCQA 3S7FA 2ETBA 2BEDA 1ZB1A 2IO2C 4JD2G 2XGMA 1N0RA 3LY9A 1SW6A 5ENRD 4C48B 5AARA 2HM8A 4DX6D 3B7RL 4YDYA 4JXTA 4F1PA 3ONLA 4LNUD 3JQ1A 5C1DA 4FADA 1N95A 4U0SA 3CEQA 3GZ1A 2XHEA 2GRPB 3FH5A 3ABME 2IOLA 3LY8A 3UT8A 1O1SA 4JPSA 3G2SA 3EU5A 4EZKA 1YMPA 3CHRA 1E8XA 2NC9A 3CV0A 3MKQB 5EKQD 3RJVA 5FT9A 3B7SA 4L1BA 3V2OA 3PZ1A 4F7AA 2J9QA 1P5QA 4YVQC 4K0RA 4OYSA 2PM6A 3MKQA 1KT0A 4DLOA 2QZAA 1TNZA 3LVQE 4WNEA 4HRLA 3LY7A 2DVWA 3FHEA 2F0YA 2FO7A 2PQRA 2GRRB 4XE0A 2F37A 2L9BA 3NQPA 4A1GA 3L08A 3ZYQA 3EJNA 3DXMG 4RG6A 3EDTB 1OCRE 4LUNU 5ENSD 4LSZE 3JQ0A 4N5QA 1LD7A 4UI9C 1NI1A 1B89A 4U07A 3CVWA 2XEHA 4HXIA 4I9EA 5E76A 2C0LA 1JPLA 5AJLA 2WQHA 4GTTA 3ONKA 4GTVA 3CIAA 4CT0A 5LOZA 5ENQD 2A4ZA 2NSZA 4K03A 4B8AA 3V30A 4TXQA 3TJPA 4PDXA 2LO6A 5HQ8A 2AWIA 3RKVA 2GROB 4DI4A 4PS7A 4JA9A 4IRUA 2AW6A 4XI0A 3AG2E 1ELRA 1BD8A 3CQCB 4N5CA 1U3DA 5DBKA 4PS3A 3ZW3A 1JUQA 4DK5A 1HH8A 3ZNGA 3MGBA 2BUGA 3T5VA 4GPMA 1UW4B 4UWGA 4J7WA 3PEVB 4I43A 2ZXWE 1HZ4A 4B0ZA 3CVXA 5CERB 1N54A 3ML8A 2IJGX 3FTXA 5KNHD 2OEVA 2X6HA 1KPSB 1TNOA 3DSXA 5ARGA 4ME2A 5CMWA 4U63A 2XZTG 2B6CA 4DJAA 4TXRA 1TNBA 4UWLA 3FTYA 3TWVA 5JJ7A 3C98A 4CGVA 3BQOA 2HYZA 2VSOE 2X6IA 4WUYA 3ZN3A 4KZ0A 1JCSA 2WB2A 3VTYA 2EIJE 4LG6A 2ETCA 4G2VA 3TL5A 2WXOA 3Q7FA 4GPKA 1FVFA 3SZ7A 3CHSA 3AU4A 2QYJA 4FHKA 2R02A 2CHXA 4D10C 4GZCA 2WQ6A 1A17A 4I6JA 2LXLA 5JHBA 5ITZF 2F8XK 4N3CA 1QNFA 2X6FA 1Y6IA 1TJFA 2XZDG 2HR2A 1H2UA 3KD7A 3MEKA 4RG9A
chains in the Genus database with same CATH topology
1YMPA 3TWRA 4HI8A 2ZGDA 4HRNA 5BXOA 5CBNA 4OAUC 1D9SA 3ZNGA 2DWZA 2PNNA 5AN8A 3J5PA 4HI9A 3Q9NC 1YYHA 3ZU7B 4GPMA 1IXVA 2J8SD 2ZGGA 4J7WA 3W9FA 3EHRA 2BKKB 4BSZB 5HRYA 5D66A 1BI8B 1QYMA 5FINA 2VGEA 3V2OA 4F6RD 4DX2A 2RFMA 5ENPD 3NBNB 3V79K 5AAOA 5EYPF 1N0QA 4K5AB 1BLXB 5HKPA 5CERB 4RLYA 2HE0A 1NFIE 5ENTD 3TWQA 3UI2A 1MX6A 4HB5A 4TUMA 3B95A 3F6QA 2Y0BG 1K3ZD 1WG0A 1K1AA 3TWUA 3LJNA 1YCSB 5KNHD 2V5QC 4HRLA 2QC9A 2DVWA 3ZKJA 1G3NB 5CECB 3ZUVB 2Y1LE 5ENOD 4O60A 4U8YD 3TWWA 4QQIA 5AQ7A 2DZNA 4UUCA 2DZOA 4U8VD 4BESA 4DX7D 2F37A 3V2XA 2XZTG 3T8KA 4HRMB 4J8YA 4GMRA 3V31A 3TWSA 5EIBE 3UXGA 1MX2A 1DC2A 2AJAA 5EYLA 4HBDA 1BU9A 1WDYA 1DCQA 2BKGA 2ETAA 1TR4A 3TWVA 2RFAA 5ENSD 2ETBA 3UTMA 4HNAD 4ZFHA 4O1PA 2XENA 4QFVA 1OY3D 3EU9A 1K1BA 3TWTA 4LSZE 2JABA 3KEAA 1AWCB 4N5QA 3AAAC 4O1OA 3W9GA 2NYJA 5BXUA 1N0RA 3NOCD 1UOHA 4K5CA 2P2CP 1SW6A 1A5EA 5ENRD 4K5BA 4CZ2D 2MYOA 5HS0A 3J5QB 2XEHA 3AJIA 4U95D 4YDWA 4BEPA 5EIDA 4DX1A 4C48B 1SVXA 4G8LA 5EILA 5AARA 1N11A 3HRAA 3TWXA 3JXIA 3C5RA 2KBXA 5AQBA 1OT8A 4DX6D 4DX5D 4LG6A 4U96D 2ETCA 3DEPA 4YDYA 2B0OE 4F1PA 2XEEA 4OAVB 2A5EA 4BERA 5FIOA 5CBOA 3JXJA 3D9HA 5JMND 3SO8A 1MYOA 4HLLA 4JB8P 4LNUD 4ATZD 5ENQD 3DEOA 3B7BA 4G8KA 2QYJA 2L6BA 3HG0D 1MX4A 1BI7B 1MJ0A 4ZHBA 3V30A 2FO1E 3Q9UC 4HQDA 3T9KA 5JA4D 1AP7A 2F8YA 4CYMD 3EHQA 5AQAA 1IKND 4DUIA 2V4HC 5ITZF 2F8XK 5AQ9A 4DRXE 3IXEA 5KBAA 2KXPC 5CEDB 5KNGA 2XZDG 5CEAA 3NOGD 1BD8A 1S70B 4A63B 3JUEA 4NIKA 4B93B 4Z68A 5EN5D 5KWDA 1IHBA 4BETA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1YMP A;  3TWR A;  4HI8 A;  2ZGD A;  4HRN A;  5BXO A;  5CBN A;  4OAU C;  1D9S A;  3ZNG A;  2DWZ A;  2PNN A;  5AN8 A;  3J5P A;  4HI9 A;  3Q9N C;  1YYH A;  3ZU7 B;  4GPM A;  1IXV A;  2J8S D;  2ZGG A;  4J7W A;  3W9F A;  3EHR A;  2BKK B;  4BSZ B;  5HRY A;  5D66 A;  1BI8 B;  1QYM A;  5FIN A;  2VGE A;  3V2O A;  4F6R D;  4DX2 A;  2RFM A;  5ENP D;  3NBN B;  3V79 K;  5AAO A;  5EYP F;  1N0Q A;  4K5A B;  1BLX B;  5HKP A;  5CER B;  4RLY A;  2HE0 A;  1NFI E;  5ENT D;  3TWQ A;  3UI2 A;  1MX6 A;  4HB5 A;  4TUM A;  3B95 A;  3F6Q A;  2Y0B G;  1K3Z D;  1WG0 A;  1K1A A;  3TWU A;  3LJN A;  1YCS B;  5KNH D;  2V5Q C;  4HRL A;  2QC9 A;  2DVW A;  3ZKJ A;  1G3N B;  5CEC B;  3ZUV B;  2Y1L E;  5ENO D;  4O60 A;  4U8Y D;  3TWW A;  4QQI A;  5AQ7 A;  2DZN A;  4UUC A;  2DZO A;  4U8V D;  4BES A;  4DX7 D;  2F37 A;  3V2X A;  2XZT G;  3T8K A;  4HRM B;  4J8Y A;  4GMR A;  3V31 A;  3TWS A;  5EIB E;  3UXG A;  1MX2 A;  1DC2 A;  2AJA A;  5EYL A;  4HBD A;  1BU9 A;  1WDY A;  1DCQ A;  2BKG A;  2ETA A;  1TR4 A;  3TWV A;  2RFA A;  5ENS D;  2ETB A;  3UTM A;  4HNA D;  4ZFH A;  4O1P A;  2XEN A;  4QFV A;  1OY3 D;  3EU9 A;  1K1B A;  3TWT A;  4LSZ E;  2JAB A;  3KEA A;  1AWC B;  4N5Q A;  3AAA C;  4O1O A;  3W9G A;  2NYJ A;  5BXU A;  1N0R A;  3NOC D;  1UOH A;  4K5C A;  2P2C P;  1SW6 A;  1A5E A;  5ENR D;  4K5B A;  4CZ2 D;  2MYO A;  5HS0 A;  3J5Q B;  2XEH A;  3AJI A;  4U95 D;  4YDW A;  4BEP A;  5EID A;  4DX1 A;  4C48 B;  1SVX A;  4G8L A;  5EIL A;  5AAR A;  1N11 A;  3HRA A;  3TWX A;  3JXI A;  3C5R A;  2KBX A;  5AQB A;  1OT8 A;  4DX6 D;  4DX5 D;  4LG6 A;  4U96 D;  2ETC A;  3DEP A;  4YDY A;  2B0O E;  4F1P A;  2XEE A;  4OAV B;  2A5E A;  4BER A;  5FIO A;  5CBO A;  3JXJ A;  3D9H A;  5JMN D;  3SO8 A;  1MYO A;  4HLL A;  4JB8 P;  4LNU D;  4ATZ D;  5ENQ D;  3DEO A;  3B7B A;  4G8K A;  2QYJ A;  2L6B A;  3HG0 D;  1MX4 A;  1BI7 B;  1MJ0 A;  4ZHB A;  3V30 A;  2FO1 E;  3Q9U C;  4HQD A;  3T9K A;  5JA4 D;  1AP7 A;  2F8Y A;  4CYM D;  3EHQ A;  5AQA A;  1IKN D;  4DUI A;  2V4H C;  5ITZ F;  2F8X K;  5AQ9 A;  4DRX E;  3IXE A;  5KBA A;  2KXP C;  5CED B;  5KNG A;  2XZD G;  5CEA A;  3NOG D;  1BD8 A;  1S70 B;  4A63 B;  3JUE A;  4NIK A;  4B93 B;  4Z68 A;  5EN5 D;  5KWD A;  1IHB A;  4BET A; 
#chains in the Genus database with same CATH topology
 4YDO A;  1ZBP A;  4HOT A;  2PL2 A;  3ZRH A;  5FZR A;  3SY2 A;  2ZIR A;  1YYH A;  3OXF A;  3G2V A;  4NAC A;  5D66 A;  1FCH A;  4DX2 A;  1EPU A;  1OWM A;  2WXH A;  4LNB A;  4CGW A;  3ZPJ A;  4GZ3 A;  3TWQ A;  1OUV A;  3B95 A;  2Y69 E;  4G11 A;  3I4R B;  3ZUV B;  4O60 A;  3QOU A;  4A3T A;  3C3Q A;  3NAW A;  5FZS A;  1D8E A;  3UXG A;  4G25 A;  3ENE A;  3T8M A;  3L9T A;  2ETA A;  4UQY A;  1TR4 A;  2RFA A;  2VGX B;  5FZQ A;  2J4D A;  4Q69 A;  3SD5 A;  4LEU A;  4I6E A;  3PZ2 A;  3KEA A;  2YQ8 A;  2J07 A;  4GTM A;  1A5E A;  1IQR A;  3G2U A;  3SFY A;  3B7U X;  2VQ2 A;  2WMO A;  3FFL A;  2XEE A;  2DYR E;  5CBO A;  3CK9 A;  1MYO A;  5AIJ A;  3ESK A;  3ML9 A;  1PY1 A;  4JHK A;  4BX9 A;  4XI9 A;  3LKU A;  3CKB A;  1N9A A;  4TV3 A;  1E7U A;  4ILI A;  3FTW A;  4DRX E;  2QY7 A;  2LNI A;  3IXE A;  2P9L G;  3SQV A;  2KCL A;  3VTX A;  5CEA A;  2R05 A;  3HXD A;  4HOQ A;  3RO3 A;  2GRM A;  3FUF A;  4Z68 A;  5KWD A;  5CCM A;  1IHB A;  5B3S E;  2GRN B;  5G05 J;  2CG2 A;  4RQI A;  3EHR A;  2X3M A;  2XEV A;  1KZP A;  3APC A;  5BV1 A;  3AG1 E;  3F6Q A;  1NA3 A;  4ATG A;  3CVY A;  3FUJ A;  4ANV A;  1W3B A;  3VLD A;  4A3V A;  4GTQ A;  4GA2 A;  2XRZ A;  3ZFW A;  2AJA A;  4IUL A;  3CHO A;  4QFV A;  1HU3 A;  3CVN A;  3ULY A;  3HXC A;  2X6J A;  3N71 A;  3IEG A;  4HOS A;  2LSU A;  2NYJ A;  3EUV A;  1HO8 A;  3JCK C;  3U3W A;  2MYO A;  5HS0 A;  4OAU C;  5FQ7 A;  4JHR A;  4JW1 A;  4U96 D;  3UIO C;  1FVH A;  1TNU A;  1N4Q A;  2X38 A;  3T5X A;  3LYA A;  3B7B A;  4XKC A;  5KJK A;  5BPP A;  1OXJ A;  2IQC A;  2OOE A;  4L2L A;  4FHJ A;  5KBA A;  3FUN A;  4AEZ C;  4ACK A;  2WQ7 A;  1TNY A;  5A23 A;  3QNK A;  4AP2 A;  1OCC E;  2P9U G;  3FEY A;  4BSX A;  1IXV A;  2LSV A;  3RO2 A;  2XPY A;  3QB2 A;  4F6R D;  1L5J A;  3CHP A;  1BLX B;  5FQ6 A;  2CHW A;  4HFG A;  3L16 A;  3BEE A;  4IYP A;  1WG0 A;  3TG5 A;  4L23 A;  3ZYL A;  5BUZ A;  5CEC B;  5ENO D;  3JYS A;  4J6I A;  3IKO B;  3E33 A;  4QQI A;  4FLB A;  5CHE E;  5ANL A;  5D0O D;  3ULE G;  4GZ5 A;  1OWL A;  1MX2 A;  1DC2 A;  3FTU A;  4KVM A;  2BKG A;  4O1P A;  4U7E B;  2XEN A;  2Y3A A;  1OCZ E;  2P9I G;  2WXQ A;  3URZ A;  5JHA A;  2AXU A;  3ZIM A;  1DCE A;  3ZYK A;  3EHM A;  3ASD A;  4OVU A;  1HXI A;  3JXI A;  2C0M A;  2KBX A;  4DLQ A;  4B8C B;  4OAV B;  1QZ2 A;  1UN8 A;  3FH7 A;  3L22 A;  4WNF A;  3SGH A;  4JZY A;  4G24 A;  3LCA A;  4UI9 K;  4F53 A;  3TG4 A;  5A6C A;  3MCX A;  3SHF A;  4ACL A;  2RKK A;  5JA4 D;  1HG5 A;  2WXL A;  3HXB A;  2GRL A;  3UIN C;  2FUL A;  3CVL A;  3CVV A;  4KYO B;  5BXO A;  4HRN A;  1D9S A;  2IY0 C;  2V8S E;  4FLH A;  3DPD A;  2NXP A;  4WND A;  2XCB A;  2AVP A;  3NBN B;  3E37 A;  4K5A B;  2HE0 A;  1Z5S C;  4HS2 A;  5M72 A;  4CRW A;  3D9J A;  2DBA A;  1E7V A;  3UIP C;  3UMV A;  3ASH A;  1HX8 A;  1EF1 C;  3LJ3 A;  3D9M A;  2Y1L E;  1E96 B;  1BPO A;  1Z3X A;  2I6H A;  4W9R A;  3VLF A;  1FT2 A;  1H19 A;  2EIN E;  3QWP A;  4X8Q A;  3SF4 A;  1BU9 A;  4JVS A;  4KBQ A;  3FDH A;  3OAW A;  4JA7 A;  2PQN A;  2P2C P;  3R7R A;  3IHY A;  4K5B A;  3MA5 A;  4FC8 A;  3AJI A;  3NZU A;  3U9W A;  3ZYM A;  3SI5 A;  3HRA A;  2VTB B;  3TXN A;  2CFZ A;  4F1S A;  1PAQ A;  4TUU A;  3RIB A;  3IV0 A;  4BER A;  5FIO A;  2H6I A;  2V4L A;  1O5M A;  2VGY A;  2L6B A;  2WM9 A;  2IEJ A;  3C3R A;  3TAX A;  3ASG A;  5CMY A;  3T9K A;  2R59 A;  4MKT A;  3NF1 A;  5CED B;  3LEW A;  4A63 B;  2WXN A;  3I3N A;  3Q47 B;  3CK8 A;  4JHJ A;  4JC8 A;  5BNW A;  2I1K A;  3ZEF A;  2X6K A;  3UM3 A;  3APD A;  4TRQ A;  5AAO A;  3RSE G;  5G04 C;  4I1O B;  3WXX A;  4TUM A;  3L54 A;  1JCR A;  1N4S A;  3ZHE B;  2EIM E;  3MJW A;  2L0T B;  3RRN B;  4OVV A;  3KSL A;  4N2Q A;  4NRH B;  2DZN A;  4BFR A;  2E2E A;  4HRM B;  4I6G A;  2RG8 A;  5G2N A;  4Q96 A;  4BTA A;  3LPZ A;  3UTM A;  2GRQ B;  4WNG A;  1K1B A;  3RAU A;  3FUL A;  2Y4T A;  3PRZ A;  5D0Q D;  4EBA A;  1FPP A;  3J5Q B;  3S7J A;  4XZ4 A;  5B1A E;  1UG3 A;  1SZA A;  4ANU A;  4I2Z A;  2B0O E;  5ARF A;  2WXI A;  3SNX A;  3ABK E;  2VJ8 A;  3HG0 D;  5FWQ A;  2XPI A;  4GTO A;  1V54 E;  4AIF A;  3CQG B;  3GZS A;  4JL0 A;  3UPV A;  4HQD A;  4EZJ A;  3UM2 A;  5AQ9 A;  3GZ2 A;  2KXP C;  2R03 A;  4GU5 A;  3UKR G;  4BY6 A;  4HOU A;  2WVI A;  3Q4A B;  2OVF A;  3TWR A;  5CBN A;  3R7Q A;  3O4Z A;  3W9F A;  5LFA A;  2WXJ A;  4GA1 A;  2ZU6 B;  3UM0 A;  3V79 K;  1N4R A;  2P9K G;  5T4Y A;  1MX6 A;  2Y0B G;  4AY5 A;  1K1A A;  4I2W A;  3HXF A;  1YCS B;  3Q5M A;  3I5P A;  3EHN A;  1G3N B;  1X5B A;  3PZD A;  4Y6W A;  4U8V D;  3V2X A;  3EIQ C;  4BT8 A;  1E90 A;  5J08 A;  1HE8 A;  3QWV A;  3BG0 B;  4GMR A;  3V31 A;  1OWP A;  3VLE A;  4XEI G;  2KCK A;  5AJD A;  2BF0 X;  3AAA C;  3PRE A;  4O1O A;  3IHV A;  2LAI A;  5T8I A;  4DX1 A;  5KJM A;  5FJY A;  2L0I A;  3C5R A;  2MRI A;  2A5E A;  3D9H A;  1SA4 A;  1PC2 A;  4J0U A;  4WWO A;  2J4B A;  3CKC A;  5FQ4 A;  3RU0 A;  2XS1 A;  3ZVV A;  4J8D A;  4A55 A;  3EHQ A;  5AQA A;  3EIJ A;  4C0M A;  3ULQ A;  1KT1 A;  2UY1 A;  3CST A;  3OXG A;  4AXH A;  1FT1 A;  2PNN A;  4GAA A;  1H6K A;  1S64 A;  4URK A;  1H0A A;  2UY1 B;  3CHM A;  3QAQ A;  3DST A;  3ESL A;  2VGE A;  3GYZ A;  5LCW J;  2RFM A;  5EYP F;  2H6H A;  1ZU2 A;  1N4P A;  2OCC E;  1TN8 A;  3NB2 A;  1OCO E;  3MYV A;  4HB5 A;  4LER A;  1K3Z D;  2VSN A;  4WWP A;  3LJN A;  3HDX A;  3GW4 A;  1O1R A;  3Q49 B;  3FUK A;  3TWW A;  3U64 A;  4DX7 D;  4RVB A;  3T8K A;  4GCN A;  4DI3 A;  3FU0 A;  5EIB E;  3QC1 A;  2CFU A;  4UQZ A;  3FUI A;  4PH4 B;  3CSF A;  2QFC A;  2YHC A;  3NOC D;  5C2Y A;  4J8F A;  3APF A;  4PUC A;  3TWX A;  3FTS A;  3LDZ A;  5AQB A;  1UJK A;  1RW2 A;  2P9S G;  1MHQ A;  3QJZ A;  4L7T A;  2FEZ A;  3CVP A;  4GMJ A;  3QKY A;  4G26 A;  3DXK G;  3KSQ A;  3E4B A;  1XNF A;  2WXG A;  2JLB A;  3PVL A;  1ELW A;  3HVE B;  1JWF A;  3FUD A;  2WXP A;  3ASO E;  4JEH A;  4E85 A;  3NOG D;  1S70 B;  4CDN A;  2Y4U A;  3CK7 A;  1ELK A;  2PM7 A;  2IO3 C;  1TYQ G;  5BV0 A;  5BT1 A;  3LS8 A;  1TN6 A;  5G04 J;  3Q15 A;  2WPV A;  3MZL B;  3FTZ A;  2CG3 A;  4KT6 B;  1S63 A;  4BSZ B;  1BI8 B;  5FIN A;  2R2L A;  3D9K A;  2XRY A;  1QBQ A;  1N0Q A;  3QWW A;  5HKP A;  4MBG A;  4U0Z A;  4AVX A;  5KJL A;  2CHZ A;  3HXE A;  3AU5 A;  4MRU A;  4XX5 A;  1KZO A;  1MQS A;  2AXZ A;  2MHK A;  4FUL A;  4BTB A;  2LXM A;  4FP7 A;  4F3V A;  2R17 C;  5HI7 A;  4UWF A;  3HHM A;  4GZD A;  4O6F A;  2MOW A;  2JAB A;  4APF A;  3MX3 A;  2KZT B;  3ZGQ A;  3CR3 A;  4CZ2 D;  4KVO A;  4U95 D;  3CVQ A;  4NQ0 A;  4DX5 D;  2XQ0 A;  2OV8 A;  4I1M A;  1E8W A;  2DCP A;  3HYM B;  2WXK A;  5EX0 A;  3FU5 A;  2IFU A;  2FO1 E;  4I17 A;  3ZHE A;  3BG1 B;  1TJC A;  5CCL A;  5BW8 C;  3FP3 A;  3ZXP A;  2YHE A;  3L6A A;  1X81 A;  4L2Y A;  4AOF A;  1O1T A;  4P29 A;  4NUR A;  2GW1 A;  4GTP A;  4CDM A;  2P58 C;  3OTN A;  1VDY A;  2RD0 A;  2J8S D;  2ZGG A;  3PZ4 A;  3D9L A;  3ASF A;  5HRY A;  3UX4 A;  1HS6 A;  3FY4 A;  4XIF A;  2EIL E;  3PNL B;  5ENT D;  3UT7 A;  2FBN A;  3CVU A;  4UQX A;  4GTS A;  2ZIS A;  4MS6 A;  1E8Y A;  1HFA A;  4MLP A;  1NZN A;  5LP0 A;  1E8Z A;  1EYH A;  2LAH A;  1MZC A;  2ILR A;  2XPZ A;  3EU9 A;  4G1T A;  4TXP A;  4BX8 A;  1AWC B;  4PS8 A;  5BXU A;  5FQ8 A;  3CHQ A;  1LTX A;  3ZXS A;  1SVX A;  4J8E A;  4GYO A;  4AV7 A;  2IOS A;  3PE3 A;  2HO1 A;  3AS8 A;  1Z6T A;  4U8H A;  3FTV A;  3D9N A;  1MX4 A;  4RSY A;  3B13 A;  3Q9U C;  4B94 A;  4HLE A;  4BWR A;  3DSS A;  2F8Y A;  2QYU A;  4CYM D;  1IKN D;  4EQF A;  2V4H C;  1XGW A;  3OXL A;  3I4G A;  4GML A;  4GZ6 A;  1WAO 1;  2GGF A;  3JXJ A;  1H6O A;  4R7L A;  1K8K G;  2DYS E;  2DWZ A;  3J5P A;  4HI9 A;  4U04 A;  3ZU7 B;  2KM4 A;  3UM1 A;  3P2B A;  3FUE A;  3UT4 A;  1DNP A;  3FU6 A;  3TWU A;  1NA0 A;  1U2V G;  2Q7F A;  3O48 A;  3UQ3 A;  3FU3 A;  3LVR E;  2KAT A;  3D9O A;  4ANW A;  2WXR A;  4LRZ A;  3HVE A;  4C0E A;  4CCA A;  4Q94 A;  5DIZ A;  4KMO A;  3S7B A;  4GB9 A;  1OY3 D;  3DSW A;  3MV3 B;  1NL4 A;  4YDW A;  5EID A;  3Q75 A;  4I1A A;  3KAE A;  5D2M C;  2YNQ A;  3KS2 A;  5JMN D;  5ANR A;  2J49 A;  3PH0 C;  3PUK A;  3DEO A;  5CRV A;  3D9I A;  4IN3 B;  4N39 A;  4FU3 A;  4YND A;  3MV2 B;  3QK0 A;  3S2A A;  2VSX E;  3FH8 A;  2VTB A;  3Q78 A;  3JUE A;  5E75 A;  5A7D B;  2FI7 A;  2V0P A;  2KCV A;  5ENN A;  5AN8 A;  4B89 A;  1EDU A;  4I9C A;  3TXM A;  3Q9N C;  5LX8 A;  4CEM A;  1OWN A;  2UWJ G;  3AS4 A;  1IQU A;  1JCQ A;  5KCM A;  4EHM A;  3DRA A;  4UI9 J;  4V3I A;  3Q73 A;  2OND A;  1HG2 A;  1IHG A;  3PZ3 A;  3UI2 A;  1NFI E;  2E0I A;  3D3M A;  3D9P A;  4DPR A;  2KZT A;  1H2V C;  5JJ6 A;  1UN9 A;  4FJZ A;  4UWH A;  3CLJ A;  2WXF A;  5J90 A;  3AG4 E;  1WDY A;  4ANX A;  4ZFH A;  3X2Q E;  3G2W A;  4M7C A;  3L82 A;  1LF8 A;  4GCO A;  4K5C A;  3PUJ A;  3DWL G;  1N11 A;  4H7Y A;  1H6P A;  1OT8 A;  2YIN A;  4UWK A;  3E32 A;  1SA5 A;  1KLX A;  2KC7 A;  3SO8 A;  3NZS A;  4ATZ D;  4JB8 P;  3TGO A;  4GTR A;  1TN7 A;  4CT4 A;  2XS8 A;  1BI7 B;  5JJT A;  1MJ0 A;  3HIZ A;  2V5F A;  3PS6 A;  3S7D A;  2EQX A;  4E6H A;  4JEU A;  4B93 B;  1TEZ A;  5EN5 D;  1SZ9 A;  4BET A;  3U66 A;  2XGS A;  2XCC A;  4FJY A;  4ABN A;  4HI8 A;  4L9P A;  2C2L A;  3FUH A;  3KEZ A;  4ILG A;  3UKU G;  4A1S A;  3PEU B;  5ENP D;  4AM9 A;  3SBS A;  1Z3Y A;  1DVP A;  2H6F A;  1Y8M A;  4EEC A;  4YDE A;  4Y6C A;  3K9I A;  4KZC A;  4N3B A;  2V5Q C;  3ZKJ A;  2XGO A;  2FF4 A;  2VSY A;  2VGX A;  2EIK E;  4UUC A;  2DZO A;  1SQM A;  3IBE A;  4GYY A;  2VYI A;  3ABL E;  3C3O A;  3TWS A;  1QQE A;  4EZL A;  5EYL A;  1RZ4 A;  4HNA D;  2R5S A;  2P9P G;  4YVO A;  4N2S A;  5B1B E;  4G23 A;  1U3C A;  1UOH A;  3RK6 A;  5FTP A;  4BEP A;  3AS5 A;  4G8L A;  3UUX A;  2PZI A;  3JUI A;  1WY6 A;  2DIW A;  3L13 A;  2LUH A;  4HOR A;  1HF8 A;  3Q79 A;  2L6J A;  2I1J A;  2M63 A;  4LNG A;  5KNG A;  3DSU A;  3PDN A;  2I2O A;  3E34 A;  4HVB A;  1N94 A;  3DPY A;  3DSV A;  3B7T A;  2ZGD A;  3LXU X;  4GYW A;  2BKK B;  3ASN E;  2OVB A;  2J09 A;  1H2T C;  5T3R A;  2J08 A;  3RRM B;  4ILH B;  1INZ A;  3C72 A;  2QC9 A;  2JEK A;  3RRU A;  3R9M A;  4U8Y D;  4GA0 A;  3PE4 A;  4U0U A;  4WWN A;  5EX3 A;  3BU8 A;  4J8Y A;  4CDR A;  4HBD A;  5KJN A;  4BT9 A;  3TWT A;  5LCW C;  3ISM C;  3W9G A;  5CRU A;  1UJJ A;  3BUA A;  1D8D A;  1AP7 A;  4XKB A;  3QDN A;  5EIL A;  4EPZ A;  1V55 E;  4EBA G;  1OWO A;  3E30 A;  3DEP A;  1IYG A;  5G05 C;  3PNT B;  3SFX A;  4LCT A;  5AEN A;  2WXM A;  3FEX A;  2I9C A;  4HLL A;  2BTD A;  3DBS A;  2IF4 A;  2P9N G;  3SBT B;  4G8K A;  2H6G A;  1YA0 A;  4ZHB A;  1JWG A;  3AG3 E;  2IU1 A;  2WMN A;  5G55 A;  4AY6 A;  4DUI A;  4FA6 A;  2OEW A;  4M3O A;  4APO A;  3MKR A;  1GW6 A;  4J8S A;  5AYW D;  4NIK A;  2ION A;  3WG7 E;  4N3A A;  3CGH A;  2A5U A;  3SFZ A;  3G2T A;  1QYM A;  3FWV A;  5IY5 E;  5H7P A;  4RLY A;  3R9A B;  4AJW A;  3L17 A;  4KXK B;  1WM5 A;  2AXV A;  1Q2Z A;  4C9B B;  1N52 A;  3U4T A;  3Q7A A;  3FUM A;  4H7X A;  5EDS A;  1S0P A;  5AQ7 A;  4BES A;  3P1U A;  4WAF A;  1LD8 A;  3QAR A;  1NP7 A;  1DCQ A;  3S7F A;  2ETB A;  2BED A;  1ZB1 A;  2IO2 C;  4JD2 G;  2XGM A;  1N0R A;  3LY9 A;  1SW6 A;  5ENR D;  4C48 B;  5AAR A;  2HM8 A;  4DX6 D;  3B7R L;  4YDY A;  4JXT A;  4F1P A;  3ONL A;  4LNU D;  3JQ1 A;  5C1D A;  4FAD A;  1N95 A;  4U0S A;  3CEQ A;  3GZ1 A;  2XHE A;  2GRP B;  3FH5 A;  3ABM E;  2IOL A;  3LY8 A;  3UT8 A;  1O1S A;  4JPS A;  3G2S A;  3EU5 A;  4EZK A;  1YMP A;  3CHR A;  1E8X A;  2NC9 A;  3CV0 A;  3MKQ B;  5EKQ D;  3RJV A;  5FT9 A;  3B7S A;  4L1B A;  3V2O A;  3PZ1 A;  4F7A A;  2J9Q A;  1P5Q A;  4YVQ C;  4K0R A;  4OYS A;  2PM6 A;  3MKQ A;  1KT0 A;  4DLO A;  2QZA A;  1TNZ A;  3LVQ E;  4WNE A;  4HRL A;  3LY7 A;  2DVW A;  3FHE A;  2F0Y A;  2FO7 A;  2PQR A;  2GRR B;  4XE0 A;  2F37 A;  2L9B A;  3NQP A;  4A1G A;  3L08 A;  3ZYQ A;  3EJN A;  3DXM G;  4RG6 A;  3EDT B;  1OCR E;  4LUN U;  5ENS D;  4LSZ E;  3JQ0 A;  4N5Q A;  1LD7 A;  4UI9 C;  1NI1 A;  1B89 A;  4U07 A;  3CVW A;  2XEH A;  4HXI A;  4I9E A;  5E76 A;  2C0L A;  1JPL A;  5AJL A;  2WQH A;  4GTT A;  3ONK A;  4GTV A;  3CIA A;  4CT0 A;  5LOZ A;  5ENQ D;  2A4Z A;  2NSZ A;  4K03 A;  4B8A A;  3V30 A;  4TXQ A;  3TJP A;  4PDX A;  2LO6 A;  5HQ8 A;  2AWI A;  3RKV A;  2GRO B;  4DI4 A;  4PS7 A;  4JA9 A;  4IRU A;  2AW6 A;  4XI0 A;  3AG2 E;  1ELR A;  1BD8 A;  3CQC B;  4N5C A;  1U3D A;  5DBK A;  4PS3 A;  3ZW3 A;  1JUQ A;  4DK5 A;  1HH8 A;  3ZNG A;  3MGB A;  2BUG A;  3T5V A;  4GPM A;  1UW4 B;  4UWG A;  4J7W A;  3PEV B;  4I43 A;  2ZXW E;  1HZ4 A;  4B0Z A;  3CVX A;  5CER B;  1N54 A;  3ML8 A;  2IJG X;  3FTX A;  5KNH D;  2OEV A;  2X6H A;  1KPS B;  1TNO A;  3DSX A;  5ARG A;  4ME2 A;  5CMW A;  4U63 A;  2XZT G;  2B6C A;  4DJA A;  4TXR A;  1TNB A;  4UWL A;  3FTY A;  3TWV A;  5JJ7 A;  3C98 A;  4CGV A;  3BQO A;  2HYZ A;  2VSO E;  2X6I A;  4WUY A;  3ZN3 A;  4KZ0 A;  1JCS A;  2WB2 A;  3VTY A;  2EIJ E;  4LG6 A;  2ETC A;  4G2V A;  3TL5 A;  2WXO A;  3Q7F A;  4GPK A;  1FVF A;  3SZ7 A;  3CHS A;  3AU4 A;  2QYJ A;  4FHK A;  2R02 A;  2CHX A;  4D10 C;  4GZC A;  2WQ6 A;  1A17 A;  4I6J A;  2LXL A;  5JHB A;  5ITZ F;  2F8X K;  4N3C A;  1QNF A;  2X6F A;  1Y6I A;  1TJF A;  2XZD G;  2HR2 A;  1H2U A;  3KD7 A;  3MEK A;  4RG9 A; 
#chains in the Genus database with same CATH homology
 1YMP A;  3TWR A;  4HI8 A;  2ZGD A;  4HRN A;  5BXO A;  5CBN A;  4OAU C;  1D9S A;  3ZNG A;  2DWZ A;  2PNN A;  5AN8 A;  3J5P A;  4HI9 A;  3Q9N C;  1YYH A;  3ZU7 B;  4GPM A;  1IXV A;  2J8S D;  2ZGG A;  4J7W A;  3W9F A;  3EHR A;  2BKK B;  4BSZ B;  5HRY A;  5D66 A;  1BI8 B;  1QYM A;  5FIN A;  2VGE A;  3V2O A;  4F6R D;  4DX2 A;  2RFM A;  5ENP D;  3NBN B;  3V79 K;  5AAO A;  5EYP F;  1N0Q A;  4K5A B;  1BLX B;  5HKP A;  5CER B;  4RLY A;  2HE0 A;  1NFI E;  5ENT D;  3TWQ A;  3UI2 A;  1MX6 A;  4HB5 A;  4TUM A;  3B95 A;  3F6Q A;  2Y0B G;  1K3Z D;  1WG0 A;  1K1A A;  3TWU A;  3LJN A;  1YCS B;  5KNH D;  2V5Q C;  4HRL A;  2QC9 A;  2DVW A;  3ZKJ A;  1G3N B;  5CEC B;  3ZUV B;  2Y1L E;  5ENO D;  4O60 A;  4U8Y D;  3TWW A;  4QQI A;  5AQ7 A;  2DZN A;  4UUC A;  2DZO A;  4U8V D;  4BES A;  4DX7 D;  2F37 A;  3V2X A;  2XZT G;  3T8K A;  4HRM B;  4J8Y A;  4GMR A;  3V31 A;  3TWS A;  5EIB E;  3UXG A;  1MX2 A;  1DC2 A;  2AJA A;  5EYL A;  4HBD A;  1BU9 A;  1WDY A;  1DCQ A;  2BKG A;  2ETA A;  1TR4 A;  3TWV A;  2RFA A;  5ENS D;  2ETB A;  3UTM A;  4HNA D;  4ZFH A;  4O1P A;  2XEN A;  4QFV A;  1OY3 D;  3EU9 A;  1K1B A;  3TWT A;  4LSZ E;  2JAB A;  3KEA A;  1AWC B;  4N5Q A;  3AAA C;  4O1O A;  3W9G A;  2NYJ A;  5BXU A;  1N0R A;  3NOC D;  1UOH A;  4K5C A;  2P2C P;  1SW6 A;  1A5E A;  5ENR D;  4K5B A;  4CZ2 D;  2MYO A;  5HS0 A;  3J5Q B;  2XEH A;  3AJI A;  4U95 D;  4YDW A;  4BEP A;  5EID A;  4DX1 A;  4C48 B;  1SVX A;  4G8L A;  5EIL A;  5AAR A;  1N11 A;  3HRA A;  3TWX A;  3JXI A;  3C5R A;  2KBX A;  5AQB A;  1OT8 A;  4DX6 D;  4DX5 D;  4LG6 A;  4U96 D;  2ETC A;  3DEP A;  4YDY A;  2B0O E;  4F1P A;  2XEE A;  4OAV B;  2A5E A;  4BER A;  5FIO A;  5CBO A;  3JXJ A;  3D9H A;  5JMN D;  3SO8 A;  1MYO A;  4HLL A;  4JB8 P;  4LNU D;  4ATZ D;  5ENQ D;  3DEO A;  3B7B A;  4G8K A;  2QYJ A;  2L6B A;  3HG0 D;  1MX4 A;  1BI7 B;  1MJ0 A;  4ZHB A;  3V30 A;  2FO1 E;  3Q9U C;  4HQD A;  3T9K A;  5JA4 D;  1AP7 A;  2F8Y A;  4CYM D;  3EHQ A;  5AQA A;  1IKN D;  4DUI A;  2V4H C;  5ITZ F;  2F8X K;  5AQ9 A;  4DRX E;  3IXE A;  5KBA A;  2KXP C;  5CED B;  5KNG A;  2XZD G;  5CEA A;  3NOG D;  1BD8 A;  1S70 B;  4A63 B;  3JUE A;  4NIK A;  4B93 B;  4Z68 A;  5EN5 D;  5KWD A;  1IHB A;  4BET A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...