1K1AA

Crystal structure of the ankyrin repeat domain of bcl-3: a unique member of the ikappab protein family
Total Genus 73
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
73
sequence length
228
structure length
228
Chain Sequence
EDGDTPLHIAVVQGNLPAVHRLVNLFQQGGRELDIYNNLRQTPLHLAVITTLPSVVRLLVTAGASPMALDRHGQTAAHLACEHRSPTCLRALLDSAAPGTLDLEARNYDGLTALHVAVNTECQETVQLLLERGADIDAVDIKSGRSPLIHAVENNSLSMVQLLLQHGANVNAQMYSGSSALHSASGRGLLPLVRTLVRSGADSSLKNCHNDTPLMVARSRRVIDILRG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of the ankyrin repeat domain of Bcl-3: a unique member of the IkappaB protein family.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription
molecule keywords B-cell lymphoma 3-encoded protein
total genus 73
structure length 228
sequence length 228
ec nomenclature
pdb deposition date 2001-09-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00023 Ank Ankyrin repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.20 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Ankyrin repeat-containing domain 1k1aA00
2QC9A 3NOCD 4GPMA 5AAOA 2V4HC 1IKND 5HRYA 4K5BA 3Q9UC 4DX2A 4K5AB 3B95A 2Y0BG 1G3NB 1MX6A 2BKGA 2DZNA 1AWCB 2NYJA 2DWZA 5FIOA 3JUEA 3UI2A 1K3ZD 3LJNA 2XZDG 4ZFHA 4LG6A 5ENOD 2ZGGA 5HKPA 2ETAA 2V5QC 3ZU7B 2A5EA 5EN5D 2VGEA 4HI9A 5CEDB 1BI7B 2JABA 1N0RA 3DEOA 4U8YD 4HRNA 2ZGDA 5EIDA 1QYMA 1N0QA 3KEAA 4U96D 3W9GA 5KNHD 5EIBE 5ENQD 5ITZF 1BU9A 1DC2A 2PNNA 4DX6D 4OAVB 3AJIA 2QYJA 4BETA 4G8KA 4UUCA 5CECB 3TWTA 1K1BA 1BD8A 3JXIA 4DUIA 1OY3D 2XZTG 5BXUA 1OT8A 1MX4A 3V30A 5KWDA 3EU9A 1MX2A 3TWQA 2RFMA 4YDYA 3TWRA 3V2XA 1MYOA 4O60A 2ETBA 5KNGA 3UXGA 4BERA 1D9SA 3ZNGA 2MYOA 3T8KA 4O1OA 2DVWA 2HE0A 3B7BA 4BSZB 1A5EA 5ENTD 5ENPD 3JXJA 4U8VD 4B93B 3TWXA 1WG0A 3J5QB 4DX7D 3AAAC 2DZOA 3DEPA 5FINA 2BKKB 3TWVA 4BESA 1TR4A 1DCQA 2KBXA 3Q9NC 3EHRA 4G8LA 2XEHA 1SW6A 1YCSB 4F1PA 4RLYA 4K5CA 2XEEA 5EILA 4Z68A 1BI8B 2KXPC 4HBDA 4HRMB 1K1AA 4N5QA 1YYHA 2F37A 1WDYA 3UTMA 1AP7A 3F6QA 4LNUD 5D66A 5CBOA 1BLXB 4HI8A 2P2CP 3J5PA 4CZ2D 2B0OE 3W9FA 5ENSD 3TWSA 4HB5A 4HRLA 4TUMA 3HG0D 4QQIA 5AN8A 4HLLA 4OAUC 5AQ7A 2XENA 5EYPF 5KBAA 3ZKJA 3T9KA 3V79K 5ENRD 3IXEA 1SVXA 5AQAA 4BEPA 4O1PA 1NFIE 5CEAA 3EHQA 5BXOA 4A63B 5CBNA 3C5RA 1IXVA 5AQBA 4HNAD 4C48B 5AARA 2FO1E 4ZHBA 2AJAA 5JA4D 4J7WA 2ETCA 2RFAA 1YMPA 4HQDA 3TWWA 1MJ0A 4J8YA 3SO8A 4JB8P 4NIKA 2L6BA 3TWUA 5EYLA 2J8SD 5CERB 5AQ9A 2F8XK 5JMND 3NBNB 4U95D 4F6RD 1S70B 4ATZD 3HRAA 1IHBA 2Y1LE 1N11A 4LSZE 2F8YA 3NOGD 4YDWA 3V2OA 4DX1A 3ZUVB 4DRXE 4DX5D 4CYMD 4QFVA 5HS0A 3D9HA 1UOHA 3V31A 4GMRA
chains in the Genus database with same CATH superfamily
2QC9A 3NOCD 1N4QA 4R7LA 2I9CA 2BKGA 3TGOA 5LFAA 2F0YA 3GZSA 4F7AA 2XS1A 2KM4A 3CVVA 3DEOA 5JHBA 4U0UA 3UKUG 3S7BA 1K1BA 3EU9A 2CG2A 3HDXA 1MYOA 2OCCE 3AG4E 4DX7D 3MA5A 3SBTB 1TR4A 3Q7AA 2KBXA 2XHEA 4RLYA 5ANLA 4Z68A 1QBQA 1BLXB 4Q94A 3QWPA 3VLDA 5H7PA 5FZSA 3FU6A 4N2QA 3MGBA 3RK6A 1SVXA 3DPDA 3EHQA 2I1JA 1IXVA 4GZ3A 3B7TA 3ML9A 5JA4D 4J7WA 4HQDA 4DJAA 4KYOB 4JB8P 2XGMA 4GZDA 2F8XK 4C0EA 5AIJA 3HRAA 2BTDA 3NOGD 3L6AA 2EIME 3V31A 3DSTA 3SFXA 3FUHA 1AWCB 4J8SA 3FUJA 2GW1A 3WXXA 3KSQA 5EN5D 2GGFA 3R9AB 4HI9A 5BPPA 3DBSA 3FUIA 1KT0A 2ZGDA 4AOFA 4LEUA 4BETA 4GA1A 3FTUA 4DUIA 2C0MA 1UJJA 1O1TA 2GRLA 3UINC 1NP7A 1MX2A 3TWQA 3OTNA 4FC8A 2PZIA 2X6HA 3O48A 4F53A 5JJ7A 4KZCA 4B93B 3TWVA 4G8LA 2DYRE 4G1TA 4F1PA 2I6HA 1ZBPA 2X38A 4LNUD 4IULA 3ULYA 3W9FA 3SBSA 1P5QA 3CSTA 4JPSA 3E30A 3ZGQA 2VGYA 4HRLA 4MLPA 2J4DA 4YDOA 1H2TC 3I4GA 2IFUA 1S64A 3ULEG 2H6FA 2YQ8A 2ETCA 1HE8A 4J8YA 4GYYA 3UM1A 4GU5A 2Y4UA 3ZYKA 4U95D 3Q5MA 2H6GA 1IHBA 1H2UA 5EX3A 3CGHA 3R7RA 3KS2A 3DSXA 3IEGA 3FEXA 4PS7A 5AJDA 5ITZF 1U3DA 3SHFA 2PNNA 4I9EA 1H6PA 2RD0A 2CHXA 5KJKA 1D8EA 5T4YA 1E8YA 2MYOA 3T8KA 3RKVA 1A5EA 3D9KA 4N3AA 1WY6A 3JXJA 3EHMA 3Q79A 4P29A 2YHEA 3BEEA 1YCSB 1INZA 5IY5E 1BI8B 4HBDA 2WVIA 3G2SA 2AXZA 2YNQA 2IO3C 4NRHB 4GZ5A 3ASNE 2XENA 3I5PA 4CEMA 1O5MA 2P9SG 3ZEFA 5AARA 5ARGA 2EILE 1YMPA 3SO8A 2L6BA 4GB9A 1S0PA 2IF4A 3ASOE 3CVXA 5LOZA 3QDNA 3JQ1A 4AY5A 3RU0A 1VDYA 3UM3A 1OCCE 1QNFA 4DLQA 4GA2A 3ASGA 3EDTB 3OXLA 2H6HA 1TYQG 4YVOA 4L2LA 5CCMA 4OYSA 3DSSA 4HXIA 2XRZA 3JUEA 3FEYA 4ZFHA 2LAIA 3CVPA 4GAAA 3CVQA 4ME2A 2GRPB 2WXFA 3Q49B 4GTOA 3HYMB 5G05J 3E32A 5FWQA 4EECA 2IY0C 5A6CA 4TXRA 2IQCA 4TRQA 4BX8A 1H0AA 3JXIA 2C0LA 2XZTG 4MRUA 3TWRA 2I1KA 3DPYA 3UXGA 3URZA 4UI9J 1N9AA 4GCNA 4JHRA 4LERA 4K03A 2XEHA 4A3VA 2P9KG 3UMVA 4FADA 4MS6A 4N5QA 4AM9A 5EDSA 5CBOA 4DI4A 2QFCA 4HI8A 1RW2A 1JCSA 3ZRHA 4KVOA 2I2OA 3KSLA 2BUGA 2X3MA 2WXJA 5BUZA 3SD5A 3D9LA 3Q75A 3CK8A 1TNBA 4XZ4A 3ZYMA 1TN7A 1E8ZA 1IQRA 4N3BA 4E85A 3P1UA 3ML8A 5J90A 1E8XA 2LXLA 3RJVA 2J4BA 3BQOA 4UWKA 4N2SA 1UG3A 3UUXA 1W3BA 4N39A 2WXIA 4GZ6A 3DXMG 3CK7A 4RSYA 2LSVA 2WMOA 2VTBA 4F3VA 4BT9A 3IHYA 4F1SA 4GPMA 4BTBA 2AW6A 4UWGA 2GRQB 3B95A 1G3NB 2OEVA 4FULA 3OAWA 2XQ0A 4AV7A 2DCPA 1SA4A 5HKPA 3ZU7B 5JJ6A 2VGEA 2J09A 1QYMA 3KEAA 1N54A 3HXBA 2KCVA 5G55A 4CDNA 2IU1A 4G24A 3MKQA 4ILIA 2ETBA 2A5UA 2XCCA 1TN8A 4XX5A 3L82A 2R02A 2DIWA 2J49A 3PEUB 4ANXA 3ABKE 4K5CA 3P2BA 4A55A 5EILA 4U0ZA 4UI9K 5C1DA 3LDZA 5CRVA 4GCOA 4TXPA 4HB5A 3D9NA 4APFA 4OAUC 5KBAA 1HU3A 5ENRD 4XE0A 4FJYA 2WPVA 3AU4A 3ENEA 3D9IA 2PM7A 2QZAA 3CHSA 3TXNA 2VSOE 3TWUA 3HXCA 5CERB 3D9OA 5AQ9A 3PVLA 5FZQA 4WAFA 3TG4A 4YDWA 3V2OA 1N11A 4BTAA 2F8YA 3UT7A 1XNFA 3ZUVB 1TEZA 4I2WA 4XEIG 1N95A 3X2QE 3RAUA 2EIKE 4GTTA 5T3RA 2XPZA 4DX2A 1TNUA 4N3CA 1N52A 3BUAA 3ISMC 5E76A 4GTVA 1Z3YA 2V5QC 2UY1A 3HHMA 4J0UA 1TNOA 3ZPJA 3GZ1A 2KZTA 5LP0A 3RO2A 2VJ8A 5CECB 3BU8A 3IHVA 2FI7A 2Y69E 1BD8A 3HVEB 2GRRB 4U0SA 4KT6B 2E0IA 3RRUA 3QK0A 4HOSA 1IHGA 3JUIA 3G2TA 5FINA 2RG8A 4BESA 3QAQA 2WXNA 3EUVA 3U64A 2X6KA 3AG2E 4HOQA 1KZOA 2WXOA 4EZLA 2WQHA 3I3NA 4JEHA 5AJLA 3J5PA 3CHPA 1TN6A 4Y6WA 3JYSA 2EIJE 2KCLA 1LF8A 2LSUA 3LY9A 3CVLA 4JVSA 3Q78A 5CEAA 4JL0A 4ABNA 2DYSE 2DBAA 3C5RA 1D8DA 5AQBA 4C48B 2FO1E 4UQZA 3ONKA 3CHRA 4RVBA 1FT2A 2P58C 3D3MA 3ZHEB 1H19A 2M63A 4CGWA 3HXEA 3QNKA 2J9QA 4CDMA 4GMRA 4U07A 5AAOA 3L54A 3B7RL 5HRYA 1KLXA 4EBAG 2GRNB 3PRZA 2XZDG 3SZ7A 2ETAA 1A17A 5EIDA 4I1AA 2WXKA 5KNHD 2KZTB 3FH5A 3CVWA 2AXUA 3BG1B 1OCOE 1H6KA 4GTPA 2NXPA 4WUYA 3G2UA 1TNYA 3QKYA 4JHJA 2WXPA 3TWXA 3RRNB 3IBEA 4W9RA 3AS8A 4YNDA 2IO2C 2IOSA 2MHKA 3MYVA 4HLEA 1HG5A 3DWLG 2VGXA 4DK5A 3EIJA 3CQCB 1K1AA 3Q73A 4Q96A 2OV8A 1FCHA 2B0OE 1U3CA 1S63A 4AY6A 5EYPF 3QWWA 2J07A 4O1PA 3PUKA 4KZ0A 4CRWA 3UQ3A 4BX9A 3LVQE 2WQ7A 2FF4A 1IQUA 4UI9C 3DSVA 3TWWA 2HM8A 2VSXE 4ANVA 2X6JA 5EX0A 4DX5D 3N71A 2XS8A 4M7CA 4U04A 1UOHA 3LS8A 1GW6A 1K3ZD 2ZGGA 4G23A 4EHMA 4FA6A 1E90A 3ZXPA 1PY1A 3PDNA 4UQXA 1N0RA 2KC7A 3R9MA 3PZ4A 1OY3D 1MX4A 5LX8A 1Q2ZA 3K9IA 2H6IA 4HORA 4FLBA 1UN8A 4U63A 4TXQA 2P9NG 4U8VD 2MRIA 4IYPA 3PEVB 3RO3A 3FUFA 3QWVA 3AG1E 4C9BB 4HRMB 4PH4B 3EHNA 1UJKA 1N4PA 4AJWA 2E2EA 1DNPA 5BT1A 2J08A 1MZCA 2ZIRA 5G04C 3HVEA 1UW4B 2HR2A 3ASHA 4HNAD 3FUNA 3LY7A 3FUKA 4EPZA 1OCZE 4NIKA 2LXMA 2J8SD 3WG7E 1JCRA 3DSWA 4XI9A 3Q47B 2JLBA 3AG3E 5HS0A 2C2LA 1DVPA 3FH7A 3MEKA 3SGHA 1MX6A 1FT1A 5HI7A 1SZAA 2WXQA 3Q15A 1BI7B 2OVBA 4AIFA 4U96D 4A1GA 4J6IA 4U8HA 3AJIA 2QYJA 1JUQA 4ACLA 1OXJA 4GPKA 3LY8A 3ULQA 5CRUA 3UKRG 4BY6A 3CIAA 4A1SA 1N94A 3AU5A 3NAWA 1N4RA 1NA3A 3NZSA 4CT0A 5B3SE 1WG0A 3HIZA 2BEDA 4CGVA 3T8MA 2FULA 4CDRA 2ILRA 4BWRA 4I17A 3C3QA 1JCQA 2WXHA 1WDYA 4XKBA 3GYZA 3ASDA 4TUMA 3U4TA 3PE4A 1HS6A 3ZIMA 1LD8A 3FY4A 3LKUA 3ABME 1OWLA 1ELRA 1PAQA 3C98A 1NA0A 2WB2A 3NBNB 3CEQA 1XGWA 4DX1A 3D9MA 4RG9A 1FPPA 2V5FA 4LCTA 3APFA 1X81A 5HQ8A 2Y0BG 3VTYA 2NYJA 1JWFA 3Q4AB 3IKOB 4LG6A 3EJNA 3SY2A 2XRYA 4H7XA 5CEDB 3G2WA 4HVBA 3JCKC 4JZYA 2IEJA 3L22A 5BXUA 3FTVA 3ZW3A 3FTSA 1O1RA 1TNZA 3DXKG 4XIFA 2DVWA 2HE0A 3Q7FA 2PM6A 1U2VG 5ENTD 5ENPD 3MX3A 3PZ1A 2XGSA 3Q9NC 1O1SA 3T5VA 4FU3A 1SW6A 3B7SA 5KCMA 3PE3A 4WNDA 3KD7A 2V0PA 2KXPC 4PDXA 3L08A 5FQ6A 5G05C 4G11A 1HH8A 3ZVVA 4J8DA 3LVRE 3C3RA 4N5CA 3MCXA 4EZKA 5M72A 3FULA 2OOEA 3UT4A 1NFIE 4GTQA 2VQ2A 5E75A 3MKRA 3FU5A 1TJFA 1KT1A 2X6FA 4WWOA 5CHEE 2X6IA 2ZU6B 1V55E 3KEZA 3QOUA 2GRMA 2ONDA 3UIOC 2V4HC 3Q9UC 4GTRA 2DZNA 4UWHA 3L17A 3NZUA 2DWZA 4JXTA 4V3IA 4D10C 5BNWA 4HOUA 2EINE 5ENOD 3GW4A 3CV0A 3FU0A 4BSXA 2JEKA 1EF1C 2OEWA 4I6JA 1UN9A 4WWPA 5T8IA 2LNIA 3CK9A 3S2AA 2L0IA 4O60A 4IRUA 3ZNGA 3SI5A 4BSZB 3TG5A 3ASFA 5KJLA 3CKBA 3PNLB 3RIBA 1DCQA 1JPLA 4GYOA 3PREA 1NL4A 5ARFA 4BT8A 5FT9A 3APCA 2FEZA 2WXRA 4A3TA 3FTWA 4FLHA 3LEWA 5AN8A 2AXVA 3CR3A 4I9CA 1HXIA 3UM0A 4WNEA 2FO7A 3LYAA 4H7YA 5EYLA 2ZXWE 4TV3A 3I4RB 5CMWA 4JC8A 5KJNA 3APDA 3AS5A 1V54E 2P9IG 4LSZE 4JA7A 4B89A 5C2YA 1E8WA 4DRXE 4CYMD 3EIQC 4APOA 1H6OA 5A23A 5CMYA 2V4LA 4G25A 3UI2A 1H2VC 3SFYA 1KZPA 2HYZA 4I6EA 4ANWA 4HS2A 3FDHA 2QYUA 2XEVA 3ABLE 3SQVA 5FJYA 3MV3B 3E33A 1EYHA 3V30A 2PQRA 5J08A 3LJ3A 4BFRA 3PZ3A 1RZ4A 3B7BA 2XGOA 2RKKA 2DZOA 3DEPA 3IV0A 3VLEA 3EHRA 4JEUA 4AXHA 3PZ2A 4UWFA 3F6QA 3CSFA 1QZ2A 2P2CP 3SF4A 4MBGA 4CZ2D 3TWSA 3HG0D 2WMNA 2VYIA 3T9KA 4RG6A 3V79K 5BV1A 2WXGA 4U7EB 2L0TB 2IONA 5BXOA 5DIZA 5CBNA 5AENA 4EBAA 3FTXA 1Z6TA 4YVQC 4IN3B 3E34A 4NQ0A 4F6RD 4GMLA 3JQ0A 4JD2G 4K5AB 3UT8A 3QARA 3VLFA 1FVFA 4UWLA 3LJNA 1OWPA 4KXKB 3FHEA 4U8YD 5JJTA 3CLJA 1N0QA 5EIBE 5ENQD 1BU9A 4O6FA 1L5JA 3MJWA 4G8KA 5EKQD 2UY1B 2WXMA 1OT8A 5AYWD 3CQGB 3TXMA 4L9PA 1MHQA 1ZB1A 2RFMA 4G26A 1K8KG 4Q69A 2KCKA 1X5BA 4Y6CA 3LCAA 4O1OA 3VTXA 4TUUA 3OXGA 4GTMA 4PS8A 2Y4TA 2WM9A 1E96B 5FQ8A 3TAXA 5D0OD 3S7JA 2B6CA 4I1OB 3DSUA 3UTMA 2F37A 3ONLA 2VTBB 3BG0B 5D66A 3MV2B 1SZ9A 5KJMA 2VSNA 2LO6A 2R5SA 4ILGA 3FP3A 5AQ7A 3ZKJA 1Y6IA 4I2ZA 4KVMA 3CVUA 4BEPA 1IYGA 1Y8MA 4A63B 2IJGX 3D9PA 3RRMB 3SNXA 2VSYA 1WAO1 4FJZA 4X8QA 4I1MA 2EQXA 3B7UX 4B8CB 3DRAA 3RSEG 1NZNA 4KBQA 3T5XA 3HXFA 4CCAA 1N4SA 4AP2A 3OXFA 4PS3A 5ENNA 4AVXA 5FIOA 1HX8A 1FVHA 1NI1A 3PUJA 3D9JA 3TJPA 2JABA 5B1BE 4GTSA 2R2LA 4B8AA 2Q7FA 3U66A 4GYWA 2CFUA 3FUDA 5D0QD 1PC2A 3QJZA 2R05A 4WNGA 4BERA 1D9SA 4FP7A 4UQYA 1LD7A 3TL5A 3L16A 2FBNA 3CVYA 5D2MC 3AS4A 4K0RA 4L23A 4XI0A 2CFZA 2R03A 4WWNA 1OWMA 3ZXSA 1AP7A 4L1BA 1EPUA 1KPSB 2VGXB 2L6JA 3FTZA 4NACA 3PS6A 2V8SE 5A7DB 3IXEA 5JHAA 4FHJA 5BW8C 1E7VA 1ZU2A 4ZHBA 2AJAA 4J8EA 1MJ0A 1HO8A 3PNTB 4I6GA 3CVNA 4LUNU 5JMND 2PL2A 5FZRA 4LNBA 1S70B 4ATZD 3ZYQA 3FU3A 3MZLB 3D9HA 4JW1A 4ACKA 5FTPA 3C72A 2LAHA 3U3WA 3FUEA 3LXUX 2P9UG 5B1AE 2A5EA 2Y3AA 2OVFA 3C3OA 3ZN3A 3ZFWA 2YINA 3W9GA 1DC2A 1DCEA 1ELWA 1B89A 3PZDA 1OWOA 2AWIA 4ILHB 4JA9A 2PQNA 4YDYA 3NF1A 2MOWA 1EDUA 3V2XA 1YA0A 1HF8A 1MQSA 2WXLA 3CKCA 1E7UA 4HOTA 4CT4A 1Z3XA 2BKKB 4I43A 2BF0X 4M3OA 4B94A 2R59A 4NURA 4RQIA 2CHWA 5G04J 3QB2A 4B0ZA 3L9TA 4GMJA 5ENSD 2NSZA 4WNFA 3S7DA 3FFLA 3FTYA 3MKQB 4FHKA 5AQAA 1HG2A 3SFZA 3ZHEA 3E37A 4ATGA 2CHZA 4PUCA 4YDEA 2R17C 2LUHA 3GZ2A 3UX4A 4HFGA 4GZCA 4GA0A 2A4ZA 4KMOA 3CHQA 4JHKA 3NB2A 4OVUA 2L9BA 1JWGA 1IKND 3QC1A 2XPIA 3PH0C 4K5BA 1WM5A 3FH8A 4EQFA 1OCRE 3LPZA 4L7TA 5DBKA 3FWVA 4L2YA 4HRNA 3NQPA 5BV0A 2P9PG 1BPOA 4XKCA 4DX6D 3R7QA 4OAVB 1OWNA 4DPRA 4E6HA 5LCWC 4UUCA 3TWTA 3EU5A 3KAEA 2CG3A 3FUMA 5KWDA 4OVVA 3CHMA 1LTXA 5KNGA 3UIPC 2UWJG 2AVPA 4LNGA 2NC9A 2XCBA 2KATA 3HXDA 4C0MA 3J5QB 3AAAC 3O4ZA 3UM2A 1SQMA 2WQ6A 1ELKA 2ZISA 2XEEA 5ANRA 5FQ4A 1TJCA 1HZ4A 3G2VA 3E4BA 3ZYLA 1YYHA 2P9LG 1Z5SC 4AEZC 4J8FA 2YHCA 2IOLA 5FQ7A 3U9WA 4QQIA 1QQEA 4HLLA 4URKA 3ESLA 3S7FA 4DLOA 5G2NA 2QY7A 3UPVA 4ANUA 3CHOA 4LRZA 4MKTA 2RFAA 4EZJA 1OUVA 5LCWJ 1HFAA 3ESKA 3L13A 1SA5A 2GROB 4G2VA 4DI3A 2Y1LE 2HO1A 2XPYA 3B13A 5CCLA 4QFVA
chains in the Genus database with same CATH topology
2QC9A 3NOCD 4GPMA 5AAOA 2V4HC 1IKND 5HRYA 4K5BA 3Q9UC 4DX2A 4K5AB 3B95A 2Y0BG 1G3NB 1MX6A 2BKGA 2DZNA 1AWCB 2NYJA 2DWZA 5FIOA 3JUEA 3UI2A 1K3ZD 3LJNA 2XZDG 4ZFHA 4LG6A 5ENOD 2ZGGA 5HKPA 2ETAA 2V5QC 3ZU7B 2A5EA 5EN5D 2VGEA 4HI9A 5CEDB 1BI7B 2JABA 1N0RA 3DEOA 4U8YD 4HRNA 2ZGDA 5EIDA 1QYMA 1N0QA 3KEAA 4U96D 3W9GA 5KNHD 5EIBE 5ENQD 5ITZF 1BU9A 1DC2A 2PNNA 4DX6D 4OAVB 3AJIA 2QYJA 4BETA 4G8KA 4UUCA 5CECB 3TWTA 1K1BA 1BD8A 3JXIA 4DUIA 1OY3D 2XZTG 5BXUA 1OT8A 1MX4A 3V30A 5KWDA 3EU9A 1MX2A 3TWQA 2RFMA 4YDYA 3TWRA 3V2XA 1MYOA 4O60A 2ETBA 5KNGA 3UXGA 4BERA 1D9SA 3ZNGA 2MYOA 3T8KA 4O1OA 2DVWA 2HE0A 3B7BA 4BSZB 1A5EA 5ENTD 5ENPD 3JXJA 4U8VD 4B93B 3TWXA 1WG0A 3J5QB 4DX7D 3AAAC 2DZOA 3DEPA 5FINA 2BKKB 3TWVA 4BESA 1TR4A 1DCQA 2KBXA 3Q9NC 3EHRA 4G8LA 2XEHA 1SW6A 1YCSB 4F1PA 4RLYA 4K5CA 2XEEA 5EILA 4Z68A 1BI8B 2KXPC 4HBDA 4HRMB 1K1AA 4N5QA 1YYHA 2F37A 1WDYA 3UTMA 1AP7A 3F6QA 4LNUD 5D66A 5CBOA 1BLXB 4HI8A 2P2CP 3J5PA 4CZ2D 2B0OE 3W9FA 5ENSD 3TWSA 4HB5A 4HRLA 4TUMA 3HG0D 4QQIA 5AN8A 4HLLA 4OAUC 5AQ7A 2XENA 5EYPF 5KBAA 3ZKJA 3T9KA 3V79K 5ENRD 3IXEA 1SVXA 5AQAA 4BEPA 4O1PA 1NFIE 5CEAA 3EHQA 5BXOA 4A63B 5CBNA 3C5RA 1IXVA 5AQBA 4HNAD 4C48B 5AARA 2FO1E 4ZHBA 2AJAA 5JA4D 4J7WA 2ETCA 2RFAA 1YMPA 4HQDA 3TWWA 1MJ0A 4J8YA 3SO8A 4JB8P 4NIKA 2L6BA 3TWUA 5EYLA 2J8SD 5CERB 5AQ9A 2F8XK 5JMND 3NBNB 4U95D 4F6RD 1S70B 4ATZD 3HRAA 1IHBA 2Y1LE 1N11A 4LSZE 2F8YA 3NOGD 4YDWA 3V2OA 4DX1A 3ZUVB 4DRXE 4DX5D 4CYMD 4QFVA 5HS0A 3D9HA 1UOHA 3V31A 4GMRA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2QC9 A;  3NOC D;  4GPM A;  5AAO A;  2V4H C;  1IKN D;  5HRY A;  4K5B A;  3Q9U C;  4DX2 A;  4K5A B;  3B95 A;  2Y0B G;  1G3N B;  1MX6 A;  2BKG A;  2DZN A;  1AWC B;  2NYJ A;  2DWZ A;  5FIO A;  3JUE A;  3UI2 A;  1K3Z D;  3LJN A;  2XZD G;  4ZFH A;  4LG6 A;  5ENO D;  2ZGG A;  5HKP A;  2ETA A;  2V5Q C;  3ZU7 B;  2A5E A;  5EN5 D;  2VGE A;  4HI9 A;  5CED B;  1BI7 B;  2JAB A;  1N0R A;  3DEO A;  4U8Y D;  4HRN A;  2ZGD A;  5EID A;  1QYM A;  1N0Q A;  3KEA A;  4U96 D;  3W9G A;  5KNH D;  5EIB E;  5ENQ D;  5ITZ F;  1BU9 A;  1DC2 A;  2PNN A;  4DX6 D;  4OAV B;  3AJI A;  2QYJ A;  4BET A;  4G8K A;  4UUC A;  5CEC B;  3TWT A;  1K1B A;  1BD8 A;  3JXI A;  4DUI A;  1OY3 D;  2XZT G;  5BXU A;  1OT8 A;  1MX4 A;  3V30 A;  5KWD A;  3EU9 A;  1MX2 A;  3TWQ A;  2RFM A;  4YDY A;  3TWR A;  3V2X A;  1MYO A;  4O60 A;  2ETB A;  5KNG A;  3UXG A;  4BER A;  1D9S A;  3ZNG A;  2MYO A;  3T8K A;  4O1O A;  2DVW A;  2HE0 A;  3B7B A;  4BSZ B;  1A5E A;  5ENT D;  5ENP D;  3JXJ A;  4U8V D;  4B93 B;  3TWX A;  1WG0 A;  3J5Q B;  4DX7 D;  3AAA C;  2DZO A;  3DEP A;  5FIN A;  2BKK B;  3TWV A;  4BES A;  1TR4 A;  1DCQ A;  2KBX A;  3Q9N C;  3EHR A;  4G8L A;  2XEH A;  1SW6 A;  1YCS B;  4F1P A;  4RLY A;  4K5C A;  2XEE A;  5EIL A;  4Z68 A;  1BI8 B;  2KXP C;  4HBD A;  4HRM B;  1K1A A;  4N5Q A;  1YYH A;  2F37 A;  1WDY A;  3UTM A;  1AP7 A;  3F6Q A;  4LNU D;  5D66 A;  5CBO A;  1BLX B;  4HI8 A;  2P2C P;  3J5P A;  4CZ2 D;  2B0O E;  3W9F A;  5ENS D;  3TWS A;  4HB5 A;  4HRL A;  4TUM A;  3HG0 D;  4QQI A;  5AN8 A;  4HLL A;  4OAU C;  5AQ7 A;  2XEN A;  5EYP F;  5KBA A;  3ZKJ A;  3T9K A;  3V79 K;  5ENR D;  3IXE A;  1SVX A;  5AQA A;  4BEP A;  4O1P A;  1NFI E;  5CEA A;  3EHQ A;  5BXO A;  4A63 B;  5CBN A;  3C5R A;  1IXV A;  5AQB A;  4HNA D;  4C48 B;  5AAR A;  2FO1 E;  4ZHB A;  2AJA A;  5JA4 D;  4J7W A;  2ETC A;  2RFA A;  1YMP A;  4HQD A;  3TWW A;  1MJ0 A;  4J8Y A;  3SO8 A;  4JB8 P;  4NIK A;  2L6B A;  3TWU A;  5EYL A;  2J8S D;  5CER B;  5AQ9 A;  2F8X K;  5JMN D;  3NBN B;  4U95 D;  4F6R D;  1S70 B;  4ATZ D;  3HRA A;  1IHB A;  2Y1L E;  1N11 A;  4LSZ E;  2F8Y A;  3NOG D;  4YDW A;  3V2O A;  4DX1 A;  3ZUV B;  4DRX E;  4DX5 D;  4CYM D;  4QFV A;  5HS0 A;  3D9H A;  1UOH A;  3V31 A;  4GMR A; 
#chains in the Genus database with same CATH topology
 2QC9 A;  3NOC D;  1N4Q A;  4R7L A;  2I9C A;  2BKG A;  3TGO A;  5LFA A;  2F0Y A;  3GZS A;  4F7A A;  2XS1 A;  2KM4 A;  3CVV A;  3DEO A;  5JHB A;  4U0U A;  3UKU G;  3S7B A;  1K1B A;  3EU9 A;  2CG2 A;  3HDX A;  1MYO A;  2OCC E;  3AG4 E;  4DX7 D;  3MA5 A;  3SBT B;  1TR4 A;  3Q7A A;  2KBX A;  2XHE A;  4RLY A;  5ANL A;  4Z68 A;  1QBQ A;  1BLX B;  4Q94 A;  3QWP A;  3VLD A;  5H7P A;  5FZS A;  3FU6 A;  4N2Q A;  3MGB A;  3RK6 A;  1SVX A;  3DPD A;  3EHQ A;  2I1J A;  1IXV A;  4GZ3 A;  3B7T A;  3ML9 A;  5JA4 D;  4J7W A;  4HQD A;  4DJA A;  4KYO B;  4JB8 P;  2XGM A;  4GZD A;  2F8X K;  4C0E A;  5AIJ A;  3HRA A;  2BTD A;  3NOG D;  3L6A A;  2EIM E;  3V31 A;  3DST A;  3SFX A;  3FUH A;  1AWC B;  4J8S A;  3FUJ A;  2GW1 A;  3WXX A;  3KSQ A;  5EN5 D;  2GGF A;  3R9A B;  4HI9 A;  5BPP A;  3DBS A;  3FUI A;  1KT0 A;  2ZGD A;  4AOF A;  4LEU A;  4BET A;  4GA1 A;  3FTU A;  4DUI A;  2C0M A;  1UJJ A;  1O1T A;  2GRL A;  3UIN C;  1NP7 A;  1MX2 A;  3TWQ A;  3OTN A;  4FC8 A;  2PZI A;  2X6H A;  3O48 A;  4F53 A;  5JJ7 A;  4KZC A;  4B93 B;  3TWV A;  4G8L A;  2DYR E;  4G1T A;  4F1P A;  2I6H A;  1ZBP A;  2X38 A;  4LNU D;  4IUL A;  3ULY A;  3W9F A;  3SBS A;  1P5Q A;  3CST A;  4JPS A;  3E30 A;  3ZGQ A;  2VGY A;  4HRL A;  4MLP A;  2J4D A;  4YDO A;  1H2T C;  3I4G A;  2IFU A;  1S64 A;  3ULE G;  2H6F A;  2YQ8 A;  2ETC A;  1HE8 A;  4J8Y A;  4GYY A;  3UM1 A;  4GU5 A;  2Y4U A;  3ZYK A;  4U95 D;  3Q5M A;  2H6G A;  1IHB A;  1H2U A;  5EX3 A;  3CGH A;  3R7R A;  3KS2 A;  3DSX A;  3IEG A;  3FEX A;  4PS7 A;  5AJD A;  5ITZ F;  1U3D A;  3SHF A;  2PNN A;  4I9E A;  1H6P A;  2RD0 A;  2CHX A;  5KJK A;  1D8E A;  5T4Y A;  1E8Y A;  2MYO A;  3T8K A;  3RKV A;  1A5E A;  3D9K A;  4N3A A;  1WY6 A;  3JXJ A;  3EHM A;  3Q79 A;  4P29 A;  2YHE A;  3BEE A;  1YCS B;  1INZ A;  5IY5 E;  1BI8 B;  4HBD A;  2WVI A;  3G2S A;  2AXZ A;  2YNQ A;  2IO3 C;  4NRH B;  4GZ5 A;  3ASN E;  2XEN A;  3I5P A;  4CEM A;  1O5M A;  2P9S G;  3ZEF A;  5AAR A;  5ARG A;  2EIL E;  1YMP A;  3SO8 A;  2L6B A;  4GB9 A;  1S0P A;  2IF4 A;  3ASO E;  3CVX A;  5LOZ A;  3QDN A;  3JQ1 A;  4AY5 A;  3RU0 A;  1VDY A;  3UM3 A;  1OCC E;  1QNF A;  4DLQ A;  4GA2 A;  3ASG A;  3EDT B;  3OXL A;  2H6H A;  1TYQ G;  4YVO A;  4L2L A;  5CCM A;  4OYS A;  3DSS A;  4HXI A;  2XRZ A;  3JUE A;  3FEY A;  4ZFH A;  2LAI A;  3CVP A;  4GAA A;  3CVQ A;  4ME2 A;  2GRP B;  2WXF A;  3Q49 B;  4GTO A;  3HYM B;  5G05 J;  3E32 A;  5FWQ A;  4EEC A;  2IY0 C;  5A6C A;  4TXR A;  2IQC A;  4TRQ A;  4BX8 A;  1H0A A;  3JXI A;  2C0L A;  2XZT G;  4MRU A;  3TWR A;  2I1K A;  3DPY A;  3UXG A;  3URZ A;  4UI9 J;  1N9A A;  4GCN A;  4JHR A;  4LER A;  4K03 A;  2XEH A;  4A3V A;  2P9K G;  3UMV A;  4FAD A;  4MS6 A;  4N5Q A;  4AM9 A;  5EDS A;  5CBO A;  4DI4 A;  2QFC A;  4HI8 A;  1RW2 A;  1JCS A;  3ZRH A;  4KVO A;  2I2O A;  3KSL A;  2BUG A;  2X3M A;  2WXJ A;  5BUZ A;  3SD5 A;  3D9L A;  3Q75 A;  3CK8 A;  1TNB A;  4XZ4 A;  3ZYM A;  1TN7 A;  1E8Z A;  1IQR A;  4N3B A;  4E85 A;  3P1U A;  3ML8 A;  5J90 A;  1E8X A;  2LXL A;  3RJV A;  2J4B A;  3BQO A;  4UWK A;  4N2S A;  1UG3 A;  3UUX A;  1W3B A;  4N39 A;  2WXI A;  4GZ6 A;  3DXM G;  3CK7 A;  4RSY A;  2LSV A;  2WMO A;  2VTB A;  4F3V A;  4BT9 A;  3IHY A;  4F1S A;  4GPM A;  4BTB A;  2AW6 A;  4UWG A;  2GRQ B;  3B95 A;  1G3N B;  2OEV A;  4FUL A;  3OAW A;  2XQ0 A;  4AV7 A;  2DCP A;  1SA4 A;  5HKP A;  3ZU7 B;  5JJ6 A;  2VGE A;  2J09 A;  1QYM A;  3KEA A;  1N54 A;  3HXB A;  2KCV A;  5G55 A;  4CDN A;  2IU1 A;  4G24 A;  3MKQ A;  4ILI A;  2ETB A;  2A5U A;  2XCC A;  1TN8 A;  4XX5 A;  3L82 A;  2R02 A;  2DIW A;  2J49 A;  3PEU B;  4ANX A;  3ABK E;  4K5C A;  3P2B A;  4A55 A;  5EIL A;  4U0Z A;  4UI9 K;  5C1D A;  3LDZ A;  5CRV A;  4GCO A;  4TXP A;  4HB5 A;  3D9N A;  4APF A;  4OAU C;  5KBA A;  1HU3 A;  5ENR D;  4XE0 A;  4FJY A;  2WPV A;  3AU4 A;  3ENE A;  3D9I A;  2PM7 A;  2QZA A;  3CHS A;  3TXN A;  2VSO E;  3TWU A;  3HXC A;  5CER B;  3D9O A;  5AQ9 A;  3PVL A;  5FZQ A;  4WAF A;  3TG4 A;  4YDW A;  3V2O A;  1N11 A;  4BTA A;  2F8Y A;  3UT7 A;  1XNF A;  3ZUV B;  1TEZ A;  4I2W A;  4XEI G;  1N95 A;  3X2Q E;  3RAU A;  2EIK E;  4GTT A;  5T3R A;  2XPZ A;  4DX2 A;  1TNU A;  4N3C A;  1N52 A;  3BUA A;  3ISM C;  5E76 A;  4GTV A;  1Z3Y A;  2V5Q C;  2UY1 A;  3HHM A;  4J0U A;  1TNO A;  3ZPJ A;  3GZ1 A;  2KZT A;  5LP0 A;  3RO2 A;  2VJ8 A;  5CEC B;  3BU8 A;  3IHV A;  2FI7 A;  2Y69 E;  1BD8 A;  3HVE B;  2GRR B;  4U0S A;  4KT6 B;  2E0I A;  3RRU A;  3QK0 A;  4HOS A;  1IHG A;  3JUI A;  3G2T A;  5FIN A;  2RG8 A;  4BES A;  3QAQ A;  2WXN A;  3EUV A;  3U64 A;  2X6K A;  3AG2 E;  4HOQ A;  1KZO A;  2WXO A;  4EZL A;  2WQH A;  3I3N A;  4JEH A;  5AJL A;  3J5P A;  3CHP A;  1TN6 A;  4Y6W A;  3JYS A;  2EIJ E;  2KCL A;  1LF8 A;  2LSU A;  3LY9 A;  3CVL A;  4JVS A;  3Q78 A;  5CEA A;  4JL0 A;  4ABN A;  2DYS E;  2DBA A;  3C5R A;  1D8D A;  5AQB A;  4C48 B;  2FO1 E;  4UQZ A;  3ONK A;  3CHR A;  4RVB A;  1FT2 A;  2P58 C;  3D3M A;  3ZHE B;  1H19 A;  2M63 A;  4CGW A;  3HXE A;  3QNK A;  2J9Q A;  4CDM A;  4GMR A;  4U07 A;  5AAO A;  3L54 A;  3B7R L;  5HRY A;  1KLX A;  4EBA G;  2GRN B;  3PRZ A;  2XZD G;  3SZ7 A;  2ETA A;  1A17 A;  5EID A;  4I1A A;  2WXK A;  5KNH D;  2KZT B;  3FH5 A;  3CVW A;  2AXU A;  3BG1 B;  1OCO E;  1H6K A;  4GTP A;  2NXP A;  4WUY A;  3G2U A;  1TNY A;  3QKY A;  4JHJ A;  2WXP A;  3TWX A;  3RRN B;  3IBE A;  4W9R A;  3AS8 A;  4YND A;  2IO2 C;  2IOS A;  2MHK A;  3MYV A;  4HLE A;  1HG5 A;  3DWL G;  2VGX A;  4DK5 A;  3EIJ A;  3CQC B;  1K1A A;  3Q73 A;  4Q96 A;  2OV8 A;  1FCH A;  2B0O E;  1U3C A;  1S63 A;  4AY6 A;  5EYP F;  3QWW A;  2J07 A;  4O1P A;  3PUK A;  4KZ0 A;  4CRW A;  3UQ3 A;  4BX9 A;  3LVQ E;  2WQ7 A;  2FF4 A;  1IQU A;  4UI9 C;  3DSV A;  3TWW A;  2HM8 A;  2VSX E;  4ANV A;  2X6J A;  5EX0 A;  4DX5 D;  3N71 A;  2XS8 A;  4M7C A;  4U04 A;  1UOH A;  3LS8 A;  1GW6 A;  1K3Z D;  2ZGG A;  4G23 A;  4EHM A;  4FA6 A;  1E90 A;  3ZXP A;  1PY1 A;  3PDN A;  4UQX A;  1N0R A;  2KC7 A;  3R9M A;  3PZ4 A;  1OY3 D;  1MX4 A;  5LX8 A;  1Q2Z A;  3K9I A;  2H6I A;  4HOR A;  4FLB A;  1UN8 A;  4U63 A;  4TXQ A;  2P9N G;  4U8V D;  2MRI A;  4IYP A;  3PEV B;  3RO3 A;  3FUF A;  3QWV A;  3AG1 E;  4C9B B;  4HRM B;  4PH4 B;  3EHN A;  1UJK A;  1N4P A;  4AJW A;  2E2E A;  1DNP A;  5BT1 A;  2J08 A;  1MZC A;  2ZIR A;  5G04 C;  3HVE A;  1UW4 B;  2HR2 A;  3ASH A;  4HNA D;  3FUN A;  3LY7 A;  3FUK A;  4EPZ A;  1OCZ E;  4NIK A;  2LXM A;  2J8S D;  3WG7 E;  1JCR A;  3DSW A;  4XI9 A;  3Q47 B;  2JLB A;  3AG3 E;  5HS0 A;  2C2L A;  1DVP A;  3FH7 A;  3MEK A;  3SGH A;  1MX6 A;  1FT1 A;  5HI7 A;  1SZA A;  2WXQ A;  3Q15 A;  1BI7 B;  2OVB A;  4AIF A;  4U96 D;  4A1G A;  4J6I A;  4U8H A;  3AJI A;  2QYJ A;  1JUQ A;  4ACL A;  1OXJ A;  4GPK A;  3LY8 A;  3ULQ A;  5CRU A;  3UKR G;  4BY6 A;  3CIA A;  4A1S A;  1N94 A;  3AU5 A;  3NAW A;  1N4R A;  1NA3 A;  3NZS A;  4CT0 A;  5B3S E;  1WG0 A;  3HIZ A;  2BED A;  4CGV A;  3T8M A;  2FUL A;  4CDR A;  2ILR A;  4BWR A;  4I17 A;  3C3Q A;  1JCQ A;  2WXH A;  1WDY A;  4XKB A;  3GYZ A;  3ASD A;  4TUM A;  3U4T A;  3PE4 A;  1HS6 A;  3ZIM A;  1LD8 A;  3FY4 A;  3LKU A;  3ABM E;  1OWL A;  1ELR A;  1PAQ A;  3C98 A;  1NA0 A;  2WB2 A;  3NBN B;  3CEQ A;  1XGW A;  4DX1 A;  3D9M A;  4RG9 A;  1FPP A;  2V5F A;  4LCT A;  3APF A;  1X81 A;  5HQ8 A;  2Y0B G;  3VTY A;  2NYJ A;  1JWF A;  3Q4A B;  3IKO B;  4LG6 A;  3EJN A;  3SY2 A;  2XRY A;  4H7X A;  5CED B;  3G2W A;  4HVB A;  3JCK C;  4JZY A;  2IEJ A;  3L22 A;  5BXU A;  3FTV A;  3ZW3 A;  3FTS A;  1O1R A;  1TNZ A;  3DXK G;  4XIF A;  2DVW A;  2HE0 A;  3Q7F A;  2PM6 A;  1U2V G;  5ENT D;  5ENP D;  3MX3 A;  3PZ1 A;  2XGS A;  3Q9N C;  1O1S A;  3T5V A;  4FU3 A;  1SW6 A;  3B7S A;  5KCM A;  3PE3 A;  4WND A;  3KD7 A;  2V0P A;  2KXP C;  4PDX A;  3L08 A;  5FQ6 A;  5G05 C;  4G11 A;  1HH8 A;  3ZVV A;  4J8D A;  3LVR E;  3C3R A;  4N5C A;  3MCX A;  4EZK A;  5M72 A;  3FUL A;  2OOE A;  3UT4 A;  1NFI E;  4GTQ A;  2VQ2 A;  5E75 A;  3MKR A;  3FU5 A;  1TJF A;  1KT1 A;  2X6F A;  4WWO A;  5CHE E;  2X6I A;  2ZU6 B;  1V55 E;  3KEZ A;  3QOU A;  2GRM A;  2OND A;  3UIO C;  2V4H C;  3Q9U C;  4GTR A;  2DZN A;  4UWH A;  3L17 A;  3NZU A;  2DWZ A;  4JXT A;  4V3I A;  4D10 C;  5BNW A;  4HOU A;  2EIN E;  5ENO D;  3GW4 A;  3CV0 A;  3FU0 A;  4BSX A;  2JEK A;  1EF1 C;  2OEW A;  4I6J A;  1UN9 A;  4WWP A;  5T8I A;  2LNI A;  3CK9 A;  3S2A A;  2L0I A;  4O60 A;  4IRU A;  3ZNG A;  3SI5 A;  4BSZ B;  3TG5 A;  3ASF A;  5KJL A;  3CKB A;  3PNL B;  3RIB A;  1DCQ A;  1JPL A;  4GYO A;  3PRE A;  1NL4 A;  5ARF A;  4BT8 A;  5FT9 A;  3APC A;  2FEZ A;  2WXR A;  4A3T A;  3FTW A;  4FLH A;  3LEW A;  5AN8 A;  2AXV A;  3CR3 A;  4I9C A;  1HXI A;  3UM0 A;  4WNE A;  2FO7 A;  3LYA A;  4H7Y A;  5EYL A;  2ZXW E;  4TV3 A;  3I4R B;  5CMW A;  4JC8 A;  5KJN A;  3APD A;  3AS5 A;  1V54 E;  2P9I G;  4LSZ E;  4JA7 A;  4B89 A;  5C2Y A;  1E8W A;  4DRX E;  4CYM D;  3EIQ C;  4APO A;  1H6O A;  5A23 A;  5CMY A;  2V4L A;  4G25 A;  3UI2 A;  1H2V C;  3SFY A;  1KZP A;  2HYZ A;  4I6E A;  4ANW A;  4HS2 A;  3FDH A;  2QYU A;  2XEV A;  3ABL E;  3SQV A;  5FJY A;  3MV3 B;  3E33 A;  1EYH A;  3V30 A;  2PQR A;  5J08 A;  3LJ3 A;  4BFR A;  3PZ3 A;  1RZ4 A;  3B7B A;  2XGO A;  2RKK A;  2DZO A;  3DEP A;  3IV0 A;  3VLE A;  3EHR A;  4JEU A;  4AXH A;  3PZ2 A;  4UWF A;  3F6Q A;  3CSF A;  1QZ2 A;  2P2C P;  3SF4 A;  4MBG A;  4CZ2 D;  3TWS A;  3HG0 D;  2WMN A;  2VYI A;  3T9K A;  4RG6 A;  3V79 K;  5BV1 A;  2WXG A;  4U7E B;  2L0T B;  2ION A;  5BXO A;  5DIZ A;  5CBN A;  5AEN A;  4EBA A;  3FTX A;  1Z6T A;  4YVQ C;  4IN3 B;  3E34 A;  4NQ0 A;  4F6R D;  4GML A;  3JQ0 A;  4JD2 G;  4K5A B;  3UT8 A;  3QAR A;  3VLF A;  1FVF A;  4UWL A;  3LJN A;  1OWP A;  4KXK B;  3FHE A;  4U8Y D;  5JJT A;  3CLJ A;  1N0Q A;  5EIB E;  5ENQ D;  1BU9 A;  4O6F A;  1L5J A;  3MJW A;  4G8K A;  5EKQ D;  2UY1 B;  2WXM A;  1OT8 A;  5AYW D;  3CQG B;  3TXM A;  4L9P A;  1MHQ A;  1ZB1 A;  2RFM A;  4G26 A;  1K8K G;  4Q69 A;  2KCK A;  1X5B A;  4Y6C A;  3LCA A;  4O1O A;  3VTX A;  4TUU A;  3OXG A;  4GTM A;  4PS8 A;  2Y4T A;  2WM9 A;  1E96 B;  5FQ8 A;  3TAX A;  5D0O D;  3S7J A;  2B6C A;  4I1O B;  3DSU A;  3UTM A;  2F37 A;  3ONL A;  2VTB B;  3BG0 B;  5D66 A;  3MV2 B;  1SZ9 A;  5KJM A;  2VSN A;  2LO6 A;  2R5S A;  4ILG A;  3FP3 A;  5AQ7 A;  3ZKJ A;  1Y6I A;  4I2Z A;  4KVM A;  3CVU A;  4BEP A;  1IYG A;  1Y8M A;  4A63 B;  2IJG X;  3D9P A;  3RRM B;  3SNX A;  2VSY A;  1WAO 1;  4FJZ A;  4X8Q A;  4I1M A;  2EQX A;  3B7U X;  4B8C B;  3DRA A;  3RSE G;  1NZN A;  4KBQ A;  3T5X A;  3HXF A;  4CCA A;  1N4S A;  4AP2 A;  3OXF A;  4PS3 A;  5ENN A;  4AVX A;  5FIO A;  1HX8 A;  1FVH A;  1NI1 A;  3PUJ A;  3D9J A;  3TJP A;  2JAB A;  5B1B E;  4GTS A;  2R2L A;  4B8A A;  2Q7F A;  3U66 A;  4GYW A;  2CFU A;  3FUD A;  5D0Q D;  1PC2 A;  3QJZ A;  2R05 A;  4WNG A;  4BER A;  1D9S A;  4FP7 A;  4UQY A;  1LD7 A;  3TL5 A;  3L16 A;  2FBN A;  3CVY A;  5D2M C;  3AS4 A;  4K0R A;  4L23 A;  4XI0 A;  2CFZ A;  2R03 A;  4WWN A;  1OWM A;  3ZXS A;  1AP7 A;  4L1B A;  1EPU A;  1KPS B;  2VGX B;  2L6J A;  3FTZ A;  4NAC A;  3PS6 A;  2V8S E;  5A7D B;  3IXE A;  5JHA A;  4FHJ A;  5BW8 C;  1E7V A;  1ZU2 A;  4ZHB A;  2AJA A;  4J8E A;  1MJ0 A;  1HO8 A;  3PNT B;  4I6G A;  3CVN A;  4LUN U;  5JMN D;  2PL2 A;  5FZR A;  4LNB A;  1S70 B;  4ATZ D;  3ZYQ A;  3FU3 A;  3MZL B;  3D9H A;  4JW1 A;  4ACK A;  5FTP A;  3C72 A;  2LAH A;  3U3W A;  3FUE A;  3LXU X;  2P9U G;  5B1A E;  2A5E A;  2Y3A A;  2OVF A;  3C3O A;  3ZN3 A;  3ZFW A;  2YIN A;  3W9G A;  1DC2 A;  1DCE A;  1ELW A;  1B89 A;  3PZD A;  1OWO A;  2AWI A;  4ILH B;  4JA9 A;  2PQN A;  4YDY A;  3NF1 A;  2MOW A;  1EDU A;  3V2X A;  1YA0 A;  1HF8 A;  1MQS A;  2WXL A;  3CKC A;  1E7U A;  4HOT A;  4CT4 A;  1Z3X A;  2BKK B;  4I43 A;  2BF0 X;  4M3O A;  4B94 A;  2R59 A;  4NUR A;  4RQI A;  2CHW A;  5G04 J;  3QB2 A;  4B0Z A;  3L9T A;  4GMJ A;  5ENS D;  2NSZ A;  4WNF A;  3S7D A;  3FFL A;  3FTY A;  3MKQ B;  4FHK A;  5AQA A;  1HG2 A;  3SFZ A;  3ZHE A;  3E37 A;  4ATG A;  2CHZ A;  4PUC A;  4YDE A;  2R17 C;  2LUH A;  3GZ2 A;  3UX4 A;  4HFG A;  4GZC A;  4GA0 A;  2A4Z A;  4KMO A;  3CHQ A;  4JHK A;  3NB2 A;  4OVU A;  2L9B A;  1JWG A;  1IKN D;  3QC1 A;  2XPI A;  3PH0 C;  4K5B A;  1WM5 A;  3FH8 A;  4EQF A;  1OCR E;  3LPZ A;  4L7T A;  5DBK A;  3FWV A;  4L2Y A;  4HRN A;  3NQP A;  5BV0 A;  2P9P G;  1BPO A;  4XKC A;  4DX6 D;  3R7Q A;  4OAV B;  1OWN A;  4DPR A;  4E6H A;  5LCW C;  4UUC A;  3TWT A;  3EU5 A;  3KAE A;  2CG3 A;  3FUM A;  5KWD A;  4OVV A;  3CHM A;  1LTX A;  5KNG A;  3UIP C;  2UWJ G;  2AVP A;  4LNG A;  2NC9 A;  2XCB A;  2KAT A;  3HXD A;  4C0M A;  3J5Q B;  3AAA C;  3O4Z A;  3UM2 A;  1SQM A;  2WQ6 A;  1ELK A;  2ZIS A;  2XEE A;  5ANR A;  5FQ4 A;  1TJC A;  1HZ4 A;  3G2V A;  3E4B A;  3ZYL A;  1YYH A;  2P9L G;  1Z5S C;  4AEZ C;  4J8F A;  2YHC A;  2IOL A;  5FQ7 A;  3U9W A;  4QQI A;  1QQE A;  4HLL A;  4URK A;  3ESL A;  3S7F A;  4DLO A;  5G2N A;  2QY7 A;  3UPV A;  4ANU A;  3CHO A;  4LRZ A;  4MKT A;  2RFA A;  4EZJ A;  1OUV A;  5LCW J;  1HFA A;  3ESK A;  3L13 A;  1SA5 A;  2GRO B;  4G2V A;  4DI3 A;  2Y1L E;  2HO1 A;  2XPY A;  3B13 A;  5CCL A;  4QFV A; 
#chains in the Genus database with same CATH homology
 2QC9 A;  3NOC D;  4GPM A;  5AAO A;  2V4H C;  1IKN D;  5HRY A;  4K5B A;  3Q9U C;  4DX2 A;  4K5A B;  3B95 A;  2Y0B G;  1G3N B;  1MX6 A;  2BKG A;  2DZN A;  1AWC B;  2NYJ A;  2DWZ A;  5FIO A;  3JUE A;  3UI2 A;  1K3Z D;  3LJN A;  2XZD G;  4ZFH A;  4LG6 A;  5ENO D;  2ZGG A;  5HKP A;  2ETA A;  2V5Q C;  3ZU7 B;  2A5E A;  5EN5 D;  2VGE A;  4HI9 A;  5CED B;  1BI7 B;  2JAB A;  1N0R A;  3DEO A;  4U8Y D;  4HRN A;  2ZGD A;  5EID A;  1QYM A;  1N0Q A;  3KEA A;  4U96 D;  3W9G A;  5KNH D;  5EIB E;  5ENQ D;  5ITZ F;  1BU9 A;  1DC2 A;  2PNN A;  4DX6 D;  4OAV B;  3AJI A;  2QYJ A;  4BET A;  4G8K A;  4UUC A;  5CEC B;  3TWT A;  1K1B A;  1BD8 A;  3JXI A;  4DUI A;  1OY3 D;  2XZT G;  5BXU A;  1OT8 A;  1MX4 A;  3V30 A;  5KWD A;  3EU9 A;  1MX2 A;  3TWQ A;  2RFM A;  4YDY A;  3TWR A;  3V2X A;  1MYO A;  4O60 A;  2ETB A;  5KNG A;  3UXG A;  4BER A;  1D9S A;  3ZNG A;  2MYO A;  3T8K A;  4O1O A;  2DVW A;  2HE0 A;  3B7B A;  4BSZ B;  1A5E A;  5ENT D;  5ENP D;  3JXJ A;  4U8V D;  4B93 B;  3TWX A;  1WG0 A;  3J5Q B;  4DX7 D;  3AAA C;  2DZO A;  3DEP A;  5FIN A;  2BKK B;  3TWV A;  4BES A;  1TR4 A;  1DCQ A;  2KBX A;  3Q9N C;  3EHR A;  4G8L A;  2XEH A;  1SW6 A;  1YCS B;  4F1P A;  4RLY A;  4K5C A;  2XEE A;  5EIL A;  4Z68 A;  1BI8 B;  2KXP C;  4HBD A;  4HRM B;  1K1A A;  4N5Q A;  1YYH A;  2F37 A;  1WDY A;  3UTM A;  1AP7 A;  3F6Q A;  4LNU D;  5D66 A;  5CBO A;  1BLX B;  4HI8 A;  2P2C P;  3J5P A;  4CZ2 D;  2B0O E;  3W9F A;  5ENS D;  3TWS A;  4HB5 A;  4HRL A;  4TUM A;  3HG0 D;  4QQI A;  5AN8 A;  4HLL A;  4OAU C;  5AQ7 A;  2XEN A;  5EYP F;  5KBA A;  3ZKJ A;  3T9K A;  3V79 K;  5ENR D;  3IXE A;  1SVX A;  5AQA A;  4BEP A;  4O1P A;  1NFI E;  5CEA A;  3EHQ A;  5BXO A;  4A63 B;  5CBN A;  3C5R A;  1IXV A;  5AQB A;  4HNA D;  4C48 B;  5AAR A;  2FO1 E;  4ZHB A;  2AJA A;  5JA4 D;  4J7W A;  2ETC A;  2RFA A;  1YMP A;  4HQD A;  3TWW A;  1MJ0 A;  4J8Y A;  3SO8 A;  4JB8 P;  4NIK A;  2L6B A;  3TWU A;  5EYL A;  2J8S D;  5CER B;  5AQ9 A;  2F8X K;  5JMN D;  3NBN B;  4U95 D;  4F6R D;  1S70 B;  4ATZ D;  3HRA A;  1IHB A;  2Y1L E;  1N11 A;  4LSZ E;  2F8Y A;  3NOG D;  4YDW A;  3V2O A;  4DX1 A;  3ZUV B;  4DRX E;  4DX5 D;  4CYM D;  4QFV A;  5HS0 A;  3D9H A;  1UOH A;  3V31 A;  4GMR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...