1K1IA

Bovine trypsin-inhibitor complex
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
223
structure length
223
Chain Sequence
IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TRYPSIN
publication title Factorising ligand affinity: a combined thermodynamic and crystallographic study of trypsin and thrombin inhibition.
pubmed doi rcsb
molecule tags Hydrolase
total genus 51
structure length 223
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 2001-09-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1k1iA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1k1iA02
4X1SU 1K1NA 1C1OA 1O5BB 1UTQA 3SU5A 1GVKB 1TMTH 1SMFE 3VB7A 1AD8H 4MNYA 3LGVA 1ZSKA 2BD8A 4NWKA 3K6YA 2F83A 5E0GA 4WXIA 1ZLRA 1HAYB 2GDEH 1GMHG 1GI8B 1DICA 1DUEA 1KYNA 3SJIA 1ANBA 3A89A 2SGQE 1WCZA 4Y71A 1GI2A 1P2QA 3SV8A 1RTKA 2BLVA 1JBUH 3SNBA 3SU4A 3ZVFA 3BTWE 4FUGA 5C1XA 4D8NA 1H8IH 2GV6A 5GJ4B 2FODA 1SLWB 4JYUH 1F2SE 4Q2KA 5FCKA 1V2LT 3QN7A 3QX5H 2W3IA 3ZVCA 5ETXA 1YGCH 2SFAA 2RCEA 1Q3XA 3AAVA 1GHYH 1P04A 3SUFA 2PW8H 3TK6A 1GGDB 4IS5A 3V3MA 2TBSA 3LKWA 1QBOA 4THNH 3QWCH 4WWYA 3H5CB 3SQEE 3L33A 3QO6A 1THPB 3P17H 4AZ2B 2VVUA 1TWXB 4K1EA 1GHAG 1QBVH 2LNCA 3PO1C 3U69H 3SNCA 1SHHB 2ZTZA 1ZMLA 2SNWA 3A84A 3KNXA 1SLVB 3UOUA 2BDHA 4AX9H 1SGEE 5EPNA 5AFZH 4UONA 1O2NA 3GICB 1GMDF 1CBWB 2QXHA 2ANMH 5DK1A 1P9UA 1YPLH 2WV5A 2O9QA 1A3EH 2ALPA 4INHA 1GMCG 3ZZBA 4I8HA 4B75A 1HIAA 1OS8A 1L1NA 1F92A 5A0AE 2PKAB 1TPSA 3DA9B 1CQQA 1VCWA 3WY8A 4WMEA 4ZKNU 1A3BH 4ABEA 4BAOB 4ABAA 2GKVE 3E6PH 1O2OA 1FIWA 1SGQE 3GCHB 3T26A 4K69A 5AFYH 2FXRA 2ANWA 3KEEA 3MNBA 1GVLA 2BD9A 2BD4A 1XUKA 1C5UA 3E90B 1J8AA 1A0LA 1CHOG 1O3IA 2Z7FE 1XUIA 1O2KA 4DOQA 1A2CH 1EOJA 1TGSZ 2EI6A 2G5NA 1TABE 1O5CB 1G9IE 2JH5D 1O2VA 2OD3B 3K65B 4J1YA 4X1PU 1C2LA 3ODFA 2VGCC 1LPGB 2FS8A 4F4OC 4Z6AH 4ISOA 1V2PT 4JMYA 3TJNA 4MPVA 3RXPA 3SUDA 2V3OH 2ZWLH 2OTVA 1VITH 5AHGH 3ZVAA 2XW9A 4WY3A 1RXPA 2BDGA 1NRQH 2HNTC 5EQQA 5DGJA 2ODQA 1O2RA 5C5NA 1EJAA 3GY7A 1W10U 1XKBC 3BIUH 1LDTT 3MYWA 1C5VA 3MNSA 1LQEA 1TPAE 4AFUA 2FOCA 2R0KA 3EA9A 3RXLA 1KXCA 1GMHF 1V2ST 2FYQA 3UWIA 1EPTB 6GCHG 2QA9E 3NXPA 2GDDA 2BD2A 4U2WA 2ANKH 1GI0A 4K8YA 1AUJA 2UUJB 1UVTH 4CHAC 4ISHH 1YKTA 2H9HA 3GCTF 2GCHG 3M37A 1TQ7B 4J2YB 1GJCB 2W7SA 3ZZ5A 4NA9H 1ANDA 3U1IB 3SV2H 1C5PA 1P3CA 1HAVA 1ZPBA 3P92A 1HDTH 1A4WH 2HPPH 3Q3KA 2PFEA 2A0QB 2ZC9H 1NU9A 2OUAA 2HNTE 1KXEA 4DGJA 2ZGXH 1HYLA 3SGBE 3SHCH 1DWDH 3HGPA 3FFGA 1W13U 2ZGHA 1O3PB 2J9NA 2D2DA 1BTHH 1DSUA 1G3DA 3MU5A 3VGCC 2P93A 3SNDA 3M5LA 4OS5A 1DITH 3GY4A 4YO9A 1NRRH 1T8NA 1HLTH 1KDQB 1GJ9B 5JYIA 1AFQB 1HJAC 1P3EA 3QGNB 2Z3CA 2Z94A 4ZH8A 4KKDA 3VB3A 1WTGH 1CHGA 1A5GH 3MH6A 1CSOE 1WU1A 1O3LA 3MOCA 5ABWA 5GXPA 1GJ8B 1BA8B 4OS6A 1XUHA 2OQUA 1GI6A 1IAUA 2STBE 1LMWB 3ATWA 3SGQE 2H5CA 1C2KA 1LQDB 3GY6A 2WYGA 4YOIA 3EYDA 7ESTE 1LTOA 2BDAA 4BTUB 4DG4A 1XXFA 5LPFA 1GMCF 3QUMP 1BTWA 2BX4A 1TRYA 2TRMA 4FUJA 2F91A 1ZSJA 2O8UA 4ABGA 3U98H 3DT0H 1DVAH 1A0HB 1FY3A 2G8TA 1Z8IB 1PJPA 2WPKS 1C1NA 4Y11E 4ABDA 3F1SB 1HPGA 1N6XA 3SBKA 4JZDH 4NIVA 1K28D 4YLUA 4YT7H 4X6NA 1TNGA 5H4IB 1RTLA 1KXAA 1O2LA 3BG4B 2CHAC 1BZXE 5C5OA 2FI4E 2ZHDA 1S0RA 1AWHB 4KELA 2BDBA 3FAOA 1AVXA 2F3CE 1EP5A 2A4GA 1C2GA 3SV9A 4JYVH 3SGAE 2THFB 3LT3A 4ABJA 4AOQA 1VITG 4KTUA 3EE0B 3BEUA 1CA8B 2VWNA 4LZ1H 2BHGA 5TCAA 2UWLA 4D9QA 1AFEH 1DDJA 4FUCA 1SGTA 1D3PB 1NRPH 1T7CA 3LIWA 5LPEA 1K1IA 3RM2H 3ZZDA 5JBAS 3HPTB 4XDEA 2G4TA 1LHDH 3MU4A 1P09A 3ATMA 6GCHF 1MTUA 3OTJE 2PKSC 3MH4A 4BAKB 2EEKA 2C8ZB 5B6OA 5T6DA 1OWEA 2Z9JA 3UY9A 1ZJKA 1O3AA 4MLFB 1C5YB 2GCHF 3TJOA 3BEFB 1PPHE 1ACBE 2P94A 3E1XB 1SQAA 1AWFH 2BOHB 1N1LA 1ZMNA 3PYHA 3E8LA 3M7TA 4D7FA 1LPKB 1XKAC 1BTXA 1PPZA 2UUKB 4Q7XA 2FOHA 2WYJA 3T25A 1SPJA 1O2GH 1GBHA 5G4BA 1BHXF 3VPKA 1V2NT 2FTLE 3LGIA 5FBIA 1W11U 1UTOA 1QGFA 2WUBA 3GDSA 4I8GA 2ODYB 1N8OC 2Q6FA 3K6ZA 1FPHH 2Q1JA 1HIAB 1UK4A 2JETB 2PUQH 5DP3A 4TPYA 4YOGA 4OS1A 2G51A 1BRUP 2G55A 3EA7A 1TGCA 1QA7A 1C4V2 1DWBH 1INCA 2FOMB 3VXEH 1M9UA 4NWLA 1O2TA 1GBFA 3GY8A 1NO9H 1WQVH 1PQ8A 1XMNB 2XNIA 5EXNA 2PV9B 4DURA 1QTFA 2W3KA 4MNVA 4UFEH 4XBDA 2GMTB 1E35B 2JH6D 1FDPA 5C2ZA 4U32A 2PR3A 3GY3A 2XWAA 2PKAA 1EJNA 1MKXH 4K1TA 2ZNKH 3S7KB 1GPZA 1H1BA 4MPWA 3ZYEA 3S9AA 4ZKRU 4LK4A 3URDA 3H7TA 5F03A 2ESTE 2QXGA 1PQAA 4INLA 5GPIB 1SC8U 2BY6X 3LGTA 3L6PA 1FAXA 1YCPM 3ATKA 4Y8ZA 3TNSA 5K7RA 1QQ4A 1O3CA 2V0BA 2EI7A 1KXDA 1TQ0B 2ZO3H 1TNLA 1FY1A 1YCPK 2FX4A 3AW1A 1GBBA 3PMHB 2PUXB 3P8FA 3GCOA 4MVNA 4Y7BA 3MFJA 1KLTA 3RXJA 1FN8A 2M5TA 1BRCE 1O5DH 1GBEA 4IN1A 3TNTA 1HBTH 2ZU3A 4AYYB 7KMEH 3LH3A 4TWWA 1JRTA 1VITF 3ZZ9A 3OY6U 1A5HA 5FHTA 3HK6B 3RXHA 1TNJA 2SGAA 3RDZA 3NZIA 2ZDVH 4Y8YA 1HAVB 1UJ1A 1D3QB 4XBBA 1SGDE 5C20A 4WMFA 2GV7A 2R9PA 4NA7A 2W7UA 4X8UH 1CO7E 5FCRA 1HNEE 1S81A 4ABHA 3HGNA 1DPOA 1ID5H 1Y5AT 1F5KU 1QJ6B 2QGRA 4DVAU 1OWHA 1VGCC 1O3MA 5GIBA 3PMJA 1C5LH 2CF9H 1TFXA 3BTHE 1RS0A 1E37B 9LPRA 5LPRA 4GLYA 2ZECA 4O3TA 1GI9B 5CMXH 1Z6EA 4IC6A 2BLWA 1GJDB 5EGMA 3SU0A 1Y5BT 4MQAA 1GL0E 1O30A 2YNAA 3BTGE 5LH8A 1AB9B 3M35A 1GHBG 2RG3A 1MBMA 1UMAH 4AB8A 2BY5X 3T28A 2G5VA 2ZFQH 3I78A 5CHAC 2Y80A 1G3CA 3UFAA 2O8MA 1P57B 4O97A 3M3VA 5DP7A 2F9UA 3VB6A 4UFDH 3QTOH 1P01A 2AH4X 4D7GA 3BTFE 3UIRA 1KTTB 3TH3H 1HAXB 5DG6A 2BB4A 3RXTA 1AVGH 4ABBA 3MH5A 1KLJH 1F5RA 4QT8C 3RMLH 4B2CA 1PPCE 3LJJA 1BT7A 5J4SA 2NU3E 3TU7H 2XCFA 2DE8A 2BY8X 3ZZ7A 1CT0E 1GVZA 1GJ6A 1GBCA 4TY6A 3NPSA 2AYWA 1GBTA 1K1MA 1UTJA 1O2QA 1C9PA 2BTCE 4AN7A 2ASUB 3PLKA 2AGEX 1MCTA 1ZMJA 1XX9A 3M5OA 1EB1H 1UCYE 1LHCH 2J2UA 3EQ0H 1G3BA 1FONA 1VJAU 2ZKSA 1V2VT 1FAKH 1JOUB 3ESTA 1QB9A 1E36B 4ISLA 4Q7YA 3SQHE 2Z9IA 1WQSA 1HAGE 1C1PA 3RXVA 2TGTA 4SGAE 3HKIB 3SO3A 3KQEA 1Z8JB 2HVXA 4I8LA 4F49A 1YPEH 1E34B 3QDZB 1GDNA 1BTZA 2ZFFH 4FU7A 3RXIA 1ZJDA 1PYTC 2BZAA 2XTTB 3OX7U 4BAMB 5AF9H 1J14A 4XFQA 1O36A 3RLWH 1O37A 5FPYA 2RDLA 2FI3E 5GWZA 4GPGA 4X1RU 1UO6A 3UUZA 3Q77A 1TPOA 4WH8A 1LVOA 1BTYA 1Z7KA 1O2XA 2B8OH 2GZ9A 1BRAA 3GISB 4TPIZ 2PLXA 3VB5A 1MKWK 1JIMA 2ODPA 3GCTG 4A5TS 1HGTH 1SLUB 5E8EH 3EA8A 1SLXB 2VVVA 1FUJA 2PSYA 1K1PA 4B2BA 3A80A 5HMAA 1MTNB 1NESE 1F0TA 1OYTH 1ZPZA 4BAHB 2G81E 2VIQA 2PTNA 2QF0A 2W5EA 4GVUA 2C8YB 3SOSA 1MQ5A 3OY5U 3U1JB 2ZQ2A 1VR1H 4Q80A 3MU1A 1BTUA 3Q3YA 1NFYA 1UVPA 2OC7A 1ZZZA 2UWPA 3SJ9A 2J38A 1P2NA 1BIOA 2FO9A 2H1UA 2Y82A 2ZDKA 2FX6A 3GYLB 1TLDA 3SI4H 2O8WA 2BD5A 3U8TH 1GJ4H 1QL9A 3MH7A 1ZR0A 5EQSA 1O3OA 1V3XA 2BYAX 4BOHA 1TNKA 2BOKA 3ZYDA 6ESTA 2A5IA 1TB6H 1ZOMA 2FOAA 1GHBF 1TX8A 1YF4A 4Y79A 2ZDLA 4NG9H 4IGDA 3E3TA 2EA3A 3BTME 4ZKSU 5A0CA 2VB0A 1GDUA 1P02A 1C5TA 1J17T 1QFKH 1S82A 1KY9A 4KGAA 3UQVA 1BOQA 1OPHB 2B9LA 1QRXA 4RKJB 1ZSLA 2WPHS 1UCYK 4IN2A 4NIYA 4A6LA 2CXVA 2Z3EA 3BF6H 3RXCA 3BTQE 1C5XB 1IHSH 4E7NA 2FOBA 3F9HA 3H7OA 2NU0E 1AMHA 4YM9A 1MZDA 2ZU5A 2AERH 3GDUA 1ELVA 2F9OA 2OINA 3RXSA 5DP6A 2VIWA 3C1KA 1LCYA 1O2ZA 3MU8A 1ZGVA 3T62A 3E16B 1SB1H 1NU7B 1O5FH 1YYY1 1Z6JH 3PO1B 1A0JA 4NA8A 4BXSA 1DWCH 1TGBA 1O3GA 3SU3A 1H4WA 1NROH 4BXWA 1OP2A 3A7ZA 2VNTA 2ZDMA 2AIQA 2NU4E 3A85A 2A4RA 2GP9B 1H8DH 1IQHA 1Y3XA 2QY0B 3LJOA 1VCPA 1EATA 2P8OC 1L1GA 2FTMA 2WPMS 5A09A 3ZZ3A 1DM4B 5EODA 1SGFA 1GCDA 1TPPA 3Q76A 1D3TB 4ZXYH 3ZVGA 1ZPCA 1C2JA 1EKBB 1ARBA 4X8VH 4ESTE 1FJSA 1LHGH 4CRBA 4R8TB 2BD3A 2HWLB 4I33A 5EOKA 2W26A 3MI4A 2Y5HA 3UOPA 1MD8A 1O2PA 4CRDA 2BQWB 2BM2A 1BBRK 2ZCHP 1Z1IA 5T3HA 3SUGA 4KTCA 1AZZA 1WBGB 1HRTH 1RJXB 2QYIA 4I7YH 1AU8A 2LPRA 4AB9A 2A7JA 1T8OA 4FU9A 1FPCH 3SW2B 1GG6C 4Y10E 2FI5E 2XBVA 1QY6A 1VJ9U 2FDAA 3SZNA 2C8WB 3ZZCA 4AFQA 2ZPQA 5L2ZH 1ESAA 2VGCB 5FX5A 1G30B 4ISNA 1UTMA 2CGAA 1JMOH 1UVOA 4XBCA 1C4U2 2D8WA 2ZPSA 3G01A 5I25A 4GSOA 4D76A 1S85A 2BQ6B 4X1NU 5T6GA 3GCNA 1C1TA 1ESTA 3A8BA 1XVOA 1N6YA 1V2QT 1O34A 1TE0A 1LPZB 2XC0A 4ABIA 1C1RA 2WINI 4BNRA 4CHAB 2GD4B 1O39A 3JZ1B 1ZTKA 2H2ZA 1AE5A 1DXWA 1A46H 3R3GB 1KTSB 1IQGA 1IQNA 3HKJB 1C2DA 2WUCA 3E0NB 3IITA 4U01A 2KAIB 1GCTC 3S0NA 4MNXA 3FVFB 1ZHPA 4MPXA 1LVMA 1UVUH 5EG4A 2ZEBA 2ZHEH 4X2VA 3R0FA 1O2MA 1P2OA 2VIPA 4RN6A 1MUEB 3O8BA 1SL3A 4ZUHA 4CRFA 8LPRA 1HFDA 1GBIA 2A5KA 2ZDNA 4ZHAA 1EAIA 2I6SA 3UWJH 3TK5A 2ZHWH 1QR3E 7GCHF 3IG6B 4A1XA 3NUMA 3VGCB 1YPKH 3ELAH 1FY4A 1PQ7A 2VU8E 1G2LA 1RIWC 1YBWA 1ZHRA 1ELAA 4X6OA 1GBAA 3KF2A 1OYQA 1HJAB 4VGCC 2H9EH 4WF8A 3UR6A 1MH0A 4Y0YE 1CA0C 4K2YA 4ZAEA 1FLEE 5IYTA 2ZTXA 4IBLH 2AGGX 4AYVB 3UNRA 1LKAA 3O8CA 2P3TB 3A7TA 3SNAA 3U9AH 4FUHA 1BJUA 5EU8A 3NK8A 3A83A 1GJBB 2ULLA 5DKMA 1BCUH 3ENSB 4BTTB 5J4QA 1O0DH 1BRBE 2FESH 3PM3A 1MTSA 4CR9A 5FAHA 8GCHG 4INKA 2ZTYA 4ZHMU 1GHZA 3TJVA 1P2KA 5HGGA 3SNEA 4E7RG 1P06A 3SU1A 1B5GH 4JZEH 5DJ7A 3SV7A 3KN2A 1C1VH 1O5GH 3P95A 1TGTA 5TJXA 2OBQA 1SGYE 7LPRA 4D9RA 1PPFE 5DO4H 1H9HE 2BDCA 1WSSH 4JK5A 2ZU2A 1K1LA 3M5MA 1MAXA 2CHAB 3I29A 1TAWA 1YPHC 3A81A 4H4FA 9ESTA 1PPEE 1TOMH 2FP7B 3LGYA 1MQ6A 4WXVA 3URCA 6CHAC 4JCNA 4FVDA 3EGKH 1TBQH 2A4OA 4H42U 1RRKA 3MMGA 3E0PB 3STJA 4UFFH 1NFWA 1Y3UA 2P16A 1SVPA 3FANA 1S6FA 2ZDAH 2UUYA 3FP8E 5T6FA 8ESTE 1J16A 3KIDU 1L4DA 1AY6H 3PB1E 2D26C 3QTVH 4AG2A 3M7QA 3ZZ6A 1MTWA 1AGJA 1OSSA 2CV3A 2FZZA 3RM0H 4DT7B 4FUFA 5DPAA 3RXGA 3TVJB 4GHTA 1Z8RA 2GCTC 5C1YA 1TALA 4MG3A 3UREA 2TGAA 3RUOA 1RGQA 1GI7B 3STIA 2PKSB 1YPHE 4B71A 3B9FH 3D23A 2H5DA 5F6MA 1F0RA 3DFLA 3EAJA 1V6DA 2GZ8A 2FS9A 1G3EA 4GAWA 3ATLA 5FPSA 3BV9B 2CN0H 3CENA 1NZQH 1ZRKA 2R2MB 3A7YA 1KIGH 2BVSH 5K0HA 1YPJH 2SNVA 3T27A 2QCYA 2A31A 2QF3A 1S6HA 4AG1A 4B1TA 4CR5A 1T4UH 2F9VA 2PGQB 3M61U 1Y3VA 2Z3DA 1HB0B 4AGJA 4NCYA 3TH2H 4XOJA 4UD9H 1O38A 3UTUH 1N8OB 3S9CA 3D65E 2Y7ZA 4Y8XA 4GCHG 4YOJA 1YP9A 3QK1A 2PHBA 4OS2A 2YNBA 1Z1JA 1K9OE 1SR5C 2XBWA 1AE8H 1D6RA 1TA6A 1Y8TA 3B23B 3GOVB 5EXMA 1ZYOA 3A7XA 3LGWA 3MTYA 3ZVBA 3BG8A 3K9XB 1SGCA 4B76A 1O2JA 4BANB 1C5OH 3LH1A 1NY22 3IWMA 1C1UH 1WUNH 5A8XA 1J9CH 4HGCA 2P59A 1BITA 1IQFA 3TPIZ 3SV6A 3O8DA 2HNTF 3KHVA 2ZHQH 1G32B 5SGAE 1C2IA 1QHRB 2RA0A 2B0FA 4LOYH 1HJ9A 4X1QU 3BSQA 1YPMH 2A7CA 3V7TA 1GBKA 2BY7X 4CRCA 2J4IA 8GCHF 1L2EA 4DJZB 5EXLA 2QXIA 1NPMA 2VWLA 4OGXA 3LC3A 4NFEA 3SU6A 3A87A 3TIUA 1AZ8A 1W0ZU 1ELEE 1DX5M 2J94A 1TOCB 2ZU1A 1GBLA 1SG8B 1XUGA 1SOZA 3SU2A 2ZI2H 1T8LA 1ANEA 4DW2U 2ZIQH 1K1JA 1IQMA 1YLCA 1BMAA 1V2UT 4KTSA 4DIIH 5JBBS 3JZ2B 5HM2A 5FBEA 4AFZA 1OWDA 1E38B 2NU2E 1ELFA 1SFIA 1C5MD 1THSH 1TRNA 3S69A 1OWKA 3BTTE 1UCYH 3PLBA 3LGUA 1ABJH 3RXDA 1IHTH 1SGFG 2GZ7A 4MPUA 3RXEA 4H6TA 1L1JA 2FOGA 5DP9A 3T2NA 2Y6TA 2HGTH 4XE4A 2NU1E 1Y3YA 1FV9A 4ABFA 2BD7A 3BTEE 1NS3A 4UDWH 1LHFH 5HXFA 5L6NH 2F9PA 1HXEH 1A61H 2ZPRA 4O9VA 1T8MA 1V2KT 2OBOA 1ABIH 1O2YA 4CRAA 4MDSA 3T29A 3T5FH 1ELGA 1DOJA 3RLYH 1BTPA 2ZCKP 3Q00A 2FPZA 2VIVA 3ZZAA 2ZFTA 1KXFA 2GX4A 1C5NH 3SJ8A 4A7IB 1BUIA 1BB0B 1QB1A 3DUXH 1TMBH 4I32A 2ZGJA 1VGCB 2TPIZ 4JK6A 2PWXA 2ZF0H 1JIRA 4Q7ZA 3RXBA 1WYKA 4SGBE 2KAIA 3FP6E 2HRVA 2Z6BD 1BDAA 3A8AA 1Y3WA 2I6QA 3D62A 3MWIU 3PROA 4BAQB 1GL1A 3ATIA 4UEHH 4I31A 4GUXA 1QBNA 1NT1A 4IMQA 1U6QA 2H6MA 1O31A 1FXYA 1DXPA 4Y76A 5DP4A 4ZXXH 2DE9A 5CHAB 1ZGIA 3UNQA 3RXKA 2Q6GA 1EOLA 1O5AB 3A88A 4NSYA 4GCHF 4IW4E 2P3FH 1Z8GA 2AMQA 5BRRE 1EZSC 3PTBA 1WAYB 4YLQH 1QA0A 2BQ7B 3F9GA 1BMLA 1C2HA 1G36A 1IOEA 5LGOA 4A1VA 1GGDC 2CF8H 3M5NA 1P12E 1KXBA 3GYMA 3SUEA 2R3YA 2QAAA 1E0FD 2XCNA 1HAZB 3PTNA 1V2JT 1TX6A 1SQOA 2AGIX 1H9IE 1DLEA 2OC0A 3RXUA 2FOFA 2ZG0H 3GY2A 5E0HA 4X8TH 4Y6DA 2ALVA 1FY5A 1MKXK 2R2WU 3O8RA 4DY7B 2ZQ1A 1NFUA 3RMOH 2VJ1A 4H6SB 4UFGH 1G37A 1P2MA 1BBRE 3AVZA 3C27B 1PYTD 1L4ZA 2IPHA 1C1WH 4TYDA 1MD7A 1TYNA 4FU8A 1OP0A 2A45B 1K1OA 1TA2A 2K1QA 4CREA 1CBWC 1VCQA 4ZHLU 1YLDA 2VH6A 1HAHH 1LHEH 1ANCA 1QURH 5JPMH 5A2MH 3A8DA 5GDSH 1W2KH 1MMJN 3BEIB 5HM9A 5HYOA 3ZZ8A 1ETRH 4NSVA 1EQ9A 1QL7A 3A82A 1AQ7A 1TBRH 4X6PA 3RXMA 3PMBB 3LC5A 2O8TA 2QIQA 3LPRA 4JYTA 3GCHC 2A2QH 1UHBA 1TNHA 4LZ4B 1O3DA 2G00A 2BXTH 1UVSH 2UWOA 5GCHG 1DT2A 1XVMA 2WPIS 1EAUA 4X2WA 1BQYA 3P8NA 4K60A 1F0SA 1C9TA 1EP6A 2Z9LA 2EI8A 4BTIB 1TGNA 5E2PA 2BDYA 1O2HA 4RKOB 1O3BA 3A7VA 3S7HB 3EDXB 2OCVB 2CJIA 1W3CA 1TBZH 1MCVA 2BZ6H 1HUTH 1T4VH 1SOTA 1RD3B 5FXLA 3DHKH 3U8OH 2QXJA 1D4PB 2XYAA 5AVDA 3RMMH 7GCHG 1C5RA 2AMPA 1XUFA 1GI5A 4ZMAH 3LDXH 1AVWA 1MBQA 1QNJA 5EPYA 2ANYA 3VEQB 1GHVH 2XBYA 1K2I1 4AORA 1WV7H 1OP8A 1P03A 1SHYA 2GT7A 4X2YA 1GBMA 1EPTC 3TGKE 2GGVB 4HTCH 1P2JA 1DS2E 1CVWH 5A8ZA 1CGHA 4K1SA 1BHXB 1D3DB 4IMZA 1W7XH 1C5WB 5L2YH 2HOBA 1GHXH 2BMGB 3FZDA 1OOKB 1K21H 5ESBA 1JWTA 3UPEA 3P70B 1PFXC 1DY9A 2JKHA 1F0UA 2FM2A 4CH8B 1OWJA 1C4Y2 3BTKE 3CS0A 8KME2 1MZAA 1RTFB 1W0YH 3TJUA 4NIXA 1F5LA 1NRNH 1A1RA 5JB8S 2V35A 1S5SA 1YPGH 3MNXA 1OWIA 2G4UA 2ZCLP 2VINA 1O33A 1C5ZB 1MTVA 1VZQH 4WH6A 1D6WA 4PROA 3PMAB 2B5TB 4XSKU 4AGKA 4A92A 2ZZUH 1TRMA 1UK2A 1AFQC 2AEIH 2WV4A 3A86A 3TK9A 2ZGCA 3QGJA 4FXGH 3ZV8A 4ZKOU 1UK3A 2VWOA 1O3FA 1UTPA 1B0FA 2R0LA 1QIXB 5C3NA 5CE1A 1GHWH 2FLRH 4JZFH 2P8OB 3N7OA 4Y7AA 1AKSB 3RMNH 1O2WA 4YZUA 1ZTJA 1OX1A 3A8CA 6LPRA 2GVFA 2YOLA 1EZUC 4M7GA 3FZZA 4X2XA 5JBCS 4ZROA 3F68H 1EZXC 3SJKA 4NFFA 2A1DB 1IQKA 2FEQH 1ETTH 3P8OA 2B7DH 2OQ5A 2FLBH 2AFQB 1XM1A 3MU0A 2Y81A 3VFEA 2EC9H 1T31A 2O8LA 3MO3A 4A1TA 5GCHF 4TWYA 2C93B 3UR9A 2ZP0H 1FIZA 2SGDE 1HAPH 1MAYA 2C90B 4OS4A 1GG6B 1QCPA 5FX6A 2XWBI 2V3HH 3LONA 2IN2A 1GJ5H 1GHAF 3BG4C 1P05A 1QB6A 1SBWA 1TMUH 1HXFH 1XXDA 2XRCA 1YCPH 2TGDA 4NZQA 3W94A 2IOTA 1NFXA 1SSXA 1CGIE 3AW0A 3RU4T 2D1JA 3RXFA 1SGPE 2Z9KA 1GBJA 1WOFA 3KGPA 4CH2B 5TCCA 2ZA5A 1C2EA 2RA3A 2BLOA 1W8BH 3OU0A 3PV4A 2FWWA 2GT8A 3F9FA 1NTPA 1ESBA 2OLGA 4KP0A 4YT6H 4X8SH 2TGPZ 1DFPA 2GTBA 4WJG2 2BDIA 1KLIH 3PLPA 5EW1H 2P3UB 3SHAH 3KQCA 3VB4A 3MO6A 5F8XA 1Y5UT 4K8BA 1THRH 1EAWA 2Z9GA 3OSYA 4I8KA 1CHOF 3KQBA 2QC2A 4IC5A 2F9BH 1O2IA 2Y5FA 2XC5A 1GI3A 1GCTB 4HZHA 1KSNA 2BXUH 5ESTE 3S9BA 4DIHH 4OS7A 3SI3H 2BX3A 2QV1A 3TGJE 1QL8A 2A4QA 3TLOA 1ZTLA 1CT4E 3KCGH 3OYPA 4HI3A 2J95A 4YESB 2OP9A 5E0JA 4B2AA 1ELCA 2OXSA 5F8TA 1HJ8A 4R0IA 1A5IA 1RIWB 2A2XH 3U8RH 1QQUA 2HALA 4VGCB 3VXFH 2JETC 2PSXA 5C67A 1Q2WA 2PTCE 1CA0B 3KL6A 4ISIH 1DY8A 4FVBA 4MNWA 3ODDA 1P11E 1V2TT 3V12A 1BMNH 3MO9A 4HFPB 4WVPE 1AI8H 5L30H 2NWNA 1GBDA 1UHBB 2J92A 4AFSA 3V13A 1GJ7B 1GWAA 1H9LB 3NCLA 4O03A 1YC0A 1P8VC 1PPGE 5F8ZA 4E06H 3AAUA 3A7WA 2GMTC 2JH0D 2SGFE 2ZFSA 1P9SA 1ZHMA 2VWMA 3DFJA 1HV7A 1TNIA 5JBTA 1NC6A 4NIWA 5E2OA 1O3JA 2F9NA 2WPJS 3ZVEA 2OC8A 3P6ZB 1IQLA 1MU8B 1HAOH 4Y0ZE 1QJ1B 5IDKA 4FUIA 1PPBH 3RXAA 1TX7A 1DUAA 3BN9A 2A5AA 3PWBA 4FUBA 2C3SA 2XBXA 1EUFA 2A32A 5EW2H 1HCGA 1Z71A 5FPTA 2TIOA 1K22H 1NN6A 4GHQA 2ZFRH 3E91A 1O3KA 1ELTA 1ARCA 2ZGBH 2VIOA 2BLQA 3D49H 2ZFPH 1ORFA 1YM0A 1XUJA 3BIVH 1P0SH 6CHAB 1W14U 1QRWA 1V2WT 1C1QA 3SORA 2UUFB 1ELBA 1C1SA 5A8YA 2P95A 1OXGA 1CGJE 2QN5T 3TGIE 1MKWH 3DD2H 1EZQA 1LVBA 2AMDA 1FZZA 3RC6A 1UTLM 1QJ7B 3I77A 1CU1A 1P2IA 2Y7XA 4FUDA 1O2SA 2FYRA 4B74A 1B0EA 1W7GH 2GCTB 1O5EH 1GJAB 4E05H 1O2UA 2C4FH 1S83A 1SQTA 3NWUA 4DCDA 2Y5GA 3CS7A 1C5QA 2C8XB 3SJOA 1SGRE 1Q31A 2H9TH 3MHWU 3RP2A 3QLPH 1B7XB 1LO6A 2XXLA 2R3UA 2SGPE 1DLKB 1LKBA 4NZLA 1C1MA 4JZIA 4CRGA 2BY9X 1O3NA 1V2MT 1FI8A 1SGIB 3RC5A 2HPQH 1NM6A 1ETSH 1EASA 3AASA 1AIXH 4K5ZA 1IQJA 1EX3A 1IQIA 1A7SA 1WTHD 2ZHFH 1IQEA 1O3EA 4LXBH 5A0BA 1EAXA 1MU6B 3L3TA 1AB9C 1FY8E 3RXRA 3HATH 1RFNA 1BMMH 5EQRA 1NRSH 1BJVA 3BTDE 2IJOB 1DSTA 3GDVA 3V0XA 1ZRBA 1AO5A 1O35A 3RU4D 3RU4E 4B73A 3RXOA 2VH0A 1LVYA 1SFQB 2STAE 1C2FA 3M3SA 3PWCA 2A7HA 1AHTH 1C2MA 1UTKA 2CMYA 3ZVDA 1FNIA 1T32A 1CE5A 1EPTA 1GI4A 3Q3XA 5I46H 3GY5A 3W95A 2DUCA 1EJMA 1W12U 1G2MA 1TIOA 1QRZA 1SI5H 1Y59T 5JDUB 3RXQA 2BVRH 1AKSA 1FQ3A 2FIRH 2J34A 1FMGA 2WPLS 3QZQA 3FP7E 1FN6A 1EXFA 1L0ZA 5DP8A 3M7UA 2VIDA 1HAIH 2Q6DA 4ASHA 1DANH 1V2OT 3KQDA 4U30A 3TH4H 2FOEA 2V6NA 1J15A 4O3UA 1ELDE 2HLCA 1S0QA 3CP7A 4X6MA 4MTBA 1JRSA 3K2UA 1D9IA 1EB2A 1GMDG 3F9EA 2OC1A 3HK3B 3P8GA 1AUTC 4RSPA 3SN8A 2AS9A 2BVXH 5C1UA 3TITA 4K3JA 3MNCA 1SGNE 4NGAH 1CT2E 2FMJA 1TONA 1F7ZA 3NKKA 1KDQA 5JB9S 3ZV9A 1O3HA 4OGYA 2G52A 3UQOA 2SGEE 4JZ1A 5DP5A 2VVCA 3ITIA 4CBNA 2XC4A 1V2RT 3B8JA 4UE7H 1GI1A 1UTNA 2ZU4A 1AN1E 3LU9B 4X0WU 4YTAA 5PTPA 1P10A 4CBOA 2PGBB 3F6UH 4WMDA 1BBRH 3ZZ4A 3RC4A 1S84A 3UNSA 1X7AC 1DWEH 1OKXA 5BPEA 3QZRA 1PQ5A 3LOXA 4TY7A 1DE7H 1MTNC 4FUEA 1JXPA 3M36A 2ILNA 3M3TA 1GDQA 4I8JA 4Z0KA 2AIPA 1C5SA 1O32A
chains in the Genus database with same CATH superfamily
4X1SU 3EE7A 1K1NA 1C1OA 1O5BB 1UTQA 3SU5A 1GVKB 1TMTH 1SMFE 3VB7A 1AD8H 4MNYA 3LGVA 1ZSKA 2BD8A 4NWKA 3K6YA 2F83A 5E0GA 4WXIA 1ZLRA 1HAYB 2GDEH 1GMHG 3F2FA 1GI8B 1DICA 1DUEA 1KYNA 3SJIA 1ANBA 3A89A 2SGQE 1WCZA 4Y71A 1GI2A 1P2QA 3SV8A 3WWBA 1RTKA 2BLVA 1JBUH 3SNBA 3SU4A 3ZVFA 3BTWE 4FUGA 5C1XA 4D8NA 1H8IH 2GV6A 5GJ4B 2FODA 1SLWB 4JYUH 1F2SE 4Q2KA 5FCKA 1V2LT 3QN7A 3QX5H 2W3IA 1E1QD 5C94A 3ZVCA 5ETXA 1YGCH 2SFAA 1KMHB 1Q3XA 2RCEA 3AAVA 1GHYH 1P04A 3SUFA 2PW8H 3TK6A 1GGDB 4IS5A 3NRLA 2J98B 3V3MA 2TBSA 3LKWA 1QBOA 4THNH 3QWCH 4WWYA 3H5CB 3SQEE 4RT0A 3L33A 3QO6A 1THPB 3P17H 4AZ2B 2VVUA 1TWXB 4K1EA 1GHAG 1QBVH 2LNCA 3PO1C 3U69H 3SNCA 2KCPA 1SHHB 2ZTZA 1ZMLA 2SNWA 3A84A 3KNXA 1SLVB 3UOUA 2BDHA 4AX9H 1SGEE 3CNRA 5EPNA 5AFZH 4UONA 1O2NA 2KX4A 3GICB 1GMDF 1CBWB 2QXHA 2ANMH 5DK1A 1P9UA 1YPLH 2WV5A 2O9QA 1A3EH 2ALPA 4INHA 1GMCG 3ZZBA 3PRDA 4I8HA 4B75A 1HIAA 1OS8A 1L1NA 1F92A 3WW7A 5A0AE 2PKAB 1TPSA 3DA9B 1CQQA 1VCWA 3WY8A 4WMEA 4ZKNU 1A3BH 4ABEA 4BAOB 4ABAA 4RT1A 2GKVE 1SKYE 3E6PH 1O2OA 1FIWA 1SGQE 3GCHB 3T26A 3OE7D 4K69A 5AFYH 2FXRA 2ANWA 3KEEA 3MNBA 1GVLA 2BD9A 2BD4A 1XUKA 1C5UA 3E90B 1J8AA 1A0LA 1CHOG 4FOUC 1O3IA 2Z7FE 1XUIA 1O2KA 4DOQA 1A2CH 1EOJA 1TGSZ 2EI6A 2G5NA 1TABE 1O5CB 1G9IE 2JH5D 1O2VA 2OD3B 3K65B 4J1YA 4X1PU 1C2LA 3ODFA 2VGCC 1LPGB 2FS8A 4F4OC 4Z6AH 4ISOA 1V2PT 1E1RD 4JMYA 3TJNA 4MPVA 3RXPA 3SUDA 2V3OH 2ZWLH 2OTVA 1VITH 2JJ1D 5AHGH 5F53A 2XW9A 3ZVAA 4WY3A 1RXPA 2BDGA 1NRQH 2HNTC 5EQQA 5DGJA 2ODQA 1O2RA 5C5NA 1EJAA 3GY7A 1W10U 1XKBC 3BIUH 1LDTT 3MYWA 1C5VA 3MNSA 1LQEA 1TPAE 4AFUA 2FOCA 2R0KA 3EA9A 3RXLA 1KXCA 1GMHF 1V2ST 2FYQA 3UWIA 1EPTB 6GCHG 3DSPA 2QA9E 3NXPA 2GDDA 2BD2A 4U2WA 3FOAA 2ANKH 1GI0A 4K8YA 1AUJA 2UUJB 4TT3D 1UVTH 4CHAC 4ISHH 1YKTA 2H9HA 3GCTF 2GCHG 3M37A 1TQ7B 4J2YB 1GJCB 2W7SA 3ZZ5A 4NA9H 1ANDA 4I86A 3SV2H 1C5PA 3FO8D 3U1IB 1P3CA 1HAVA 1ZPBA 3P92A 1HDTH 1A4WH 2HPPH 3Q3KA 2PFEA 2A0QB 2ZC9H 1NU9A 2OUAA 2HNTE 1KXEA 4DGJA 2ZGXH 1HYLA 3SGBE 3SHCH 1DWDH 3HGPA 3FFGA 1W13U 2ZGHA 1O3PB 2J9NA 2D2DA 1BTHH 1DSUA 1G3DA 3MU5A 3VGCC 2P93A 3SNDA 3M5LA 4OS5A 1DITH 3GY4A 4YO9A 1NRRH 1T8NA 1HLTH 1KDQB 1GJ9B 3H09A 1AFQB 1HJAC 1P3EA 3QGNB 5JYIA 2Z3CA 2Z94A 4ZH8A 4KKDA 3VB3A 1WTGH 1CHGA 2WHXA 1A5GH 3MH6A 1CSOE 1WU1A 1O3LA 3MOCA 5ABWA 5GXPA 1GJ8B 2WPDD 1BA8B 4OS6A 1XUHA 2OQUA 1GI6A 1IAUA 2STBE 1LMWB 1YLNA 2KR7A 3ATWA 2H5CA 3SGQE 1C2KA 1LQDB 3GY6A 2WYGA 4YOIA 3EYDA 7ESTE 1LTOA 2BDAA 4BTUB 3F0PA 4DG4A 1XXFA 5LPFA 1GMCF 3QUMP 1BTWA 2BX4A 1TRYA 2TRMA 4FUJA 1OHHD 2F91A 1ZSJA 2O8UA 4ABGA 2JIZD 3U98H 3DT0H 1DVAH 1A0HB 1FY3A 2G8TA 1Z8IB 1PJPA 2WPKS 1C1NA 4Y11E 4ABDA 3F1SB 2YMSC 1HPGA 1N6XA 3SBKA 4JZDH 4NIVA 1K28D 4YLUA 4YT7H 4X6NA 1TNGA 5H4IB 1RTLA 1KXAA 1O2LA 3BG4B 2CHAC 1BZXE 5C5OA 2FI4E 2ZHDA 1S0RA 1AWHB 4KELA 2BDBA 3FAOA 1AVXA 2F3CE 1EP5A 2A4GA 1C2GA 1BMFD 3SV9A 2PP6A 4JYVH 3SGAE 2THFB 3LT3A 4ABJA 4AOQA 1VITG 4KTUA 3EE0B 3BEUA 1CA8B 2VWNA 4LZ1H 2BHGA 5TCAA 1WXRA 2UWLA 3UAIC 4D9QA 5HKKD 1AFEH 5GNDA 1DDJA 4FUCA 1SGTA 5HIYA 1D3PB 1NRPH 1T7CA 3LIWA 5LPEA 1K1IA 3RM2H 3ZZDA 3MQKC 5JBAS 3HPTB 4XDEA 5KEDA 2G4TA 1LHDH 3MU4A 1P09A 3ATMA 6GCHF 1MTUA 3OTJE 2WV9A 2PKSC 3MH4A 4BAKB 2EEKA 2C8ZB 5B6OA 5T6DA 1OWEA 2Z9JA 3UY9A 1ZJKA 1O3AA 4MLFB 1C5YB 2GCHF 3TJOA 3BEFB 1PPHE 1ACBE 2P94A 3E1XB 1SQAA 1AWFH 2BOHB 1N1LA 1ZMNA 3PYHA 3E8LA 3M7TA 1UW7A 4D7FA 1LPKB 1XKAC 1BTXA 1PPZA 2UUKB 4Q7XA 2FOHA 2WYJA 3T25A 1SPJA 1O2GH 1GBHA 5G4BA 1BHXF 3VPKA 1V2NT 2FTLE 2J98A 3LGIA 5FBIA 1W11U 1UTOA 1QGFA 2WUBA 3GDSA 4I8GA 5T1VA 2ODYB 1N8OC 2RFKC 2QF5A 2Q6FA 3F3BA 3K6ZA 1FPHH 2Q1JA 1HIAB 1UK4A 2JETB 2PUQH 5DP3A 4TPYA 4YOGA 4OS1A 2G51A 1BRUP 2G55A 3EA7A 1TGCA 1QA7A 1C4V2 1DWBH 1INCA 2FOMB 3VXEH 1M9UA 4NWLA 1O2TA 1GBFA 3GY8A 1NO9H 1WQVH 1PQ8A 1XMNB 2XNIA 5EXNA 2PV9B 4DURA 1QTFA 2W3KA 4MNVA 4UFEH 4XBDA 2GMTB 5CDFE 2JJ2D 1E35B 2JH6D 1FDPA 5C2ZA 4U32A 2PR3A 3GY3A 3KQ5A 2XWAA 2PKAA 1EJNA 1MKXH 4K1TA 2ZNKH 3S7KB 1GPZA 1H1BA 4MPWA 3ZYEA 3S9AA 4ZKRU 4LK4A 3URDA 3U28C 3H7TA 5F03A 2ESTE 2QXGA 1PQAA 4ACBA 4DT4A 4INLA 5GPIB 1SC8U 2BY6X 3LGTA 3L6PA 1FAXA 1YCPM 5CHBA 3ATKA 4Y8ZA 3TNSA 5K7RA 1QQ4A 1O3CA 2V0BA 2EI7A 1KXDA 1TQ0B 2ZO3H 1TNLA 1FY1A 1YCPK 2FX4A 3AW1A 1GBBA 2W6ID 3PMHB 3FN8A 2QE7D 2PUXB 3P8FA 3GCOA 4MVNA 4Y7BA 3MFJA 1KLTA 3RXJA 1FN8A 2M5TA 3UB0A 1BRCE 1O5DH 1GBEA 4IN1A 3TNTA 1HBTH 2ZU3A 4AYYB 7KMEH 3LH3A 4TWWA 1JRTA 1VITF 3ZZ9A 3OY6U 1A5HA 5FHTA 3HK6B 3RXHA 1TNJA 2SGAA 3RDZA 3NZIA 2ZDVH 2XNDD 1QZ8A 4Y8YA 1HAVB 1UJ1A 1D3QB 4XBBA 2QF4A 2JDID 1SGDE 5C20A 4WMFA 2GV7A 2R9PA 4NA7A 2W7UA 4X8UH 1CO7E 5FCRA 1HNEE 1S81A 4ABHA 3HGNA 2CK3D 1DPOA 1ID5H 1Y5AT 1F5KU 1QJ6B 2QGRA 4DVAU 1OWHA 1VGCC 1O3MA 5GIBA 3PMJA 1C5LH 2CF9H 1TFXA 3BTHE 1RS0A 1E37B 9LPRA 5LPRA 4GLYA 2ZECA 4O3TA 1GI9B 5CMXH 1Z6EA 4IC6A 2BLWA 1GJDB 5EGMA 3SU0A 1Y5BT 4MQAA 1GL0E 1O30A 2YNAA 3BTGE 2KCYA 5LH8A 1AB9B 3M35A 1GHBG 2RG3A 1MBMA 1UMAH 4AB8A 2BY5X 3T28A 2G5VA 2ZFQH 3I78A 5CHAC 2Y80A 1G3CA 3UFAA 2O8MA 1P57B 4O97A 3M3VA 5DP7A 2F9UA 3VB6A 4UFDH 5KGOA 3QTOH 1P01A 2AH4X 4D7GA 3BTFE 3UIRA 1KTTB 3TH3H 1HAXB 5DG6A 2BB4A 3RXTA 1AVGH 4ABBA 3MH5A 1KLJH 1F5RA 4QT8C 3RMLH 4B2CA 1PPCE 3LJJA 1BT7A 5J4SA 2NU3E 3TU7H 2XCFA 2DE8A 2BY8X 3ZZ7A 1CT0E 1GVZA 1GJ6A 3OAAD 1GBCA 4TY6A 3NPSA 2AYWA 1GBTA 1K1MA 1UTJA 1O2QA 2KFWA 1C9PA 2BTCE 4AN7A 2ASUB 3PLKA 5EJZA 2AGEX 1MCTA 1ZMJA 1XX9A 3M5OA 1EB1H 1UCYE 1LHCH 2J2UA 3EQ0H 1G3BA 1FONA 1VJAU 2ZKSA 1V2VT 1FAKH 1JOUB 3ESTA 1QB9A 1E36B 4ISLA 1H8ED 4Q7YA 3SQHE 2Z9IA 1WQSA 1HAGE 1C1PA 3RXVA 2F43B 2TGTA 2K0QA 4SGAE 3HKIB 3SO3A 3KQEA 1Z8JB 2HVXA 4I8LA 4F49A 4F55A 1YPEH 1E34B 3QDZB 1GDNA 1BTZA 2ZFFH 2J97A 1EFRD 4FU7A 3RXIA 1ZJDA 1PYTC 2BZAA 2XTTB 3OX7U 4BAMB 5AF9H 1J14A 4XFQA 1O36A 3RLWH 1O37A 5FPYA 2RDLA 2FI3E 5GWZA 4GPGA 4X1RU 1UO6A 3UUZA 3Q77A 1TPOA 4WH8A 1LVOA 1BTYA 1Z7KA 1O2XA 2B8OH 2GZ9A 1BRAA 3GISB 4TPIZ 2PLXA 3VB5A 1MKWK 1JIMA 2ODPA 3GCTG 4A5TS 3N7DA 1HGTH 1SLUB 5E8EH 3EA8A 1SLXB 2VVVA 1FUJA 2PSYA 1K1PA 4B2BA 3A80A 5HMAA 1MTNB 1NESE 1F0TA 1OYTH 1ZPZA 4BAHB 2G81E 2VIQA 2PTNA 2QF0A 2W5EA 1H8HD 4GVUA 2C8YB 3SOSA 1MQ5A 3OY5U 3U1JB 2ZQ2A 1VR1H 2V7QD 4Q80A 3MU1A 1BTUA 3Q3YA 1MABB 1NFYA 1UVPA 2OC7A 1ZZZA 2UWPA 3SJ9A 2J38A 1P2NA 1BIOA 2FO9A 2H1UA 2Y82A 2ZDKA 2FX6A 3GYLB 1TLDA 3SI4H 2O8WA 2BD5A 3U8TH 1GJ4H 1QL9A 3MH7A 1ZR0A 5EQSA 1O3OA 1V3XA 2BYAX 4BOHA 1TNKA 2BOKA 3ZYDA 6ESTA 2A5IA 4P00A 1TB6H 1ZOMA 2FOAA 1GHBF 1TX8A 1YF4A 4Y79A 2ZDLA 4NG9H 4IGDA 3E3TA 2EA3A 3BTME 4ZKSU 5A0CA 2VB0A 1GDUA 1P02A 1C5TA 1J17T 1QFKH 1S82A 1KY9A 4KGAA 3UQVA 1BOQA 1OPHB 2B9LA 4AC9A 1QRXA 4RKJB 1ZSLA 2WPHS 1UCYK 4IN2A 4NIYA 4A6LA 2CXVA 2Z3EA 3BF6H 3RXCA 3BTQE 1C5XB 1IHSH 4E7NA 2FOBA 3F9HA 3H7OA 2NU0E 1AMHA 4YM9A 1NBMD 1NBME 1MZDA 2ZU5A 2AERH 3GDUA 1ELVA 2F9OA 2OINA 3RXSA 5DP6A 2VIWA 3C1KA 1LCYA 1O2ZA 3MU8A 1ZGVA 3T62A 3E16B 1SB1H 1NU7B 1O5FH 1YYY1 1Z6JH 3PO1B 1A0JA 4NA8A 4BXSA 1DWCH 1TGBA 1O3GA 3SU3A 1H4WA 5EJLA 1NROH 4BXWA 2K8IA 1OP2A 3N99A 3A7ZA 2VNTA 2ZDMA 2AIQA 2NU4E 3A85A 2A4RA 2GP9B 1H8DH 1IQHA 1Y3XA 2QY0B 3LJOA 1VCPA 1EATA 2P8OC 5EIYA 1L1GA 2FTMA 2WPMS 5A09A 3ZZ3A 1DM4B 5EODA 1SGFA 1GCDA 1TPPA 3Q76A 1D3TB 4ZXYH 3ZVGA 1ZPCA 1C2JA 1EKBB 1ARBA 4X8VH 4ESTE 1FJSA 1LHGH 4CRBA 4R8TB 2BD3A 2HWLB 4I33A 5EOKA 2W26A 3MI4A 2Y5HA 3UOPA 1MD8A 1O2PA 3F2GA 4CRDA 2BQWB 2BM2A 1BBRK 2ZCHP 1Z1IA 5T3HA 3SUGA 4KTCA 1AZZA 1WBGB 1HRTH 1RJXB 2QYIA 3DSGA 4I7YH 1AU8A 2LPRA 4AB9A 2A7JA 1T8OA 4FU9A 1FPCH 3SW2B 1GG6C 4Y10E 2FI5E 2XBVA 1QY6A 1VJ9U 2FDAA 3SZNA 2C8WB 3ZZCA 4AFQA 2ZPQA 5L2ZH 1ESAA 2VGCB 2EY4C 5FX5A 1G30B 4ISNA 1UTMA 2CGAA 1JMOH 1UVOA 4XBCA 1C4U2 2D8WA 2ZPSA 3G01A 4HG6A 5I25A 4GSOA 4D76A 1S85A 2BQ6B 4X1NU 5T6GA 3GCNA 1C1TA 1ESTA 3A8BA 1XVOA 1N6YA 1V2QT 1O34A 1TE0A 1LPZB 2XC0A 4ABIA 1C1RA 2WINI 4BNRA 4CHAB 2GD4B 1O39A 3JZ1B 1ZTKA 2H2ZA 4FETA 1AE5A 1DXWA 1A46H 3R3GB 1KTSB 1IQGA 1IQNA 3HKJB 1C2DA 2WUCA 3E0NB 3IITA 4U01A 2KAIB 1GCTC 3S0NA 4MNXA 3N7EA 3FVFB 1ZHPA 4MPXA 1LVMA 1UVUH 5EG4A 2ZEBA 3PV2A 2ZHEH 4X2VA 3R0FA 1O2MA 1P2OA 2VIPA 4RN6A 5HIZA 1MUEB 3O8BA 1SL3A 4ZUHA 4CRFA 8LPRA 1HFDA 1GBIA 2A5KA 2ZDNA 4ZHAA 1EAIA 2I6SA 3UWJH 3TK5A 2ZHWH 1QR3E 7GCHF 3IG6B 4A1XA 3NUMA 3VGCB 1YPKH 3ELAH 1FY4A 4Q63A 1PQ7A 2VU8E 1G2LA 1RIWC 1YBWA 1ZHRA 1ELAA 4X6OA 1GBAA 3KF2A 1OYQA 1HJAB 4VGCC 2H9EH 4WF8A 3GS9A 3UR6A 1MH0A 4Y0YE 1CA0C 4K2YA 4ZAEA 1FLEE 5IYTA 2ZTXA 4IBLH 1WDIA 2AGGX 4AYVB 3UNRA 1LKAA 3O8CA 2P3TB 3A7TA 3SNAA 3U9AH 4FUHA 1BJUA 5EU8A 3NK8A 3A83A 1GJBB 2ULLA 5DKMA 1BCUH 3ENSB 4BTTB 5J4QA 1O0DH 1BRBE 2FESH 2YMSD 1MTSA 3PM3A 4CR9A 5FAHA 4INKA 8GCHG 2ZTYA 4ZHMU 5EJ1A 1GHZA 3TJVA 1P2KA 5HGGA 3SNEA 4E7RG 1P06A 3SU1A 1B5GH 4JZEH 5DJ7A 3SV7A 3KN2A 1C1VH 1O5GH 3P95A 2YMSB 1TGTA 5TJXA 2OBQA 1SGYE 7LPRA 4D9RA 1PPFE 5DO4H 1H9HE 2BDCA 1WSSH 4JK5A 2ZU2A 1K1LA 3M5MA 1MAXA 3PV5A 2CHAB 3I29A 1TAWA 1YPHC 3A81A 4H4FA 9ESTA 1PPEE 1TOMH 1W0KD 2FP7B 3LGYA 1MQ6A 4WXVA 3URCA 6CHAC 4JCNA 4FVDA 3EGKH 1TBQH 2A4OA 4H42U 1RRKA 3MMGA 3E0PB 3FKSD 3STJA 4UFFH 1NFWA 1Y3UA 2P16A 1SVPA 3FANA 1S6FA 2ZDAH 2UUYA 3FP8E 5T6FA 8ESTE 1J16A 3KIDU 1L4DA 1AY6H 3PB1E 2D26C 3QTVH 5DSFA 4AG2A 3M7QA 3ZZ6A 1MTWA 1AGJA 1OSSA 2CV3A 2FZZA 3RM0H 4DT7B 4FUFA 5DPAA 3RXGA 3TVJB 4GHTA 1Z8RA 3W1EA 2GCTC 5C1YA 1TALA 4MG3A 3UREA 1S6LA 2TGAA 3RUOA 1RGQA 1GI7B 3STIA 2PKSB 5KECA 1YPHE 4B71A 3B9FH 3D23A 2H5DA 2KCOA 5F6MA 1F0RA 3DFLA 3EAJA 1V6DA 2GZ8A 2FS9A 1G3EA 4GAWA 3ATLA 5FPSA 3BV9B 2CN0H 1E79D 3CENA 1NZQH 1ZRKA 2R2MB 3A7YA 1KIGH 2BVSH 5K0HA 1YPJH 2SNVA 3T27A 2QCYA 2A31A 2QF3A 1S6HA 4AG1A 4B1TA 4CR5A 1T4UH 2F9VA 2PGQB 3M61U 1Y3VA 2Z3DA 1HB0B 4AGJA 4NCYA 3TH2H 4XOJA 4UD9H 1O38A 3UTUH 1N8OB 3S9CA 3D65E 2Y7ZA 4Y8XA 4GCHG 4YOJA 1YP9A 3QK1A 2PHBA 4OS2A 2YNBA 1Z1JA 1K9OE 2J5UA 1SR5C 2XBWA 1AE8H 1D6RA 1TA6A 1Y8TA 3B23B 3GOVB 5EXMA 1ZYOA 3A7XA 3LGWA 3MTYA 2OK5A 3ZVBA 3BG8A 3K9XB 1SGCA 4B76A 1O2JA 4BANB 1C5OH 3LH1A 1NY22 3IWMA 1C1UH 1WUNH 1FX0B 5A8XA 1J9CH 4HGCA 2P59A 1BITA 1IQFA 3TPIZ 3SV6A 3O8DA 2HNTF 3KHVA 2ZHQH 1G32B 5SGAE 1C2IA 1QHRB 2RA0A 2B0FA 4LOYH 1HJ9A 3ZIAD 4X1QU 3BSQA 1YPMH 2A7CA 3V7TA 1GBKA 2BY7X 4CRCA 2J4IA 8GCHF 1L2EA 4DJZB 5EXLA 2QXIA 1NPMA 2VWLA 4OGXA 3LC3A 4NFEA 3SU6A 3A87A 3TIUA 1AZ8A 1W0ZU 1ELEE 1DX5M 2J94A 1TOCB 2ZU1A 1GBLA 1SG8B 1XUGA 1SOZA 3SU2A 2ZI2H 1T8LA 1ANEA 3OFND 4DW2U 2ZIQH 1K1JA 1IQMA 1YLCA 1BMAA 1V2UT 4KTSA 4DIIH 5JBBS 3JZ2B 5HM2A 5FBEA 4AFZA 1OWDA 1E38B 2NU2E 1ELFA 1SFIA 1C5MD 1THSH 1TRNA 3S69A 1OWKA 3BTTE 1UCYH 3PLBA 3LGUA 1ABJH 3RXDA 1IHTH 1SGFG 2GZ7A 4MPUA 3RXEA 4H6TA 1L1JA 2FOGA 2V3MA 5DP9A 3T2NA 2Y6TA 2HGTH 4XE4A 2NU1E 1Y3YA 1FV9A 4ABFA 2BD7A 3BTEE 1NS3A 4UDWH 1LHFH 5HXFA 5L6NH 2F9PA 1HXEH 1A61H 2ZPRA 4O9VA 2L74A 1T8MA 1V2KT 2OBOA 1ABIH 1O2YA 4CRAA 4MDSA 3T29A 3F2HA 1ELGA 3T5FH 1DOJA 3RLYH 1BTPA 2ZCKP 3Q00A 2FPZA 2VIVA 3ZZAA 2ZFTA 1KXFA 2GX4A 1C5NH 3SJ8A 4A7IB 1BUIA 1BB0B 2WZQA 1QB1A 3DUXH 1TMBH 4I32A 2ZGJA 1VGCB 2TPIZ 4JK6A 2PWXA 2ZF0H 1JIRA 4Q7ZA 2M2AA 3RXBA 1WYKA 4SGBE 2KAIA 3FP6E 2HRVA 2Z6BD 1BDAA 3A8AA 1Y3WA 2I6QA 3D62A 3MWIU 3PROA 4BAQB 1GL1A 3ATIA 4UEHH 4I31A 4GUXA 1QBNA 1NT1A 4IMQA 1U6QA 2H6MA 1O31A 1FXYA 1DXPA 4Y76A 5DP4A 4ZXXH 2DE9A 5CHAB 5C17A 1ZGIA 3UNQA 3RXKA 2Q6GA 1EOLA 1O5AB 3A88A 4NSYA 4GCHF 4IW4E 3KYFA 2P3FH 1Z8GA 2AMQA 5BRRE 1EZSC 3PTBA 1WAYB 4YLQH 2HLDD 1QA0A 4XD7D 2BQ7B 3F9GA 1BMLA 1C2HA 1G36A 1IOEA 5LGOA 4A1VA 1GGDC 2CF8H 3M5NA 1P12E 1KXBA 3GYMA 3SUEA 2R3YA 2QAAA 1E0FD 2XCNA 1HAZB 3PTNA 1V2JT 1TX6A 1SQOA 2AGIX 1H9IE 1DLEA 2OC0A 3RXUA 2FOFA 2EQNA 2ZG0H 3GY2A 5E0HA 4X8TH 4Y6DA 2ALVA 1FY5A 1MKXK 2R2WU 3O8RA 4P02A 4DY7B 2ZQ1A 1NFUA 3RMOH 2VBCA 2VJ1A 4H6SB 2LELA 4UFGH 1G37A 1P2MA 1BBRE 3AVZA 3C27B 1PYTD 1L4ZA 2IPHA 1C1WH 4TYDA 1MD7A 1TYNA 5C0UA 4FU8A 1OP0A 2A45B 1K1OA 1TA2A 2K1QA 4CREA 1CBWC 1VCQA 4ZHLU 4B6EA 1YLDA 5DN6D 2VH6A 1HAHH 1LHEH 1ANCA 1QURH 5JPMH 5A2MH 3A8DA 5GDSH 1W2KH 1MMJN 3BEIB 5HM9A 5HYOA 3ZZ8A 1ETRH 4NSVA 1EQ9A 1QL7A 3A82A 1AQ7A 1TBRH 4X6PA 4XRNA 3RXMA 3PMBB 3LC5A 2O8TA 2QIQA 3LPRA 4JYTA 3GCHC 2A2QH 1UHBA 1TNHA 4LZ4B 1O3DA 2G00A 2BXTH 1UVSH 2UWOA 5GCHG 1DT2A 1XVMA 2WPIS 1EAUA 4X2WA 1BQYA 3P8NA 4K60A 1F0SA 1C9TA 1EP6A 2Z9LA 2EI8A 4BTIB 1TGNA 5E2PA 2BDYA 1O2HA 2IPQX 5B6LA 3AK5A 4RKOB 1O3BA 3A7VA 3S7HB 3EDXB 1SQRA 2CJIA 1W3CA 1TBZH 2OCVB 1MCVA 2BZ6H 1HUTH 1T4VH 1SOTA 1RD3B 5FXLA 3DHKH 3U8OH 2QXJA 1D4PB 2XYAA 5AVDA 3RMMH 7GCHG 1C5RA 2AMPA 1XUFA 1GI5A 4ZMAH 3LDXH 1AVWA 1MBQA 1QNJA 5EPYA 2ANYA 3VEQB 1GHVH 2XBYA 1K2I1 4AORA 1WV7H 1OP8A 1P03A 1SHYA 2GT7A 4X2YA 1GBMA 1EPTC 3TGKE 2GGVB 4HTCH 5C0TA 1P2JA 1DS2E 1CVWH 5A8ZA 1CGHA 4K1SA 1BHXB 1D3DB 4IMZA 1W7XH 4TSFD 1C5WB 5L2YH 2HOBA 1GHXH 2BMGB 3FZDA 2L6OA 2AHME 1OOKB 1K21H 5ESBA 1JWTA 3UPEA 3P70B 1PFXC 1DY9A 2JKHA 1F0UA 2FM2A 4CH8B 1OWJA 1C4Y2 3BTKE 3CS0A 8KME2 1MZAA 1RTFB 1W0YH 3TJUA 4NIXA 1F5LA 1NRNH 1A1RA 5JB8S 2V35A 1S5SA 1YPGH 3MNXA 1OWIA 2G4UA 2ZCLP 2VINA 1O33A 1C5ZB 1MTVA 1VZQH 4WH6A 1D6WA 4PROA 3PMAB 2B5TB 4XSKU 4AGKA 4A92A 2ZZUH 1TRMA 1UK2A 1AFQC 2AEIH 2WV4A 3A86A 3TK9A 2ZGCA 3QGJA 4FXGH 3ZV8A 4ZKOU 1UK3A 2VWOA 1O3FA 1UTPA 1B0FA 2R0LA 1QIXB 5C3NA 5CE1A 1GHWH 2FLRH 4JZFH 2P8OB 3N7OA 4Y7AA 1AKSB 3RMNH 1O2WA 4YZUA 2RDEA 1ZTJA 1OX1A 3A8CA 6LPRA 2GVFA 2KM0A 2YOLA 1EZUC 4M7GA 3FZZA 4X2XA 5JBCS 4ZROA 3F68H 4OM9A 1EZXC 3SJKA 4NFFA 2A1DB 1IQKA 2FEQH 1ETTH 3P8OA 2B7DH 2OQ5A 2FLBH 3DSOA 2AFQB 2F4LA 1XM1A 3MU0A 2Y81A 3VFEA 2EC9H 1T31A 2O8LA 1W0JD 3MO3A 4A1TA 5GCHF 4TWYA 2C93B 3UR9A 2ZP0H 1FIZA 2SGDE 1HAPH 1MAYA 2C90B 4OS4A 1GG6B 1QCPA 5FX6A 2GJGA 2XWBI 2V3HH 3LONA 2IN2A 4ZCNA 1GJ5H 1GHAF 3BG4C 1P05A 1QB6A 1SBWA 1TMUH 1HXFH 1XXDA 2XRCA 1YCPH 2TGDA 4NZQA 3W94A 2IOTA 1NFXA 1SSXA 1CGIE 3AW0A 3RU4T 2D1JA 2KCAA 3RXFA 1SGPE 2Z9KA 1GBJA 1WOFA 3KGPA 4CH2B 5TCCA 5FL7D 2ZA5A 1C2EA 2RA3A 2BLOA 1W8BH 3OU0A 3PV4A 2FWWA 2GT8A 3F9FA 1NTPA 4M9FA 1ESBA 2OLGA 4KP0A 4YT6H 4X8SH 2TGPZ 1DFPA 2GTBA 4WJG2 2BDIA 1KLIH 3PLPA 5EW1H 2P3UB 3SHAH 3KQCA 3VB4A 3MO6A 5F8XA 1Y5UT 4K8BA 1THRH 4ASUD 1EAWA 2Z9GA 3OSYA 5IK2D 2WSSD 4I8KA 1CHOF 3KQBA 2QC2A 4IC5A 2F9BH 1O2IA 2Y5FA 2XC5A 1GI3A 1GCTB 4HZHA 1KSNA 2BXUH 5ESTE 3S9BA 4DIHH 3VG8A 4OS7A 3SI3H 2BX3A 2QV1A 3TGJE 1QL8A 2A4QA 3TLOA 1ZTLA 1CT4E 3KCGH 3OYPA 4HI3A 2J95A 4YESB 2OP9A 5E0JA 4B2AA 1ELCA 2OXSA 5F8TA 1HJ8A 4R0IA 1A5IA 1RIWB 2A2XH 3U8RH 1QQUA 2HALA 4VGCB 3VXFH 2JETC 2PSXA 5C67A 1Q2WA 2PTCE 1CA0B 3KL6A 4ISIH 1DY8A 4FVBA 4MNWA 3WWFA 3ODDA 4RI0A 1P11E 1V2TT 3V12A 1BMNH 3MO9A 4HFPB 4WVPE 1AI8H 5L30H 2NWNA 1GBDA 1UHBB 2J92A 4AFSA 3V13A 4ACAA 1GJ7B 1GWAA 3DCLA 1H9LB 3NCLA 4O03A 1YC0A 1P8VC 1PPGE 5F8ZA 4E06H 3AAUA 3A7WA 2GMTC 2JH0D 4YXWD 2SGFE 2ZFSA 1P9SA 1COWD 1ZHMA 2VWMA 3DFJA 1HV7A 1TNIA 5JBTA 1NC6A 4NIWA 5E2OA 1O3JA 2F9NA 2WPJS 3ZVEA 2OC8A 3P6ZB 1IQLA 1MU8B 1HAOH 4Y0ZE 1QJ1B 5IDKA 4FUIA 1YY3A 1PPBH 3RXAA 1TX7A 1DUAA 3BN9A 2A5AA 3PWBA 4FUBA 2C3SA 1VKYA 2XBXA 1EUFA 2A32A 5EW2H 1HCGA 1Z71A 5FPTA 2TIOA 1K22H 1NN6A 4GHQA 2ZFRH 3E91A 1O3KA 1ELTA 1ARCA 2ZGBH 2VIOA 2BLQA 3D49H 2ZFPH 1ORFA 1YM0A 1XUJA 3BIVH 1P0SH 6CHAB 1W14U 1YWUA 1QRWA 1V2WT 3PRBA 1C1QA 3SORA 2UUFB 1ELBA 1C1SA 5A8YA 2P95A 1OXGA 1CGJE 2QN5T 3TGIE 1MKWH 3DD2H 1EZQA 1LVBA 2AMDA 1FZZA 3RC6A 1UTLM 1QJ7B 3I77A 1CU1A 1P2IA 2Y7XA 4FUDA 1O2SA 2FYRA 4B74A 1B0EA 1W7GH 2GCTB 1O5EH 1GJAB 3OEED 4E05H 1O2UA 2C4FH 1S83A 1SQTA 3NWUA 4DCDA 2IJD1 2Y5GA 3CS7A 1C5QA 2C8XB 3SJOA 1SGRE 1Q31A 2H9TH 3MHWU 4Q4LA 3RP2A 3QLPH 1B7XB 1LO6A 2XXLA 2R3UA 2SGPE 1DLKB 2HVYB 1LKBA 4NZLA 1C1MA 4JZIA 4CRGA 2BY9X 1O3NA 1V2MT 1FI8A 1SGIB 3RC5A 2HPQH 1NM6A 1ETSH 1EASA 2W6JD 1AIXH 3AASA 1IQJA 4K5ZA 4F48B 1EX3A 1IQIA 1A7SA 1WTHD 2ZHFH 1IQEA 1O3EA 4LXBH 5A0BA 1EAXA 1MU6B 3L3TA 1AB9C 1FY8E 3RXRA 3HATH 1RFNA 1BMMH 5EQRA 1NRSH 1BJVA 3BTDE 2IJOB 1DSTA 3KYGA 3GDVA 3V0XA 1ZRBA 1AO5A 3SYJA 1O35A 3RU4D 3RU4E 4B73A 3RXOA 2VH0A 1LVYA 1SFQB 2STAE 1C2FA 3M3SA 3PWCA 3F0OA 2A7HA 1AHTH 1C2MA 1UTKA 2CMYA 3ZVDA 1FNIA 1T32A 1CE5A 1EPTA 2LP6A 1GI4A 3Q3XA 5I46H 3GY5A 3W95A 2DUCA 1EJMA 1W12U 1G2MA 1TIOA 1K0HA 1QRZA 1SI5H 1Y59T 5JDUB 3RXQA 2BVRH 1AKSA 1FQ3A 2FIRH 2J34A 1FMGA 2WPLS 3QZQA 3FP7E 1FN6A 1EXFA 1L0ZA 5DP8A 3M7UA 2VIDA 1HAIH 2Q6DA 4ASHA 1DANH 1V2OT 3KQDA 4U30A 3TH4H 2FOEA 2V6NA 3SZEA 1J15A 4O3UA 1ELDE 2HLCA 1S0QA 3CP7A 4X6MA 4MTBA 3OTPA 1JRSA 3K2UA 1D9IA 1EB2A 1GMDG 2XOKD 3F9EA 2OC1A 3HK3B 3P8GA 1AUTC 4RSPA 3SN8A 2AS9A 2BVXH 5C1UA 3TITA 4K3JA 3MNCA 1SGNE 4NGAH 1CT2E 2FMJA 1TONA 1F7ZA 3NKKA 1KDQA 5JB9S 3ZV9A 1O3HA 4OGYA 2G52A 3UQOA 2SGEE 4JZ1A 5DP5A 2VVCA 3ITIA 4CBNA 2XC4A 1V2RT 3B8JA 4UE7H 1GI1A 1UTNA 2ZU4A 1AN1E 3LU9B 4X0WU 4YTAA 5PTPA 1P10A 4CBOA 2PGBB 3F6UH 4WMDA 1BBRH 3ZZ4A 3RC4A 1S84A 4B6FA 3UNSA 1X7AC 1DWEH 1OKXA 5BPEA 3QZRA 1PQ5A 3LOXA 4TY7A 1DE7H 1MTNC 4FUEA 1JXPA 4Z1MD 3M36A 2ILNA 3M3TA 1GDQA 2KZ4A 4I8JA 4Z0KA 3OEHD 2AIPA 1C5SA 1O32A
chains in the Genus database with same CATH topology
4X1SU 1K1NA 1C1OA 1O5BB 1UTQA 3SU5A 1GVKB 1TMTH 1SMFE 3VB7A 1AD8H 4MNYA 3LGVA 1ZSKA 2BD8A 4NWKA 3K6YA 2F83A 5E0GA 4WXIA 1ZLRA 1HAYB 2GDEH 1GMHG 1GI8B 1DICA 1DUEA 1KYNA 3SJIA 1ANBA 3A89A 2SGQE 1WCZA 4Y71A 1GI2A 1P2QA 3SV8A 1RTKA 2BLVA 1JBUH 3SNBA 3SU4A 3ZVFA 3BTWE 4FUGA 5C1XA 4D8NA 1H8IH 2GV6A 5GJ4B 2FODA 1SLWB 4JYUH 1F2SE 4Q2KA 5FCKA 1V2LT 3QN7A 3QX5H 2W3IA 3ZVCA 5ETXA 1YGCH 2SFAA 2RCEA 1Q3XA 3AAVA 1GHYH 1P04A 3SUFA 2PW8H 3TK6A 1GGDB 4IS5A 3V3MA 2TBSA 3LKWA 1QBOA 4THNH 3QWCH 4WWYA 3H5CB 3SQEE 3L33A 3QO6A 1THPB 3P17H 4AZ2B 2VVUA 1TWXB 4K1EA 1GHAG 1QBVH 2LNCA 3PO1C 3U69H 3SNCA 1SHHB 2ZTZA 1ZMLA 2SNWA 3A84A 3KNXA 1SLVB 3UOUA 2BDHA 4AX9H 1SGEE 5EPNA 5AFZH 4UONA 1O2NA 3GICB 1GMDF 1CBWB 2QXHA 2ANMH 5DK1A 1P9UA 1YPLH 2WV5A 2O9QA 1A3EH 2ALPA 4INHA 1GMCG 3ZZBA 4I8HA 4B75A 1HIAA 1OS8A 1L1NA 1F92A 5A0AE 2PKAB 1TPSA 3DA9B 1CQQA 1VCWA 3WY8A 4WMEA 4ZKNU 1A3BH 4ABEA 4BAOB 4ABAA 2GKVE 3E6PH 1O2OA 1FIWA 1SGQE 3GCHB 3T26A 4K69A 5AFYH 2FXRA 2ANWA 3KEEA 3MNBA 1GVLA 2BD9A 2BD4A 1XUKA 1C5UA 3E90B 1J8AA 1A0LA 1CHOG 1O3IA 2Z7FE 1XUIA 1O2KA 4DOQA 1A2CH 1EOJA 1TGSZ 2EI6A 2G5NA 1TABE 1O5CB 1G9IE 2JH5D 1O2VA 2OD3B 3K65B 4J1YA 4X1PU 1C2LA 3ODFA 2VGCC 1LPGB 2FS8A 4F4OC 4Z6AH 4ISOA 1V2PT 4JMYA 3TJNA 4MPVA 3RXPA 3SUDA 2V3OH 2ZWLH 2OTVA 1VITH 5AHGH 3ZVAA 2XW9A 4WY3A 1RXPA 2BDGA 1NRQH 2HNTC 5EQQA 5DGJA 2ODQA 1O2RA 5C5NA 1EJAA 3GY7A 1W10U 1XKBC 3BIUH 1LDTT 3MYWA 1C5VA 3MNSA 1LQEA 1TPAE 4AFUA 2FOCA 2R0KA 3EA9A 3RXLA 1KXCA 1GMHF 1V2ST 2FYQA 3UWIA 1EPTB 6GCHG 2QA9E 3NXPA 2GDDA 2BD2A 4U2WA 2ANKH 1GI0A 4K8YA 1AUJA 2UUJB 1UVTH 4CHAC 4ISHH 1YKTA 2H9HA 3GCTF 2GCHG 3M37A 1TQ7B 4J2YB 1GJCB 2W7SA 3ZZ5A 4NA9H 1ANDA 3U1IB 3SV2H 1C5PA 1P3CA 1HAVA 1ZPBA 3P92A 1HDTH 1A4WH 2HPPH 3Q3KA 2PFEA 2A0QB 2ZC9H 1NU9A 2OUAA 2HNTE 1KXEA 4DGJA 2ZGXH 1HYLA 3SGBE 3SHCH 1DWDH 3HGPA 3FFGA 1W13U 2ZGHA 1O3PB 2J9NA 2D2DA 1BTHH 1DSUA 1G3DA 3MU5A 3VGCC 2P93A 3SNDA 3M5LA 4OS5A 1DITH 3GY4A 4YO9A 1NRRH 1T8NA 1HLTH 1KDQB 1GJ9B 5JYIA 1AFQB 1HJAC 1P3EA 3QGNB 2Z3CA 2Z94A 4ZH8A 4KKDA 3VB3A 1WTGH 1CHGA 1A5GH 3MH6A 1CSOE 1WU1A 1O3LA 3MOCA 5ABWA 5GXPA 1GJ8B 1BA8B 4OS6A 1XUHA 2OQUA 1GI6A 1IAUA 2STBE 1LMWB 3ATWA 3SGQE 2H5CA 1C2KA 1LQDB 3GY6A 2WYGA 4YOIA 3EYDA 7ESTE 1LTOA 2BDAA 4BTUB 4DG4A 1XXFA 5LPFA 1GMCF 3QUMP 1BTWA 2BX4A 1TRYA 2TRMA 4FUJA 2F91A 1ZSJA 2O8UA 4ABGA 3U98H 3DT0H 1DVAH 1A0HB 1FY3A 2G8TA 1Z8IB 1PJPA 2WPKS 1C1NA 4Y11E 4ABDA 3F1SB 1HPGA 1N6XA 3SBKA 4JZDH 4NIVA 1K28D 4YLUA 4YT7H 4X6NA 1TNGA 5H4IB 1RTLA 1KXAA 1O2LA 3BG4B 2CHAC 1BZXE 5C5OA 2FI4E 2ZHDA 1S0RA 1AWHB 4KELA 2BDBA 3FAOA 1AVXA 2F3CE 1EP5A 2A4GA 1C2GA 3SV9A 4JYVH 3SGAE 2THFB 3LT3A 4ABJA 4AOQA 1VITG 4KTUA 3EE0B 3BEUA 1CA8B 2VWNA 4LZ1H 2BHGA 5TCAA 2UWLA 4D9QA 1AFEH 1DDJA 4FUCA 1SGTA 1D3PB 1NRPH 1T7CA 3LIWA 5LPEA 1K1IA 3RM2H 3ZZDA 5JBAS 3HPTB 4XDEA 2G4TA 1LHDH 3MU4A 1P09A 3ATMA 6GCHF 1MTUA 3OTJE 2PKSC 3MH4A 4BAKB 2EEKA 2C8ZB 5B6OA 5T6DA 1OWEA 2Z9JA 3UY9A 1ZJKA 1O3AA 4MLFB 1C5YB 2GCHF 3TJOA 3BEFB 1PPHE 1ACBE 2P94A 3E1XB 1SQAA 1AWFH 2BOHB 1N1LA 1ZMNA 3PYHA 3E8LA 3M7TA 4D7FA 1LPKB 1XKAC 1BTXA 1PPZA 2UUKB 4Q7XA 2FOHA 2WYJA 3T25A 1SPJA 1O2GH 1GBHA 5G4BA 1BHXF 3VPKA 1V2NT 2FTLE 3LGIA 5FBIA 1W11U 1UTOA 1QGFA 2WUBA 3GDSA 4I8GA 2ODYB 1N8OC 2Q6FA 3K6ZA 1FPHH 2Q1JA 1HIAB 1UK4A 2JETB 2PUQH 5DP3A 4TPYA 4YOGA 4OS1A 2G51A 1BRUP 2G55A 3EA7A 1TGCA 1QA7A 1C4V2 1DWBH 1INCA 2FOMB 3VXEH 1M9UA 4NWLA 1O2TA 1GBFA 3GY8A 1NO9H 1WQVH 1PQ8A 1XMNB 2XNIA 5EXNA 2PV9B 4DURA 1QTFA 2W3KA 4MNVA 4UFEH 4XBDA 2GMTB 1E35B 2JH6D 1FDPA 5C2ZA 4U32A 2PR3A 3GY3A 2XWAA 2PKAA 1EJNA 1MKXH 4K1TA 2ZNKH 3S7KB 1GPZA 1H1BA 4MPWA 3ZYEA 3S9AA 4ZKRU 4LK4A 3URDA 3H7TA 5F03A 2ESTE 2QXGA 1PQAA 4INLA 5GPIB 1SC8U 2BY6X 3LGTA 3L6PA 1FAXA 1YCPM 3ATKA 4Y8ZA 3TNSA 5K7RA 1QQ4A 1O3CA 2V0BA 2EI7A 1KXDA 1TQ0B 2ZO3H 1TNLA 1FY1A 1YCPK 2FX4A 3AW1A 1GBBA 3PMHB 2PUXB 3P8FA 3GCOA 4MVNA 4Y7BA 3MFJA 1KLTA 3RXJA 1FN8A 2M5TA 1BRCE 1O5DH 1GBEA 4IN1A 3TNTA 1HBTH 2ZU3A 4AYYB 7KMEH 3LH3A 4TWWA 1JRTA 1VITF 3ZZ9A 3OY6U 1A5HA 5FHTA 3HK6B 3RXHA 1TNJA 2SGAA 3RDZA 3NZIA 2ZDVH 4Y8YA 1HAVB 1UJ1A 1D3QB 4XBBA 1SGDE 5C20A 4WMFA 2GV7A 2R9PA 4NA7A 2W7UA 4X8UH 1CO7E 5FCRA 1HNEE 1S81A 4ABHA 3HGNA 1DPOA 1ID5H 1Y5AT 1F5KU 1QJ6B 2QGRA 4DVAU 1OWHA 1VGCC 1O3MA 5GIBA 3PMJA 1C5LH 2CF9H 1TFXA 3BTHE 1RS0A 1E37B 9LPRA 5LPRA 4GLYA 2ZECA 4O3TA 1GI9B 5CMXH 1Z6EA 4IC6A 2BLWA 1GJDB 5EGMA 3SU0A 1Y5BT 4MQAA 1GL0E 1O30A 2YNAA 3BTGE 5LH8A 1AB9B 3M35A 1GHBG 2RG3A 1MBMA 1UMAH 4AB8A 2BY5X 3T28A 2G5VA 2ZFQH 3I78A 5CHAC 2Y80A 1G3CA 3UFAA 2O8MA 1P57B 4O97A 3M3VA 5DP7A 2F9UA 3VB6A 4UFDH 3QTOH 1P01A 2AH4X 4D7GA 3BTFE 3UIRA 1KTTB 3TH3H 1HAXB 5DG6A 2BB4A 3RXTA 1AVGH 4ABBA 3MH5A 1KLJH 1F5RA 4QT8C 3RMLH 4B2CA 1PPCE 3LJJA 1BT7A 5J4SA 2NU3E 3TU7H 2XCFA 2DE8A 2BY8X 3ZZ7A 1CT0E 1GVZA 1GJ6A 1GBCA 4TY6A 3NPSA 2AYWA 1GBTA 1K1MA 1UTJA 1O2QA 1C9PA 2BTCE 4AN7A 2ASUB 3PLKA 2AGEX 1MCTA 1ZMJA 1XX9A 3M5OA 1EB1H 1UCYE 1LHCH 2J2UA 3EQ0H 1G3BA 1FONA 1VJAU 2ZKSA 1V2VT 1FAKH 1JOUB 3ESTA 1QB9A 1E36B 4ISLA 4Q7YA 3SQHE 2Z9IA 1WQSA 1HAGE 1C1PA 3RXVA 2TGTA 4SGAE 3HKIB 3SO3A 3KQEA 1Z8JB 2HVXA 4I8LA 4F49A 1YPEH 1E34B 3QDZB 1GDNA 1BTZA 2ZFFH 4FU7A 3RXIA 1ZJDA 1PYTC 2BZAA 2XTTB 3OX7U 4BAMB 5AF9H 1J14A 4XFQA 1O36A 3RLWH 1O37A 5FPYA 2RDLA 2FI3E 5GWZA 4GPGA 4X1RU 1UO6A 3UUZA 3Q77A 1TPOA 4WH8A 1LVOA 1BTYA 1Z7KA 1O2XA 2B8OH 2GZ9A 1BRAA 3GISB 4TPIZ 2PLXA 3VB5A 1MKWK 1JIMA 2ODPA 3GCTG 4A5TS 1HGTH 1SLUB 5E8EH 3EA8A 1SLXB 2VVVA 1FUJA 2PSYA 1K1PA 4B2BA 3A80A 5HMAA 1MTNB 1NESE 1F0TA 1OYTH 1ZPZA 4BAHB 2G81E 2VIQA 2PTNA 2QF0A 2W5EA 4GVUA 2C8YB 3SOSA 1MQ5A 3OY5U 3U1JB 2ZQ2A 1VR1H 4Q80A 3MU1A 1BTUA 3Q3YA 1NFYA 1UVPA 2OC7A 1ZZZA 2UWPA 3SJ9A 2J38A 1P2NA 1BIOA 2FO9A 2H1UA 2Y82A 2ZDKA 2FX6A 3GYLB 1TLDA 3SI4H 2O8WA 2BD5A 3U8TH 1GJ4H 1QL9A 3MH7A 1ZR0A 5EQSA 1O3OA 1V3XA 2BYAX 4BOHA 1TNKA 2BOKA 3ZYDA 6ESTA 2A5IA 1TB6H 1ZOMA 2FOAA 1GHBF 1TX8A 1YF4A 4Y79A 2ZDLA 4NG9H 4IGDA 3E3TA 2EA3A 3BTME 4ZKSU 5A0CA 2VB0A 1GDUA 1P02A 1C5TA 1J17T 1QFKH 1S82A 1KY9A 4KGAA 3UQVA 1BOQA 1OPHB 2B9LA 1QRXA 4RKJB 1ZSLA 2WPHS 1UCYK 4IN2A 4NIYA 4A6LA 2CXVA 2Z3EA 3BF6H 3RXCA 3BTQE 1C5XB 1IHSH 4E7NA 2FOBA 3F9HA 3H7OA 2NU0E 1AMHA 4YM9A 1MZDA 2ZU5A 2AERH 3GDUA 1ELVA 2F9OA 2OINA 3RXSA 5DP6A 2VIWA 3C1KA 1LCYA 1O2ZA 3MU8A 1ZGVA 3T62A 3E16B 1SB1H 1NU7B 1O5FH 1YYY1 1Z6JH 3PO1B 1A0JA 4NA8A 4BXSA 1DWCH 1TGBA 1O3GA 3SU3A 1H4WA 1NROH 4BXWA 1OP2A 3A7ZA 2VNTA 2ZDMA 2AIQA 2NU4E 3A85A 2A4RA 2GP9B 1H8DH 1IQHA 1Y3XA 2QY0B 3LJOA 1VCPA 1EATA 2P8OC 1L1GA 2FTMA 2WPMS 5A09A 3ZZ3A 1DM4B 5EODA 1SGFA 1GCDA 1TPPA 3Q76A 1D3TB 4ZXYH 3ZVGA 1ZPCA 1C2JA 1EKBB 1ARBA 4X8VH 4ESTE 1FJSA 1LHGH 4CRBA 4R8TB 2BD3A 2HWLB 4I33A 5EOKA 2W26A 3MI4A 2Y5HA 3UOPA 1MD8A 1O2PA 4CRDA 2BQWB 2BM2A 1BBRK 2ZCHP 1Z1IA 5T3HA 3SUGA 4KTCA 1AZZA 1WBGB 1HRTH 1RJXB 2QYIA 4I7YH 1AU8A 2LPRA 4AB9A 2A7JA 1T8OA 4FU9A 1FPCH 3SW2B 1GG6C 4Y10E 2FI5E 2XBVA 1QY6A 1VJ9U 2FDAA 3SZNA 2C8WB 3ZZCA 4AFQA 2ZPQA 5L2ZH 1ESAA 2VGCB 5FX5A 1G30B 4ISNA 1UTMA 2CGAA 1JMOH 1UVOA 4XBCA 1C4U2 2D8WA 2ZPSA 3G01A 5I25A 4GSOA 4D76A 1S85A 2BQ6B 4X1NU 5T6GA 3GCNA 1C1TA 1ESTA 3A8BA 1XVOA 1N6YA 1V2QT 1O34A 1TE0A 1LPZB 2XC0A 4ABIA 1C1RA 2WINI 4BNRA 4CHAB 2GD4B 1O39A 3JZ1B 1ZTKA 2H2ZA 1AE5A 1DXWA 1A46H 3R3GB 1KTSB 1IQGA 1IQNA 3HKJB 1C2DA 2WUCA 3E0NB 3IITA 4U01A 2KAIB 1GCTC 3S0NA 4MNXA 3FVFB 1ZHPA 4MPXA 1LVMA 1UVUH 5EG4A 2ZEBA 2ZHEH 4X2VA 3R0FA 1O2MA 1P2OA 2VIPA 4RN6A 1MUEB 3O8BA 1SL3A 4ZUHA 4CRFA 8LPRA 1HFDA 1GBIA 2A5KA 2ZDNA 4ZHAA 1EAIA 2I6SA 3UWJH 3TK5A 2ZHWH 1QR3E 7GCHF 3IG6B 4A1XA 3NUMA 3VGCB 1YPKH 3ELAH 1FY4A 1PQ7A 2VU8E 1G2LA 1RIWC 1YBWA 1ZHRA 1ELAA 4X6OA 1GBAA 3KF2A 1OYQA 1HJAB 4VGCC 2H9EH 4WF8A 3UR6A 1MH0A 4Y0YE 1CA0C 4K2YA 4ZAEA 1FLEE 5IYTA 2ZTXA 4IBLH 2AGGX 4AYVB 3UNRA 1LKAA 3O8CA 2P3TB 3A7TA 3SNAA 3U9AH 4FUHA 1BJUA 5EU8A 3NK8A 3A83A 1GJBB 2ULLA 5DKMA 1BCUH 3ENSB 4BTTB 5J4QA 1O0DH 1BRBE 2FESH 3PM3A 1MTSA 4CR9A 5FAHA 8GCHG 4INKA 2ZTYA 4ZHMU 1GHZA 3TJVA 1P2KA 5HGGA 3SNEA 4E7RG