1K1LA

Bovine trypsin-inhibitor complex
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
223
structure length
223
Chain Sequence
IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Factorising ligand affinity: a combined thermodynamic and crystallographic study of trypsin and thrombin inhibition.
pubmed doi rcsb
molecule tags Hydrolase
molecule keywords TRYPSIN
total genus 53
structure length 223
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 2001-09-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1k1lA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1k1lA02
3SGQE 1P2MA 1WTGH 5A2MH 3SV8A 4YLUA 1AUJA 1KLIH 3ATMA 1EAIA 4ZUHA 2VWOA 2FOHA 3RXIA 1O5AB 1QJ1B 3E1XB 1SGQE 1HAVA 1Y3WA 1UVTH 2LNCA 3GCNA 2AEIH 3Q76A 1FZZA 2SNWA 2BMGB 3U8TH 1EZSC 1P2JA 1ZYOA 1QTFA 3HATH 2G51A 4RN6A 2H9TH 3IG6B 3ZVCA 2PW8H 2NU2E 1O2KA 1QBNA 3ATIA 3U8RH 1YCPM 1QY6A 3M3TA 2A7JA 1QL7A 2BLOA 5FCKA 3LGYA 1C2LA 1GJ5H 1XMNB 5E0JA 3K9XB 2BDBA 4MLFB 3A88A 3HGNA 3C27B 4OS6A 1YGCH 2WPLS 2HALA 1GBEA 2FOMB 4PROA 1YPJH 7LPRA 1S83A 2Q1JA 1SQOA 4IMQA 1LQEA 1MH0A 3U8OH 4A7IB 3E6PH 2D26C 4ZROA 1LMWB 2ZKSA 3BN9A 3LC3A 4CH8B 1Y3VA 1MD7A 1FIZA 1H4WA 5HM9A 1LHGH 4CR9A 3ZYEA 1DICA 1HJAB 3KNXA 3RU4E 3EQ0H 3FP8E 2OINA 3RC4A 1PQ7A 2VNTA 4O3TA 1TGNA 2ZZUH 3F9GA 1OWHA 2GZ7A 1CA0C 2B5TB 3ELAH 2FS9A 3BIUH 2XNIA 4FU7A 1O2UA 3PO1B 2SGQE 1MTVA 2F9VA 2PV9B 2FM2A 4BXSA 3BEFB 1S5SA 1TPOA 2ZU3A 2BHGA 1AHTH 3GY8A 6ESTA 4HFPB 3SGAE 4JK5A 1EB1H 3QZQA 4WMDA 4ISNA 1TNJA 1WV7H 2A0QB 1HPGA 1XXDA 1GHVH 2XCFA 1IHSH 4MTBA 4K1EA 4ISIH 2WPJS 3B9FH 1D3TB 4E06H 2VIDA 1TFXA 4NCYA 2FOBA 5F8ZA 1C1SA 2ZIQH 3RXDA 1QRWA 1HRTH 1O3MA 4ZKOU 3ZVAA 1O3OA 2HOBA 4I7YH 2AIPA 1BMLA 1HAVB 3SJKA 2Y82A 1JMOH 2IOTA 5EU8A 2Z9KA 3PMHB 5EOKA 3ZZ8A 5C3NA 2GV7A 3VB6A 1ZHPA 2ZQ2A 4O9VA 2FXRA 1O34A 4IW4E 1XKBC 1BZXE 1TB6H 3U69H 2ALVA 2A2XH 2SNVA 1SLWB 4AFQA 3OX7U 1FY3A 1ARCA 1G3EA 2TGTA 1YPLH 1GG6C 5A0AE 1E34B 1AMHA 2OXSA 2VIWA 5GXPA 1T31A 3B8JA 3TK6A 2BD9A 2ZFRH 1TMUH 3A87A 2FYRA 3NKKA 2YOLA 1KTSB 1TBRH 3VEQB 1ZGVA 3MNXA 5DP8A 1W2KH 9LPRA 1D3QB 1RD3B 2ZWLH 3TVJB 3SJOA 2ESTE 2OQ5A 4DIHH 2CJIA 4FVDA 4GUXA 5FBEA 4LXBH 2BY7X 1C1VH 2RDLA 2G4TA 4MQAA 1GBIA 3S7HB 3ZZ5A 1Y3UA 1NRRH 5GWZA 4SGBE 1BHXF 1GBHA 1AWFH 1ZMLA 1BRBE 2ODPA 2P95A 1AD8H 2VINA 1BRCE 1ZRKA 3EE0B 1KXBA 6GCHF 1NM6A 1TNLA 2PTCE 1MKXK 1UTOA 4NA8A 5EQQA 1DS2E 4D7GA 1QB1A 1TA2A 3MI4A 1GG6B 3G01A 1LO6A 1ELCA 2VWLA 3QZRA 1V2NT 4IN1A 1YBWA 3FZZA 3CENA 2XCNA 4I8JA 2D2DA 1K1PA 2P3TB 2A4QA 1P12E 2QYIA 1O2XA 5A09A 4YTAA 2ZHEH 2NU0E 5FX5A 1F5KU 3E0NB 1SSXA 3KQEA 2J38A 3NZIA 1UTKA 2QAAA 2C8XB 3TITA 1PPZA 4ABFA 1JRSA 3SBKA 1TONA 3VB4A 5L2YH 1AIXH 1ELTA 4YZUA 1C1PA 2G00A 1P11E 4YLQH 4Y0YE 2SGEE 3GOVB 3K2UA 1RFNA 2P8OC 2OUAA 2Y5GA 3SHAH 1QBVH 2PKSB 4BTTB 1KTTB 2P59A 1FDPA 1G36A 2OC7A 1Q3XA 2ZU5A 5FAHA 2VGCB 5ETXA 3PV4A 2ZCKP 4NA9H 2WPIS 4XOJA 4K8YA 1NN6A 4Y0ZE 2WYGA 3KIDU 3DT0H 1CGJE 2I6QA 1C2EA 1PPFE 3RLYH 1Z1IA 3A8DA 2THFB 2Z6BD 2GZ8A 2ZU1A 2Z9JA 1O3AA 4O97A 1IHTH 1Y3XA 1MQ5A 2FI4E 1CHOF 3DUXH 3T62A 4ABIA 3IITA 1JWTA 1KY9A 2ZO3H 3LGIA 4ZHLU 1GHAG 1J9CH 1GDNA 1MKWK 1ESAA 3K6ZA 1VR1H 3K65B 1GMDG 1WCZA 1XVMA 2NU1E 2EI6A 3C1KA 1A5IA 1QB6A 3RXFA 4OS7A 4X2YA 2HNTF 2OC8A 4Q7YA 4D7FA 1S6FA 1K1IA 1F5LA 4K60A 2HPQH 4AG2A 3ODDA 5L2ZH 3SJ8A 3E16B 1DFPA 3WY8A 1V2TT 3PMJA 4I8HA 4SGAE 1VITG 3ZZAA 3RDZA 4NSYA 2XW9A 5C67A 1V2MT 5JDUB 3GISB 1THSH 5FHTA 1UTPA 4XBBA 1EXFA 2GCHF 4Y8XA 1HBTH 1ELBA 4ZXXH 2J94A 4B2CA 3UPEA 1IQGA 1NU9A 3LDXH 2AIQA 3JZ2B 1DXPA 1C5VA 3RU4D 1KIGH 3RU4T 1MTUA 1SGRE 2OP9A 3BTTE 1F5RA 4AN7A 1TNGA 5B6OA 3NWUA 1N8OC 3NXPA 2RG3A 2GMTC 4B2AA 1UTQA 4IGDA 1GI9B 1OYTH 1FV9A 2Y81A 3T28A 5JB9S 4FXGH 1YCPH 2BDIA 1M9UA 3BTHE 3LKWA 1NFYA 2AMQA 3EGKH 2VH6A 1H8IH 4NA7A 4CHAB 1YPMH 1GCTC 1Z8JB 2J92A 1A5GH 1HV7A 1GCDA 4I8GA 1Z7KA 4MPWA 2EI7A 2BXTH 4CRCA 3RMLH 2XWAA 1O2JA 2XYAA 4B73A 4X1QU 1WAYB 5CMXH 1SFIA 1KXDA 2NU4E 3MH4A 1O2QA 3GYLB 2VIOA 1O32A 2TPIZ 4TWYA 2ZNKH 4MNXA 2NWNA 1YP9A 1P3EA 2VWNA 4TYDA 2ZU4A 1BJUA 5TJXA 1EZXC 3LPRA 4XFQA 3E8LA 1G32B 1T7CA 1JIMA 1O3EA 2VH0A 2XTTB 1OWEA 1ANEA 4AGKA 5E2PA 1A0JA 4O3UA 1OPHB 4XSKU 2EC9H 4X2XA 5E8EH 2Q6GA 4YM9A 1GBJA 5DP9A 2F9OA 2Y7XA 3Q00A 3A8CA 1O3JA 1O3GA 4ISLA 3SW2B 3V3MA 1GHBF 1DDJA 4ZH8A 4Y11E 1G3DA 1MZAA 3STJA 1EZQA 1P04A 3CP7A 1P2OA 1EB2A 2H9EH 4Z6AH 1QFKH 1FUJA 3ZV8A 1W11U 3TIUA 3LC5A 1W0ZU 1S0QA 1HB0B 2PGBB 2FZZA 1S6HA 2GT7A 2ZP0H 2BVSH 2ODYB 1TX6A 4MNYA 1C5OH 2BY6X 5FBIA 4F4OC 3GCOA 1HCGA 3A86A 3RM0H 4AX9H 3GY7A 3SU4A 5A8XA 1DSUA 4B76A 2VVCA 1HIAB 1NS3A 1TBZH 3QGNB 4BXWA 4I8LA 5JBBS 4H4FA 3KEEA 1ZPZA 2BY8X 3ATLA 3U98H 3NCLA 3OYPA 3BEUA 4FUDA 2FOAA 2ZFQH 3QX5H 3P8GA 5EQSA 1VCPA 3ZVBA 2A1DB 2GGVB 3BIVH 1YPHC 1IQKA 1HJAC 2J4IA 1TQ7B 1ELGA 1HAIH 1P9UA 3FFGA 3A81A 4WY3A 2OC1A 1LVOA 4Q2KA 3MFJA 1SG8B 2Y80A 4OS1A 4BANB 1FAXA 1K28D 1LHDH 1S84A 1GJ6A 3R3GB 3JZ1B 2F9NA 2BOKA 4JYUH 4LZ1H 4MPXA 3UREA 1NFUA 5DO4H 2ZGHA 4IS5A 2J9NA 3HPTB 2A5KA 1C5XB 2W7UA 1TGBA 1D6WA 4IN2A 2PSYA 2ZGJA 4MDSA 1SLVB 1BB0B 2KAIA 3NPSA 1WBGB 2C90B 3AW1A 1PYTD 2YNAA 2B8OH 1SGTA 1GPZA 1BDAA 1E0FD 1WSSH 1O3IA 3MHWU 3RP2A 3GCHC 2Z94A 5HGGA 4KTUA 5SGAE 1OWIA 2HRVA 1SGYE 1W13U 2WPMS 1Y8TA 2BLVA 1C9TA 2ZGBH 4A5TS 1C5LH 7GCHG 4THNH 3HK3B 1L1JA 2ZI2H 2M5TA 4JZIA 1G30B 2V3HH 4NIXA 3LJJA 5L30H 1KXFA 1O2TA 4X1RU 2XBXA 1BTPA 4RKJB 1GJCB 1H1BA 1LHFH 2R2MB 3SORA 3TU7H 1DLEA 1O5GH 1S85A 3E91A 1BMNH 1UHBA 3B23B 1FNIA 3SNAA 8ESTE 3A8AA 1Z8IB 2ZU2A 2DE8A 3A7YA 4FUCA 3ZZ3A 4AFZA 1HJ8A 4JMYA 3BSQA 3TPIZ 1C1OA 3QN7A 3KQBA 1C5RA 3A7WA 1AWHB 3P8OA 2VWMA 3TGIE 3V13A 4H6TA 1FY5A 3L6PA 1MTNC 2UUYA 5C20A 1ORFA 2O8UA 2FYQA 1XXFA 1SFQB 1P02A 2PKAB 1W0YH 2ZTYA 1SQTA 4OGXA 1GI8B 1S82A 2PWXA 1OWJA 1VGCB 4DGJA 1PPEE 2TGPZ 3TJNA 3SI4H 1HAPH 3V0XA 2ANMH 3M3SA 2VIPA 4JZEH 3SV2H 3ZVGA 5J4SA 5IYTA 1AGJA 3V12A 5C1XA 1QRZA 1K1LA 1RIWB 4JZ1A 1HAHH 1IQIA 1BRUP 2HGTH 3IWMA 3GCHB 1ZLRA 5LPRA 1GHWH 1DLKB 3MH5A 1V2KT 5L6NH 4U01A 1XX9A 1FY1A 4TWWA 3RXTA 2FWWA 3PMAB 2WPHS 3O8BA 3RXCA 1SGCA 1T8MA 4BTUB 3LOXA 4YOIA 1ZZZA 3UOPA 4NZQA 3NUMA 1LPGB 1OP0A 1SGNE 1F0SA 1S0RA 1FPCH 1GBAA 1O36A 2OBOA 1PPCE 4HI3A 3TK9A 3GY4A 1O2WA 4AZ2B 1C2MA 3GDUA 4Y7AA 5HYOA 4IMZA 1YF4A 1HAZB 3L3TA 3ATWA 3VGCB 2EI8A 3I29A 4VGCB 2ANWA 2XC5A 1AE5A 4YOGA 4DURA 3BF6H 2B9LA 1EP5A 1DANH 1MAXA 3M5NA 4BAHB 1NESE 2P3UB 4K5ZA 1O35A 4KTCA 5FX6A 1MU6B 3T29A 1W7GH 4U32A 3BTDE 1C2HA 4FUEA 1P05A 2PHBA 3FANA 1MMJN 9ESTA 3TH3H 1FY8E 1SLXB 3P92A 3SZNA 1C4U2 1EJAA 1FONA 2FO9A 2ZQ1A 8GCHF 4GPGA 4INKA 1LTOA 2FLBH 3GCTG 1ZHMA 2BQ7B 1C2GA 4FVBA 1WQSA 4X1PU 3NK8A 2R3UA 1Z1JA 1AVWA 5FPTA 1GI1A 3LH3A 1GDQA 1ETSH 1DXWA 2BDGA 4ZAEA 1AUTC 3RXQA 1N1LA 4ZHAA 4BNRA 3QLPH 4J2YB 1UVPA 2Y5HA 2XRCA 1CGHA 3EYDA 3EA8A 1TIOA 2C8ZB 1IQLA 4WMEA 3S9BA 1EJMA 1ZOMA 3GY6A 1CBWC 3VXFH 1CSOE 3VXEH 1BBRH 5BPEA 2O8MA 4UDWH 3AW0A 2Z7FE 5A8YA 3F9FA 1H8DH 1F0TA 1GCTB 2A5AA 3PYHA 4WWYA 1O3NA 1OSSA 3R0FA 3ZYDA 2GZ9A 2KAIB 1QA7A 2PUQH 1P01A 5DP6A 3RXUA 3S9AA 4ZMAH 3QGJA 1IOEA 5DKMA 4X6OA 1GJDB 1T4VH 2HNTE 4WJG2 4Q7XA 1JOUB 1V2ST 3V7TA 2VIVA 3PTNA 1AQ7A 2G5NA 1W10U 5EXLA 4D8NA 1SB1H 1GDUA 1O2ZA 1XUHA 1EPTB 4DJZB 2GD4B 1QJ7B 2XXLA 1A46H 1TPAE 1TABE 1MKXH 2PR3A 1UVUH 3PWBA 5A8ZA 4NFFA 3SJIA 2JKHA 4FUHA 1ID5H 3VFEA 2BVXH 4AB9A 2TIOA 2ZPQA 3Q3YA 2FI5E 1LHCH 1NROH 4D9RA 1EOLA 1SGPE 1C1WH 1HGTH 1ZTLA 5AFYH 2A45B 2IPHA 1O2PA 4Y10E 4MNVA 1ELDE 1EAXA 2BD2A 2C8WB 4LOYH 2ZDVH 3S69A 4K1TA 1L2EA 2GCTB 2VIQA 4BTIB 1DUAA 2BY5X 4ZXYH 1IAUA 2FOEA 4OS4A 1RS0A 2IN2A 3A8BA 1HIAA 2BQWB 1UK2A 2CN0H 1BUIA 1DE7H 1GBMA 1CBWB 4WH8A 3U9AH 4GLYA 2QIQA 3T25A 3MOCA 3OTJE 1TYNA 3LU9B 2V3OH 5EG4A 3BG4B 3Q3XA 2CMYA 4GCHG 1GMHF 3AAUA 3FAOA 5C2ZA 3ATKA 4INLA 1K9OE 4MVNA 2ZDAH 3MNBA 3PLBA 1IQFA 5E2OA 2QCYA 2G8TA 1AFQC 1AZ8A 1O2GH 1SGFG 3TJUA 1CT4E 1D4PB 2R2WU 4B74A 1LHEH 1LKAA 4OS5A 1AZZA 3M7QA 1SHHB 1GHAF 2BX4A 4NSVA 1ZGIA 2B0FA 2WPKS 1AKSA 1KLTA 4I32A 3UIRA 1QURH 3LGTA 3SU1A 3T5FH 1VZQH 2OBQA 2H9HA 2TGDA 3TH2H 2OLGA 2BDCA 4DVAU 4MPUA 3N7OA 1QB9A 1FLEE 1SPJA 4FUGA 4B1TA 4CRGA 1V2OT 1TWXB 1ZRBA 2H5DA 3P17H 2ZHDA 2ILNA 5BRRE 3I78A 4AYVB 2EA3A 3MYWA 2FPZA 2PTNA 3QDZB 1O5CB 2F9UA 2PKAA 2XWBI 2SGFE 4Y7BA 3TJVA 2BZAA 1NRNH 1KXAA 1SOZA 2FP7B 4WVPE 3L33A 1TALA 2R0LA 3E0PB 4K69A 3MU5A 1GL1A 1P3CA 1AI8H 1QL9A 1TLDA 4YT6H 4GHTA 6CHAB 1G9IE 2Z3CA 3A83A 3RXRA 3A84A 2RA0A 1TOCB 2ODQA 1G37A 2J95A 1NU7B 1JXPA 3MO9A 4E7NA 2AERH 3RC5A 2ZHFH 3ZVEA 1CE5A 3TGKE 3BTGE 2FOGA 3MMGA 3A7XA 1J15A 1LQDB 1AO5A 1UTNA 2C93B 2BTCE 1O3HA 2ANYA 3VGCC 5DP5A 3SJ9A 3OU0A 3PLPA 2BYAX 1Z6JH 3U1JB 1OS8A 2B7DH 1ANDA 1E36B 1GI0A 4OGYA 5DP4A 3T26A 4A1XA 1Y59T 4X8SH 1LCYA 4JK6A 1CHOG 2VVUA 3LT3A 3UWIA 3RXBA 4ESTE 4X0WU 1ZR0A 1QCPA 3FZDA 4YT7H 1HLTH 1MD8A 3P6ZB 2P3FH 4XBDA 5GCHF 1V2PT 4BAQB 1A0LA 3BV9B 3BEIB 3AAVA 3MU1A 1FY4A 2CF8H 3DA9B 5AFZH 2C3SA 3MO6A 2FDAA 4FUBA 2ZFTA 3F6UH 2SGAA 2Q6DA 1C4Y2 5LH8A 2TBSA 3I77A 4DG4A 1NO9H 5F8XA 3EAJA 1ESTA 1MBQA 2AS9A 1G2MA 2G4UA 1GBTA 4WF8A 1MCTA 7KMEH 5JBAS 1HXFH 2GCHG 1O37A 3RUOA 4JZDH 4K3JA 1O0DH 1PQ8A 1ARBA 4GSOA 3PTBA 2ZG0H 1C2FA 1SHYA 4INHA 3T27A 2BLQA 1CA0B 3UQVA 1H9IE 5HM2A 1OWDA 4B2BA 3MTYA 1TNKA 4X8TH 1K22H 1Z8RA 1TAWA 1MZDA 1K1OA 3FVFB 1G2LA 3AASA 3S7KB 2O8WA 4AG1A 1OWKA 3ODFA 1PJPA 1C5TA 5CHAB 4M7GA 2AGGX 3SU3A 2GDDA 1BCUH 1HAYB 1MQ6A 1K2I1 1J16A 5LGOA 1T4UH 1IQNA 3P95A 1H9LB 1CT0E 1DWEH 1C2DA 1TOMH 4XDEA 2BDAA 2A32A 1PQAA 1TMBH 4ZHMU 1D6RA 1A5HA 1YC0A 5E0GA 5TCAA 4ABBA 4X6PA 2AYWA 1BRAA 3Q77A 3RXPA 1O3KA 3RXHA 1V2UT 2R3YA 1Q2WA 3U1IB 5LPFA 1GHXH 3ZZ9A 4BAKB 1K21H 3LIWA 3RMMH 1RTKA 1NRQH 1NRPH 2A4RA 5T6FA 1A0HB 1UJ1A 1TE0A 4D76A 1TRMA 3KF2A 4ABJA 2STAE 2FLRH 1XUIA 2OCVB 2P8OB 2BOHB 4UD9H 2BVRH 1W3CA 3D23A 1FJSA 1HJ9A 2QXGA 5HMAA 1BMMH 1C1TA 1O31A 1T8OA 3UNQA 1GHBG 3ZV9A 5F03A 4CBOA 1C1RA 5F8TA 1P8VC 3M5MA 3EA9A 1D3PB 1W7XH 2QA9E 1UCYE 2W3IA 3D49H 3RMOH 3RXJA 1N6YA 1KDQA 1KXEA 2GDEH 1QL8A 4BAMB 3H7TA 1PPHE 1GJ8B 1VITH 4IBLH 3A7TA 1Q31A 1HAGE 5DJ7A 5ESTE 1CQQA 1SGFA 1A3BH 3PLKA 1CU1A 4A1TA 4F49A 2J2UA 1O2MA 3K6YA 1BT7A 3E90B 3RXOA 2CGAA 1O3DA 4B75A 1YPKH 2AMPA 4X1NU 5T6DA 1HAOH 4CRFA 4X8UH 3M5LA 4AYYB 1P2KA 2AH4X 4K8BA 2FI3E 1BBRK 2CHAC 1UCYK 3GDVA 1UO6A 4UFEH 1O2SA 2ZGXH 2ZTZA 2PUXB 1YPGH 1TGSZ 1THPB 2F83A 2YNBA 1C5WB 1YM0A 2F9PA 3H7OA 1UVOA 3P8NA 4YOJA 3HKJB 2QY0B 3ZZBA 2BD5A 3TGJE 1DWDH 1OX1A 3BG8A 4Y8ZA 5C5OA 3KCGH 1QQ4A 3RXVA 2WUCA 1P9SA 5J4QA 5C1UA 1SL3A 1BOQA 1GBCA 4DW2U 2WV5A 3DHKH 3PMBB 1O2OA 1L4DA 2C8YB 1BTXA 1L0ZA 1GI3A 3UFAA 3KHVA 2AMDA 1KLJH 1LDTT 2CXVA 1FIWA 3GYMA 5GPIB 1UTLM 1WU1A 2XC0A 3HK6B 1GWAA 4ZKNU 3UQOA 3A80A 2SFAA 1E35B 2VGCC 4HTCH 1O3CA 1C9PA 1YPHE 1RGQA 1X7AC 2J34A 1RTLA 4NZLA 3UUZA 1PYTC 4H42U 5EW1H 1V3XA 1SBWA 5JBTA 2A5IA 1JBUH 1ETRH 3A82A 2XC4A 4Y76A 1O2LA 1DUEA 1GMCF 1P2QA 2GMTB 4HZHA 1IQEA 1ZMNA 3ITIA 1BHXB 1V2WT 2JH0D 1DY9A 1HFDA 3HKIB 1WTHD 4JZFH 1C1NA 2D8WA 3KGPA 2A4OA 1XUGA 1UHBB 4X1SU 1A1RA 4FUIA 1YLDA 4FU8A 4AFSA 2Z9GA 2GCTC 3SI3H 1VCQA 4ABAA 1N8OB 2Z3DA 3SV7A 2A2QH 1P2NA 2FMJA 3S9CA 2F9BH 2GX4A 1ELEE 1IQJA 2FTMA 2FS8A 1O5BB 3KQDA 3MO3A 5EODA 2QF3A 3RC6A 4K2YA 1WYKA 4X2WA 1V2LT 4UONA 1GVLA 3SUEA 5AVDA 1P57B 3SV6A 1AB9B 2DE9A 3QK1A 3DFJA 3F9EA 1O5EH 1O3LA 2GT8A 4DOQA 1J8AA 1WUNH 1RXPA 1T8NA 4BAOB 4FUJA 5AF9H 1Y5BT 8GCHG 1AFQB 1AKSB 3GDSA 3TK5A 5ABWA 1ABJH 5C5NA 2D1JA 5K7RA 1HUTH 4Z0KA 2GKVE 4TY7A 2UWOA 2ZEBA 1GI4A 1GVKB 1GGDB 1GJAB 3EDXB 4UFFH 1O2RA 1SGEE 1UCYH 3E3TA 1C2KA 1QA0A 1DM4B 2GP9B 1RRKA 3BTKE 1TRNA 3RXSA 1F92A 1GJBB 1GJ7B 1ZTKA 1SC8U 2O9QA 1AB9C 4XE4A 1C5UA 2BLWA 1BTYA 4O03A 4VGCC 1EAWA 4ASHA 3GICB 1JRTA 1C2IA 1GI7B 3QTOH 2G81E 3ZZCA 4FU9A 1FMGA 1TRYA 1MAYA 4RSPA 1GHZA 3SU6A 1ELVA 1ABIH 1GBDA 3W94A 2I6SA 1QQUA 3RLWH 1GJ4H 1QR3E 1XUKA 3VPKA 4ABEA 3BTFE 1DY8A 1GGDC 1L1NA 1Z8GA 3BG4C 2ZFSA 3ZVDA 3LGWA 5G4BA 1GMDF 1QJ6B 1BIOA 1AFEH 3VB5A 2WINI 3SN8A 2BQ6B 4NIVA 1KYNA 1HDTH 4DT7B 2JETB 3O8DA 2ZF0H 2OTVA 1SVPA 3M5OA 1QNJA 2JH5D 4Q7ZA 3Q3KA 3SUFA 2PKSC 2ANKH 1FXYA 4HGCA 4KP0A 3STIA 3ZZ7A 3TLOA 1INCA 2ZHWH 1OYQA 1XVOA 1OP8A 4BOHA 5F6MA 7GCHF 1LPKB 3AVZA 2ZDLA 1W8BH 3UR6A 2BB4A 5HXFA 2BD7A 2VU8E 3D62A 1P10A 2JETC 5K0HA 2BDHA 4AFUA 1V6DA 2AGEX 1E37B 1O5DH 1CO7E 1C5SA 5FPSA 1CHGA 2BD4A 4NWLA 3URCA 4DCDA 4CR5A 3D65E 4KKDA 5TCCA 1TBQH 3PO1C 2CF9H 1L4ZA 4CRDA 3RM2H 5IDKA 1ACBE 1D3DB 4KELA 4AGJA 4J1YA 2G5VA 2P94A 3F68H 3UNRA 3SQHE 1BQYA 3RXMA 3W95A 1QHRB 2HPPH 1ANCA 2P93A 3LJOA 1GBKA 3BTWE 1NPMA 2Y5FA 4CH2B 2G55A 1G3CA 3SO3A 1A4WH 1THRH 1ZTJA 4X6MA 1A7SA 2ZCHP 4JCNA 2W7SA 4A6LA 1C5YB 2UWPA 3M61U 4WH6A 3ZZ6A 3SV9A 1PPBH 2QXHA 4UEHH 2HWLB 1BMAA 1HYLA 3SQEE 1O38A 1O5FH 3MNCA 1HNEE 1O3PB 1BTWA 1EQ9A 1BJVA 1C5PA 2GTBA 3LGUA 4NIWA 2Y6TA 5AHGH 2V35A 1OKXA 2XBVA 2QXIA 1P2IA 2ZFPH 1O30A 2UWLA 3SNEA 5DP7A 4MPVA 5ESBA 1BBRE 2RCEA 1FN8A 1F0UA 5EW2H 1CT2E 2ZFFH 1QGFA 3ESTA 2Q6FA 2FEQH 3MU4A 8KME2 1EASA 4Y71A 1P0SH 2R9PA 1DOJA 1ELFA 1TQ0B 6CHAC 1TPSA 5T3HA 3KN2A 4NWKA 1J14A 2A31A 1GJ9B 1G3BA 1SGIB 1NFWA 2BD3A 1XM1A 4OS2A 2A4GA 1DITH 1C1QA 4LZ4B 1AN1E 3KQCA 5PTPA 4QT8C 2H5CA 1C1UH 1K1MA 3M37A 1KSNA 1ZJKA 1K1JA 1JIRA 1EPTA 1PQ5A 4U30A 2QN5T 3UTUH 2AFQB 5LPEA 5DGJA 2V6NA 3MU0A 2HNTC 4ISOA 1NZQH 3BTME 3UWJH 3SNDA 5EQRA 1NC6A 5FXLA 4ABHA 1FAKH 2PGQB 2UUKB 2OD3B 4ABDA 3VB7A 1NRSH 2R0KA 5GDSH 2P16A 3RXGA 2A7CA 2ZA5A 2H2ZA 4I8KA 3RXKA 3P70B 1BITA 2QC2A 1GMHG 2W3KA 1P03A 2ZCLP 1MTWA 1NFXA 1ZHRA 4AORA 2BDYA 3MWIU 1O2IA 1O33A 2XBYA 5A0CA 2ZGCA 2ZDNA 1ETTH 3MNSA 5CHAC 1B0EA 3OY5U 4RKOB 2BZ6H 1SLUB 2FOFA 2BXUH 3M35A 4MNWA 1SOTA 4TPIZ 2TRMA 3SUGA 1OP2A 1P06A 2QF0A 2ZDMA 1YPEH 2H6MA 4Y8YA 1B0FA 3OSYA 1ZSLA 2LPRA 1AE8H 2F91A 1NY22 3SNBA 1P09A 5JB8S 1UMAH 1VCWA 2DUCA 5FCRA 1IQHA 1BA8B 2QXJA 4ZKSU 1VITF 3UOUA 1T8LA 1C5ZB 4IC5A 1EZUC 4Y6DA 1EAUA 1VJ9U 4TPYA 3OY6U 1F7ZA 2VVVA 1GBFA 3M3VA 3PB1E 4MG3A 4NGAH 1ZPCA 1ZSKA 5DPAA 2Y7ZA 3M36A 5GJ4B 3H5CB 4LK4A 1OOKB 4Q80A 1L1GA 3HGPA 1GBLA 1ZSJA 2WUBA 8LPRA 1CVWH 3SGBE 3BTQE 2TGAA 3A7ZA 1SMFE 3MH6A 5I46H 1ZJDA 3EA7A 1GHYH 4H6SB 4UE7H 2Z9IA 1C5NH 3ZZDA 1XUJA 2ZDKA 4CRAA 1HXEH 2RA3A 1B5GH 1C5MD 2QGRA 1AVXA 3MH7A 5EXNA 1V2RT 1O3BA 1DWBH 3F9HA 3SU5A 4KTSA 2FTLE 1NTPA 1LPZB 1ZMJA 4R0IA 4U2WA 3LH1A 1C5QA 4UFDH 5DP3A 1YYY1 3RXEA 1FQ3A 1LVMA 1V2JT 1DSTA 1YCPK 1W12U 4JYTA 1SQAA 3A89A 1C1MA 2ZECA 1EP6A 2UUFB 1O3FA 2XBWA 3SU0A 1V2VT 4GCHF 3TH4H 2VJ1A 1C4V2 2O8LA 1K1NA 1TX7A 2SGPE 5FPYA 3URDA 1T32A 4A92A 1EJNA 1GI6A 1A3EH 3LONA 1N6XA 2IJOB 3ENSB 2HVXA 4CBNA 1RJXB 1BTHH 1NT1A 5JPMH 1TPPA 1TMTH 4GHQA 2CHAB 1LVYA 1O2HA 5E0HA 2G52A 1OXGA 4CRBA 2K1QA 2FIRH 1BTUA 3ZZ4A 1EATA 2ULLA 4ISHH 4AB8A 2O8TA 1A61H 1CA8B 1YLCA 4GAWA 3TJOA 4CHAC 3VB3A 3S0NA 3GY2A 1KDQB 2GVFA 1AU8A 1E38B 1MUEB 1D9IA 1LVBA 4NFEA 1UK3A 4AOQA 3RMNH 4GVUA 3M7TA 3SU2A 2ZPSA 1TGTA 4D9QA 3PM3A 1EKBB 4TY6A 1MTNB 2JH6D 3TNTA 1F2SE 1MU8B 1BTZA 1GI5A 4K1SA 4YO9A 1SR5C 1UVSH 1GBBA 2BM2A 1MKWH 2Z9LA 1UK4A 2ZPRA 1ELAA 2VB0A 1SGDE 1O2YA 4X6NA 4DIIH 2F3CE 1DVAH 3QWCH 4JYVH 5DG6A 1EOJA 1RIWC 1VJAU 4UFGH 5EPNA 1ZPBA 2PSXA 3FP7E 1Z6EA 2GV6A 1XUFA 3CS7A 2ZHQH 1AVGH 1GVZA 2FX4A 2ASUB 7ESTE 1YKTA 2W26A 4I31A 4ZKRU 4WXVA 5DK1A 1FI8A 2OQUA 3A7VA 2ALPA 4IC6A 4A1VA 3QO6A 4E7RG 3MU8A 2FOCA 1CGIE 5C1YA 1PPGE 1WQVH 1F0RA 1ANBA 3F1SB 2BD8A 3QTVH 3SOSA 1TNIA 2BY9X 3GCTF 4XBCA 2NU3E 3TNSA 1RTFB 2AGIX 3O8RA 3O8CA 5A0BA 5EXMA 2QV1A 1ESBA 5EGMA 2C4FH 1Y3YA 1TNHA 4NG9H 2V0BA 3RXLA 4X2VA 1EUFA 5T6GA 1O2NA 2SGDE 2FESH 3PROA 4X8VH 3PWCA 2A7HA 1LKBA 1UTMA 1O2VA 3A85A 5JBCS 1HAXB 4E05H 1QBOA 1MBMA 1Z71A 1QRXA 1IQMA 1Y5AT 4ABGA 1S81A 2BX3A 2ZTXA 3DFLA 4WMFA 1DX5M 4YESB 3BTEE 1AY6H 4WXIA 4CREA 1EPTC 1O39A 1QIXB 5GCHG 1PFXC 5GIBA 3GY3A 1Y5UT 1J17T 1XKAC 5JYIA 3LGVA 1W14U 1TGCA 4Y79A 3UY9A 1GL0E 2HLCA 3SNCA 1TX8A 5I25A 4R8TB 1U6QA 1GMCG 3UR9A 6GCHG 2WYJA 1KXCA 2FODA 1WOFA 2H1UA 2PFEA 3KL6A 2STBE 6LPRA 2CV3A 4DY7B 4KGAA 1UTJA 3CS0A 3UNSA 1DWCH 1GI2A 2OC0A 1DPOA 2WV4A 1H9HE 2EEKA 3M7UA 2ZC9H 3P8FA 3SHCH 1VGCC 3GY5A 5CE1A 2Z3EA 4I33A 3DD2H 1TA6A 3FP6E 2PLXA 2UUJB 1EX3A 4FUFA 1MTSA 1C2JA 1SI5H 5EPYA 4NIYA 1V2QT 1DT2A 1B7XB 3SUDA 5H4IB 2FX6A 1FN6A 3QUMP 4B71A 1A2CH 1FPHH 1MCVA 3RXAA 2W5EA 3T2NA 3ZVFA
chains in the Genus database with same CATH superfamily
3SGQE 1P2MA 2XOKD 1WTGH 5A2MH 3SV8A 4YLUA 1AUJA 1KLIH 3ATMA 1EAIA 4ZUHA 2VWOA 2FOHA 3RXIA 1O5AB 1QJ1B 3E1XB 1SGQE 1HAVA 3AK5A 1Y3WA 1UVTH 2LNCA 3GCNA 2AEIH 3Q76A 1FZZA 2SNWA 2BMGB 3U8TH 1EZSC 1P2JA 1ZYOA 1QTFA 3HATH 2G51A 4RN6A 2H9TH 1QZ8A 3IG6B 3ZVCA 2PW8H 2NU2E 1O2KA 1QBNA 3U28C 3ATIA 3U8RH 4ASUD 1YCPM 1QY6A 3M3TA 2A7JA 1QL7A 2BLOA 5FCKA 3LGYA 1C2LA 1GJ5H 1XMNB 5E0JA 3K9XB 2BDBA 4MLFB 2KCPA 3A88A 3HGNA 3C27B 4OS6A 3N7DA 1YGCH 2WPLS 2HALA 1GBEA 2FOMB 4PROA 1YPJH 7LPRA 1S83A 2Q1JA 1SQOA 4IMQA 1LQEA 1MH0A 3U8OH 4A7IB 3E6PH 1NBMD 2D26C 1YY3A 4ZROA 1LMWB 2ZKSA 3BN9A 3LC3A 4CH8B 1Y3VA 1MD7A 1FIZA 1H4WA 5HM9A 1LHGH 2AHME 4CR9A 3ZYEA 1DICA 1HJAB 3KNXA 3RU4E 3EQ0H 3FP8E 2OINA 3RC4A 1PQ7A 2VNTA 4O3TA 3KYFA 1TGNA 2ZZUH 3F9GA 1OWHA 2GZ7A 1CA0C 2B5TB 3ELAH 2FS9A 3BIUH 2XNIA 4FU7A 1O2UA 3PO1B 2SGQE 1MTVA 2F9VA 2PV9B 2FM2A 4BXSA 3BEFB 1S5SA 1TPOA 2ZU3A 2BHGA 1AHTH 3GY8A 6ESTA 4HFPB 3SGAE 4JK5A 1EB1H 3QZQA 4WMDA 4ISNA 1TNJA 1WV7H 2A0QB 1HPGA 1XXDA 1GHVH 3PV5A 2XCFA 1IHSH 4MTBA 4K1EA 4ISIH 2WPJS 5EJ1A 3B9FH 1D3TB 4E06H 2VIDA 5F53A 1TFXA 4NCYA 2FOBA 5F8ZA 1C1SA 2ZIQH 3RXDA 1QRWA 1HRTH 1O3MA 4ZKOU 3ZVAA 1O3OA 2M2AA 2HOBA 4I7YH 2AIPA 1BMLA 1HAVB 3SJKA 2Y82A 3FN8A 5C0TA 1JMOH 3F2FA 2IOTA 5EU8A 2Z9KA 3PMHB 5EOKA 3ZZ8A 5C3NA 2GV7A 3VB6A 1ZHPA 2ZQ2A 4O9VA 2FXRA 1O34A 4IW4E 1XKBC 1BZXE 1TB6H 3U69H 2ALVA 2A2XH 2SNVA 1SLWB 4AFQA 3OX7U 1FY3A 1ARCA 1G3EA 2TGTA 1YPLH 1GG6C 5A0AE 1E34B 1AMHA 2OXSA 2VIWA 5GXPA 1T31A 3B8JA 3TK6A 2BD9A 2ZFRH 1TMUH 3A87A 2FYRA 3NKKA 2YOLA 1KTSB 1TBRH 3VEQB 1ZGVA 3MNXA 5DP8A 1W2KH 2KZ4A 9LPRA 4AC9A 1D3QB 1RD3B 2ZWLH 3TVJB 3SJOA 2ESTE 2OQ5A 4DIHH 2CJIA 4FVDA 4GUXA 5FBEA 4LXBH 4ACAA 2BY7X 1C1VH 2RDLA 2G4TA 4MQAA 1GBIA 3S7HB 3ZZ5A 1Y3UA 1NRRH 5GWZA 4SGBE 1BHXF 1GBHA 1AWFH 1ZMLA 1BRBE 2ODPA 2P95A 1AD8H 2VINA 1BRCE 1ZRKA 3EE0B 1KXBA 6GCHF 1NM6A 1TNLA 2PTCE 1MKXK 1UTOA 4NA8A 5EQQA 1DS2E 4D7GA 1QB1A 1TA2A 3MI4A 1GG6B 3G01A 1LO6A 1ELCA 2VWLA 3QZRA 1V2NT 4IN1A 1YBWA 3DSGA 3FZZA 3CENA 2XCNA 4I8JA 2D2DA 1K1PA 2P3TB 2A4QA 1P12E 2QYIA 3UB0A 1O2XA 5A09A 4YTAA 2ZHEH 2NU0E 5FX5A 1F5KU 3E0NB 1SSXA 2EQNA 3KQEA 2J38A 3NZIA 1UTKA 2QAAA 2C8XB 3TITA 1PPZA 4ABFA 1JRSA 3F2HA 3SBKA 1TONA 3DCLA 3VB4A 5L2YH 1AIXH 1ELTA 4YZUA 1C1PA 2G00A 1P11E 4YLQH 4Y0YE 3KQ5A 2SGEE 3GOVB 3K2UA 1RFNA 2P8OC 2OUAA 2Y5GA 3SHAH 1QBVH 2PKSB 4BTTB 1KTTB 2P59A 1FDPA 1G36A 2OC7A 1Q3XA 2ZU5A 5FAHA 2VGCB 5ETXA 2WZQA 2ZCKP 3PV4A 4NA9H 2WPIS 4XOJA 4K8YA 1NN6A 4Y0ZE 2WYGA 3KIDU 3DT0H 1CGJE 2I6QA 1C2EA 1PPFE 3RLYH 1Z1IA 3A8DA 2THFB 2Z6BD 2GZ8A 2ZU1A 2Z9JA 1O3AA 4O97A 1IHTH 1Y3XA 1MQ5A 2FI4E 1CHOF 3DUXH 3T62A 4ABIA 3IITA 1JWTA 1KY9A 2ZO3H 3LGIA 4ZHLU 1GHAG 1J9CH 1GDNA 1MKWK 1ESAA 3K6ZA 1VR1H 2WHXA 3K65B 1GMDG 1WCZA 1XVMA 2YMSC 2NU1E 2EI6A 3C1KA 1A5IA 1QB6A 3RXFA 4OS7A 4X2YA 2HNTF 2OC8A 4Q7YA 4D7FA 1S6FA 5EJZA 1K1IA 1F5LA 4K60A 2HPQH 4AG2A 3ODDA 5L2ZH 3SJ8A 3E16B 1DFPA 3WY8A 1V2TT 3PMJA 4I8HA 4SGAE 1VITG 3ZZAA 3RDZA 4NSYA 2XW9A 5C67A 1V2MT 5JDUB 4ACBA 3GISB 1THSH 5FHTA 1UTPA 4XBBA 1EXFA 2GCHF 1NBME 4Y8XA 1HBTH 1ELBA 4ZXXH 2J94A 5HKKD 4B2CA 3UPEA 1IQGA 1NU9A 3LDXH 2AIQA 4FETA 3JZ2B 1DXPA 1C5VA 4TSFD 3RU4D 1KIGH 3RU4T 1MTUA 1SGRE 2OP9A 3BTTE 1F5RA 4I86A 2CK3D 4AN7A 1TNGA 5B6OA 3NWUA 1N8OC 3NXPA 2RG3A 1WXRA 2GMTC 4B2AA 1UTQA 4IGDA 1GI9B 1OYTH 1FV9A 2Y81A 3T28A 5JB9S 4FXGH 1YCPH 2BDIA 1BMFD 1M9UA 3BTHE 2JJ1D 3LKWA 1NFYA 2AMQA 3EGKH 2VH6A 1H8IH 4NA7A 4CHAB 1YPMH 1GCTC 1Z8JB 2J92A 1A5GH 1HV7A 1GCDA 4I8GA 1Z7KA 4MPWA 2EI7A 2BXTH 4CRCA 3RMLH 2XWAA 1O2JA 2XYAA 4B73A 4X1QU 1WAYB 5CMXH 1SFIA 1KXDA 2NU4E 3F0OA 3MH4A 1O2QA 3GYLB 2VIOA 1O32A 2TPIZ 4TWYA 2ZNKH 4MNXA 2NWNA 1YP9A 1P3EA 2VWNA 4TYDA 2ZU4A 2RFKC 1BJUA 5TJXA 1EZXC 3LPRA 4XFQA 3E8LA 1G32B 1T7CA 1JIMA 1O3EA 2VH0A 2XTTB 3MQKC 1OWEA 1ANEA 4AGKA 3FKSD 5E2PA 1A0JA 4O3UA 1OPHB 4XSKU 2EC9H 4X2XA 5E8EH 2Q6GA 4YM9A 1GBJA 5DP9A 2F9OA 2Y7XA 3Q00A 3A8CA 1O3JA 1O3GA 2YMSD 4ISLA 1SKYE 3SW2B 3V3MA 1GHBF 1DDJA 4ZH8A 4Y11E 1G3DA 1MZAA 4XD7D 3STJA 1EZQA 1P04A 3CP7A 1P2OA 1EB2A 2F4LA 2H9EH 1QFKH 4Z6AH 1FUJA 2IJD1 3ZV8A 1W11U 3TIUA 4YXWD 3LC5A 1W0ZU 1S0QA 1HB0B 2PGBB 2FZZA 1S6HA 2GT7A 2ZP0H 2BVSH 2ODYB 5EJLA 1TX6A 4MNYA 1C5OH 2BY6X 5FBIA 4TT3D 4F4OC 3GCOA 1HCGA 3A86A 3RM0H 4AX9H 3GY7A 3SU4A 5A8XA 1DSUA 4B76A 2VVCA 1HIAB 3OEHD 1NS3A 1TBZH 3QGNB 3KYGA 4BXWA 4I8LA 5JBBS 4H4FA 3KEEA 1ZPZA 2BY8X 3ATLA 3U98H 3NCLA 3OYPA 3BEUA 4FUDA 2FOAA 2ZFQH 3QX5H 3P8GA 5EQSA 1VCPA 3ZVBA 2A1DB 2GGVB 3BIVH 1YPHC 1IQKA 1HJAC 2J4IA 1TQ7B 1ELGA 1HAIH 1P9UA 3FFGA 3A81A 4WY3A 2OC1A 1LVOA 4Q2KA 3MFJA 1SG8B 2Y80A 4OS1A 4BANB 1FAXA 1K28D 1LHDH 1S84A 1GJ6A 3R3GB 3JZ1B 2F9NA 2BOKA 4JYUH 4LZ1H 4MPXA 3UREA 1NFUA 5DO4H 2ZGHA 4IS5A 2J9NA 3HPTB 2A5KA 1C5XB 2W7UA 1TGBA 1D6WA 4IN2A 2PSYA 2ZGJA 4MDSA 1SLVB 1BB0B 2KAIA 3NPSA 1WBGB 2C90B 3AW1A 1PYTD 2YNAA 2B8OH 1SGTA 1GPZA 1BDAA 1E0FD 1WSSH 1O3IA 3MHWU 3RP2A 3GCHC 2Z94A 5HGGA 4KTUA 5SGAE 1OWIA 2HRVA 1SGYE 1W13U 2WPMS 1Y8TA 2BLVA 1C9TA 2ZGBH 4A5TS 1C5LH 7GCHG 4THNH 3HK3B 1L1JA 2ZI2H 2M5TA 4JZIA 1G30B 2V3HH 4NIXA 3LJJA 5L30H 1KXFA 1O2TA 4X1RU 2XBXA 1BTPA 4RKJB 1GJCB 1H1BA 1LHFH 2R2MB 3SORA 3TU7H 1DLEA 1O5GH 1S85A 3E91A 1BMNH 1UHBA 3B23B 1FNIA 3SNAA 8ESTE 3A8AA 1Z8IB 2ZU2A 2DE8A 3A7YA 4FUCA 3ZZ3A 4AFZA 1HJ8A 4JMYA 3BSQA 3TPIZ 1C1OA 3QN7A 3KQBA 1C5RA 3A7WA 1AWHB 2KX4A 3P8OA 2VWMA 2J97A 3TGIE 3V13A 4H6TA 3N99A 1FY5A 3L6PA 1MTNC 2UUYA 5C20A 1ORFA 2O8UA 2FYQA 1XXFA 1SFQB 1P02A 2PKAB 1W0YH 2ZTYA 1SQTA 4OGXA 1GI8B 2K0QA 1S82A 2PWXA 1OWJA 1VGCB 4DGJA 1PPEE 2TGPZ 3TJNA 3SZEA 3SI4H 1HAPH 3V0XA 2J98B 2ANMH 3M3SA 2VIPA 4JZEH 3SV2H 3ZVGA 5J4SA 5IYTA 1AGJA 3V12A 5C1XA 1QRZA 1K1LA 1RIWB 4JZ1A 1HAHH 1IQIA 1BRUP 2HGTH 3IWMA 3GCHB 1ZLRA 5LPRA 1GHWH 1DLKB 3MH5A 1V2KT 5L6NH 4U01A 1XX9A 1FY1A 4TWWA 3RXTA 2FWWA 3PMAB 2WPHS 3O8BA 3RXCA 1SGCA 1T8MA 4BTUB 3LOXA 4YOIA 1ZZZA 3UOPA 4NZQA 3NUMA 1LPGB 1OP0A 1SGNE 1F0SA 1S0RA 1FPCH 1GBAA 3F3BA 1O36A 2OBOA 1PPCE 4HI3A 3TK9A 3GY4A 1O2WA 4AZ2B 1C2MA 3GDUA 4Y7AA 5HYOA 4IMZA 1YF4A 1HAZB 3L3TA 3ATWA 3VGCB 2EI8A 3I29A 4VGCB 2ANWA 3PV2A 2XC5A 1AE5A 4YOGA 4DURA 3BF6H 2B9LA 1EP5A 3OFND 1DANH 1MAXA 3M5NA 4BAHB 2GJGA 1NESE 2P3UB 4K5ZA 1O35A 4KTCA 5FX6A 1MU6B 3T29A 1W7GH 4U32A 3BTDE 1C2HA 4FUEA 1P05A 2PHBA 3FANA 1MMJN 9ESTA 3TH3H 1FY8E 1SLXB 3P92A 3SZNA 1C4U2 1EJAA 1FONA 2FO9A 2ZQ1A 8GCHF 1UW7A 4GPGA 4INKA 1LTOA 2FLBH 3GCTG 1ZHMA 2BQ7B 1C2GA 4FVBA 1WQSA 4X1PU 3NK8A 2R3UA 4HG6A 1Z1JA 1AVWA 5FPTA 1GI1A 3LH3A 1GDQA 2YMSB 1ETSH 1DXWA 2BDGA 4ZAEA 1AUTC 3RXQA 1N1LA 4ZHAA 4BNRA 3QLPH 4J2YB 1UVPA 2Y5HA 2XRCA 1CGHA 3EYDA 3EA8A 1TIOA 2C8ZB 2J98A 1IQLA 4WMEA 3S9BA 1EJMA 1ZOMA 3GY6A 1CBWC 3VXFH 1CSOE 3VXEH 1BBRH 2QF4A 5BPEA 2O8MA 4UDWH 3AW0A 2Z7FE 5A8YA 3F9FA 1H8DH 1F0TA 1GCTB 2A5AA 3PYHA 4WWYA 1O3NA 1OSSA 3R0FA 1YLNA 3ZYDA 2GZ9A 2KAIB 1QA7A 2PUQH 1P01A 5DP6A 3RXUA 3S9AA 4ZMAH 3QGJA 1IOEA 5DKMA 4X6OA 4F48B 1GJDB 1T4VH 2HNTE 4WJG2 4Q7XA 1JOUB 1V2ST 3V7TA 2VIVA 3PTNA 1AQ7A 2G5NA 1W10U 5EXLA 4D8NA 1SB1H 1GDUA 1O2ZA 1XUHA 1EPTB 4DJZB 2GD4B 1QJ7B 2F43B 2XXLA 1A46H 1TPAE 2RDEA 1TABE 1MKXH 2PR3A 1UVUH 3PWBA 5A8ZA 4NFFA 3SJIA 2JKHA 4FUHA 1ID5H 3VFEA 2BVXH 4AB9A 2TIOA 2ZPQA 3Q3YA 2FI5E 1LHCH 1NROH 4D9RA 1EOLA 1SGPE 1C1WH 1HGTH 1ZTLA 5AFYH 2A45B 2IPHA 1O2PA 3N7EA 4Y10E 4MNVA 1ELDE 1EAXA 2BD2A 2C8WB 4LOYH 2ZDVH 3S69A 4K1TA 1L2EA 2GCTB 2VIQA 2WSSD 1DUAA 2BY5X 4BTIB 4ZXYH 1IAUA 2FOEA 4OS4A 1RS0A 2IN2A 3A8BA 1HIAA 2BQWB 1UK2A 2CN0H 1BUIA 1DE7H 1GBMA 1CBWB 4WH8A 3U9AH 4GLYA 2QIQA 3T25A 3MOCA 3OTJE 1TYNA 3LU9B 2V3OH 5EG4A 3BG4B 5IK2D 3Q3XA 2CMYA 4GCHG 1GMHF 3AAUA 3FAOA 5C2ZA 3ATKA 4INLA 1K9OE 4MVNA 2ZDAH 3MNBA 3PLBA 1IQFA 5E2OA 2QCYA 2G8TA 1AFQC 1AZ8A 1O2GH 1SGFG 3TJUA 1CT4E 1D4PB 2R2WU 4B74A 4ZCNA 1LHEH 1LKAA 4OS5A 1AZZA 3M7QA 1SHHB 1GHAF 2BX4A 4NSVA 5GNDA 1ZGIA 2B0FA 2WPKS 1AKSA 1KLTA 4I32A 3UIRA 2QF5A 1QURH 3LGTA 5B6LA 3SU1A 3T5FH 5T1VA 1VZQH 2OBQA 2H9HA 2TGDA 1W0KD 3TH2H 2OLGA 3NRLA 2BDCA 3H09A 4DVAU 4MPUA 3N7OA 1QB9A 1FLEE 1SPJA 4FUGA 4B1TA 4CRGA 5C94A 1V2OT 1TWXB 1ZRBA 2H5DA 3P17H 2ZHDA 2ILNA 5BRRE 3I78A 4AYVB 2EA3A 3MYWA 2FPZA 2PTNA 3QDZB 1O5CB 2F9UA 2PKAA 2XWBI 2SGFE 4Y7BA 3TJVA 2BZAA 1NRNH 1KXAA 1SOZA 2FP7B 4WVPE 3L33A 1TALA 2R0LA 3E0PB 4K69A 3MU5A 1GL1A 1P3CA 1AI8H 1QL9A 1TLDA 4YT6H 4GHTA 6CHAB 1G9IE 2Z3CA 3A83A 3ZIAD 3RXRA 3A84A 2RA0A 5DN6D 1TOCB 2ODQA 1G37A 2J95A 1NU7B 1JXPA 4M9FA 3MO9A 4E7NA 2AERH 3RC5A 2ZHFH 3ZVEA 1CE5A 3TGKE 3GS9A 3BTGE 2FOGA 3MMGA 3A7XA 1J15A 1LQDB 1AO5A 1UTNA 2C93B 2BTCE 1O3HA 2ANYA 3VGCC 5DP5A 3SJ9A 3OU0A 3PLPA 2BYAX 1Z6JH 3U1JB 1OS8A 2B7DH 1ANDA 1E36B 1GI0A 4OGYA 5DP4A 3T26A 4A1XA 4F55A 1Y59T 4X8SH 1LCYA 4JK6A 1CHOG 2VVUA 3LT3A 4FOUC 3UWIA 3RXBA 4ESTE 4X0WU 1ZR0A 1QCPA 3FZDA 4YT7H 1HLTH 1MD8A 3P6ZB 2P3FH 4XBDA 5GCHF 1V2PT 4BAQB 1A0LA 5C17A 3BV9B 3BEIB 3AAVA 1MABB 3MU1A 1WDIA 1FY4A 2CF8H 3DA9B 5AFZH 2C3SA 3UAIC 3MO6A 2FDAA 3VG8A 4FUBA 2ZFTA 3F6UH 2SGAA 2Q6DA 1C4Y2 2WV9A 5LH8A 2TBSA 3I77A 4DG4A 1NO9H 5F8XA 3EAJA 1ESTA 1MBQA 2AS9A 1G2MA 2G4UA 1GBTA 4WF8A 2LP6A 1MCTA 7KMEH 5JBAS 1HXFH 2GCHG 1O37A 3RUOA 4JZDH 4K3JA 1O0DH 1PQ8A 1ARBA 4GSOA 3PTBA 2ZG0H 1C2FA 1SHYA 4INHA 3T27A 2BLQA 1CA0B 3UQVA 1H9IE 5HM2A 1OWDA 4B2BA 3MTYA 1TNKA 4X8TH 1K22H 1Z8RA 1TAWA 1MZDA 1K1OA 3FVFB 1G2LA 3AASA 3WWFA 3S7KB 2O8WA 4AG1A 1OWKA 3ODFA 1PJPA 1C5TA 4Q63A 5CHAB 4M7GA 2AGGX 4RT1A 3SU3A 2GDDA 1BCUH 1HAYB 1MQ6A 1K2I1 1J16A 5LGOA 1T4UH 1IQNA 3P95A 1H9LB 1CT0E 1DWEH 2W6ID 1C2DA 1TOMH 4XDEA 2BDAA 2A32A 1PQAA 1TMBH 4ZHMU 1D6RA 1A5HA 1YC0A 5E0GA 5TCAA 4ABBA 4X6PA 2AYWA 1BRAA 3Q77A 3RXPA 1O3KA 3RXHA 1V2UT 2R3YA 1Q2WA 3U1IB 5LPFA 1GHXH 3ZZ9A 4BAKB 1K21H 3LIWA 3RMMH 1RTKA 1NRQH 1NRPH 2A4RA 5T6FA 1A0HB 1UJ1A 1TE0A 4D76A 2JIZD 1TRMA 3KF2A 4ABJA 2STAE 4OM9A 2FLRH 1XUIA 2OCVB 2P8OB 1E79D 2BOHB 4UD9H 2BVRH 1W3CA 3D23A 1FJSA 1HJ9A 2QXGA 5HMAA 1BMMH 1C1TA 1O31A 1T8OA 3UNQA 1GHBG 5HIYA 5F03A 3ZV9A 4CBOA 1C1RA 5F8TA 1P8VC 3M5MA 3EA9A 1D3PB 1W7XH 2QA9E 1UCYE 2W3IA 3D49H 3RMOH 3RXJA 1N6YA 1KDQA 1KXEA 2GDEH 1QL8A 4BAMB 3H7TA 1PPHE 1GJ8B 1VITH 4IBLH 3A7TA 1Q31A 1HAGE 5DJ7A 5ESTE 1CQQA 1SGFA 1A3BH 3PLKA 1CU1A 4A1TA 4F49A 2J2UA 1O2MA 2KFWA 3K6YA 1BT7A 3E90B 3RXOA 2CGAA 1O3DA 4B75A 1YPKH 2AMPA 4X1NU 5T6DA 1HAOH 4RI0A 4CRFA 4X8UH 3M5LA 4AYYB 1P2KA 2AH4X 4K8BA 2FI3E 1BBRK 2CHAC 1UCYK 3GDVA 1UO6A 4UFEH 1O2SA 2ZGXH 2ZTZA 2PUXB 1YPGH 3PRDA 1TGSZ 1THPB 2F83A 2YNBA 1C5WB 1YM0A 2F9PA 3H7OA 1UVOA 3P8NA 4YOJA 3HKJB 2QY0B 3ZZBA 2BD5A 3TGJE 1DWDH 1OX1A 3BG8A 4Y8ZA 5C5OA 3KCGH 1QQ4A 3RXVA 3WW7A 2WUCA 1P9SA 5J4QA 5C1UA 1SL3A 1BOQA 3DSOA 1GBCA 4DW2U 2WV5A 3DHKH 3PMBB 1O2OA 1L4DA 2C8YB 1BTXA 1L0ZA 2W6JD 1GI3A 3UFAA 3KHVA 2AMDA 1KLJH 1LDTT 2CXVA 1FIWA 3GYMA 5GPIB 1UTLM 1WU1A 2XC0A 3HK6B 1GWAA 4ZKNU 3UQOA 3A80A 2SFAA 1E35B 2VGCC 4HTCH 1O3CA 1C9PA 1YPHE 1RGQA 1X7AC 2J34A 1RTLA 4NZLA 3UUZA 1PYTC 4H42U 2OK5A 5EW1H 1V3XA 1SBWA 5JBTA 2A5IA 1JBUH 1ETRH 3A82A 1E1RD 2XC4A 4Y76A 1O2LA 1DUEA 1GMCF 1P2QA 2V7QD 2GMTB 4HZHA 1IQEA 1ZMNA 3ITIA 1BHXB 1V2WT 2JH0D 1DY9A 1HFDA 3HKIB 1WTHD 4JZFH 1C1NA 2D8WA 3KGPA 2A4OA 1XUGA 1UHBB 2V3MA 4X1SU 1A1RA 4FUIA 1YLDA 4FU8A 4AFSA 2Z9GA 2GCTC 3SI3H 1VCQA 1YWUA 4ABAA 1N8OB 2Z3DA 3SV7A 2A2QH 1P2NA 2FMJA 3S9CA 2F9BH 2GX4A 1ELEE 1IQJA 2FTMA 2FS8A 1O5BB 3KQDA 2JDID 3F0PA 2WPDD 3MO3A 5EODA 2QF3A 3RC6A 4K2YA 1WYKA 4X2WA 1V2LT 4UONA 1GVLA 3SUEA 5AVDA 2VBCA 1P57B 3SV6A 1AB9B 2DE9A 2KM0A 3QK1A 3DFJA 5KECA 3F9EA 1O5EH 1O3LA 2GT8A 4DOQA 1J8AA 1W0JD 1WUNH 1RXPA 1T8NA 4BAOB 2PP6A 4FUJA 5AF9H 1Y5BT 3F2GA 8GCHG 1AFQB 1AKSB 3GDSA 3TK5A 5ABWA 1ABJH 5C5NA 2D1JA 5K7RA 1HUTH 4Z0KA 2GKVE 4TY7A 2UWOA 2ZEBA 1FX0B 1GI4A 1GVKB 1GGDB 1GJAB 3EDXB 4UFFH 1O2RA 1SGEE 1UCYH 3E3TA 1C2KA 1QA0A 1DM4B 2GP9B 1RRKA 3BTKE 1TRNA 3RXSA 1F92A 1GJBB 1GJ7B 1ZTKA 1SC8U 2O9QA 1AB9C 4XE4A 1C5UA 2BLWA 1BTYA 4O03A 4VGCC 1EAWA 4ASHA 3GICB 1JRTA 1C2IA 1GI7B 3QTOH 2G81E 3ZZCA 4FU9A 1FMGA 1TRYA 1MAYA 4RSPA 1GHZA 3SU6A 1ELVA 1ABIH 1GBDA 3W94A 2I6SA 1QQUA 5KGOA 1GJ4H 1QR3E 3RLWH 1XUKA 3VPKA 4ABEA 3BTFE 1DY8A 1GGDC 1L1NA 1Z8GA 3BG4C 2ZFSA 3ZVDA 3LGWA 5G4BA 1GMDF 1QJ6B 1BIOA 1AFEH 3VB5A 2WINI 1EFRD 3SN8A 2BQ6B 4NIVA 1KYNA 1HDTH 4DT7B 2JETB 3O8DA 2ZF0H 2OTVA 1SVPA 3M5OA 3W1EA 1QNJA 2JH5D 4Q7ZA 3Q3KA 3SUFA 2PKSC 2ANKH 1FXYA 4HGCA 4KP0A 3STIA 3FOAA 3ZZ7A 3TLOA 1INCA 2ZHWH 1OYQA 1XVOA 3EE7A 4RT0A 1OP8A 4BOHA 5F6MA 7GCHF 1LPKB 3AVZA 2ZDLA 1W8BH 2QE7D 3UR6A 2BB4A 3SYJA 5HXFA 2BD7A 2VU8E 3D62A 3PRBA 1P10A 2JETC 5K0HA 2BDHA 4AFUA 4Q4LA 1V6DA 2AGEX 1E37B 4DT4A 1O5DH 1CO7E 1C5SA 5FPSA 1CHGA 2BD4A 4NWLA 3URCA 4DCDA 4CR5A 3D65E 4KKDA 5TCCA 1TBQH 3PO1C 2EY4C 2CF9H 1L4ZA 4CRDA 3RM2H 5IDKA 1ACBE 1D3DB 4KELA 1VKYA 4AGJA 4J1YA 2G5VA 2P94A 3F68H 3UNRA 3SQHE 1BQYA 3RXMA 3W95A 1QHRB 2HPPH 1ANCA 2P93A 3LJOA 1GBKA 3BTWE 1NPMA 2Y5FA 4CH2B 2G55A 1G3CA 3SO3A 1A4WH 4P00A 1THRH 1H8ED 1ZTJA 4X6MA 1A7SA 2ZCHP 4JCNA 3OTPA 2W7SA 4A6LA 1C5YB 2UWPA 3M61U 4WH6A 3ZZ6A 3OAAD 3SV9A 2KR7A 1PPBH 2QXHA 4UEHH 2K8IA 2HWLB 1BMAA 1HYLA 3SQEE 1O38A 1O5FH 3MNCA 1HNEE 1O3PB 1BTWA 1EQ9A 1BJVA 1C5PA 2GTBA 3LGUA 4NIWA 2Y6TA 5AHGH 2V35A 1OKXA 2XBVA 2QXIA 1P2IA 2ZFPH 1O30A 2UWLA 3SNEA 5DP7A 4MPVA 5ESBA 1BBRE 4Z1MD 2RCEA 1FN8A 1F0UA 3OEED 5EW2H 1CT2E 2ZFFH 1QGFA 3ESTA 2Q6FA 2FEQH 3MU4A 8KME2 1EASA 4Y71A 1P0SH 1OHHD 2R9PA 1DOJA 1ELFA 1TQ0B 6CHAC 1TPSA 5T3HA 3KN2A 4NWKA 1J14A 2A31A 1GJ9B 1G3BA 1SGIB 1NFWA 2BD3A 1XM1A 4OS2A 2A4GA 1DITH 1C1QA 4LZ4B 5C0UA 1AN1E 3KQCA 5PTPA 4QT8C 2H5CA 1C1UH 1K1MA 3M37A 1KSNA 1ZJKA 1K1JA 2J5UA 1JIRA 1EPTA 1PQ5A 4U30A 2QN5T 3UTUH 2AFQB 5LPEA 5DGJA 2V6NA 3MU0A 2KCAA 2HNTC 4ISOA 1NZQH 3BTME 3UWJH 3SNDA 5EQRA 1NC6A 5FXLA 4ABHA 1FAKH 2PGQB 2UUKB 2OD3B 4ABDA 3VB7A 1NRSH 2R0KA 5GDSH 1H8HD 2P16A 3RXGA 2A7CA 2ZA5A 2H2ZA 4I8KA 3RXKA 3P70B 1BITA 2QC2A 1GMHG 2W3KA 1P03A 2ZCLP 1MTWA 1NFXA 1ZHRA 4AORA 2HVYB 2BDYA 3MWIU 2JJ2D 1O2IA 1O33A 2XBYA 5A0CA 2ZGCA 2ZDNA 1ETTH 3MNSA 5CHAC 1B0EA 3OY5U 4RKOB 2BZ6H 1SLUB 2FOFA 2BXUH 3M35A 2XNDD 4MNWA 1SOTA 4TPIZ 2TRMA 3SUGA 1OP2A 1P06A 2QF0A 2ZDMA 1YPEH 2H6MA 4Y8YA 1B0FA 3OSYA 1ZSLA 2LPRA 1AE8H 2F91A 1NY22 3SNBA 1P09A 5JB8S 1UMAH 1VCWA 2DUCA 5FCRA 1IQHA 1BA8B 2QXJA 4ZKSU 1VITF 3UOUA 1T8LA 1C5ZB 4IC5A 1EZUC 3DSPA 4Y6DA 1EAUA 1VJ9U 4TPYA 3OY6U 1F7ZA 2VVVA 1GBFA 3M3VA 3PB1E 4MG3A 4NGAH 1ZPCA 1ZSKA 5DPAA 2Y7ZA 3M36A 5GJ4B 3H5CB 4LK4A 1OOKB 4Q80A 1L1GA 3HGPA 1GBLA 1ZSJA 2WUBA 8LPRA 1CVWH 3SGBE 4P02A 3BTQE 2TGAA 1COWD 1SMFE 3A7ZA 3MH6A 2L6OA 5I46H 5CDFE 4B6FA 1ZJDA 3EA7A 1GHYH 4H6SB 4UE7H 2Z9IA 1C5NH 3ZZDA 1XUJA 2ZDKA 4CRAA 1HXEH 2RA3A 1B5GH 1C5MD 2QGRA 1AVXA 3MH7A 5EXNA 1V2RT 1O3BA 1DWBH 3F9HA 3SU5A 4KTSA 3CNRA 2FTLE 1NTPA 1LPZB 1ZMJA 4R0IA 4U2WA 2KCYA 1C5QA 3LH1A 4UFDH 5DP3A 1YYY1 1E1QD 3RXEA 1FQ3A 1LVMA 1V2JT 1DSTA 1YCPK 1W12U 4JYTA 1SQAA 3A89A 4XRNA 1C1MA 5FL7D 2ZECA 1EP6A 2UUFB 1O3FA 2XBWA 3SU0A 2IPQX 1V2VT 4GCHF 1S6LA 2VJ1A 3TH4H 1C4V2 2O8LA 1K1NA 1TX7A 2SGPE 5FPYA 3URDA 1T32A 4A92A 1EJNA 1GI6A 1A3EH 3LONA 1N6XA 2IJOB 3ENSB 2HVXA 4CBNA 1RJXB 1BTHH 1NT1A 5JPMH 1TPPA 1TMTH 4GHQA 2CHAB 1LVYA 1O2HA 5E0HA 2G52A 1OXGA 4CRBA 2K1QA 2FIRH 1BTUA 3ZZ4A 1EATA 2ULLA 4ISHH 4AB8A 2O8TA 3FO8D 1A61H 1CA8B 1YLCA 4GAWA 5HIZA 3TJOA 3VB3A 4CHAC 3S0NA 3GY2A 1KDQB 2GVFA 1AU8A 1E38B 1MUEB 1D9IA 1LVBA 4NFEA 1UK3A 4AOQA 3RMNH 4GVUA 3M7TA 3SU2A 2ZPSA 1TGTA 4D9QA 3PM3A 1EKBB 4TY6A 1MTNB 2JH6D 3TNTA 1F2SE 1MU8B 1BTZA 1GI5A 4K1SA 4YO9A 3OE7D 1SR5C 1UVSH 1GBBA 2BM2A 1MKWH 2Z9LA 5EIYA 1UK4A 2ZPRA 1KMHB 1ELAA 1SQRA 1SGDE 2VB0A 1O2YA 4X6NA 4DIIH 2F3CE 1DVAH 3QWCH 4JYVH 5DG6A 1EOJA 1RIWC 1VJAU 4UFGH 5EPNA 1ZPBA 2PSXA 3FP7E 1Z6EA 2GV6A 1XUFA 3CS7A 2ZHQH 1AVGH 1GVZA 2FX4A 2ASUB 3WWBA 7ESTE 1YKTA 2W26A 4I31A 4ZKRU 4WXVA 5DK1A 1FI8A 2OQUA 3A7VA 2ALPA 4IC6A 4A1VA 3QO6A 4E7RG 3MU8A 2FOCA 1CGIE 5C1YA 1PPGE 1WQVH 1F0RA 1ANBA 3F1SB 1K0HA 2BD8A 3QTVH 3SOSA 1TNIA 2BY9X 3GCTF 4XBCA 2NU3E 3TNSA 1RTFB 2AGIX 3O8RA 3O8CA 5A0BA 5EXMA 2LELA 2QV1A 1ESBA 5EGMA 2C4FH 1Y3YA 1TNHA 4NG9H 2V0BA 3RXLA 4X2VA 1EUFA 5T6GA 1O2NA 2SGDE 2FESH 3PROA 4X8VH 3PWCA 2A7HA 1LKBA 1UTMA 1O2VA 4B6EA 3A85A 5JBCS 1HAXB 2HLDD 4E05H 1QBOA 1MBMA 1Z71A 1QRXA 1IQMA 1Y5AT 4ABGA 1S81A 2BX3A 2ZTXA 3DFLA 4WMFA 1DX5M 4YESB 3BTEE 1AY6H 4WXIA 4CREA 1EPTC 1O39A 1QIXB 5GCHG 1PFXC 5GIBA 5KEDA 3GY3A 1Y5UT 1J17T 1XKAC 5JYIA 3LGVA 1W14U 1TGCA 4Y79A 3UY9A 1GL0E 2HLCA 3SNCA 1TX8A 5I25A 4R8TB 1U6QA 1GMCG 3UR9A 6GCHG 2WYJA 1KXCA 2FODA 1WOFA 2H1UA 2PFEA 3KL6A 2STBE 6LPRA 2CV3A 4DY7B 4KGAA 1UTJA 3CS0A 3UNSA 1DWCH 1GI2A 2OC0A 1DPOA 5DSFA 2WV4A 1H9HE 2EEKA 3M7UA 2ZC9H 3P8FA 3SHCH 1VGCC 2KCOA 3GY5A 5CE1A 2Z3EA 4I33A 3DD2H 1TA6A 3FP6E 2PLXA 2UUJB 1EX3A 4FUFA 1MTSA 1C2JA 5CHBA 1SI5H 5EPYA 4NIYA 1V2QT 1DT2A 1B7XB 3SUDA 5H4IB 2FX6A 1FN6A 3QUMP 4B71A 1A2CH 2L74A 1FPHH 1MCVA 3RXAA 2W5EA 3T2NA 3ZVFA
chains in the Genus database with same CATH topology
3SGQE 1P2MA 1WTGH 5A2MH 3SV8A 4YLUA 1AUJA 1KLIH 3ATMA 1EAIA 4ZUHA 2VWOA 2FOHA 3RXIA 1O5AB 1QJ1B 3E1XB 1SGQE 1HAVA 1Y3WA 1UVTH 2LNCA 3GCNA 2AEIH 3Q76A 1FZZA 2SNWA 2BMGB 3U8TH 1EZSC 1P2JA 1ZYOA 1QTFA 3HATH 2G51A 4RN6A 2H9TH 3IG6B 3ZVCA 2PW8H 2NU2E 1O2KA 1QBNA 3ATIA 3U8RH 1YCPM 1QY6A 3M3TA 2A7JA 1QL7A 2BLOA 5FCKA 3LGYA 1C2LA 1GJ5H 1XMNB 5E0JA 3K9XB 2BDBA 4MLFB 3A88A 3HGNA 3C27B 4OS6A 1YGCH 2WPLS 2HALA 1GBEA 2FOMB 4PROA 1YPJH 7LPRA 1S83A 2Q1JA 1SQOA 4IMQA 1LQEA 1MH0A 3U8OH 4A7IB 3E6PH 2D26C 4ZROA 1LMWB 2ZKSA 3BN9A 3LC3A 4CH8B 1Y3VA 1MD7A 1FIZA 1H4WA 5HM9A 1LHGH 4CR9A 3ZYEA 1DICA 1HJAB 3KNXA 3RU4E 3EQ0H 3FP8E 2OINA 3RC4A 1PQ7A 2VNTA 4O3TA 1TGNA 2ZZUH 3F9GA 1OWHA 2GZ7A 1CA0C 2B5TB 3ELAH 2FS9A 3BIUH 2XNIA 4FU7A 1O2UA 3PO1B 2SGQE 1MTVA 2F9VA 2PV9B 2FM2A 4BXSA 3BEFB 1S5SA 1TPOA 2ZU3A 2BHGA 1AHTH 3GY8A 6ESTA 4HFPB 3SGAE 4JK5A 1EB1H 3QZQA 4WMDA 4ISNA 1TNJA 1WV7H 2A0QB 1HPGA 1XXDA 1GHVH 2XCFA 1IHSH 4MTBA 4K1EA 4ISIH 2WPJS 3B9FH 1D3TB 4E06H 2VIDA 1TFXA 4NCYA 2FOBA 5F8ZA 1C1SA 2ZIQH 3RXDA 1QRWA 1HRTH 1O3MA 4ZKOU 3ZVAA 1O3OA 2HOBA 4I7YH 2AIPA 1BMLA 1HAVB 3SJKA 2Y82A 1JMOH 2IOTA 5EU8A 2Z9KA 3PMHB 5EOKA 3ZZ8A 5C3NA 2GV7A 3VB6A 1ZHPA 2ZQ2A 4O9VA 2FXRA 1O34A 4IW4E 1XKBC 1BZXE 1TB6H 3U69H 2ALVA 2A2XH 2SNVA 1SLWB 4AFQA 3OX7U 1FY3A 1ARCA 1G3EA 2TGTA 1YPLH 1GG6C 5A0AE 1E34B 1AMHA 2OXSA 2VIWA 5GXPA 1T31A 3B8JA 3TK6A 2BD9A 2ZFRH 1TMUH 3A87A 2FYRA 3NKKA 2YOLA 1KTSB 1TBRH 3VEQB 1ZGVA 3MNXA 5DP8A 1W2KH 9LPRA 1D3QB 1RD3B 2ZWLH 3TVJB 3SJOA 2ESTE 2OQ5A 4DIHH 2CJIA 4FVDA 4GUXA 5FBEA 4LXBH 2BY7X 1C1VH 2RDLA 2G4TA 4MQAA 1GBIA 3S7HB 3ZZ5A 1Y3UA 1NRRH 5GWZA 4SGBE 1BHXF 1GBHA 1AWFH 1ZMLA 1BRBE 2ODPA 2P95A 1AD8H 2VINA 1BRCE 1ZRKA 3EE0B 1KXBA 6GCHF 1NM6A 1TNLA 2PTCE 1MKXK 1UTOA 4NA8A 5EQQA 1DS2E 4D7GA 1QB1A 1TA2A 3MI4A 1GG6B 3G01A 1LO6A 1ELCA 2VWLA 3QZRA 1V2NT 4IN1A 1YBWA 3FZZA 3CENA 2XCNA 4I8JA 2D2DA 1K1PA 2P3TB 2A4QA 1P12E 2QYIA 1O2XA 5A09A 4YTAA 2ZHEH 2NU0E 5FX5A 1F5KU 3E0NB 1SSXA 3KQEA 2J38A 3NZIA 1UTKA 2QAAA 2C8XB 3TITA 1PPZA 4ABFA 1JRSA 3SBKA 1TONA 3VB4A 5L2YH 1AIXH 1ELTA 4YZUA 1C1PA 2G00A 1P11E 4YLQH 4Y0YE 2SGEE 3GOVB 3K2UA 1RFNA 2P8OC 2OUAA 2Y5GA 3SHAH 1QBVH 2PKSB 4BTTB 1KTTB 2P59A 1FDPA 1G36A 2OC7A 1Q3XA 2ZU5A 5FAHA 2VGCB 5ETXA 3PV4A 2ZCKP 4NA9H 2WPIS 4XOJA 4K8YA 1NN6A 4Y0ZE 2WYGA 3KIDU 3DT0H 1CGJE 2I6QA 1C2EA 1PPFE 3RLYH 1Z1IA 3A8DA 2THFB 2Z6BD 2GZ8A 2ZU1A 2Z9JA 1O3AA 4O97A 1IHTH 1Y3XA 1MQ5A 2FI4E 1CHOF 3DUXH 3T62A 4ABIA 3IITA 1JWTA 1KY9A 2ZO3H 3LGIA 4ZHLU 1GHAG 1J9CH 1GDNA 1MKWK 1ESAA 3K6ZA 1VR1H 3K65B 1GMDG 1WCZA 1XVMA 2NU1E 2EI6A 3C1KA 1A5IA 1QB6A 3RXFA 4OS7A 4X2YA 2HNTF 2OC8A 4Q7YA 4D7FA 1S6FA 1K1IA 1F5LA 4K60A 2HPQH 4AG2A 3ODDA 5L2ZH 3SJ8A 3E16B 1DFPA 3WY8A 1V2TT 3PMJA 4I8HA 4SGAE 1VITG 3ZZAA 3RDZA 4NSYA 2XW9A 5C67A 1V2MT 5JDUB 3GISB 1THSH 5FHTA 1UTPA 4XBBA 1EXFA 2GCHF 4Y8XA 1HBTH 1ELBA 4ZXXH 2J94A 4B2CA 3UPEA 1IQGA 1NU9A 3LDXH 2AIQA 3JZ2B 1DXPA 1C5VA 3RU4D 1KIGH 3RU4T 1MTUA 1SGRE 2OP9A 3BTTE 1F5RA 4AN7A 1TNGA 5B6OA 3NWUA 1N8OC 3NXPA 2RG3A 2GMTC 4B2AA 1UTQA 4IGDA 1GI9B 1OYTH 1FV9A 2Y81A 3T28A 5JB9S 4FXGH 1YCPH 2BDIA 1M9UA 3BTHE 3LKWA 1NFYA 2AMQA 3EGKH 2VH6A 1H8IH 4NA7A 4CHAB 1YPMH 1GCTC 1Z8JB 2J92A 1A5GH 1HV7A 1GCDA 4I8GA 1Z7KA 4MPWA 2EI7A 2BXTH 4CRCA 3RMLH 2XWAA 1O2JA 2XYAA 4B73A 4X1QU 1WAYB 5CMXH 1SFIA 1KXDA 2NU4E 3MH4A 1O2QA 3GYLB 2VIOA 1O32A 2TPIZ 4TWYA 2ZNKH 4MNXA 2NWNA 1YP9A 1P3EA 2VWNA 4TYDA 2ZU4A 1BJUA 5TJXA 1EZXC 3LPRA 4XFQA 3E8LA 1G32B 1T7CA 1JIMA 1O3EA 2VH0A 2XTTB 1OWEA 1ANEA 4AGKA 5E2PA 1A0JA 4O3UA 1OPHB 4XSKU 2EC9H 4X2XA 5E8EH 2Q6GA 4YM9A 1GBJA 5DP9A 2F9OA 2Y7XA 3Q00A 3A8CA 1O3JA 1O3GA 4ISLA 3SW2B 3V3MA 1GHBF 1DDJA 4ZH8A 4Y11E 1G3DA 1MZAA 3STJA 1EZQA 1P04A 3CP7A 1P2OA 1EB2A 2H9EH 4Z6AH 1QFKH 1FUJA 3ZV8A 1W11U 3TIUA 3LC5A 1W0ZU 1S0QA 1HB0B 2PGBB 2FZZA 1S6HA 2GT7A 2ZP0H 2BVSH 2ODYB 1TX6A 4MNYA 1C5OH 2BY6X 5FBIA 4F4OC 3GCOA 1HCGA 3A86A 3RM0H 4AX9H 3GY7A 3SU4A 5A8XA 1DSUA 4B76A 2VVCA 1HIAB 1NS3A 1TBZH 3QGNB 4BXWA 4I8LA 5JBBS 4H4FA 3KEEA 1ZPZA 2BY8X 3ATLA 3U98H 3NCLA 3OYPA 3BEUA 4FUDA 2FOAA 2ZFQH 3QX5H 3P8GA 5EQSA 1VCPA 3ZVBA 2A1DB 2GGVB 3BIVH 1YPHC 1IQKA 1HJAC 2J4IA 1TQ7B 1ELGA 1HAIH 1P9UA 3FFGA 3A81A 4WY3A 2OC1A 1LVOA 4Q2KA 3MFJA 1SG8B 2Y80A 4OS1A 4BANB 1FAXA 1K28D 1LHDH 1S84A 1GJ6A 3R3GB 3JZ1B 2F9NA 2BOKA 4JYUH 4LZ1H 4MPXA 3UREA 1NFUA 5DO4H 2ZGHA 4IS5A 2J9NA 3HPTB 2A5KA 1C5XB 2W7UA 1TGBA 1D6WA 4IN2A 2PSYA 2ZGJA 4MDSA 1SLVB 1BB0B 2KAIA 3NPSA 1WBGB 2C90B 3AW1A 1PYTD 2YNAA 2B8OH 1SGTA 1GPZA 1BDAA 1E0FD 1WSSH 1O3IA 3MHWU 3RP2A 3GCHC 2Z94A 5HGGA 4KTUA 5SGAE 1OWIA 2HRVA 1SGYE 1W13U 2WPMS 1Y8TA 2BLVA 1C9TA 2ZGBH 4A5TS 1C5LH 7GCHG 4THNH 3HK3B 1L1JA 2ZI2H 2M5TA 4JZIA 1G30B 2V3HH 4NIXA 3LJJA 5L30H 1KXFA 1O2TA 4X1RU 2XBXA 1BTPA 4RKJB 1GJCB 1H1BA 1LHFH 2R2MB 3SORA 3TU7H 1DLEA 1O5GH 1S85A 3E91A 1BMNH 1UHBA 3B23B 1FNIA 3SNAA 8ESTE 3A8AA 1Z8IB 2ZU2A 2DE8A 3A7YA 4FUCA 3ZZ3A 4AFZA 1HJ8A 4JMYA 3BSQA 3TPIZ 1C1OA 3QN7A 3KQBA 1C5RA 3A7WA 1AWHB 3P8OA 2VWMA 3TGIE 3V13A 4H6TA 1FY5A 3L6PA 1MTNC 2UUYA 5C20A 1ORFA 2O8UA 2FYQA 1XXFA 1SFQB 1P02A 2PKAB 1W0YH 2ZTYA 1SQTA 4OGXA 1GI8B 1S82A 2PWXA 1OWJA 1VGCB 4DGJA 1PPEE 2TGPZ 3TJNA 3SI4H 1HAPH 3V0XA 2ANMH 3M3SA 2VIPA 4JZEH 3SV2H 3ZVGA 5J4SA 5IYTA 1AGJA 3V12A 5C1XA 1QRZA 1K1LA 1RIWB 4JZ1A 1HAHH 1IQIA 1BRUP 2HGTH 3IWMA 3GCHB 1ZLRA 5LPRA 1GHWH 1DLKB 3MH5A 1V2KT 5L6NH 4U01A 1XX9A 1FY1A 4TWWA 3RXTA 2FWWA 3PMAB 2WPHS 3O8BA 3RXCA 1SGCA 1T8MA 4BTUB 3LOXA 4YOIA 1ZZZA 3UOPA 4NZQA 3NUMA 1LPGB 1OP0A 1SGNE 1F0SA 1S0RA 1FPCH 1GBAA 1O36A 2OBOA 1PPCE 4HI3A 3TK9A 3GY4A 1O2WA 4AZ2B 1C2MA 3GDUA 4Y7AA 5HYOA 4IMZA 1YF4A 1HAZB 3L3TA 3ATWA 3VGCB 2EI8A 3I29A 4VGCB 2ANWA 2XC5A 1AE5A 4YOGA 4DURA 3BF6H 2B9LA 1EP5A 1DANH 1MAXA 3M5NA 4BAHB 1NESE 2P3UB 4K5ZA 1O35A 4KTCA 5FX6A 1MU6B 3T29A 1W7GH 4U32A 3BTDE 1C2HA 4FUEA 1P05A 2PHBA 3FANA 1MMJN 9ESTA 3TH3H 1FY8E 1SLXB 3P92A 3SZNA 1C4U2 1EJAA 1FONA 2FO9A 2ZQ1A 8GCHF 4GPGA 4INKA 1LTOA 2FLBH 3GCTG 1ZHMA 2BQ7B 1C2GA 4FVBA 1WQSA 4X1PU 3NK8A 2R3UA 1Z1JA 1AVWA 5FPTA 1GI1A 3LH3A 1GDQA 1ETSH 1DXWA 2BDGA 4ZAEA 1AUTC 3RXQA 1N1LA 4ZHAA 4BNRA 3QLPH 4J2YB 1UVPA 2Y5HA 2XRCA 1CGHA 3EYDA 3EA8A 1TIOA 2C8ZB 1IQLA 4WMEA 3S9BA 1EJMA 1ZOMA 3GY6A 1CBWC 3VXFH 1CSOE 3VXEH 1BBRH 5BPEA 2O8MA 4UDWH 3AW0A 2Z7FE 5A8YA 3F9FA 1H8DH 1F0TA 1GCTB 2A5AA 3PYHA 4WWYA 1O3NA 1OSSA 3R0FA 3ZYDA 2GZ9A 2KAIB 1QA7A 2PUQH 1P01A 5DP6A 3RXUA 3S9AA 4ZMAH 3QGJA 1IOEA 5DKMA 4X6OA 1GJDB 1T4VH 2HNTE 4WJG2 4Q7XA 1JOUB 1V2ST 3V7TA 2VIVA 3PTNA 1AQ7A 2G5NA 1W10U 5EXLA 4D8NA 1SB1H 1GDUA 1O2ZA 1XUHA 1EPTB 4DJZB 2GD4B 1QJ7B 2XXLA 1A46H 1TPAE 1TABE 1MKXH 2PR3A 1UVUH 3PWBA 5A8ZA 4NFFA 3SJIA 2JKHA 4FUHA 1ID5H 3VFEA 2BVXH 4AB9A 2TIOA 2ZPQA 3Q3YA 2FI5E 1LHCH 1NROH 4D9RA 1EOLA 1SGPE 1C1WH 1HGTH 1ZTLA 5AFYH 2A45B 2IPHA 1O2PA 4Y10E 4MNVA 1ELDE 1EAXA 2BD2A 2C8WB 4LOYH 2ZDVH 3S69A 4K1TA 1L2EA 2GCTB 2VIQA 4BTIB 1DUAA 2BY5X 4ZXYH 1IAUA 2FOEA 4OS4A 1RS0A 2IN2A 3A8BA 1HIAA 2BQWB 1UK2A 2CN0H 1BUIA 1DE7H 1GBMA 1CBWB 4WH8A 3U9AH 4GLYA 2QIQA 3T25A 3MOCA 3OTJE 1TYNA 3LU9B 2V3OH 5EG4A 3BG4B 3Q3XA 2CMYA 4GCHG 1GMHF 3AAUA 3FAOA 5C2ZA 3ATKA 4INLA 1K9OE 4MVNA 2ZDAH 3MNBA 3PLBA 1IQFA 5E2OA 2QCYA 2G8TA 1AFQC 1AZ8A 1O2GH 1SGFG 3TJUA 1CT4E 1D4PB 2R2WU 4B74A 1LHEH 1LKAA 4OS5A 1AZZA 3M7QA 1SHHB 1GHAF 2BX4A 4NSVA 1ZGIA 2B0FA 2WPKS 1AKSA 1KLTA 4I32A 3UIRA 1QURH 3LGTA 3SU1A 3T5FH 1VZQH 2OBQA 2H9HA 2TGDA 3TH2H 2OLGA 2BDCA 4DVAU 4MPUA 3N7OA 1QB9A 1FLEE 1SPJA 4FUGA 4B1TA 4CRGA 1V2OT 1TWXB 1ZRBA 2H5DA 3P17H 2ZHDA 2ILNA 5BRRE 3I78A 4AYVB 2EA3A 3MYWA 2FPZA 2PTNA 3QDZB 1O5CB 2F9UA 2PKAA 2XWBI 2SGFE 4Y7BA 3TJVA 2BZAA 1NRNH 1KXAA 1SOZA 2FP7B 4WVPE 3L33A 1TALA 2R0LA 3E0PB 4K69A 3MU5A 1GL1A 1P3CA 1AI8H 1QL9A 1TLDA 4YT6H 4GHTA 6CHAB 1G9IE 2Z3CA 3A83A 3RXRA 3A84A 2RA0A 1TOCB 2ODQA 1G37A 2J95A 1NU7B 1JXPA 3MO9A 4E7NA 2AERH 3RC5A 2ZHFH 3ZVEA 1CE5A 3TGKE 3BTGE 2FOGA 3MMGA 3A7XA 1J15A 1LQDB 1AO5A 1UTNA 2C93B 2BTCE 1O3HA 2ANYA 3VGCC 5DP5A 3SJ9A 3OU0A 3PLP