1K1LA

Bovine trypsin-inhibitor complex
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
223
structure length
223
Chain Sequence
b'IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TRYPSIN
publication title Factorising ligand affinity: a combined thermodynamic and crystallographic study of trypsin and thrombin inhibition.
pubmed doi rcsb
molecule tags Hydrolase
total genus 53
structure length 223
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 2001-09-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1k1lA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1k1lA02
3R0FA 3ZZ4A 2FI3E 2Z9LA 2R0KA 1HLTH 1GHBG 2Z3CA 3RXQA 1BTHH 1SHYA 1UTKA 1DXWA 1J15A 2ZHQH 1LO6A 1LVOA 2Z9IA 1A0JA 2W3KA 4O3UA 2P3TB 4WMDA 1A4WH 1UTJA 1GHVH 3BTTE 4FUCA 1NU9A 2A2QH 1CO7E 1EZSC 3UR9A 2FDAA 3F1SB 1EAUA 1GBAA 3H7OA 5LH8A 1TGTA 1ZR0A 1OP8A 2JH6D 2BYAX 5LPEA 2GDDA 1HAOH 1BJUA 1QJ6B 5BRRE 4KKDA 3PWBA 1GMDF 4IMQA 4MPUA 3RXEA 1P09A 1EB1H 2ZDMA 1VJAU 1BMAA 4X6NA 3SUDA 3LPRA 1TLDA 1E36B 3QGNB 4Y7AA 5SGAE 1AVXA 1C5ZB 5EXMA 1BRBE 1LPKB 1XUFA 1AMHA 3Q76A 2OINA 1FMGA 1C5SA 1XX9A 3W95A 1T8OA 3WY8A 2DUCA 1QCPA 1BCUH 1L4DA 2EI6A 5C1XA 1WQSA 2V6NA 3HATH 3QWCH 2PFEA 1C5MD 3QDZB 2Y80A 4X6PA 3VB5A 1O5DH 1P9UA 2VWMA 3MMGA 5GCHF 3STJA 1CT4E 1FIZA 1IOEA 3RC5A 5LGOA 2STBE 1QGFA 2CXVA 1OWJA 1Y59T 1K21H 3PROA 3SV7A 1C1PA 2OLGA 4B2CA 1UCYK 1ZSKA 3GYLB 3LJOA 4K1SA 6GCHF 1TX7A 1WCZA 4X6MA 3RXVA 1K1MA 4F49A 3T2NA 3HK3B 1P2IA 4FUHA 1EX3A 3OU0A 1MAXA 1B5GH 1V2OT 2ZGXH 2BXUH 4I8KA 1SHHB 3O8DA 3RXTA 3OYPA 1MU6B 1W11U 2Y7ZA 3SI3H 3KN2A 3QTOH 3TH2H 1CVWH 1G32B 4DGJA 1YPMH 1C5PA 1RRKA 5K7RA 2F9UA 3A7VA 3MHWU 1IQLA 1GJ4H 2RDLA 1KYNA 4KGAA 1QB1A 3RXJA 4O3TA 4NSYA 2J95A 3R3GB 1N8OB 3A81A 1SGIB 1GHXH 1G3EA 1CA0B 1KXEA 3SN8A 2F9PA 4TY6A 3ZZ9A 1GBIA 2RA3A 1K2I1 1A1RA 2I6SA 1UTNA 2BDYA 3GICB 4UFEH 3FZZA 1K1OA 1NRNH 1TX8A 2C90B 1VCWA 2NWNA 1IQHA 3E0NB 1CHGA 1LVBA 4Q2KA 1HFDA 1W7GH 5EW2H 2PTNA 4B71A 3I29A 3GY4A 3ATLA 2ZA5A 4Y8ZA 3RU4D 3AVZA 1ZTJA 1RTLA 1MUEB 2AGIX 1CE5A 1Z8IB 2D8WA 1ANEA 1GJAB 2P59A 1G36A 1YPHE 2XW9A 2ZC9H 1PQ8A 2UUKB 3F9EA 3ODDA 4NA7A 1WYKA 3K9XB 1O2JA 1B0FA 4XFQA 1FDPA 1X7AC 1A0LA 1ZRBA 2CMYA 1GJBB 1NM6A 1GL1A 1P0SH 4GVUA 3VGCC 1K28D 2K1QA 1S85A 1GI5A 4Y0YE 5C67A 1WOFA 1LVMA 4ABIA 1OWHA 3P8OA 1EJAA 3U8OH 2W3IA 4GLYA 4BXSA 1Y3YA 2BDIA 1O33A 3OSYA 2RCEA 2FOMB 3P70B 4A6LA 1GI7B 1HDTH 1W7XH 3EGKH 1BRAA 2FYRA 2GCTC 1O39A 2G4TA 4BTTB 5EU8A 3S9BA 2R2MB 3Q3YA 3DA9B 5DO4H 2OBOA 5DP6A 1ZLRA 1N6YA 1LHCH 1ANCA 4YT7H 5T6GA 1ZGIA 4K8BA 1FPHH 4ZXYH 1O2UA 1Q2WA 2A2XH 1BTZA 1V2VT 2BD5A 4DOQA 1V2UT 2GCHF 2O8TA 2A45B 4DW2U 1TRYA 2C3SA 1TOCB 3PMBB 4JMYA 1XUGA 1C5QA 1AFQB 3SU6A 1QNJA 1ETSH 3RXLA 2J94A 1GBLA 1ZPCA 1FIWA 7ESTE 2ESTE 2G00A 4XBBA 1FZZA 2W26A 1SFQB 2IN2A 4B1TA 2YNBA 1SGNE 2GKVE 1GGDB 1AI8H 3EQ0H 1PPHE 2PR3A 3TGIE 1FQ3A 1GJ9B 3LOXA 1O35A 2ANMH 1Y5AT 2Q6FA 1A2CH 1YPKH 4TY7A 5BPEA 1OPHB 1A5GH 1NESE 3ZZ7A 1P2QA 3EDXB 3E0PB 1UK3A 1KTSB 1Z71A 4NZQA 1BTPA 2AGEX 3GCOA 3L33A 3UPEA 4AFUA 4ZXXH 2WYGA 4GCHF 4AN7A 2BXTH 2EA3A 3FANA 1O3HA 2WPJS 3B8JA 1DUAA 1QIXB 4I8LA 1TNHA 3LH3A 3TGJE 2GTBA 1OYQA 2UUYA 1FY8E 3MH5A 1PPGE 2ZU1A 1XXFA 4MNYA 1C4Y2 2ZFRH 5JDUB 1K1PA 1VITG 5EODA 1FN6A 1W14U 1UTMA 1PYTC 1AKSA 1ELFA 1ZHMA 2BOKA 2WPIS 5CHAB 4X2YA 1O2MA 3ZYDA 1MBQA 1UHBA 3RLWH 6CHAC 1A5IA 1LCYA 2VNTA 1AWFH 3E16B 1O3LA 1QQUA 4AG2A 2NU4E 1C1VH 3BF6H 2A7JA 5F8ZA 4UFFH 4NFEA 1KXFA 1ZHPA 1C1NA 2HNTC 1DICA 1GBBA 2ASUB 3KQCA 1V2QT 3AASA 1THSH 1MKXH 3RM2H 1RXPA 3QK1A 4B2AA 2XTTB 1NN6A 3HGPA 3MFJA 3RXSA 4WJG2 1BHXF 2AIQA 1SGYE 3D65E 1UTOA 5DGJA 1ZOMA 2ZGHA 1O2YA 2BD2A 4ABAA 1RIWC 2SNWA 3SV6A 1HGTH 1V2WT 1O2XA 3BTME 1OXGA 3TJUA 3MH7A 4ZUHA 1IQGA 3PM3A 2FS9A 8LPRA 4LOYH 2XCFA 4BNRA 1TRNA 4I33A 2H5DA 3SUEA 1ABIH 4U2WA 3TPIZ 3CS0A 2Y5FA 1C5RA 1S84A 1QB9A 1ZHRA 1EATA 2ZCHP 2R3YA 3NWUA 4X1QU 2SGDE 3KNXA 1ZMLA 4TPYA 2FESH 4JCNA 3ITIA 1ETRH 2R3UA 3G01A 1UVUH 3M35A 4ABDA 5I25A 1DDJA 3PWCA 3MH4A 2HOBA 2V3OH 4GSOA 2GZ7A 2JKHA 1MTNB 4YM9A 3KHVA 1AE5A 2ZTXA 5EPNA 5FBIA 1P10A 1ZZZA 1ZPBA 1Z6JH 2PGQB 1QTFA 3VXEH 1S6HA 2UUFB 4SGBE 1H8IH 1ARBA 1W10U 2FODA 1F7ZA 2ZFFH 3PTNA 3UNQA 3GDUA 2XWBI 2FEQH 1LKBA 1FLEE 2BDBA 3ATIA 3K6YA 2PKSB 2XBXA 4MTBA 4CH2B 4CHAB 1CA8B 2BVRH 2J38A 1UMAH 3A7WA 1BMMH 2FYQA 2OC8A 3ZV9A 2C4FH 3BG8A 4DT7B 2W7UA 8GCHF 2H9TH 2ZTZA 3SU3A 2SFAA 3RMMH 1G9IE 2ZQ1A 3UNRA 1BHXB 3UREA 3D62A 1SQAA 1P05A 4XSKU 1Z1JA 1E35B 5FX6A 3CS7A 5EW1H 1VGCC 2AS9A 2ZHWH 1C2HA 2BVSH 1O3DA 3PO1B 2ILNA 5ABWA 1B7XB 1CT0E 4ASHA 1F5KU 4WH6A 3GY2A 2Z3DA 3MWIU 4MNWA 1JIMA 2SGPE 1ZJKA 4FVBA 1TE0A 2A4RA 9LPRA 1SI5H 5HGGA 4XBDA 1H8DH 1O3JA 2BVXH 2BDHA 5GIBA 9ESTA 1BTUA 4AB9A 2WV4A 1GJ8B 1W8BH 1SGFG 1O2HA 3V12A 5A8YA 5EG4A 3ATMA 3D49H 4IGDA 3GDSA 3MNSA 1WV7H 3MU0A 1EJMA 5GDSH 5T6DA 1MQ6A 3TH3H 3SNCA 2GV7A 3UOUA 1ELAA 4JK6A 3KQBA 1MKWH 1TYNA 1YF4A 2BQ6B 4FUIA 1OWKA 4CH8B 2R2WU 2SGFE 8ESTE 5IYTA 3QTVH 3S9CA 5E0GA 5L30H 4HI3A 1VZQH 2QYIA 1K1JA 1C2IA 1Y5UT 3GY6A 3M3SA 3E6PH 1ZTKA 1TPSA 1ZSJA 3LC3A 3ZVAA 3A8AA 4CRCA 2GMTB 3TK5A 1NFYA 5FXLA 4MPXA 4MG3A 1C5WB 2ZG0H 3LC5A 3SZNA 2XXLA 7GCHF 1D3DB 1DSTA 2GVFA 3LGYA 2PHBA 5PTPA 1YCPH 1P2JA 4LZ4B 5JPMH 4OGXA 4FU9A 4K8YA 2C8ZB 2VIQA 1V2RT 3GCTF 1WUNH 1TBZH 5HMAA 3MU5A 4INHA 3SNDA 2WINI 1AHTH 1EAWA 2O8LA 4X1SU 3QLPH 1ZMJA 4SGAE 2TPIZ 1ZRKA 4BOHA 3ZZBA 1A61H 2QXIA 1H1BA 4XBCA 2BDGA 4MVNA 1S6FA 2ANKH 1O3IA 3NUMA 3TITA 2HRVA 3RC6A 1O5FH 2BY5X 5E8EH 2UWLA 4K3JA 1BTWA 2A4GA 2FX4A 1Y3UA 1HV7A 3K65B 2WPKS 1W12U 1UJ1A 1G30B 1B0EA 5EGMA 3DT0H 1GBMA 4OS6A 3SU2A 3A8DA 1OP0A 1P2NA 3BN9A 2XC5A 1NFUA 1O3CA 1BBRH 2PGBB 2WPLS 1ETTH 2ZDVH 1QJ7B 1LVYA 2HGTH 3STIA 3SV2H 3SQEE 3SGAE 4AX9H 4JYVH 4CR5A 4CRBA 6ESTA 1UK4A 2JH0D 3V0XA 5C2ZA 4DVAU 2AMDA 1CGIE 4B73A 3M61U 2QIQA 2ZHFH 3E91A 3LDXH 2GGVB 1C2KA 4WY3A 1DXPA 5DP7A 1DWCH 4X8UH 1MBMA 4FUFA 1CHOF 1T4VH 2FS8A 3EAJA 3RMOH 1IQIA 1HXEH 1KIGH 1O2ZA 3NXPA 1SLWB 1S0QA 2VWOA 2ZDAH 3S7KB 1BOQA 2VU8E 2W7SA 2GP9B 2OD3B 1Z8JB 1JOUB 3UTUH 2UUJB 2ALVA 4ISIH 2J9NA 1OWEA 2EI8A 1AKSB 1BBRE 4AFZA 1HRTH 2VB0A 3BG4B 4R8TB 2BTCE 1YLDA 3FZDA 1NS3A 3T25A 3RXPA 4HGCA 3PYHA 3UOPA 1C1SA 1C2JA 4CBNA 6LPRA 4I7YH 3E90B 5HXFA 1UHBB 2P8OB 5TCCA 3P8NA 1V2NT 2D2DA 1C1QA 2XBVA 1O2WA 4WXVA 4X1NU 4I8JA 5A09A 4NSVA 5A8XA 1GJ7B 1ANBA 1GHAG 1H9IE 3E3TA 3SUGA 3Q3XA 4RKJB 1XUJA 2QGRA 2M5TA 4FUJA 5HYOA 3QZRA 1IQFA 1TNGA 3BEUA 4E06H 4MNVA 2VH0A 2VVVA 1W3CA 2SGQE 4OS1A 1YKTA 3H5CB 1QL7A 1SGDE 2BOHB 5F03A 3P92A 1SVPA 4TYDA 1GWAA 5FPYA 1KDQA 1TMBH 1TNIA 2SGAA 3FP6E 3EA8A 2VIWA 5JBCS 3VB4A 5FCRA 3SJ8A 2ODQA 1J9CH 1O2TA 1WTHD 1FY3A 1XKBC 2F9NA 5DP5A 1ACBE 1D3PB 1OSSA 3IG6B 3Q3KA 2BLOA 3P95A 3M36A 1VJ9U 2Y7XA 1QJ1B 3NKKA 4YOIA 4Q7XA 2ZNKH 4JZFH 4ABHA 1SSXA 1NRRH 4NZLA 3RXUA 1G3DA 2VGCB 1C1WH 2TGAA 1OWDA 1T8LA 5CMXH 3TGKE 5HM2A 1FN8A 2O8MA 4X2XA 3UQOA 1HAHH 1AVWA 1GI4A 4O97A 2LNCA 3V7TA 2HVXA 3OTJE 3KCGH 1IQEA 1F0SA 5DKMA 2P93A 1AU8A 1QQ4A 4O9VA 2F9BH 3U98H 3RP2A 1PYTD 3VGCB 3SNAA 3LT3A 1XKAC 2FIRH 2H5CA 1GJ5H 3TVJB 1GI6A 1YGCH 4IN1A 1JXPA 3LJJA 2DE8A 1BQYA 2OUAA 1O30A 4D7FA 1O5BB 2VJ1A 1HJAB 4Y76A 1DWEH 1DLEA 1GDUA 5T3HA 1LHEH 3SORA 2VIDA 1UTPA 1DM4B 3EE0B 3RXHA 3SBKA 1HBTH 1TNLA 1SPJA 2KAIA 3A88A 2A5AA 2OQ5A 1GMHG 1GI8B 1LHGH 2QCYA 4B74A 5GXPA 2PW8H 2A32A 5B6OA 2GD4B 1Y8TA 3GCNA 3HKIB 1TX6A 1T4UH 1ESAA 1TQ0B 2CJIA 4ZKRU 2ZKSA 3P8GA 2WPMS 1IHSH 2A7HA 3EA7A 4J2YB 1AQ7A 2B0FA 1EPTC 1W0YH 2G51A 2G5NA 1ANDA 2BY8X 3M5OA 3MU8A 3ZVCA 2HLCA 2HNTF 2OBQA 4AORA 1G3BA 1Z1IA 5C1UA 4NG9H 3RUOA 1SLUB 3ESTA 1EOJA 1EQ9A 1L2EA 1YC0A 1XUKA 1AFEH 3W94A 3BIVH 1TOMH 5G4BA 2AMQA 2G55A 3BTFE 3UR6A 1ELGA 4INLA 1PPEE 5EXLA 1SGFA 2F3CE 2BY7X 4LZ1H 3ELAH 1MD8A 2AERH 2TIOA 1JWTA 2BY9X 2GT8A 1O2RA 3LGUA 3DFJA 1TNKA 3IITA 3GCHB 3I77A 3Q00A 2QXJA 2QN5T 1SBWA 3HKJB 2HWLB 1BRUP 2ZWLH 2BMGB 5E2PA 1HB0B 1YCPK 3RU4T 1P2MA 1P2KA 1HAPH 4TWWA 2IOTA 3T26A 1O2NA 2F83A 2AGGX 5GPIB 2ZI2H 3M3VA 3SJKA 4NWKA 1KXCA 2XC0A 1ARCA 4Y71A 4E05H 3V13A 3SUFA 5T6FA 2WUBA 1TMTH 2YOLA 1XM1A 1MMJN 1QB6A 6CHAB 1V2LT 3O8BA 4ISOA 4JZEH 1WQVH 1AIXH 1F5RA 1W0ZU 2AEIH 4YOJA 2NU0E 1AZZA 3VB7A 3A84A 4JZDH 1VITF 1RTFB 4NIXA 1AO5A 1JRSA 5C20A 2Q6GA 1OYTH 1A3BH 2QAAA 5TCAA 1MTSA 1RFNA 3F9HA 3A85A 3MNXA 2JETB 5C1YA 2Z9GA 1BIOA 4YZUA 1VCQA 2WYJA 4IS5A 1HYLA 4UE7H 1DOJA 1O2LA 3TJNA 4ISNA 4GUXA 3UY9A 1T32A 1TALA 4XOJA 3BEIB 1QRWA 5EQQA 3NPSA 1UTQA 3S9AA 4NFFA 2O8WA 2B9LA 4ABEA 3DD2H 1C5UA 3BV9B 5L2ZH 2SNVA 1ELDE 3KL6A 1P9SA 1GG6B 4I8GA 3SOSA 4KELA 1CSOE 1MCTA 1P8VC 2THFB 1DLKB 4DIIH 3BIUH 1O3GA 4FUDA 4A1XA 3NZIA 3KQEA 2Y5GA 3LGVA 3BTDE 1JBUH 1NY22 2B7DH 1HXFH 2FOCA 4K5ZA 5FAHA 2LPRA 1AUTC 1AWHB 1RJXB 2PLXA 2ZGCA 5A8ZA 2XC4A 3A82A 2UWPA 1S83A 2QY0B 2F9OA 1MZAA 1WBGB 3OY5U 4A7IB 4BTIB 3A7TA 4K2YA 4GAWA 4DG4A 3CENA 1O2VA 1GI9B 1BMLA 4J1YA 1UCYH 2PWXA 4KTSA 2AFQB 1OS8A 5DG6A 3I78A 1C2DA 1GCTC 3H7TA 1P57B 1G2MA 4DJZB 1O36A 3AAVA 2J2UA 1SGTA 2ZU5A 5JB9S 2VIVA 2G81E 2SGEE 1F92A 1BT7A 1PQ7A 3PLBA 2BM2A 2C93B 3M7QA 3RXGA 2QF0A 1OOKB 1KDQB 2ZU3A 4AFQA 1EXFA 2GX4A 3RDZA 1MQ5A 1S82A 4Z6AH 1TFXA 3U8TH 5J4QA 3SV9A 4YLUA 4VGCC 3MNBA 3NCLA 4D7GA 2Q6DA 1Y3WA 5AFZH 1K9OE 3A87A 3T28A 4JYTA 1NRQH 1BZXE 2TGTA 1AB9C 1L1JA 4ZKNU 2A31A 2BD4A 3RXIA 3A89A 1CGHA 1PPBH 4H4FA 1EPTA 1UCYE 2CF9H 2BB4A 1C2GA 4HZHA 1O5GH 3P6ZB 1YPLH 1YCPM 1W13U 2P16A 2FWWA 3P17H 3RLYH 3DHKH 1QBVH 5JBAS 3LGWA 1DITH 2BLQA 3ATWA 3QX5H 4DCDA 1SLXB 1HIAA 3HPTB 5AHGH 1KXDA 1QHRB 2ODYB 3TK9A 1GHWH 3UWJH 1D4PB 2R0LA 2RA0A 1QY6A 2PSXA 5DP3A 4UEHH 1UO6A 4RN6A 2GV6A 2Z7FE 3TJVA 1LHFH 1GMCF 1C9TA 4U30A 3RMNH 3O8CA 1CU1A 4TWYA 1TQ7B 1GBHA 1C9PA 2BD7A 1GJDB 2KAIB 1NRSH 2A4QA 2ZPRA 1FV9A 4U01A 2A0QB 4AYYB 1FNIA 2H9HA 3FP8E 1Z7KA 1JIRA 2D26C 1D3QB 4CHAC 4RKOB 3HGNA 4AB8A 1W2KH 1O2OA 4DY7B 1ORFA 1TA6A 2NU1E 3C27B 1IQNA 3SU0A 2TGDA 4NA8A 3DFLA 2CHAB 1QURH 2Z6BD 4BTUB 1O3BA 4FUGA 1CBWC 2J92A 1HAXB 2XRCA 3MO9A 1O3NA 2BDCA 2Z9KA 1G2LA 2IJOB 4YLQH 1CQQA 1EOLA 1K22H 1LKAA 3PO1C 1ZTLA 2J4IA 1FAKH 1FY4A 2B8OH 3TNTA 4X6OA 1O38A 1PQAA 4D8NA 2OC0A 2AH4X 2ZCLP 1LQEA 2PSYA 4KTUA 3SO3A 1TAWA 2BX3A 2FOEA 1TONA 2BZAA 2FZZA 3GDVA 3ZZDA 1K1NA 5E0HA 1O32A 3GY3A 3V3MA 2O9QA 2GDEH 1EB2A 1HPGA 1WAYB 3ZVDA 3RXBA 3U1JB 4YTAA 5FPSA 1S0RA 1YPJH 3S69A 3SJOA 3QZQA 3RXRA 4ABJA 4UDWH 3UUZA 1H9LB 2ALPA 3S0NA 1ID5H 3VB6A 5E2OA 7KMEH 1C1UH 1FXYA 1J14A 1DSUA 3BTWE 2FM2A 3LU9B 1ZJDA 2FLBH 8KME2 5C5NA 4KTCA 1TGCA 3SHAH 1H4WA 3GCTG 2PTCE 3JZ1B 4MDSA 2Z94A 2PV9B 1V2KT 1MD7A 4X2VA 1YPGH 4ESTE 1FAXA 1TGNA 1BDAA 1WU1A 4D76A 1GDQA 1RTKA 2GMTC 1GJ6A 5IDKA 2BD9A 1HAVA 3ZZ5A 1MZDA 1GHBF 1TMUH 1YBWA 2H9EH 5F8XA 2FXRA 5K0HA 3Q77A 4IC6A 4ABBA 3LONA 4K1TA 1QFKH 3RXDA 1L1NA 1HUTH 1HCGA 1SR5C 3O8RA 3B9FH 2ZFQH 1N1LA 1EZXC 4OS2A 5JBBS 3PMAB 3FP7E 3KQDA 1C5YB 2VH6A 1UVSH 3KGPA 3PTBA 2P94A 2HPPH 1P04A 4NWLA 3SJIA 2XNIA 1ABJH 1IQKA 3ZZ6A 4BAHB 1MCVA 1O3EA 4JZ1A 1GI3A 4AZ2B 1BMNH 4HTCH 3A83A 3A7ZA 4WWYA 1BJVA 1MTWA 1Y3VA 1ELCA 3A86A 4IMZA 1O2QA 5DP8A 1AZ8A 1GHAF 1GL0E 1V2TT 4B76A 5ETXA 3SHCH 4Y0ZE 1MAYA 1N6XA 1V2JT 2EI7A 2ZDLA 4AFSA 1BRCE 4WXIA 2CN0H 4UFGH 1CHOG 1Q3XA 1EP6A 3U9AH 2FP7B 1LPGB 2Z9JA 1C4U2 1DE7H 1F5LA 1KLTA 3PLPA 3VPKA 4NGAH 1SQOA 2PUXB 3OY6U 5DPAA 3SU4A 1LPZB 2XWAA 1ZPZA 2G4UA 4AGKA 3K6ZA 2AYWA 3BTEE 1F2SE 1Z8RA 4ZHAA 2VIPA 3KIDU 1HJ8A 5FCKA 3TJOA 3UWIA 2QV1A 1GHYH 1GMDG 2EEKA 4IC5A 1MKXK 3BSQA 2G52A 1TPAE 2H1UA 4MNXA 4O03A 1KY9A 4M7GA 3PMHB 4Y7BA 5JYIA 1Q31A 3URDA 3F68H 1SOTA 1O34A 2V3HH 3GYMA 3LGIA 1BA8B 1QBOA 1TNJA 1UVOA 1OP2A 1P12E 3KF2A 1C5LH 4X8TH 1K1LA 1Y5BT 3E1XB 1AD8H 2ZPSA 1FY1A 1GVKB 3FVFB 1AGJA 1SC8U 1YLCA 3ODFA 5GJ4B 4CR9A 5C3NA 1C2FA 4TPIZ 3BG4C 2J34A 2FPZA 1C2EA 1NT1A 1VCPA 3B23B 4WVPE 1P3EA 4E7RG 4AG1A 4BAKB 1EZUC 1Y3XA 1J16A 4UONA 2P8OC 2H2ZA 1D6WA 3PB1E 3QN7A 4PROA 1DS2E 1CT2E 5GCHG 3SNBA 7LPRA 4UD9H 5A0AE 1NO9H 2NU3E 1HAIH 3T62A 1GBTA 4OS5A 2FOAA 4H6SB 4CREA 1HAGE 6GCHG 4ISLA 1SMFE 2BHGA 4GHTA 1FJSA 1QA7A 5EOKA 4LK4A 2PKAA 3AW1A 1UVPA 3A8CA 4RSPA 5HM9A 3ZVEA 3FFGA 2FX6A 3EYDA 4CRFA 1O3FA 4Y8YA 3K2UA 4A1VA 3LKWA 2GZ9A 1K1IA 5F8TA 1EPTB 2ZZUH 2WUCA 2CF8H 1O2IA 3RMLH 3RXOA 2OC1A 1EUFA 2P95A 1GMHF 1C1MA 1NTPA 2ZF0H 1QR3E 1C2LA 4OGYA 2FOBA 1M9UA 2GCTB 1CGJE 3RXMA 1TB6H 1YPEH 1GBFA 1HIAB 1GDNA 1GBCA 1GVZA 2FOHA 4IW4E 3ZVFA 1AY6H 3ZZCA 2VGCC 4B2BA 1E37B 1GBDA 3SU5A 4K60A 2RG3A 1UK2A 2FTLE 4WF8A 1N8OC 3LGTA 1HJ9A 1CA0C 1BTYA 1FONA 3SU1A 5L6NH 2FI4E 2VVUA 1O2KA 1MTVA 3PLKA 2BDAA 4I32A 1A46H 1V2PT 1V6DA 2FMJA 5EXNA 4NIVA 1IHTH 1HAYB 1O3KA 3QGJA 4I31A 1KXAA 1OKXA 1O3AA 4YESB 3PV4A 1ELEE 1WSSH 4BXWA 1RS0A 1F0UA 1TA2A 5DJ7A 2ZECA 1MKWK 2XCNA 1SGQE 4MLFB 1MU8B 1ZMNA 4Y8XA 3RC4A 5DP9A 1HJAC 1XXDA 1J8AA 3FAOA 2C8WB 4Q7YA 3BTGE 3AW0A 2FI5E 2BZ6H 3HK6B 3ENSB 4Y11E 2I6QA 3SV8A 1INCA 1O5EH 1XVOA 2EC9H 2C8YB 1ZGVA 3SGQE 5EPYA 2XYAA 1Z8GA 3A7XA 4ZAEA 1TWXB 3SI4H 1ESTA 1C5OH 4X2WA 1LDTT 4UFDH 4YO9A 4GPGA 2FTMA 3EA9A 4WH8A 3NK8A 4IBLH 3BEFB 4ZMAH 1O31A 3URCA 4OS4A 3BTHE 3PMJA 4U32A 1EKBB 4Q7ZA 1MH0A 4Q80A 4AGJA 2TBSA 1GJCB 4K69A 2QF3A 4JZIA 3IWMA 5FPTA 1GI0A 2F91A 4ZKSU 4NIYA 1YYY1 2A4OA 2ZEBA 3U8RH 4BAQB 2ZTYA 1E34B 2OXSA 1NRPH 1O3OA 2GCHG 1MTUA 1DUEA 4OS7A 4FU8A 2ZFPH 3ZZ3A 2Z3EA 3E8LA 2ZFTA 4CRGA 5AF9H 4ZKOU 3GOVB 4MQAA 2QXHA 1BTXA 2BX4A 2CV3A 1J17T 2ZP0H 4JYUH 3DUXH 1T8MA 4AYVB 1HAVB 3D23A 3TIUA 1BBRK 4ZHMU 3MOCA 2A5KA 4Z0KA 3MTYA 1SGRE 2AMPA 5GWZA 3MH6A 2ZO3H 1SL3A 3A7YA 1P02A 1RIWB 1O3MA 5ESBA 4B75A 4BANB 3GCHC 3U1IB 5EQRA 1L0ZA 1BUIA 2ANYA 3M3TA 1AFQC 3T5FH 2CGAA 2VWLA 1C4V2 4WMEA 2BQ7B 4AOQA 5A0BA 2ZGBH 1EJNA 4DURA 5JB8S 3GY7A 1P2OA 1GCTB 4GCHG 3T27A 1OX1A 2OCVB 1HNEE 1U6QA 1GGDC 2FOFA 3ZVBA 5LPRA 1DVAH 1DANH 1XMNB 1P01A 1IQMA 1TGSZ 4CBOA 1C5VA 2ZHEH 5FBEA 3M37A 1GHZA 4A92A 4QT8C 3UIRA 4A1TA 4Y6DA 1A5HA 4CRAA 1GBKA 2V0BA 2A7CA 1O2PA 1E0FD 2BLVA 4WMFA 2A5IA 1AN1E 1F0RA 3UQVA 1O3PB 1PJPA 1XUIA 1P06A 2VIOA 4X0WU 3ZVGA 3SGBE 1NZQH 1QL9A 1YM0A 2V35A 1KLJH 4FXGH 2ZQ2A 4FU7A 1HAZB 5L2YH 3M7UA 1O2SA 4X1PU 4VGCB 1AVGH 2NU2E 1NPMA 1DT2A 2JETC 3MYWA 4FUEA 5AVDA 3ZV8A 1C1OA 1TRMA 1NFXA 2ZDKA 1AB9B 2ZIQH 1G37A 1LQDB 3SNEA 5I46H 1T7CA 1OWIA 3UNSA 1O5AB 5J4SA 2ZGJA 5CHAC 1TGBA 1A0HB 3ZZ8A 1SGPE 1G3CA 2GZ8A 5FX5A 3C1KA 1QRXA 1VGCB 1DWDH 4MPWA 5A0CA 1PPZA 1T8NA 3GY8A 3SJ9A 1GG6C 5DP4A 3TH4H 2F9VA 4NCYA 3QO6A 3AAUA 2ODPA 1ELBA 2WPHS 3S7HB 2HPQH 5CE1A 2A1DB 3RXAA 1ELTA 3TU7H 1GVLA 2C8XB 2OP9A 2B5TB 4XE4A 2BD3A 2GT7A 3F9FA 1KXBA 4JK5A 2PUQH 2BLWA 2P3FH 4YOGA 4HFPB 1PFXC 2ULLA 1XVMA 3VB3A 3BTQE 2IPHA 2XBYA 1FI8A 4YT6H 4GHQA 1QBNA 1L1GA 3ZYEA 1ESBA 2ZDNA 1Z6EA 4ABFA 4I8HA 1EP5A 2ZU2A 2QC2A 1NROH 1P03A 1YP9A 4Y79A 1VR1H 1P3CA 2ANWA 1DY8A 1C5XB 2PKAB 5ESTE 2OC7A 1JRTA 1LHDH 1THRH 1AE8H 3U69H 1QA0A 1A7SA 2Y5HA 3SW2B 1FUJA 4ZHLU 1CBWB 3ATKA 1E38B 4Y10E 3RXKA 1C5NH 2DE9A 1MTNC 1TPOA 3LH1A 8GCHG 3VEQB 5FHTA 1SGCA 3L6PA 4KP0A 2P3UB 4H42U 2YNAA 1A3EH 1EAXA 5E0JA 5A2MH 2ZPQA 1FPCH 4A5TS 2OQUA 3N7OA 1GCDA 1BITA 1GI2A 1SB1H 1C2MA 1GI1A 4CRDA 2STAE 2PKSC 4X8VH 1WTGH 3VFEA 2WV5A 2TRMA 2QXGA 1SLVB 5AFYH 4E7NA 1TABE 4K1EA 2Y6TA 4FVDA 2BQWB 1NC6A 4FUBA 4THNH 2H6MA 5JBTA 4BAMB 1XUHA 3P8FA 4R0IA 1DX5M 3GISB 1FY5A 5DK1A 2G5VA 4INKA 1PQ5A 1ZYOA 2VVCA 1DPOA 1EZQA 1DWBH 4ZH8A 1F0TA 1GMCG 1THPB 1QRZA 5EQSA 4XDEA 1D9IA 4IN2A 3RM0H 3TK6A 4ABGA 1V2MT 1SFIA 4H6TA 1V3XA 3MU1A 2FOGA 4ISHH 1DY9A 3F6UH 5C5OA 1EASA 1ZSLA 1O0DH 4D9QA 2O8UA 3RXCA 3RU4E 3M5LA 3SQHE 1KSNA 1C5TA 1C1RA 2D1JA 2Q1JA 1KTTB 3TLOA 1D3TB 3M5MA 1PPFE 1S5SA 2HNTE 3VXFH 3OX7U 1RGQA 3RXFA 3MU4A 4X8SH 1QL8A 3ZZAA 4D9RA 3TNSA 3CP7A 1P11E 7GCHG 1KLIH 1NFWA 3A80A 3L3TA 4MPVA 5F6MA 1TPPA 4ZROA 1BB0B 1VITH 1IQJA 1ELVA 3M7TA 2BY6X 2AIPA 1GPZA 1AUJA 1NU7B 1DFPA 3LIWA 5LPFA 2Y82A 2CHAC 2FLRH 1PPCE 1TBQH 1V2ST 4DIHH 1GBEA 3A8BA 3QUMP 1C1TA 2ZCKP 3GY5A 2VWNA 3JZ2B 3M5NA 2W5EA 4F4OC 1LTOA 2JH5D 2OTVA 1JMOH 3T29A 3BTKE 2FO9A 1LMWB 2XBWA 2VINA 1UVTH 2BD8A 2R9PA 4BAOB 1IAUA 1SGEE 1EAIA 1O5CB 2ZFSA 4NIWA 1GBJA 4NA9H 2TGPZ 1SOZA 1SQTA 4X1RU 5H4IB 2ZHDA 1SG8B 3F9GA 2HALA 1T31A 1O2GH 1YPHC 2G8TA 1O37A 3MO6A 1UTLM 4LXBH 1H9HE 1L4ZA 2QA9E 3UFAA 5TJXA 3MNCA 2ZU4A 3KEEA 1RD3B 2Y81A 3MO3A 1D6RA 1TBRH 1TIOA 3MI4A 2UWOA 1S81A
chains in the Genus database with same CATH superfamily
3R0FA 3ZZ4A 2FI3E 2Z9LA 2R0KA 1HLTH 1GHBG 2Z3CA 3RXQA 1BTHH 1SHYA 1UTKA 1DXWA 1J15A 2J97A 2ZHQH 1LO6A 1LVOA 2Z9IA 3GS9A 1A0JA 2W3KA 4O3UA 2P3TB 4WMDA 1A4WH 1UTJA 1GHVH 3BTTE 4FUCA 1NU9A 2A2QH 1CO7E 1EZSC 3UR9A 2FDAA 3F1SB 1EAUA 1GBAA 3H7OA 5LH8A 1TGTA 1ZR0A 1OP8A 4B6EA 2JH6D 5HIZA 2BYAX 5LPEA 2YMSC 2GDDA 1HAOH 1BJUA 1QJ6B 5BRRE 4KKDA 3PWBA 1GMDF 4IMQA 4MPUA 3RXEA 1P09A 1EB1H 2ZDMA 1VJAU 1BMAA 4X6NA 3SUDA 3LPRA 1TLDA 2HLDD 1E36B 3QGNB 4Y7AA 5SGAE 1AVXA 3F2GA 1C5ZB 5EXMA 1BRBE 1LPKB 1XUFA 1AMHA 3Q76A 2OINA 1FMGA 1C5SA 1XX9A 3W95A 1T8OA 3WY8A 2DUCA 1QCPA 1BCUH 3H09A 1L4DA 2EI6A 5C1XA 1WQSA 2V6NA 3HATH 3QWCH 2PFEA 1C5MD 3QDZB 2Y80A 4X6PA 3VB5A 1O5DH 1P9UA 2VWMA 3MMGA 5GCHF 3STJA 1CT4E 1FIZA 1IOEA 3RC5A 5LGOA 2STBE 1QGFA 2CXVA 1OWJA 1Y59T 1K21H 3PROA 3SV7A 1C1PA 2OLGA 4B2CA 1UCYK 1ZSKA 3GYLB 3LJOA 4K1SA 6GCHF 1TX7A 1WCZA 4X6MA 3RXVA 1K1MA 4F49A 3T2NA 3HK3B 2VBCA 1P2IA 4FUHA 1EX3A 3OU0A 1MAXA 1B5GH 1V2OT 2ZGXH 2BXUH 4I8KA 1SHHB 3O8DA 3RXTA 3OYPA 1MU6B 1W11U 2Y7ZA 3SI3H 3KN2A 3QTOH 3TH2H 1CVWH 1G32B 4DGJA 1YPMH 1C5PA 1RRKA 5K7RA 2F9UA 3SZEA 3A7VA 3MHWU 1IQLA 1GJ4H 2RDLA 1KYNA 4KGAA 1QB1A 3RXJA 4O3TA 4NSYA 2J95A 3KYFA 3R3GB 1N8OB 3A81A 1SGIB 1GHXH 1G3EA 1CA0B 1KXEA 3N7DA 3SN8A 2F9PA 4TY6A 3ZZ9A 1GBIA 2RA3A 1K2I1 1A1RA 2I6SA 1UTNA 2BDYA 3GICB 4UFEH 3FZZA 1K1OA 1NRNH 1TX8A 2C90B 1VCWA 2NWNA 1IQHA 3E0NB 1CHGA 1LVBA 4Q2KA 1HFDA 1W7GH 5EW2H 2PTNA 4B71A 3I29A 3GY4A 3ATLA 2HVYB 2ZA5A 4Y8ZA 3RU4D 3AVZA 1ZTJA 4F55A 1RTLA 1MUEB 2AGIX 1CE5A 1Z8IB 2D8WA 1ANEA 5KEDA 1GJAB 2P59A 1G36A 1YPHE 2XW9A 2ZC9H 1PQ8A 2UUKB 3F9EA 3KYGA 3ODDA 4NA7A 1WYKA 5CHBA 3K9XB 1O2JA 1B0FA 4XFQA 1FDPA 1X7AC 1A0LA 1ZRBA 2CMYA 1GJBB 1NM6A 1GL1A 1P0SH 4GVUA 2EY4C 3VGCC 2KM0A 1K28D 2K1QA 1S85A 4ACAA 1GI5A 4Y0YE 5C67A 1WOFA 2M2AA 1LVMA 4ABIA 1OWHA 3P8OA 1EJAA 3U8OH 2W3IA 4GLYA 4BXSA 1Y3YA 2BDIA 1O33A 4RT0A 3OSYA 2RCEA 2FOMB 2XOKD 3FN8A 3P70B 4A6LA 1GI7B 1HDTH 1W7XH 3EGKH 3F0OA 1BRAA 2FYRA 2GCTC 1O39A 2G4TA 4BTTB 5EU8A 2RDEA 3S9BA 2R2MB 3Q3YA 3DA9B 5DO4H 2OBOA 5DP6A 1ZLRA 1N6YA 1LHCH 1ANCA 4YT7H 5T6GA 1ZGIA 4K8BA 1FPHH 4ZXYH 1O2UA 1Q2WA 2A2XH 1BTZA 1V2VT 2BD5A 4DOQA 5C17A 1V2UT 2GCHF 2O8TA 2A45B 2KCAA 4DW2U 1TRYA 2C3SA 1TOCB 3PMBB 4JMYA 1MABB 1XUGA 1C5QA 1AFQB 3SU6A 2WHXA 1QNJA 1ETSH 3RXLA 2J94A 1GBLA 1ZPCA 1FIWA 7ESTE 2ESTE 2KR7A 2G00A 4XBBA 1FZZA 2W26A 1SFQB 2IN2A 4B1TA 2YNBA 1SGNE 2GKVE 1GGDB 1AI8H 3EQ0H 4HG6A 1PPHE 2PR3A 2OK5A 3TGIE 1FQ3A 1GJ9B 3LOXA 1O35A 2ANMH 1Y5AT 2Q6FA 1A2CH 1YPKH 4TY7A 5BPEA 1OPHB 1A5GH 1NESE 3ZZ7A 1P2QA 3EDXB 3E0PB 1UK3A 1KTSB 1Z71A 4NZQA 1BTPA 2AGEX 3GCOA 3L33A 3UPEA 4AFUA 2W6JD 4ZXXH 2WYGA 4GCHF 4AN7A 2BXTH 2EA3A 3FANA 3OE7D 1O3HA 2WPJS 3B8JA 1DUAA 1QIXB 4I8LA 1TNHA 3LH3A 3TGJE 2GTBA 1OYQA 2UUYA 1FY8E 3MH5A 1PPGE 2ZU1A 1XXFA 4MNYA 1C4Y2 2ZFRH 5JDUB 1K1PA 1VITG 5EODA 1FN6A 1W14U 1UTMA 1PYTC 1AKSA 1ELFA 1ZHMA 4ASUD 2BOKA 2WPIS 5CHAB 4X2YA 1O2MA 4YXWD 3ZYDA 1MBQA 1UHBA 3RLWH 6CHAC 1A5IA 1LCYA 2VNTA 1AWFH 3N99A 3E16B 1O3LA 1QQUA 4AG2A 2NU4E 1C1VH 3BF6H 2A7JA 5F8ZA 4UFFH 4Q63A 4NFEA 2EQNA 1KXFA 1ZHPA 1C1NA 2HNTC 1DICA 1GBBA 2ASUB 3KQCA 1V2QT 3AASA 1THSH 1MKXH 3RM2H 1RXPA 3QK1A 4B2AA 2XTTB 1NN6A 3HGPA 3MFJA 3RXSA 4WJG2 1BHXF 2AIQA 2IJD1 1SGYE 3D65E 1UTOA 5DGJA 1ZOMA 2ZGHA 1O2YA 2BD2A 4ABAA 1RIWC 2SNWA 1QZ8A 3SV6A 1HGTH 1V2WT 1O2XA 3BTME 1OXGA 3TJUA 3MH7A 4ZUHA 1IQGA 3PM3A 2FS9A 8LPRA 4LOYH 2XCFA 3U28C 4BNRA 1TRNA 4I33A 2H5DA 3SUEA 1ABIH 4U2WA 3TPIZ 3CS0A 2Y5FA 1C5RA 1S84A 1QB9A 1ZHRA 1EATA 2ZCHP 2R3YA 3NWUA 4X1QU 2SGDE 3KNXA 1ZMLA 4TPYA 3WWFA 2FESH 4JCNA 3ITIA 1ETRH 1SQRA 2R3UA 3G01A 1UVUH 3M35A 4ABDA 5I25A 1DDJA 3PWCA 3MH4A 2HOBA 2V3OH 4GSOA 2GZ7A 2JKHA 1MTNB 4YM9A 3KHVA 1AE5A 2ZTXA 5EPNA 5FBIA 1P10A 1ZZZA 1ZPBA 1Z6JH 2PGQB 1QTFA 3VXEH 1S6HA 2UUFB 4SGBE 2JDID 1H8IH 1ARBA 1W10U 2FODA 1F7ZA 2ZFFH 3PTNA 3UNQA 3GDUA 2XWBI 4I86A 2FEQH 1LKBA 1FLEE 2BDBA 3ATIA 3K6YA 2PKSB 2XBXA 4MTBA 4CH2B 3DSPA 4CHAB 1CA8B 2BVRH 2J38A 1UMAH 3A7WA 1BMMH 2FYQA 2OC8A 3ZV9A 2C4FH 3BG8A 4DT7B 2J5UA 2W7UA 8GCHF 2H9TH 2ZTZA 3SU3A 4ZCNA 2SFAA 3RMMH 1G9IE 2ZQ1A 3UNRA 1BHXB 3UREA 3D62A 1SQAA 1P05A 4XSKU 1Z1JA 1E35B 5FX6A 3CS7A 5EW1H 1VGCC 2AS9A 2ZHWH 1C2HA 2BVSH 1O3DA 3PO1B 2ILNA 5ABWA 5EIYA 1B7XB 1CT0E 4XRNA 3OEHD 4ASHA 1F5KU 4WH6A 3GY2A 1WDIA 2Z3DA 3MWIU 4MNWA 1JIMA 2SGPE 1ZJKA 4FVBA 1TE0A 2A4RA 9LPRA 1SI5H 5HGGA 4XBDA 1H8DH 1O3JA 2BVXH 2BDHA 5GIBA 9ESTA 1BTUA 4AB9A 2KFWA 2WV4A 1GJ8B 1W8BH 1SGFG 1O2HA 3V12A 5A8YA 5EG4A 3ATMA 3D49H 4IGDA 3GDSA 3MNSA 1WV7H 3MU0A 1EJMA 5GDSH 5T6DA 1MQ6A 3TH3H 3SNCA 2GV7A 3UOUA 1ELAA 4JK6A 3KQBA 1MKWH 1TYNA 1YF4A 3AK5A 5C0TA 2BQ6B 4FUIA 1OWKA 4CH8B 2R2WU 2SGFE 8ESTE 5IYTA 3FO8D 3QTVH 3S9CA 5E0GA 5L30H 1E79D 1VZQH 2QYIA 1K1JA 1C2IA 1Y5UT 3GY6A 3M3SA 4HI3A 3E6PH 1ZTKA 1TPSA 1ZSJA 3LC3A 3ZVAA 3A8AA 4CRCA 2GMTB 3TK5A 1NFYA 5EJLA 5FXLA 4MPXA 4MG3A 1C5WB 2ZG0H 3LC5A 3SZNA 2XXLA 7GCHF 1D3DB 1DSTA 2GVFA 3LGYA 2PHBA 1H8ED 1YCPH 1P2JA 5PTPA 4LZ4B 5JPMH 2KCYA 4OGXA 4FU9A 4K8YA 3CNRA 2C8ZB 2VIQA 1V2RT 3GCTF 1WUNH 1TBZH 5HMAA 3MU5A 4INHA 3SNDA 2WINI 1AHTH 1EAWA 2O8LA 4X1SU 3QLPH 1ZMJA 4SGAE 2TPIZ 2K8IA 1ZRKA 2KCPA 2LP6A 3ZZBA 4BOHA 1A61H 1OHHD 2QXIA 1H1BA 4XBCA 2BDGA 4MVNA 1S6FA 2ANKH 1O3IA 3NUMA 3TITA 2HRVA 3RC6A 1O5FH 2BY5X 5E8EH 2UWLA 4K3JA 1BTWA 2A4GA 2FX4A 1Y3UA 1HV7A 3K65B 2WPKS 1W12U 1UJ1A 1G30B 1B0EA 5EGMA 3WW7A 3DT0H 1GBMA 4OS6A 3SU2A 3A8DA 1OP0A 1P2NA 1EFRD 2XC5A 3BN9A 1NFUA 1O3CA 1BBRH 2PGBB 2WPLS 1ETTH 2ZDVH 1QJ7B 1LVYA 2HGTH 3STIA 3SV2H 5KECA 3SQEE 3SGAE 4AX9H 4JYVH 4CR5A 4B6FA 4CRBA 6ESTA 1UK4A 2JH0D 3V0XA 5C2ZA 2YMSB 3OFND 4DVAU 1NBME 2AMDA 1CGIE 4B73A 3M61U 3SYJA 3PRBA 2QIQA 2ZHFH 5C0UA 3E91A 3LDXH 2GGVB 1C2KA 4WY3A 1DXPA 5DP7A 5B6LA 1DWCH 4X8UH 1MBMA 4FUFA 1CHOF 1T4VH 2FS8A 3EAJA 3RMOH 1IQIA 1HXEH 1KIGH 1O2ZA 3NXPA 1SLWB 1S0QA 2VWOA 2ZDAH 3S7KB 1BOQA 2VU8E 2W7SA 2GP9B 2OD3B 1Z8JB 1JOUB 3UTUH 2UUJB 2ALVA 4ISIH 2J9NA 1OWEA 2EI8A 1AKSB 4Z1MD 1BBRE 4AFZA 3W1EA 1HRTH 2VB0A 3BG4B 4R8TB 2BTCE 1YLDA 3FZDA 1NS3A 3T25A 3RXPA 4HGCA 3PYHA 3UOPA 1C1SA 1C2JA 4CBNA 6LPRA 4I7YH 3E90B 5HXFA 1UHBB 2P8OB 5TCCA 3P8NA 1V2NT 2D2DA 1C1QA 2XBVA 1O2WA 4WXVA 4X1NU 4I8JA 5A09A 4NSVA 5A8XA 1FX0B 1GJ7B 3UAIC 1ANBA 1GHAG 1H9IE 3E3TA 3SUGA 3Q3XA 4RKJB 1XUJA 2QGRA 2M5TA 4FUJA 5HYOA 3QZRA 1IQFA 1TNGA 3BEUA 4E06H 4MNVA 2VH0A 1YLNA 2VVVA 1W3CA 2SGQE 4OS1A 1YKTA 3H5CB 1QL7A 1SGDE 2BOHB 5F03A 3P92A 1SVPA 4TYDA 1GWAA 5FPYA 1KDQA 1TMBH 1TNIA 2SGAA 3FP6E 3EA8A 2VIWA 5JBCS 3VB4A 5FCRA 3SJ8A 2ODQA 1J9CH 1O2TA 1WTHD 1FY3A 1XKBC 2F9NA 5DP5A 1ACBE 1D3PB 1OSSA 3IG6B 3Q3KA 2BLOA 3P95A 3M36A 1VJ9U 2Y7XA 1QJ1B 3NKKA 4YOIA 4Q7XA 2ZNKH 4JZFH 4ABHA 1SSXA 1NRRH 4NZLA 3RXUA 1G3DA 2VGCB 1C1WH 2TGAA 1OWDA 1T8LA 5CMXH 3TGKE 5HM2A 1FN8A 2O8MA 4X2XA 3UQOA 1HAHH 1AVWA 1GI4A 4O97A 2LNCA 3V7TA 1S6LA 2HVXA 3OTJE 3KCGH 1IQEA 1F0SA 2V7QD 2P93A 5DKMA 1AU8A 1QQ4A 4O9VA 2F9BH 3U98H 3RP2A 1PYTD 3VGCB 3SNAA 3LT3A 1XKAC 3F2HA 2FIRH 2H5CA 1GJ5H 1YY3A 3TVJB 1GI6A 1YGCH 4IN1A 1JXPA 3LJJA 2DE8A 1BQYA 2OUAA 1O30A 4D7FA 1O5BB 2VJ1A 1HJAB 4Y76A 1DWEH 1DLEA 1GDUA 5T3HA 1LHEH 3SORA 2VIDA 1UTPA 5DN6D 1DM4B 3EE0B 3RXHA 3SBKA 1HBTH 1TNLA 1SPJA 2KAIA 3A88A 2A5AA 2OQ5A 1GMHG 1GI8B 1LHGH 2QCYA 4B74A 5GXPA 2PW8H 2A32A 5B6OA 2GD4B 1Y8TA 3GCNA 3HKIB 1TX6A 1T4UH 1ESAA 1TQ0B 2CJIA 4ZKRU 2ZKSA 3P8GA 2WPMS 1IHSH 2A7HA 3EA7A 4J2YB 1AQ7A 2B0FA 1EPTC 1W0YH 2G51A 2G5NA 1ANDA 2BY8X 4Q4LA 3M5OA 3MU8A 3ZVCA 2HLCA 2HNTF 2OBQA 4AORA 3F3BA 1G3BA 1Z1IA 5C1UA 4NG9H 3RUOA 1SLUB 3ESTA 1EOJA 1EQ9A 1L2EA 1YC0A 1XUKA 1AFEH 3W94A 3BIVH 1TOMH 5G4BA 2AMQA 2G55A 3BTFE 3UR6A 1ELGA 4INLA 1PPEE 5EXLA 1SGFA 2V3MA 2F3CE 1NBMD 2BY7X 4LZ1H 3ELAH 1MD8A 2AERH 2TIOA 1JWTA 2BY9X 2QF4A 2GT8A 1O2RA 3LGUA 3DFJA 1TNKA 3FOAA 1UW7A 3IITA 3GCHB 3I77A 3Q00A 2QXJA 2QN5T 1SBWA 3HKJB 2HWLB 1BRUP 2ZWLH 2BMGB 5E2PA 1HB0B 1YCPK 3RU4T 1P2MA 1P2KA 1HAPH 4TWWA 2IOTA 3T26A 1O2NA 2F83A 2AGGX 5GPIB 2ZI2H 3M3VA 3SJKA 4NWKA 1KXCA 2XC0A 1ARCA 4Y71A 4E05H 3V13A 5IK2D 3SUFA 5T6FA 2WUBA 1TMTH 2WSSD 2YOLA 1XM1A 1MMJN 1QB6A 6CHAB 3KQ5A 1V2LT 3O8BA 4ISOA 4JZEH 1WQVH 1AIXH 1F5RA 1W0ZU 2AEIH 4YOJA 2NU0E 1AZZA 3VB7A 3A84A 4JZDH 1VITF 1RTFB 4NIXA 1AO5A 1JRSA 5C20A 4OM9A 2Q6GA 1OYTH 1A3BH 2QAAA 2W6ID 5TCAA 1MTSA 1RFNA 3F9HA 3A85A 3MNXA 2JETB 5C1YA 2Z9GA 1BIOA 4YZUA 1VCQA 2WYJA 4IS5A 1HYLA 4UE7H 1DOJA 1O2LA 3TJNA 4ISNA 4GUXA 3UY9A 1T32A 1TALA 4XOJA 3BEIB 1QRWA 5EQQA 3NPSA 1UTQA 3S9AA 4NFFA 2O8WA 2B9LA 4ABEA 3DD2H 1C5UA 3BV9B 5L2ZH 2SNVA 1ELDE 3KL6A 1P9SA 1GG6B 4I8GA 3SOSA 4KELA 1CSOE 1MCTA 1P8VC 2THFB 1DLKB 4DIIH 3BIUH 1O3GA 4FUDA 4A1XA 4TSFD 3NZIA 3KQEA 2Y5GA 3LGVA 3BTDE 1JBUH 1NY22 2B7DH 1HXFH 2FOCA 4K5ZA 5FAHA 2LPRA 1AUTC 1AWHB 1RJXB 2PLXA 2ZGCA 5A8ZA 2XC4A 3A82A 2UWPA 1S83A 5DSFA 2QY0B 3OTPA 2F9OA 1MZAA 1WBGB 3OY5U 4A7IB 4BTIB 3A7TA 4K2YA 4GAWA 2JIZD 4DG4A 3CENA 3OEED 1O2VA 1GI9B 1BMLA 2AHME 4J1YA 1UCYH 2PWXA 4KTSA 2AFQB 1OS8A 5DG6A 3I78A 1C2DA 2K0QA 2GJGA 1GCTC 3H7TA 1P57B 1G2MA 4DJZB 1O36A 3AAVA 2J2UA 1SGTA 2ZU5A 5JB9S 2VIVA 2G81E 2SGEE 1F92A 1BT7A 1PQ7A 3PLBA 2BM2A 2C93B 3M7QA 3RXGA 2QF0A 1OOKB 1KDQB 2ZU3A 4AFQA 1EXFA 2GX4A 3RDZA 1MQ5A 1S82A 1VKYA 4Z6AH 1TFXA 3U8TH 5J4QA 3SV9A 4YLUA 4VGCC 3MNBA 3NCLA 4D7GA 2Q6DA 1Y3WA 2RFKC 2F43B 5AFZH 1K9OE 3A87A 3T28A 4JYTA 1NRQH 1BZXE 2TGTA 1AB9C 1L1JA 4ZKNU 2A31A 2BD4A 3RXIA 3A89A 1CGHA 1PPBH 4H4FA 1EPTA 1UCYE 2CF9H 2BB4A 1C2GA 4HZHA 1O5GH 1E1RD 3P6ZB 1YPLH 1YCPM 1W13U 2P16A 2CK3D 2FWWA 3P17H 3RLYH 3DHKH 1QBVH 5JBAS 3LGWA 1DITH 2BLQA 3ATWA 3QX5H 5EJ1A 4DCDA 1SLXB 1HIAA 3HPTB 2PP6A 5AHGH 1KXDA 1QHRB 2ODYB 5HIYA 3TK9A 1GHWH 3UWJH 1D4PB 2R0LA 2RA0A 1QY6A 2PSXA 5DP3A 4UEHH 1UO6A 4RN6A 2GV6A 2Z7FE 3TJVA 1LHFH 1GMCF 1C9TA 4U30A 3RMNH 3O8CA 1CU1A 4TWYA 1TQ7B 1GBHA 1C9PA 2BD7A 2J98A 1GJDB 2KAIB 1NRSH 2A4QA 2ZPRA 1FV9A 4U01A 2A0QB 4AYYB 1FNIA 2H9HA 3FP8E 1Z7KA 1JIRA 2D26C 1D3QB 4CHAC 4RKOB 3HGNA 4AB8A 1W2KH 1O2OA 4DY7B 3PRDA 1ORFA 1TA6A 2NU1E 3C27B 1IQNA 3SU0A 2TGDA 4NA8A 3DFLA 2CHAB 1QURH 2Z6BD 4BTUB 1O3BA 4FUGA 1CBWC 2J92A 5F53A 1HAXB 2XRCA 3MO9A 1O3NA 2BDCA 2Z9KA 1G2LA 2IJOB 4YLQH 1CQQA 1EOLA 1K22H 1LKAA 3PO1C 1ZTLA 2J4IA 1FAKH 1FY4A 2B8OH 3TNTA 4X6OA 1O38A 1PQAA 4D8NA 2OC0A 2AH4X 2ZCLP 1LQEA 2PSYA 4KTUA 3SO3A 1TAWA 2BX3A 2FOEA 1TONA 2BZAA 2FZZA 3GDVA 3ZZDA 1K1NA 5E0HA 1O32A 3GY3A 3V3MA 2O9QA 2GDEH 1EB2A 1HPGA 1WAYB 3ZVDA 3RXBA 3U1JB 4YTAA 5FPSA 1S0RA 1YPJH 3S69A 3SJOA 3QZQA 3RXRA 4ABJA 4UDWH 3UUZA 1H9LB 2ALPA 3S0NA 1ID5H 3VB6A 5E2OA 7KMEH 1C1UH 1FXYA 1J14A 1DSUA 3BTWE 2FM2A 3LU9B 1ZJDA 2FLBH 8KME2 5C5NA 4KTCA 1TGCA 2L6OA 3SHAH 1H4WA 3VG8A 3GCTG 2PTCE 3JZ1B 4MDSA 2Z94A 2PV9B 1V2KT 1MD7A 4X2VA 1YPGH 4ESTE 1FAXA 1TGNA 1BDAA 1WU1A 4D76A 1GDQA 1RTKA 2GMTC 1GJ6A 5IDKA 2BD9A 4M9FA 1HAVA 3ZZ5A 1MZDA 1GHBF 1TMUH 1YBWA 2H9EH 5F8XA 2FXRA 5K0HA 3Q77A 4IC6A 4ABBA 3LONA 4K1TA 1QFKH 3RXDA 1L1NA 1HUTH 1HCGA 1SR5C 3O8RA 3B9FH 2ZFQH 1N1LA 1EZXC 4OS2A 5JBBS 3PMAB 3FP7E 3KQDA 1C5YB 2VH6A 1UVSH 3KGPA 3PTBA 2P94A 2HPPH 1P04A 4NWLA 3SJIA 2XNIA 3EE7A 1ABJH 5GNDA 1IQKA 3ZZ6A 4BAHB 1MCVA 1O3EA 4JZ1A 1GI3A 4AZ2B 1BMNH 2QF5A 4HTCH 3A83A 3A7ZA 4WWYA 3OAAD 1BJVA 2WV9A 1MTWA 1Y3VA 1ELCA 3A86A 4IMZA 1O2QA 5DP8A 4RT1A 1AZ8A 1GHAF 1GL0E 1V2TT 4B76A 5ETXA 3SHCH 4Y0ZE 1MAYA 1N6XA 1V2JT 2EI7A 2ZDLA 4TT3D 2KX4A 4AFSA 1BRCE 4WXIA 2CN0H 4UFGH 1CHOG 1Q3XA 1EP6A 3U9AH 2FP7B 1LPGB 2Z9JA 1C4U2 1DE7H 1F5LA 1KLTA 3PLPA 3VPKA 4NGAH 1SQOA 3ZIAD 1WXRA 2PUXB 3OY6U 5DPAA 3SU4A 1LPZB 2XWAA 1ZPZA 2G4UA 4AGKA 3K6ZA 2AYWA 3BTEE 1F2SE 1Z8RA 4ZHAA 2VIPA 3KIDU 1HJ8A 5FCKA 3TJOA 3UWIA 2QV1A 1GHYH 1GMDG 2EEKA 4IC5A 1MKXK 3BSQA 2G52A 1TPAE 2H1UA 4MNXA 4O03A 1KY9A 4M7GA 3PMHB 4Y7BA 5JYIA 1Q31A 2KCOA 3URDA 3F68H 1SOTA 1O34A 2V3HH 3GYMA 3LGIA 1BA8B 1QBOA 1TNJA 1UVOA 1OP2A 1P12E 3KF2A 1C5LH 4X8TH 1K1LA 1Y5BT 3E1XB 1AD8H 2ZPSA 1FY1A 1GVKB 3FVFB 1AGJA 1SC8U 1YLCA 3ODFA 5GJ4B 4CR9A 5C3NA 1C2FA 4TPIZ 3BG4C 2J34A 2FPZA 1C2EA 1NT1A 1VCPA 3B23B 4WVPE 1P3EA 4E7RG 4AG1A 4BAKB 1EZUC 1Y3XA 1J16A 4UONA 2P8OC 2H2ZA 3FKSD 1D6WA 3PB1E 3QN7A 4PROA 1DS2E 1CT2E 5GCHG 3SNBA 7LPRA 4UD9H 5A0AE 1NO9H 2NU3E 1HAIH 3T62A 1GBTA 4OS5A 2FOAA 4H6SB 4CREA 1HAGE 6GCHG 1KMHB 1W0JD 4ISLA 1SMFE 2BHGA 4GHTA 4P00A 1FJSA 1QA7A 5EOKA 4LK4A 2PKAA 3AW1A 3UB0A 2L74A 1UVPA 3A8CA 3DSGA 2XNDD 4RSPA 5HM9A 3ZVEA 3FFGA 2FX6A 3EYDA 4CRFA 1O3FA 4Y8YA 3K2UA 4A1VA 3LKWA 2GZ9A 1K1IA 5F8TA 1EPTB 2ZZUH 2WUCA 2CF8H 1O2IA 3RMLH 3RXOA 2OC1A 1EUFA 2P95A 1GMHF 1C1MA 1NTPA 3PV5A 2ZF0H 5EJZA 1QR3E 2QE7D 1C2LA 4OGYA 2FOBA 1M9UA 2GCTB 1CGJE 3RXMA 1TB6H 1YPEH 1GBFA 1HIAB 1GDNA 1GBCA 1GVZA 2FOHA 4IW4E 3ZVFA 1AY6H 3ZZCA 2VGCC 4B2BA 1E37B 1GBDA 1H8HD 3SU5A 4K60A 2RG3A 1UK2A 2FTLE 2IPQX 4WF8A 1N8OC 3LGTA 1HJ9A 1CA0C 1BTYA 1FONA 3SU1A 5L6NH 2FI4E 2VVUA 1O2KA 1MTVA 2J98B 3PLKA 4F48B 2BDAA 4I32A 1A46H 1V2PT 1V6DA 2FMJA 5EXNA 4NIVA 1IHTH 1HAYB 1O3KA 3QGJA 4I31A 1KXAA 1OKXA 1O3AA 4YESB 3PV4A 1ELEE 1WSSH 4BXWA 1RS0A 1F0UA 1TA2A 5DJ7A 2ZECA 1MKWK 2XCNA 5HKKD 1SGQE 4MLFB 1MU8B 1ZMNA 4Y8XA 3RC4A 5DP9A 1HJAC 1XXDA 1J8AA 3FAOA 2C8WB 4Q7YA 3BTGE 3AW0A 2FI5E 2BZ6H 3HK6B 3ENSB 4Y11E 2I6QA 3SV8A 1INCA 1O5EH 1XVOA 2EC9H 2C8YB 1ZGVA 3SGQE 5EPYA 2XYAA 1Z8GA 3A7XA 4ZAEA 1TWXB 3SI4H 1ESTA 1C5OH 4X2WA 1LDTT 4UFDH 4YO9A 4GPGA 2FTMA 3EA9A 4WH8A 3NK8A 4IBLH 3BEFB 4ZMAH 1O31A 3URCA 4OS4A 3BTHE 3PMJA 4DT4A 4U32A 1EKBB 4Q7ZA 1MH0A 4Q80A 2JJ2D 2TBSA 1GJCB 4K69A 4AGJA 2QF3A 4JZIA 3IWMA 5FPTA 1GI0A 2F91A 4ZKSU 4NIYA 1YYY1 2A4OA 2ZEBA 3U8RH 4BAQB 2ZTYA 1E34B 2OXSA 1NRPH 1O3OA 2GCHG 1MTUA 1DUEA 4OS7A 4FU8A 2ZFPH 3ZZ3A 2Z3EA 3E8LA 2ZFTA 4CRGA 5AF9H 4ZKOU 3GOVB 4MQAA 2QXHA 1BTXA 2BX4A 2CV3A 1J17T 2ZP0H 4JYUH 3DUXH 1T8MA 4AYVB 1HAVB 3D23A 3TIUA 1BBRK 4ZHMU 3MOCA 2A5KA 4Z0KA 3MTYA 1SGRE 2AMPA 5GWZA 3MH6A 2ZO3H 1SL3A 3A7YA 1P02A 5FL7D 1RIWB 1O3MA 5ESBA 4B75A 4BANB 3MQKC 3GCHC 3U1IB 5EQRA 1L0ZA 1BUIA 2ANYA 3M3TA 1AFQC 3T5FH 2CGAA 2VWLA 1C4V2 4WMEA 2BQ7B 4AOQA 5A0BA 2ZGBH 1EJNA 4DURA 5JB8S 3GY7A 1P2OA 1GCTB 4GCHG 3T27A 1OX1A 2OCVB 1HNEE 1U6QA 1GGDC 2FOFA 3ZVBA 5LPRA 1DVAH 1DANH 1XMNB 1P01A 1IQMA 1TGSZ 1E1QD 3WWBA 4CBOA 1C5VA 2ZHEH 5FBEA 3M37A 1GHZA 4A92A 4QT8C 3UIRA 4A1TA 4Y6DA 1A5HA 4CRAA 1GBKA 2V0BA 2A7CA 1O2PA 1E0FD 2BLVA 4WMFA 2A5IA 1AN1E 1F0RA 3UQVA 1O3PB 1PJPA 1XUIA 1K0HA 1P06A 2VIOA 4X0WU 3ZVGA 3SGBE 1NZQH 1QL9A 1YM0A 2V35A 1KLJH 4FXGH 2ZQ2A 4FU7A 1HAZB 5L2YH 3M7UA 1O2SA 4X1PU 1W0KD 4FETA 4VGCB 1AVGH 2NU2E 1NPMA 1DT2A 2JETC 3MYWA 4FUEA 5AVDA 4ACBA 3ZV8A 1C1OA 1TRMA 1NFXA 2ZDKA 1AB9B 2ZIQH 1G37A 1LQDB 3SNEA 5I46H 1T7CA 1OWIA 3UNSA 1O5AB 5J4SA 2ZGJA 5CHAC 1TGBA 1A0HB 3ZZ8A 1SGPE 1G3CA 2GZ8A 1YWUA 5FX5A 2F4LA 3C1KA 1QRXA 1VGCB 1DWDH 4MPWA 5A0CA 1PPZA 1T8NA 3GY8A 3SJ9A 1GG6C 5DP4A 3TH4H 2F9VA 4NCYA 3QO6A 3AAUA 2ODPA 1ELBA 2WPHS 3S7HB 2HPQH 5CE1A 2A1DB 3RXAA 1ELTA 3TU7H 1GVLA 2C8XB 2OP9A 2B5TB 4XE4A 2BD3A 2GT7A 3F9FA 1KXBA 4JK5A 2PUQH 2BLWA 2P3FH 4YOGA 2LELA 4HFPB 1PFXC 2ULLA 1XVMA 3VB3A 3BTQE 2IPHA 2XBYA 3N7EA 1FI8A 4YT6H 4GHQA 1QBNA 1L1GA 3ZYEA 1ESBA 2ZDNA 3F2FA 1Z6EA 4ABFA 4I8HA 1EP5A 2ZU2A 2QC2A 1NROH 1P03A 1YP9A 4Y79A 1VR1H 1P3CA 2ANWA 1DY8A 5CDFE 1C5XB 2PKAB 5ESTE 1JRTA 1LHDH 1THRH 2OC7A 1AE8H 3U69H 1QA0A 1A7SA 2Y5HA 3SW2B 1FUJA 4ZHLU 1CBWB 3ATKA 3F0PA 1E38B 4Y10E 3RXKA 1C5NH 2DE9A 1MTNC 5KGOA 1TPOA 3LH1A 8GCHG 3VEQB 5FHTA 1SGCA 2KZ4A 3L6PA 4KP0A 2P3UB 4H42U 2YNAA 1A3EH 2YMSD 1EAXA 4FOUC 5E0JA 5A2MH 4AC9A 2ZPQA 1FPCH 4A5TS 2OQUA 3N7OA 1GCDA 1SKYE 1BITA 1GI2A 1SB1H 1C2MA 1GI1A 4CRDA 2STAE 2PKSC 4X8VH 1WTGH 3VFEA 2WV5A 2TRMA 2QXGA 1SLVB 3DSOA 5AFYH 4E7NA 1TABE 4K1EA 2Y6TA 4FVDA 2BQWB 3PV2A 1NC6A 4FUBA 4THNH 2H6MA 5JBTA 4BAMB 1XUHA 3P8FA 4R0IA 1DX5M 3GISB 4XD7D 1FY5A 5DK1A 2G5VA 4INKA 1PQ5A 1ZYOA 2VVCA 1DPOA 1EZQA 1DWBH 4ZH8A 1F0TA 1GMCG 1THPB 1QRZA 5EQSA 4XDEA 1D9IA 4IN2A 3RM0H 3TK6A 4ABGA 1V2MT 1SFIA 4H6TA 1V3XA 3MU1A 2FOGA 4ISHH 1DY9A 3F6UH 4RI0A 1EASA 1ZSLA 5C5OA 1O0DH 1COWD 4D9QA 2O8UA 3RXCA 3RU4E 3M5LA 3SQHE 1KSNA 1C5TA 5C94A 1C1RA 2D1JA 2Q1JA 1KTTB 3TLOA 1D3TB 3M5MA 1PPFE 1S5SA 2HNTE 3VXFH 3OX7U 1RGQA 2WZQA 3RXFA 3DCLA 3MU4A 4X8SH 1QL8A 3ZZAA 4D9RA 3TNSA 3CP7A 1P11E 7GCHG 1KLIH 1NFWA 3A80A 3L3TA 4MPVA 5F6MA 1BMFD 1TPPA 4ZROA 1BB0B 1VITH 1IQJA 1ELVA 3M7TA 2BY6X 2AIPA 1GPZA 1AUJA 1NU7B 1DFPA 3LIWA 5LPFA 2Y82A 2CHAC 2FLRH 1PPCE 1TBQH 1V2ST 4DIHH 1GBEA 3A8BA 3QUMP 1C1TA 2ZCKP 3GY5A 2VWNA 3JZ2B 3M5NA 2W5EA 4P02A 4F4OC 1LTOA 2JH5D 2OTVA 1JMOH 3T29A 3BTKE 2FO9A 1LMWB 2XBWA 2JJ1D 1UVTH 2VINA 2BD8A 2R9PA 4BAOB 1IAUA 1SGEE 1EAIA 2WPDD 1O5CB 2ZFSA 4NIWA 1GBJA 4NA9H 3NRLA 2TGPZ 1SOZA 1SQTA 4X1RU 5H4IB 2ZHDA 1SG8B 3F9GA 2HALA 1T31A 1O2GH 1YPHC 2G8TA 1O37A 3MO6A 1UTLM 4LXBH 1H9HE 1L4ZA 2QA9E 5T1VA 3UFAA 5TJXA 3MNCA 2ZU4A 3KEEA 1RD3B 2Y81A 3MO3A 1D6RA 1TBRH 1TIOA 3MI4A 2UWOA 1S81A
chains in the Genus database with same CATH topology
3R0FA 3ZZ4A 2FI3E 2Z9LA 2R0KA 1HLTH 1GHBG 2Z3CA 3RXQA 1BTHH 1SHYA 1UTKA 1DXWA 1J15A 2ZHQH 1LO6A 1LVOA 2Z9IA 1A0JA 2W3KA 4O3UA 2P3TB 4WMDA 1A4WH 1UTJA 1GHVH 3BTTE 4FUCA 1NU9A 2A2QH 1CO7E 1EZSC 3UR9A 2FDAA 3F1SB 1EAUA 1GBAA 3H7OA 5LH8A 1TGTA 1ZR0A 1OP8A 2JH6D 2BYAX 5LPEA 2GDDA 1HAOH 1BJUA 1QJ6B 5BRRE 4KKDA 3PWBA 1GMDF 4IMQA 4MPUA 3RXEA 1P09A 1EB1H 2ZDMA 1VJAU 1BMAA 4X6NA 3SUDA 3LPRA 1TLDA 1E36B 3QGNB 4Y7AA 5SGAE 1AVXA 1C5ZB 5EXMA 1BRBE 1LPKB 1XUFA 1AMHA 3Q76A 2OINA 1FMGA 1C5SA 1XX9A 3W95A 1T8OA 3WY8A 2DUCA 1QCPA 1BCUH 1L4DA 2EI6A 5C1XA 1WQSA 2V6NA 3HATH 3QWCH 2PFEA 1C5MD 3QDZB 2Y80A 4X6PA 3VB5A 1O5DH 1P9UA 2VWMA 3MMGA 5GCHF 3STJA 1CT4E 1FIZA 1IOEA 3RC5A 5LGOA 2STBE 1QGFA 2CXVA 1OWJA 1Y59T 1K21H 3PROA 3SV7A 1C1PA 2OLGA 4B2CA 1UCYK 1ZSKA 3GYLB 3LJOA 4K1SA 6GCHF 1TX7A 1WCZA 4X6MA 3RXVA 1K1MA 4F49A 3T2NA 3HK3B 1P2IA 4FUHA 1EX3A 3OU0A 1MAXA 1B5GH 1V2OT 2ZGXH 2BXUH 4I8KA 1SHHB 3O8DA 3RXTA 3OYPA 1MU6B 1W11U 2Y7ZA 3SI3H 3KN2A 3QTOH 3TH2H 1CVWH 1G32B 4DGJA 1YPMH 1C5PA 1RRKA 5K7RA 2F9UA 3A7VA 3MHWU 1IQLA 1GJ4H 2RDLA 1KYNA 4KGAA 1QB1A 3RXJA 4O3TA 4NSYA 2J95A 3R3GB 1N8OB 3A81A 1SGIB 1GHXH 1G3EA 1CA0B 1KXEA 3SN8A 2F9PA 4TY6A 3ZZ9A 1GBIA 2RA3A 1K2I1 1A1RA 2I6SA 1UTNA 2BDYA 3GICB 4UFEH 3FZZA 1K1OA 1NRNH 1TX8A 2C90B 1VCWA 2NWNA 1IQHA 3E0NB 1CHGA 1LVBA 4Q2KA 1HFDA 1W7GH 5EW2H 2PTNA 4B71A 3I29A 3GY4A 3ATLA 2ZA5A 4Y8ZA 3RU4D 3AVZA 1ZTJA 1RTLA 1MUEB 2AGIX 1CE5A 1Z8IB 2D8WA 1ANEA 1GJAB 2P59A 1G36A 1YPHE 2XW9A 2ZC9H 1PQ8A 2UUKB 3F9EA 3ODDA 4NA7A 1WYKA 3K9XB 1O2JA 1B0FA 4XFQA 1FDPA 1X7AC 1A0LA 1ZRBA 2CMYA 1GJBB 1NM6A 1GL1A 1P0SH 4GVUA 3VGCC 1K28D 2K1QA 1S85A 1GI5A 4Y0YE 5C67A 1WOFA 1LVMA 4ABIA 1OWHA 3P8OA 1EJAA 3U8OH 2W3IA 4GLYA 4BXSA 1Y3YA 2BDIA 1O33A 3OSYA 2RCEA 2FOMB 3P70B 4A6LA 1GI7B 1HDTH 1W7XH 3EGKH 1BRAA 2FYRA 2GCTC 1O39A 2G4TA 4BTTB 5EU8A 3S9BA 2R2MB 3Q3YA 3DA9B 5DO4H 2OBOA 5DP6A 1ZLRA 1N6YA 1LHCH 1ANCA 4YT7H 5T6GA 1ZGIA 4K8BA 1FPHH 4ZXYH 1O2UA 1Q2WA 2A2XH 1BTZA 1V2VT 2BD5A 4DOQA 1V2UT 2GCHF 2O8TA 2A45B 4DW2U 1TRYA 2C3SA 1TOCB 3PMBB 4JMYA 1XUGA 1C5QA 1AFQB 3SU6A 1QNJA 1ETSH 3RXLA 2J94A 1GBLA 1ZPCA 1FIWA 7ESTE 2ESTE 2G00A 4XBBA 1FZZA 2W26A 1SFQB 2IN2A 4B1TA 2YNBA 1SGNE 2GKVE 1GGDB 1AI8H 3EQ0H 1PPHE 2PR3A 3TGIE 1FQ3A 1GJ9B 3LOXA 1O35A 2ANMH 1Y5AT 2Q6FA 1A2CH 1YPKH 4TY7A 5BPEA 1OPHB 1A5GH 1NESE 3ZZ7A 1P2QA 3EDXB 3E0PB 1UK3A 1KTSB 1Z71A 4NZQA 1BTPA 2AGEX 3GCOA 3L33A 3UPEA 4AFUA 4ZXXH 2WYGA 4GCHF 4AN7A 2BXTH 2EA3A 3FANA 1O3HA 2WPJS 3B8JA 1DUAA 1QIXB 4I8LA 1TNHA 3LH3A 3TGJE 2GTBA 1OYQA 2UUYA 1FY8E 3MH5A 1PPGE 2ZU1A 1XXFA 4MNYA 1C4Y2 2ZFRH 5JDUB 1K1PA 1VITG 5EODA 1FN6A 1W14U 1UTMA 1PYTC 1AKSA 1ELFA 1ZHMA 2BOKA 2WPIS 5CHAB 4X2YA 1O2MA 3ZYDA 1MBQA 1UHBA 3RLWH 6CHAC 1A5IA 1LCYA 2VNTA 1AWFH 3E16B 1O3LA 1QQUA 4AG2A 2NU4E 1C1VH 3BF6H 2A7JA 5F8ZA 4UFFH 4NFEA 1KXFA 1ZHPA 1C1NA 2HNTC 1DICA 1GBBA 2ASUB 3KQCA 1V2QT 3AASA 1THSH 1MKXH 3RM2H 1RXPA 3QK1A 4B2AA 2XTTB 1NN6A 3HGPA 3MFJA 3RXSA 4WJG2 1BHXF 2AIQA 1SGYE 3D65E 1UTOA 5DGJA 1ZOMA 2ZGHA 1O2YA 2BD2A 4ABAA 1RIWC 2SNWA 3SV6A 1HGTH 1V2WT 1O2XA 3BTME 1OXGA 3TJUA 3MH7A 4ZUHA 1IQGA 3PM3A 2FS9A 8LPRA 4LOYH 2XCFA 4BNRA 1TRNA 4I33A 2H5DA 3SUEA 1ABIH 4U2WA 3TPIZ 3CS0A 2Y5FA 1C5RA 1S84A 1QB9A 1ZHRA 1EATA 2ZCHP 2R3YA 3NWUA 4X1QU 2SGDE 3KNXA 1ZMLA 4TPYA 2FESH 4JCNA 3ITIA 1ETRH 2R3UA 3G01A 1UVUH 3M35A 4ABDA 5I25A 1DDJA 3PWCA 3MH4A 2HOBA 2V3OH 4GSOA 2GZ7A 2JKHA 1MTNB 4YM9A 3KHVA 1AE5A 2ZTXA 5EPNA 5FBIA 1P10A 1ZZZA 1ZPBA 1Z6JH 2PGQB 1QTFA 3VXEH 1S6HA 2UUFB 4SGBE 1H8IH 1ARBA 1W10U 2FODA 1F7ZA 2ZFFH 3PTNA 3UNQA 3GDUA 2XWBI 2FEQH 1LKBA 1FLEE 2BDBA 3ATIA 3K6YA 2PKSB 2XBXA 4MTBA 4CH2B 4CHAB 1CA8B 2BVRH 2J38A 1UMAH 3A7WA 1BMMH 2FYQA 2OC8A 3ZV9A 2C4FH 3BG8A 4DT7B 2W7UA 8GCHF 2H9TH 2ZTZA 3SU3A 2SFAA 3RMMH 1G9IE 2ZQ1A 3UNRA 1BHXB 3UREA 3D62A 1SQAA 1P05A 4XSKU 1Z1JA 1E35B 5FX6A 3CS7A 5EW1H 1VGCC 2AS9A 2ZHWH 1C2HA 2BVSH 1O3DA 3PO1B 2ILNA 5ABWA 1B7XB 1CT0E 4ASHA 1F5KU 4WH6A 3GY2A 2Z3DA 3MWIU 4MNWA 1JIMA 2SGPE 1ZJKA 4FVBA 1TE0A 2A4RA 9LPRA 1SI5H 5HGGA 4XBDA 1H8DH 1O3JA 2BVXH 2BDHA 5GIBA 9ESTA 1BTUA 4AB9A 2WV4A 1GJ8B 1W8BH 1SGFG 1O2HA 3V12A 5A8YA 5EG4A 3ATMA 3D49H 4IGDA 3GDSA 3MNSA 1WV7H 3MU0A 1EJMA 5GDSH 5T6DA 1MQ6A 3TH3H 3SNCA 2GV7A 3UOUA 1ELAA 4JK6A 3KQBA 1MKWH 1TYNA 1YF4A 2BQ6B 4FUIA 1OWKA 4CH8B 2R2WU 2SGFE 8ESTE 5IYTA 3QTVH 3S9CA 5E0GA 5L30H 4HI3A 1VZQH 2QYIA 1K1JA 1C2IA 1Y5UT 3GY6A 3M3SA 3E6PH 1ZTKA 1TPSA 1ZSJA 3LC3A 3ZVAA 3A8AA 4CRCA 2GMTB 3TK5A 1NFYA 5FXLA 4MPXA 4MG3A 1C5WB 2ZG0H 3LC5A 3SZNA 2XXLA 7GCHF 1D3DB 1DSTA 2GVFA 3LGYA 2PHBA 5PTPA 1YCPH 1P2JA 4LZ4B 5JPMH 4OGXA 4FU9A 4K8YA 2C8ZB 2VIQA 1V2RT 3GCTF 1WUNH 1TBZH 5HMAA 3MU5A 4INHA 3SNDA 2WINI 1AHTH 1EAWA 2O8LA 4X1SU 3QLPH 1ZMJA 4SGAE 2TPIZ 1ZRKA 4BOHA 3ZZBA 1A61H 2QXIA 1H1BA 4XBCA 2BDGA 4MVNA 1S6FA 2ANKH 1O3IA 3NUMA 3TITA 2HRVA 3RC6A 1O5FH 2BY5X 5E8EH 2UWLA 4K3JA 1BTWA 2A4GA 2FX4A 1Y3UA 1HV7A 3K65B 2WPKS 1W12U 1UJ1A 1G30B 1B0EA 5EGMA 3DT0H 1GBMA 4OS6A 3SU2A 3A8DA 1OP0A 1P2NA 3BN9A 2XC5A 1NFUA 1O3CA 1BBRH 2PGBB 2WPLS 1ETTH 2ZDVH 1QJ7B 1LVYA 2HGTH 3STIA 3SV2H 3SQEE 3SGAE 4AX9H 4JYVH 4CR5A 4CRBA 6ESTA 1UK4A 2JH0D 3V0XA 5C2ZA 4DVAU 2AMDA 1CGIE 4B73A 3M61U 2QIQA 2ZHFH 3E91A 3LDXH 2GGVB 1C2KA 4WY3A 1DXPA 5DP7A 1DWCH 4X8UH 1MBMA 4FUFA 1CHOF 1T4VH 2FS8A 3EAJA 3RMOH 1IQIA 1HXEH 1KIGH 1O2ZA 3NXPA 1SLWB 1S0QA 2VWOA 2ZDAH 3S7KB 1BOQA 2VU8E 2W7SA 2GP9B 2OD3B 1Z8JB 1JOUB 3UTUH 2UUJB 2ALVA 4ISIH 2J9NA 1OWEA 2EI8A 1AKSB 1BBRE 4AFZA 1HRTH 2VB0A 3BG4B 4R8TB 2BTCE 1YLDA 3FZDA 1NS3A 3T25A 3RXPA 4HGCA 3PYHA 3UOPA 1C1SA 1C2JA 4CBNA 6LPRA 4I7YH 3E90B 5HXFA 1UHBB 2P8OB 5TCCA 3P8NA 1V2NT 2D2DA 1C1QA 2XBVA 1O2WA 4WXVA 4X1NU 4I8JA 5A09A 4NSVA 5A8XA 1GJ7B 1ANBA 1GHAG 1H9IE 3E3TA 3SUGA 3Q3XA 4RKJB 1XUJA 2QGRA 2M5TA 4FUJA 5HYOA 3QZRA 1IQFA 1TNGA 3BEUA 4E06H 4MNVA 2VH0A 2VVVA 1W3CA 2SGQE 4OS1A 1YKTA 3H5CB 1QL7A 1SGDE 2BOHB 5F03A 3P92A 1SVPA 4TYDA 1GWAA 5FPYA 1KDQA 1TMBH 1TNIA 2SGAA 3FP6E 3EA8A 2VIWA 5JBCS 3VB4A 5FCRA 3SJ8A 2ODQA 1J9CH 1O2TA 1WTHD 1FY3A 1XKBC 2F9NA 5DP5A 1ACBE 1D3PB 1OSSA 3IG6B 3Q3KA 2BLOA 3P95A 3M36A 1VJ9U 2Y7XA 1QJ1B 3NKKA 4YOIA 4Q7XA 2ZNKH 4JZFH 4ABHA 1SSXA 1NRRH 4NZLA 3RXUA 1G3DA 2VGCB 1C1WH 2TGAA 1OWDA 1T8LA 5CMXH 3TGKE 5HM2A 1FN8A 2O8MA 4X2XA 3UQOA 1HAHH 1AVWA 1GI4A 4O97A 2LNCA 3V7TA 2HVXA 3OTJE 3KCGH 1IQEA 1F0SA 5DKMA 2P93A 1AU8A 1QQ4A 4O9VA 2F9BH 3U98H 3RP2A 1PYTD 3VGCB 3SNAA 3LT3A 1XKAC 2FIRH 2H5CA 1GJ5H 3TVJB 1GI6A 1YGCH 4IN1A 1JXPA 3LJJA 2DE8A 1BQYA 2OUAA 1O30A 4D7FA 1O5BB 2VJ1A 1HJAB 4Y76A 1DWEH 1DLEA 1GDUA 5T3HA 1LHEH 3SORA 2VIDA 1UTPA 1DM4B 3EE0B 3RXHA 3SBKA 1HBTH 1TNLA 1SPJA 2KAIA 3A88A 2A5AA 2OQ5A 1GMHG 1GI8B 1LHGH 2QCYA 4B74A 5GXPA 2PW8H 2A32A 5B6OA 2GD4B 1Y8TA 3GCNA 3HKIB 1TX6A 1T4UH 1ESAA 1TQ0B 2CJIA 4ZKRU 2ZKSA 3P8GA 2WPMS 1IHSH 2A7HA 3EA7A 4J2YB 1AQ7A 2B0FA 1EPTC 1W0YH 2G51A 2G5NA 1ANDA 2BY8X 3M5OA 3MU8A 3ZVCA 2HLCA 2HNTF 2OBQA 4AORA 1G3BA 1Z1IA 5C1UA 4NG9H 3RUOA 1SLUB 3ESTA 1EOJA 1EQ9A 1L2EA 1YC0A 1XUKA 1AFEH 3W94A 3BIVH 1TOMH 5G4BA 2AMQA 2G55A 3BTFE 3UR6A 1ELGA 4INLA 1PPEE 5EXLA 1SGFA 2F3CE 2BY7X 4LZ1H 3ELAH 1MD8A 2AERH 2TIOA 1JWTA 2BY9X 2GT8A 1O2RA 3LGUA 3DFJA 1TNKA 3IITA 3GCHB 3I77A 3Q00A 2QXJA 2QN5T 1SBWA 3HKJB 2HWLB 1BRUP 2ZWLH 2BMGB 5E2PA 1HB0B 1YCPK 3RU4T 1P2MA 1P2KA 1HAPH 4TWWA 2IOTA 3T26A 1O2NA 2F83A 2AGGX 5GPIB 2ZI2H 3M3VA 3SJKA 4NWKA 1KXCA 2XC0A 1ARCA 4Y71A 4E05H 3V13A 3SUFA 5T6FA 2WUBA 1TMTH 2YOLA 1XM1A 1MMJN 1QB6A 6CHAB 1V2LT 3O8BA 4ISOA 4JZEH 1WQVH 1AIXH 1F5RA 1W0ZU 2AEIH 4YOJA 2NU0E 1AZZA 3VB7A 3A84A 4JZDH 1VITF 1RTFB 4NIXA 1AO5A 1JRSA 5C20A 2Q6GA 1OYTH 1A3BH 2QAAA 5TCAA 1MTSA 1RFNA 3F9HA 3A85A 3MNXA 2JETB 5C1YA 2Z9GA 1BIOA 4YZUA 1VCQA 2WYJA 4IS5A 1HYLA 4UE7H 1DOJA 1O2LA 3TJNA 4ISNA 4GUXA 3UY9A 1T32A 1TALA 4XOJA 3BEIB 1QRWA 5EQQA 3NPSA 1UTQA 3S9AA 4NFFA 2O8WA 2B9LA 4ABEA 3DD2H 1C5UA 3BV9B 5L2ZH 2SNVA 1ELDE 3KL6A 1P9SA 1GG6B 4I8GA 3SOSA 4KELA 1CSOE 1MCTA 1P8VC 2THFB 1DLKB 4DIIH 3BIUH 1O3GA 4FUDA