1K1LA

Bovine trypsin-inhibitor complex
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
223
structure length
223
Chain Sequence
IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Factorising ligand affinity: a combined thermodynamic and crystallographic study of trypsin and thrombin inhibition.
pubmed doi rcsb
molecule tags Hydrolase
molecule keywords TRYPSIN
total genus 53
structure length 223
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 2001-09-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1k1lA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1k1lA02
2FOEA 1V2RT 1KSNA 1XKAC 1Z7KA 3E90B 1AGJA 4B2CA 3OY6U 4TPIZ 3M36A 3A8BA 1F0RA 1GDUA 3GCHB 3KIDU 1TGSZ 1P0SH 2PKSC 2BZAA 1IQKA 2BOHB 3BEIB 3GYLB 7GCHG 4TWWA 4CRFA 4QT8C 4Z6AH 3RXRA 3SUGA 2XBYA 1O2WA 2OQUA 3PLPA 2Z9LA 2UWPA 5HYOA 1WOFA 1YCPK 1SGIB 4ZUHA 4O3TA 1QFKH 2ZDLA 4X2VA 3GY6A 3R0FA 2A4OA 2CF8H 4I8GA 1EUFA 2A4RA 4Y11E 3IITA 2BB4A 1RTKA 1HAGE 2F83A 1BHXF 2CHAC 4A1VA 1WYKA 1P3EA 5FAHA 1XUJA 1GBJA 4GCHG 5DO4H 3KF2A 1GJ8B 1NM6A 1V2WT 4E7RG 1P9UA 2BXUH 2BY7X 1V2UT 1PPZA 2IPHA 3ZVEA 1YLDA 3T26A 1PPCE 2W26A 4H6TA 3RC6A 3HKIB 2ZI2H 9LPRA 5H4IB 3A7YA 4JYTA 3TGJE 3ODFA 2ZA5A 2Z9GA 1AWFH 1OWJA 2ZP0H 1O5CB 3RDZA 3MI4A 4YT6H 1GI3A 2GCHF 4IS5A 3SGBE 1UVSH 4SGAE 3HK3B 1Y3YA 2PTCE 5DPAA 4YOGA 2FPZA 1B0FA 4NZLA 2W7UA 2W5EA 3I29A 1ZGIA 1C5NH 1UTOA 1V3XA 1ZMJA 3FZDA 2I6QA 5LPFA 5JYIA 4GPGA 3UREA 5GCHG 3UIRA 2P95A 4BAHB 1PQ8A 5C3NA 1GBBA 1QQUA 3LGVA 3HGPA 1JRTA 4XFQA 1RXPA 1RS0A 1O3EA 5A09A 4Y8ZA 2UWOA 2JH0D 1GJ9B 3S7KB 4O97A 4XBDA 4WMEA 2FOCA 4TYDA 3LKWA 1O3KA 2CGAA 1A1RA 1N8OB 1AVWA 4ZHLU 1V2VT 1CGIE 4NFEA 2Q6FA 2YOLA 3VB5A 3RXHA 2CXVA 2FI5E 3M7QA 1DWDH 2BD9A 3UPEA 1J17T 4WVPE 1SGNE 2ZU1A 4K2YA 1E36B 4DOQA 1J9CH 1AFQC 3SJIA 2BVSH 2AEIH 4IMZA 1LHFH 2BLWA 1IQFA 4ABBA 1S6HA 1Y59T 2VU8E 2J2UA 4MQAA 1C5WB 1P11E 4WMDA 1GMDF 3UQOA 3NUMA 1DDJA 2GZ9A 1FN8A 4B75A 1YCPH 2OD3B 2CN0H 1O2GH 2BD5A 2VIPA 4JYUH 4KP0A 4TY6A 2Y7ZA 3QZQA 2BDBA 1FY4A 1KTSB 1KLJH 1PYTC 2VWNA 1MU6B 4H42U 3HATH 2ZCHP 1SHYA 1J14A 1CBWC 1P02A 2ANYA 4JYVH 4ZKSU 2ZZUH 2FYRA 1KLIH 1V2ST 2R9PA 4A6LA 4D7FA 2ZQ2A 1DE7H 1QJ6B 3UOUA 1WV7H 3FP8E 4FUEA 2HRVA 3K2UA 1AKSB 2V35A 5AF9H 4AYVB 1T8MA 1IQGA 1O5BB 2ZDAH 1SGRE 1LHCH 2BQWB 2Z3DA 1ZLRA 3DT0H 1AZ8A 1DY8A 2OINA 1SR5C 2YNAA 3ATWA 1IQMA 1LVMA 4U32A 1DWBH 4A92A 4GAWA 1O2RA 3TPIZ 2B7DH 4KTCA 1ABJH 2ANWA 2LPRA 3A84A 2OBQA 3UWIA 2HALA 1W14U 3MO9A 3Q76A 4UE7H 2ZGXH 1ORFA 1EZUC 1NFXA 1O3OA 1CA0B 1W7GH 3BTWE 1GVKB 4MDSA 4ABAA 1F5LA 2WPJS 1BB0B 2ZFSA 2NU0E 4HTCH 1UCYH 4Y6DA 1TQ7B 2A32A 1TBQH 2OLGA 1SGDE 1HRTH 1O3JA 1LVYA 3NKKA 1C1WH 2FOFA 2SFAA 5LH8A 2TPIZ 3VFEA 4GVUA 2Q1JA 2XXLA 3SU0A 1UCYE 3SJ8A 1O3PB 1C2IA 2QYIA 4X1QU 1Z8IB 2XCFA 3TNTA 1E38B 5CMXH 1QBOA 2F9OA 2VH6A 5K7RA 1TX8A 1OWEA 1H8DH 3UY9A 3SNBA 1NU9A 4AGJA 1XXDA 2O8LA 1YGCH 1K1MA 2B0FA 2EI6A 5PTPA 4K1SA 4I33A 1ZTKA 2Q6DA 2XC0A 3OYPA 3MU8A 3BEUA 1TMUH 4GUXA 1F0SA 4Y8XA 2FOHA 1ZJDA 3TGIE 4MPUA 1YF4A 2R2MB 3GYMA 1HAVA 2FI4E 1EPTA 1F0TA 2AMDA 2AERH 2I6SA 3SI3H 2W3KA 1W8BH 2ASUB 1GGDC 1L1JA 5E0GA 5C5NA 6LPRA 4JK6A 3O8CA 1VITF 3SBKA 2IJOB 1TGBA 1C4Y2 3QWCH 1THPB 4SGBE 1P2KA 2ODYB 4MPVA 3T2NA 3MH7A 3LONA 2ZCKP 1OYQA 4FUDA 2ZFTA 1EOLA 1O37A 3ZZBA 2B9LA 1SVPA 1SBWA 3RXJA 4B74A 2BOKA 9ESTA 1X7AC 1P01A 4CH8B 5LGOA 4HGCA 1MTWA 2GDEH 3RXBA 3ZZ3A 1O32A 1TLDA 1AUJA 1GCDA 2UUFB 2ZWLH 4I32A 3FANA 1K22H 1INCA 4TWYA 4MG3A 3U69H 1GHBG 2BVXH 1SL3A 1BBRE 5CE1A 3VEQB 1Y8TA 4U01A 1HLTH 4AG2A 2QAAA 5DP6A 5DP5A 1EP5A 4OGXA 1ZJKA 1ZPZA 1M9UA 1HIAB 1KXDA 5LPEA 1NRSH 1AB9B 1O5FH 1H8IH 1TA2A 5FCKA 3CENA 4RN6A 3Q77A 1Y3VA 1C5XB 2AMQA 1K1PA 5T6GA 1O5DH 2PGQB 2NU4E 1AFEH 1XUHA 3EA7A 1DT2A 4E06H 1HAVB 1TRYA 2AYWA 3K9XB 3V12A 1UK2A 2BM2A 1ZGVA 2OC0A 2YNBA 2D8WA 1K28D 1O2UA 3RM2H 3PYHA 2ZU3A 1XMNB 2KAIA 4DG4A 1UTMA 1GJDB 2ZO3H 2J9NA 4YO9A 4X6OA 4Y8YA 2B8OH 5DKMA 3GISB 1RJXB 3GOVB 1OWHA 1QL8A 1SMFE 4Y10E 3GCNA 4JCNA 1FN6A 4IBLH 2SGQE 1K2I1 3SNEA 3BIVH 1S0QA 1C5QA 1VGCC 3SU2A 1GL1A 6CHAB 4Q7XA 1A5HA 1P06A 1UJ1A 3A7TA 4B2BA 1G2MA 4NIVA 1T8LA 1ELFA 3SOSA 4DW2U 1YPJH 1QY6A 3BSQA 4I8KA 1O2VA 1SGFA 1WBGB 5C1YA 1ZMNA 3RU4E 2ZTXA 5EQQA 7KMEH 2FWWA 1PPBH 2QF0A 3AW0A 1TBRH 1C1QA 1ZHRA 3PTBA 3RXQA 2XYAA 2ZFRH 3STJA 1AO5A 1AE8H 1GBKA 3W94A 2ZHQH 1ANCA 1C2DA 3DD2H 4LXBH 3LIWA 3DA9B 3W95A 3MO6A 4MVNA 4FUBA 2CF9H 2M5TA 3RMOH 1GG6C 3S9AA 1QQ4A 2BMGB 3CS7A 5EW1H 2Y81A 1LHDH 1HAIH 4YOIA 2QIQA 3K6YA 3SV7A 4CHAB 1W13U 2ZPRA 4JZ1A 1L1NA 1ZHPA 4DIHH 1CT0E 1AY6H 1O0DH 2O8WA 4CREA 2JH6D 1OX1A 1OOKB 1A5GH 1UMAH 1WQVH 2HNTF 1DSUA 4CBNA 4ABDA 4JZIA 1BCUH 1O31A 1WU1A 2EI8A 3ODDA 2A4QA 2EC9H 1NFUA 5B6OA 1MKXK 1C1TA 3ATLA 3Q3YA 1Y5AT 4WXVA 1EPTB 3AW1A 8ESTE 7ESTE 3ELAH 1O2JA 1PPFE 1O3BA 1Y3UA 2GDDA 3TLOA 1ANDA 2XCNA 2BDAA 5C5OA 3TU7H 2FX4A 1GBCA 2QC2A 3KEEA 1TX6A 2VWLA 4ABJA 4IN1A 3V13A 4KGAA 1MKWK 1HGTH 3RC5A 1GMHG 4ISOA 2F9UA 1W10U 3MO3A 3QZRA 4Q7ZA 3A81A 4NFFA 1CO7E 1BIOA 3GY8A 3GCTF 3JZ2B 1C2MA 3M3TA 1MMJN 4ISIH 1Z6JH 3BTFE 3S9CA 1PFXC 2J95A 1C1PA 3NWUA 3V3MA 4B71A 4K1EA 1Z6EA 1KXAA 4ZKNU 3M5MA 2BDCA 4IGDA 3QGNB 3P8FA 4YT7H 1QURH 1UTPA 4CRGA 1Q3XA 5L2ZH 1T8OA 1O3AA 4F49A 1L4DA 4MNYA 3SU5A 2A4GA 1MD8A 2GP9B 1FI8A 2GKVE 3RXAA 1O3GA 1H4WA 2GGVB 4K5ZA 2BY8X 1XUGA 1LHEH 1PPEE 3MU1A 3A80A 3STIA 4X1NU 2OXSA 1TB6H 1EAWA 3L6PA 2XTTB 1GPZA 3TITA 2TGPZ 3SGAE 3PM3A 1FY8E 1KXEA 1C1SA 1BZXE 2HPPH 3KQDA 1QIXB 4UDWH 1DFPA 1C5PA 2Z3CA 4J1YA 2A45B 1NU7B 1P10A 1TQ0B 3SNDA 5DP4A 3DHKH 3FP7E 1GVZA 1TNIA 3TJNA 4XDEA 1UCYK 1N1LA 1P2OA 4X1SU 4NGAH 2BQ6B 1O5AB 4AN7A 1BITA 2GCTB 2ZFPH 2Y5FA 4WH8A 3M5LA 2WV4A 1ZTJA 1KIGH 1TNKA 2V6NA 2GCHG 4NA8A 3UWJH 1A0JA 2ZKSA 1TGTA 4FXGH 4I8JA 1BDAA 1KY9A 1DX5M 1HJAC 1FPCH 3VB4A 1P2IA 4HFPB 3VPKA 1IOEA 1D6WA 1N6YA 2VIWA 2RCEA 1GCTB 3A7VA 1GHVH 2ZDKA 1O2NA 1L4ZA 4Q7YA 1XVMA 2QXIA 3GDUA 3A86A 1HFDA 3PTNA 1GBLA 3AAUA 3UNQA 1S82A 3H7TA 4KTSA 1G3EA 3RXCA 2SGAA 4Z0KA 2QGRA 5EQSA 1TOCB 1QB6A 3QTOH 5E0HA 1TNHA 1SPJA 4NIXA 2PKSB 3F68H 2Q6GA 2BYAX 2A2QH 1HB0B 1SLUB 2GMTB 5AFZH 7LPRA 3H7OA 2ZPSA 5GXPA 2A7JA 2R3UA 1YM0A 1PYTD 5IYTA 3T25A 2H9EH 1ELVA 1QA0A 3K65B 4Y79A 1F5KU 2BXTH 2C8XB 1P09A 3I77A 4JZDH 2C8ZB 2PWXA 2Y5GA 1SLWB 3P92A 1QL7A 1SGEE 4IC6A 1MD7A 4FVBA 1LPGB 1KXCA 2FIRH 2XWAA 6GCHF 1GHZA 1W7XH 1C5VA 1G3CA 1NT1A 5I46H 2VVVA 2ZG0H 3TJVA 3RP2A 1GJ6A 5DP8A 3U8RH 2AIPA 1ANBA 1O2IA 3QTVH 3LOXA 4K8BA 4ZMAH 3BTQE 4ABFA 1UHBB 4YM9A 3LH1A 5T3HA 1MBQA 4AYYB 4E05H 1TNLA 2P8OC 3SU1A 1EATA 6CHAC 4FUCA 2FOGA 1HJ8A 1P05A 2JETB 1CA8B 2ZTZA 1EB1H 1BTZA 2O9QA 4CHAC 1CQQA 2PLXA 1ELTA 5JBBS 1AD8H 1C2LA 2HWLB 1SFQB 4YOJA 1CSOE 1XUIA 5TCCA 3MNCA 4K69A 1GBMA 2R0KA 5F03A 1O3NA 5FHTA 4VGCB 4FU9A 4K3JA 1IAUA 3RXSA 3E0NB 1SI5H 3BTEE 2XBXA 2R3YA 3C1KA 1CE5A 3TJUA 2PV9B 3E91A 4GHQA 1SG8B 2RG3A 1TNGA 2J94A 1W2KH 2A2XH 1UTKA 1QR3E 1PPHE 3NPSA 5DP3A 4X0WU 1NTPA 1AB9C 3MWIU 1TGCA 3ATMA 4YESB 1FLEE 3KQEA 1H9IE 2ZPQA 3ATIA 1NN6A 3LJJA 1Y5BT 2O8UA 3MU0A 8LPRA 1W0YH 3GY7A 5HM2A 3A87A 1D3QB 1NRRH 5C2ZA 1KDQB 1MAYA 2R2WU 1GCTC 2FOMB 2XRCA 3UR6A 3SU4A 1V2KT 3ZYEA 1MU8B 1NC6A 1D6RA 1LCYA 3PV4A 2FXRA 1CHGA 1BT7A 1TIOA 4ABGA 5EW2H 3SUFA 3C27B 1EZSC 2Y5HA 1C1UH 4X1PU 3V7TA 4THNH 3SQEE 4XOJA 4UFFH 1SHHB 3NZIA 3SW2B 1W11U 1LPKB 3GY2A 1DVAH 3QLPH 1GI4A 1OWDA 3BG8A 1F2SE 3M7TA 2BQ7B 1XUFA 1AUTC 3M61U 2PKAB 1DITH 3PLKA 2FS9A 1VCPA 2P3UB 4ISHH 1V2PT 5DG6A 4CRBA 2VNTA 3T62A 1FIZA 2P94A 3LJOA 2EI7A 4NWLA 1EZXC 1UO6A 1PJPA 5EU8A 3T5FH 1MUEB 1O5GH 1S0RA 3KL6A 2C90B 1AU8A 4M7GA 1MTVA 1EZQA 2BDIA 1FDPA 3E0PB 1SGTA 1SQOA 3RXTA 2AMPA 1VJAU 4ISNA 3LC3A 2J34A 1GHBF 1O38A 1SQTA 4R0IA 4NWKA 2PHBA 2AS9A 3MNBA 2P59A 3AVZA 4Y0ZE 3URDA 1C1OA 2JKHA 5GIBA 3UNSA 3E8LA 3R3GB 1V2QT 1GHAF 5TJXA 3SNAA 3MFJA 2WYJA 2Z6BD 3SU3A 1B5GH 4O03A 2VVUA 1QL9A 4X6MA 1BMLA 1J8AA 2GD4B 2G5NA 4D9QA 4I7YH 1UTLM 1ARCA 2PTNA 3A85A 5AFYH 2V3HH 1BRBE 3DFJA 4FUJA 1GG6B 1GJ7B 3RXFA 2BY9X 4X8VH 1ZRKA 5EXMA 1GHXH 4AFUA 1IQNA 1QBNA 4NZQA 3ZVDA 4LZ1H 2H6MA 3LGYA 7GCHF 2NU1E 2WPLS 5TCAA 4IC5A 2ALVA 1Z8RA 1O39A 1F92A 1EKBB 3UNRA 4AFZA 3PMJA 1J15A 3A8AA 1EJNA 4NCYA 1HAHH 3AASA 1QA7A 4BAKB 3RXGA 4A7IB 4IMQA 1DSTA 4RKJB 1BA8B 1S83A 2FTLE 2AGIX 1ELDE 2G81E 2BD3A 3K6ZA 1YPEH 5FPTA 2CV3A 3LT3A 1BMAA 1BTYA 4K1TA 2C4FH 1U6QA 1C4V2 2BX4A 3BV9B 1YPHC 4NSYA 1CA0C 2PUQH 4X2XA 3SV6A 4ABEA 3VB3A 4A1XA 1WTGH 3P8GA 3PMAB 4WF8A 5GJ4B 2THFB 1AI8H 2EEKA 3KHVA 1SGQE 3E1XB 2FESH 3RLYH 1LKBA 2Y80A 1G37A 1DLKB 2Y82A 3OX7U 3VXEH 1C2HA 4KKDA 3MU4A 4K60A 5F8TA 4AB9A 5L30H 3RXEA 2OCVB 4Y0YE 1EAXA 4FUHA 4BANB 4AX9H 5JBAS 1LPZB 4U2WA 4WH6A 1QCPA 3EAJA 5G4BA 4DURA 2Y7XA 2ZTYA 2ILNA 1O2QA 3O8DA 1H1BA 4KELA 5ABWA 2BLOA 1BHXB 2WINI 2ZGCA 1OP2A 3NXPA 2R0LA 5J4SA 1ESBA 1G2LA 1CBWB 2PGBB 5EPNA 1EXFA 1P2JA 2ZFFH 3DUXH 4OS4A 3P95A 4OS7A 1KTTB 4MNWA 1Y3XA 1KLTA 3IG6B 5A2MH 4XBCA 1NY22 1AIXH 1GJBB 1WUNH 2VWOA 2Z3EA 4OS6A 1F7ZA 1FAXA 2ZGJA 5T6FA 1HAYB 1UK4A 5AHGH 1WTHD 2G5VA 2F9NA 1OS8A 1ANEA 2ANMH 4AZ2B 1ARBA 1ZOMA 1ETSH 1S81A 1FNIA 1TPAE 3HPTB 1GMDG 5L2YH 1YPGH 4ZHAA 5JBCS 2EA3A 2ZU4A 3SHAH 2F9BH 1QRWA 4NA9H 1QNJA 2G55A 2UUYA 2FDAA 3FAOA 1J16A 1G3DA 1QRXA 4I8LA 5FPSA 1HIAA 1MZDA 1Q31A 1A7SA 1HCGA 2WYGA 1G3BA 3QUMP 2XC5A 3NK8A 3OY5U 3RC4A 1CU1A 1ELCA 1K1JA 1DXPA 1FPHH 3QX5H 2FO9A 4CRAA 1GJCB 3WY8A 2GT8A 4DIIH 1O2KA 5SGAE 3RXKA 1VR1H 4K8YA 1TFXA 1TRMA 5E2OA 1O34A 3FZZA 2J38A 1SOZA 3NCLA 3U1JB 2BD2A 1IQIA 4WY3A 5GCHF 1MTNC 3SHCH 5CHAC 4Y7BA 4WXIA 3A83A 1T7CA 2UUJB 1C1RA 2FM2A 2ZHWH 1XM1A 1LTOA 1O2ZA 1KYNA 1F0UA 3ZZDA 5JB8S 2CMYA 5I25A 2A5AA 4IN2A 1L2EA 3RXOA 1DXWA 3ESTA 1QHRB 1TMBH 1GBAA 5HGGA 2H5CA 4H6SB 2P3TB 1HNEE 4AOQA 1O2PA 4CR9A 2IN2A 1UVOA 2FZZA 1BTXA 4FUIA 2WPKS 2BLVA 1BTHH 2O8MA 3ZZ6A 1C1MA 3KNXA 3ZYDA 1O3CA 1KDQA 2H9HA 1SGYE 1MQ6A 1YYY1 1AWHB 2J92A 3RMNH 3P8OA 3ZVCA 4NSVA 2D1JA 3CS0A 4AORA 1FUJA 1BRAA 2D26C 1XXFA 5JPMH 3EYDA 3VB7A 2XNIA 1V2JT 1Z1IA 1GDNA 3EDXB 1GJ4H 4WWYA 4YLUA 1AKSA 4D9RA 1QJ7B 1JMOH 2A0QB 1O3HA 1JBUH 2IOTA 1C5LH 1BRCE 4X6PA 3SUEA 3RXIA 1LVOA 3ZZAA 2GT7A 3A7XA 1GBEA 2P3FH 1K1IA 3RM0H 4ZXXH 1E35B 2VH0A 4JZEH 1S85A 5C67A 2ODPA 1EB2A 2RA0A 1MZAA 1HXFH 1O33A 1GI7B 2O8TA 5A8YA 4GSOA 1ZZZA 4MNVA 1ABIH 1BTPA 4CH2B 1GBFA 2V3OH 3VB6A 3UQVA 1GI5A 5EOKA 1MTNB 4B1TA 4PROA 1G9IE 1CVWH 1VITG 3LGIA 1WQSA 1TPSA 5F8ZA 1O3LA 4JZFH 3TK6A 4D76A 2JETC 3EA9A 1TWXB 3BTME 1NPMA 2KAIB 4RSPA 1GHAG 3LU9B 3ENSB 4TPYA 2GTBA 3PO1B 1T31A 2ZF0H 4MNXA 2OBOA 1K21H 3D49H 3RU4D 3M7UA 3T29A 1G32B 1NO9H 2Z7FE 3F9GA 2AH4X 1D9IA 2ZGHA 1ZRBA 1EPTC 1TABE 1ELEE 4JMYA 1VZQH 1QRZA 2C93B 2BDYA 1FQ3A 3ZZCA 1RFNA 2TGDA 3MH5A 1GBIA 1TBZH 1P2NA 1LVBA 4X8UH 3ZVAA 2VINA 2ZIQH 1C4U2 1SC8U 1JWTA 3RXVA 1JIRA 3SV2H 1HJAB 1AZZA 1E37B 1NZQH 2Z9JA 4OGYA 2HGTH 1Y5UT 1GL0E 2BD4A 1TONA 3SN8A 4X6NA 3Q3KA 5DP9A 1NROH 1D4PB 1HAOH 4Y7AA 3BN9A 2AGGX 3ZV8A 1BJVA 1MTUA 1THRH 3PMHB 1T8NA 4HZHA 3ZVGA 1ZPCA 4J2YB 3JZ1B 1AN1E 1CT4E 4O3UA 1GWAA 3ZV9A 4F4OC 1EOJA 2Z9IA 4MLFB 1O2HA 1GHYH 5AVDA 5DGJA 3KQCA 3RXLA 3SU6A 2GVFA 4WJG2 1QBVH 1P8VC 3P6ZB 2WUBA 1TX7A 4Y71A 1O2LA 1QJ1B 3ATKA 2ZHEH 1YPHE 1V2LT 1W0ZU 2QXHA 2BD8A 3TH4H 1K1OA 1TRNA 1GI8B 2VJ1A 3U8OH 2A7CA 2TGTA 1VCWA 5E0JA 3IWMA 3TH2H 3SO3A 5LPRA 3BTDE 5EGMA 2SNVA 2PSYA 1GBDA 2G00A 1FIWA 2PSXA 1YKTA 2HNTE 4NIYA 2ZC9H 1VGCB 2FS8A 1ZPBA 3M5NA 1YBWA 4YLQH 1TNJA 1YLCA 2PUXB 4ZH8A 3M3SA 1V2MT 1DOJA 1ETTH 2RA3A 3E3TA 5A0AE 1DWCH 3SI4H 3GY4A 1D3PB 1G36A 1DUAA 1ZR0A 4UD9H 3U9AH 4R8TB 3O8BA 1KXBA 4D8NA 1D3TB 3N7OA 3QK1A 1UTNA 1C5UA 4AG1A 3P17H 4MTBA 3RXUA 1MAXA 4Q80A 2ANKH 1A3BH 1QB9A 2K1QA 3F9EA 3M5OA 4Q2KA 1PPGE 2BHGA 4UFDH 3EA8A 1FJSA 2Y6TA 1GI1A 3MU5A 4O9VA 4A5TS 2FLRH 3B23B 4FU8A 3BIUH 4Y76A 1FY5A 1AFQB 2QV1A 1O3DA 2FP7B 3EQ0H 3FVFB 5FXLA 1GMCF 2D2DA 4HI3A 1S6FA 1E34B 1SQAA 4DCDA 3BG4B 3LH3A 3SJKA 4BNRA 1ZSLA 3SGQE 1K1LA 4BAQB 2XBWA 3GY5A 3PO1C 1YPMH 2G8TA 2ZQ1A 1MCTA 4UONA 1LMWB 1ZSJA 2ODQA 2BY6X 4TY7A 1O2XA 1NESE 1O3IA 3G01A 1MTSA 3Q3XA 5FPYA 2NU3E 2TBSA 2FLBH 2P93A 5BPEA 3TIUA 1EP6A 3BEFB 1A4WH 2SGPE 1FV9A 3FFGA 3M35A 3D65E 4FVDA 1AVGH 1E0FD 1ELGA 2W7SA 1CGJE 1NRQH 3SNCA 2VVCA 1HYLA 1TOMH 1GJ5H 2QA9E 1ID5H 3QO6A 4GCHF 3VGCC 3M3VA 2F91A 3OU0A 1D3DB 5FBEA 1ACBE 2ZHDA 1OSSA 2C8WB 1H9HE 2VIVA 1HAZB 1HBTH 1DWEH 1XVOA 1NRNH 2BZ6H 2ALPA 5CHAB 4ZKOU 1T4UH 1H9LB 2TRMA 2B5TB 4A1TA 2XWBI 2F9VA 3KQBA 4UFGH 2ZECA 3T27A 3ITIA 1DUEA 1CGHA 1ESAA 1RD3B 1LO6A 4ABIA 1A3EH 2JH5D 4U30A 4NIWA 1TE0A 1ZYOA 1N6XA 1TAWA 1S84A 1DLEA 1O2TA 4INHA 3P70B 4BAMB 4X2YA 5EQRA 1OWKA 2ULLA 3D23A 2OC8A 2PR3A 2VB0A 2SGFE 1O35A 2SGEE 5ESBA 3H5CB 1GBTA 3GCHC 2BLQA 1DM4B 4NA7A 1LQEA 3GCOA 3MTYA 3FP6E 2OC1A 1C5ZB 3CP7A 1LKAA 3SQHE 2GZ7A 5BRRE 4X2WA 4BTUB 2BVRH 4OS2A 3TNSA 3SJ9A 1RRKA 1S5SA 3LC5A 1B7XB 3ZVFA 2HOBA 3U8TH 2F9PA 3UTUH 3MHWU 4ISLA 1C9PA 2WV5A 5L6NH 3GY3A 2GMTC 2NWNA 2HVXA 1DY9A 1EJAA 2XBVA 4DGJA 2GV6A 3QGJA 3TK5A 4FU7A 4B2AA 2G51A 1SLVB 3UUZA 4CRCA 1A0HB 2HPQH 5DK1A 4OS1A 3B8JA 5A8XA 4ZXYH 5GDSH 2G52A 2FOBA 3ZZ7A 1CT2E 3QN7A 1FZZA 3S69A 1HDTH 1VJ9U 2GV7A 1TYNA 1OKXA 1HV7A 4LOYH 2XW9A 1FXYA 4BXSA 2UWLA 4NG9H 3LGTA 3F1SB 2BD7A 1Y3WA 1IQJA 3P8NA 3BTTE 4XBBA 4XE4A 1FMGA 1HAXB 4BOHA 1BJUA 1IHSH 1V2TT 4WMFA 5EPYA 3URCA 4BXWA 3HKJB 4AGKA 4ZKRU 1DS2E 5C1XA 2VGCC 3UR9A 1GBHA 2NU2E 3A8CA 2OTVA 3HK6B 4INKA 2WPIS 1SSXA 3RXDA 2CJIA 1XX9A 2J4IA 3E16B 4MPWA 5JDUB 1OXGA 2FOAA 1TPPA 1C2FA 4B76A 5EG4A 1IQEA 5FX6A 1QGFA 2GX4A 3L3TA 5DJ7A 2OP9A 2ZDNA 3GICB 1G30B 4GLYA 3A8DA 1GI0A 2PFEA 3KCGH 1P9SA 5EXLA 2P16A 1RTFB 2STAE 3M37A 1P2QA 3A7ZA 3ZZ4A 2OQ5A 4AB8A 1A0LA 1A61H 2GZ8A 2Z9KA 2VIQA 2STBE 1SGCA 2BDHA 1OP0A 4KTUA 2Z94A 3PWBA 4H4FA 5DP7A 2A1DB 4CBOA 1XUKA 4BAOB 1ESTA 1L0ZA 1P04A 1CHOG 3D62A 4X8TH 5FCRA 1VITH 3UOPA 1PQ7A 3LGWA 1JIMA 4I8HA 3VGCB 1GI9B 2H1UA 3BTGE 1NFYA 3ZZ9A 1VCQA 1UVPA 2GCTC 1BRUP 2VWMA 3VXFH 1O2YA 3F9FA 1GI6A 1P57B 3SJOA 5F8XA 1RTLA 3U98H 3A7WA 1BTUA 1EAIA 1WCZA 1GGDB 2AFQB 1ELAA 4UFEH 3EGKH 1YPKH 1BMMH 1GDQA 3RU4T 1C5MD 1JOUB 4FUFA 5F6MA 1CHOF 1KXFA 3MMGA 1QTFA 2WUCA 3MH6A 1AVXA 3ZZ8A 3OSYA 4XSKU 1AMHA 4RKOB 3MH4A 1C5OH 2H9TH 2OUAA 1IHTH 1GVLA 3PMBB 4DY7B 3UFAA 1HJ9A 3V0XA 4CRDA 1Z8GA 4CR5A 1GI2A 1GMCG 2VIOA 2CHAB 2DUCA 2ZHFH 4INLA 3SV8A 2BTCE 3S0NA 4BTTB 4AFQA 1RIWC 2ZFQH 3GDVA 2V0BA 1C5TA 1OP8A 1SGFG 2ZDVH 5EXNA 1AQ7A 3E6PH 4ASHA 3L33A 5A0CA 6GCHG 1LQDB 1O36A 2FX6A 5ETXA 5JBTA 3S9BA 1XKBC 3MYWA 2QXJA 3DFLA 5IDKA 1K9OE 5HM9A 2BDGA 1A2CH 1THSH 4D7GA 3SUDA 5A8ZA 2QN5T 1C2KA 5T6DA 1YC0A 2DE9A 1RIWB 1DICA 1MH0A 3TH3H 3PROA 2H5DA 2SGDE 1UK3A 1A5IA 1GJAB 3EE0B 1WAYB 3HGNA 1TGNA 3KN2A 2FTMA 3RUOA 5E2PA 1HXEH 1O3FA 2ZU2A 1MKXH 2LNCA 2WPHS 1IQLA 2AGEX 1BTWA 1EAUA 1NS3A 1PQ5A 3RXPA 3MNXA 1AE5A 1F5RA 8GCHF 1Z8JB 3LPRA 1SB1H 2FODA 3MOCA 4AFSA 1ETRH 5HMAA 5ESTE 1A46H 2RDLA 2VIDA 1UTQA 2G4UA 2ZNKH 3A82A 1MKWH 1MQ5A 1FY1A 2QXGA 1MBMA 1C2EA 1C5RA 2A5KA 3KGPA 2WPMS 5C1UA 1ZSKA 5GPIB 1EJMA 4YZUA 2ZU5A 2ZEBA 1C5YB 4JK5A 1C1VH 1O30A 4ABHA 1C2GA 3SV9A 1BOQA 4ZROA 1ZHMA 1C5SA 3F6UH 5EODA 3MNSA 1V2OT 1NFWA 1T4VH 8KME2 8GCHG 4UEHH 4YTAA 3SZNA 1HUTH 3U1IB 1SGPE 2C8YB 1TPOA 2FYQA 2FI3E 1FY3A 4LK4A 4X8SH 1B0EA 1HPGA 3A88A 3RLWH 3SORA 2G4TA 6ESTA 3F9HA 5E8EH 2F3CE 4DT7B 1JRSA 2A5IA 1W12U 1O3MA 1T32A 1P3CA 1YCPM 1EX3A 1JXPA 2FEQH 3QDZB 1L1GA 2ZGBH 3I78A 1O2OA 1Z71A 4B73A 1BBRK 4E7NA 3RXMA 4ZAEA 2TIOA 5GWZA 2XC4A 1BMNH 5A0BA 2P8OB 2ESTE 3ZVBA 2ZCLP 2C3SA 3OTJE 3BTHE 1EASA 1V2NT 1P2MA 2ZDMA 1N8OC 1ZTLA 2QF3A 1V6DA 4FUGA 1C1NA 3BTKE 2FMJA 3GDSA 1FONA 2A31A 1Z1JA 4DJZB 1LDTT 1OYTH 1FAKH 3LGUA 2H2ZA 1YP9A 2HNTC 3S7HB 4X1RU 4LZ4B 1Q2WA 3TGKE 5JB9S 5J4QA 2VGCB 1BBRH 3B9FH 5FBIA 1C9TA 1P12E 3AAVA 4IW4E 4VGCC 2TGAA 1PQAA 1HAPH 2OC7A 1MCVA 1K1NA 3RMMH 2BX3A 1O2MA 1SFIA 1NRPH 3T28A 1SOTA 5C20A 3Q00A 1ZMLA 1BUIA 2BY5X 4ESTE 4ZHMU 1BQYA 5FX5A 2W3IA 1UVUH 3ZZ5A 3O8RA 1OPHB 5K0HA 5HXFA 1RGQA 1EQ9A 1QB1A 1WSSH 1IQHA 3RMLH 1TA6A 4I31A 3TK9A 1OWIA 4GHTA 4MPXA 1GMHF 3PB1E 2SNWA 1UTJA 2A7HA 2PKAA 2PW8H 1UVTH 4BTIB 3A89A 4OS5A 2QCYA 1O5EH 4DVAU 1AHTH 3GCTG 3PLBA 2QY0B 1TALA 1ELBA 1O2SA 1W3CA 1LHGH 1C2JA 3TJOA 2DE8A 1TMTH 2UUKB 2AIQA 1YPLH 1GHWH 1UHBA 1P03A 3TVJB 1SLXB 2HLCA 1DPOA 3PWCA 3LDXH 3BG4C 1DANH 3BF6H
chains in the Genus database with same CATH superfamily
2FOEA 1V2RT 1KSNA 1XKAC 1Z7KA 3E90B 1AGJA 4B2CA 3OY6U 4TPIZ 3M36A 2KCOA 3A8BA 1F0RA 1GDUA 3GCHB 3KIDU 1TGSZ 2W6JD 1P0SH 2PKSC 2BZAA 1IQKA 2BOHB 3BEIB 3GYLB 7GCHG 4TWWA 4CRFA 4QT8C 4Z6AH 3RXRA 3SUGA 2XBYA 1O2WA 2OQUA 3PLPA 2Z9LA 2UWPA 5HYOA 1WOFA 1YCPK 1SGIB 4ZUHA 4O3TA 1QFKH 2ZDLA 4X2VA 3GY6A 3R0FA 2A4OA 2CF8H 4I8GA 1EUFA 2A4RA 3F2FA 4Y11E 3IITA 2BB4A 1RTKA 1HAGE 2F83A 1BHXF 2CHAC 4A1VA 1WYKA 1P3EA 5FAHA 1XUJA 1GBJA 4GCHG 5DO4H 3KF2A 1GJ8B 1NM6A 1V2WT 4E7RG 1P9UA 2BXUH 2BY7X 1V2UT 1PPZA 2IPHA 3ZVEA 1YLDA 3T26A 1PPCE 2W26A 4H6TA 3RC6A 3HKIB 2ZI2H 9LPRA 5H4IB 3A7YA 4JYTA 3TGJE 3ODFA 2ZA5A 2Z9GA 1AWFH 1OWJA 2ZP0H 1O5CB 3RDZA 3MI4A 4YT6H 1GI3A 2GCHF 4IS5A 3SGBE 1UVSH 4SGAE 3HK3B 1Y3YA 2PTCE 5DPAA 4YOGA 2FPZA 1B0FA 4NZLA 2W7UA 2W5EA 3I29A 1ZGIA 1C5NH 1UTOA 1V3XA 1ZMJA 3FZDA 2I6QA 5LPFA 5JYIA 4GPGA 3UREA 5GCHG 3UIRA 2P95A 4BAHB 1PQ8A 5C3NA 1GBBA 1QQUA 3LGVA 3HGPA 1JRTA 4XFQA 1RXPA 1RS0A 1O3EA 5A09A 4Y8ZA 1YLNA 2JH0D 2UWOA 2L74A 3DSPA 1GJ9B 3S7KB 4O97A 4XBDA 4I86A 4WMEA 2FOCA 4TYDA 3LKWA 1O3KA 2CGAA 1A1RA 1N8OB 1AVWA 4ZHLU 1V2VT 1CGIE 4NFEA 2Q6FA 2YOLA 3VB5A 3RXHA 2KFWA 2CXVA 2FI5E 3M7QA 1DWDH 2BD9A 3UPEA 1J17T 4WVPE 1SGNE 2ZU1A 4K2YA 1E36B 4DOQA 1J9CH 1AFQC 3SJIA 1FX0B 2BVSH 2AEIH 4IMZA 1LHFH 2BLWA 1IQFA 4ABBA 1S6HA 1Y59T 2VU8E 2J2UA 4MQAA 1C5WB 1P11E 4WMDA 1GMDF 5EJ1A 3UQOA 2J5UA 3NUMA 1DDJA 2GZ9A 1FN8A 4B75A 1YCPH 2OD3B 2CN0H 1O2GH 2BD5A 2VIPA 4JYUH 4KP0A 4TY6A 3H09A 2Y7ZA 3QZQA 2BDBA 1FY4A 1KTSB 1KLJH 1PYTC 2VWNA 1MU6B 4H42U 3HATH 2ZCHP 1SHYA 1J14A 1CBWC 1P02A 2ANYA 4JYVH 4ZKSU 2ZZUH 2FYRA 1KLIH 1V2ST 3ZIAD 2R9PA 4A6LA 4D7FA 2ZQ2A 2WHXA 1DE7H 1QJ6B 3UOUA 1WV7H 3FP8E 4FUEA 2HRVA 3K2UA 1AKSB 2V35A 5AF9H 4AYVB 1T8MA 1IQGA 1O5BB 2ZDAH 1SGRE 1LHCH 2BQWB 3U28C 2Z3DA 1ZLRA 3DT0H 1AZ8A 1DY8A 2OINA 1SR5C 2YNAA 3ATWA 1IQMA 1LVMA 4U32A 1DWBH 4A92A 4GAWA 1O2RA 3TPIZ 2B7DH 4KTCA 1ABJH 2ANWA 2LPRA 3A84A 2OBQA 3UWIA 2HALA 1W14U 3MO9A 3Q76A 4UE7H 2ZGXH 1ORFA 1EZUC 1NFXA 1O3OA 1CA0B 1W7GH 3BTWE 1GVKB 4MDSA 4ABAA 1F5LA 2WPJS 1BB0B 2ZFSA 2NU0E 4HTCH 1UCYH 4Y6DA 4P00A 1TQ7B 5KEDA 2A32A 1TBQH 2OLGA 1SGDE 1HRTH 1O3JA 1LVYA 3NKKA 1C1WH 2FOFA 2WSSD 2SFAA 5LH8A 3WWFA 2TPIZ 3VFEA 4GVUA 1WXRA 2Q1JA 2XXLA 3SU0A 1UCYE 3SJ8A 2J97A 1O3PB 1C2IA 2QYIA 4X1QU 1Z8IB 2XCFA 3TNTA 1E38B 5CMXH 1QBOA 2F9OA 2VH6A 5K7RA 1TX8A 1OWEA 1H8DH 3UY9A 3SNBA 1NU9A 4AGJA 1XXDA 2O8LA 1YGCH 1K1MA 2B0FA 2EI6A 3CNRA 5PTPA 4K1SA 4I33A 1ZTKA 2Q6DA 2XC0A 3OYPA 3MU8A 3BEUA 1TMUH 4GUXA 1F0SA 3KYFA 4Y8XA 2FOHA 1ZJDA 3TGIE 4MPUA 1YF4A 2R2MB 3GYMA 1HAVA 2FI4E 1EPTA 1F0TA 2AMDA 2AERH 2I6SA 3SI3H 2W3KA 1W8BH 2ASUB 2WV9A 1GGDC 3OFND 1L1JA 5E0GA 5C5NA 6LPRA 4JK6A 3O8CA 1VITF 3SBKA 2IJOB 1TGBA 1C4Y2 3QWCH 1THPB 4SGBE 1P2KA 2ODYB 4MPVA 3T2NA 5HIZA 3MH7A 3LONA 2ZCKP 1OYQA 4FUDA 5C0UA 2ZFTA 1EOLA 1O37A 3ZZBA 2B9LA 3F0OA 1SVPA 1SBWA 3RXJA 4B74A 2BOKA 9ESTA 1X7AC 1P01A 4CH8B 5LGOA 4HGCA 1MTWA 2GDEH 3RXBA 3ZZ3A 1O32A 1TLDA 1AUJA 3KYGA 1GCDA 2UUFB 2ZWLH 4I32A 3FANA 1K22H 1INCA 4TWYA 4MG3A 3U69H 1GHBG 2BVXH 2K0QA 1SL3A 1BBRE 5CE1A 3VEQB 1Y8TA 4U01A 1KMHB 1HLTH 4AG2A 2QAAA 5DP6A 5DP5A 1EP5A 4OGXA 1ZJKA 1ZPZA 1M9UA 1HIAB 1KXDA 5LPEA 1NRSH 1AB9B 1O5FH 1H8IH 1TA2A 1K0HA 5FCKA 3CENA 5DN6D 4RN6A 2RFKC 3Q77A 1Y3VA 1C5XB 2AMQA 1K1PA 5T6GA 1O5DH 1S6LA 2PGQB 2NU4E 1AFEH 1XUHA 3EA7A 1DT2A 4E06H 1HAVB 1TRYA 2AYWA 3K9XB 3V12A 1UK2A 2BM2A 1ZGVA 2OC0A 2LP6A 2KR7A 2D8WA 2YNBA 1K28D 1O2UA 3RM2H 3PYHA 2ZU3A 1SQRA 2KAIA 1XMNB 4DG4A 1UTMA 1GJDB 2ZO3H 2J9NA 4YO9A 4X6OA 4Y8YA 2B8OH 5DKMA 3GISB 1RJXB 3GOVB 1OWHA 1QL8A 1SMFE 4Y10E 3GCNA 4JCNA 1FN6A 4IBLH 2SGQE 4ZCNA 1K2I1 4F48B 3SNEA 3BIVH 1S0QA 1C5QA 1VGCC 3SU2A 1GL1A 6CHAB 4Q7XA 1A5HA 1P06A 1UJ1A 3A7TA 4B2BA 1G2MA 4NIVA 1T8LA 1ELFA 3SOSA 4DW2U 1YPJH 1QY6A 3BSQA 4I8KA 1O2VA 1SGFA 1WBGB 5C1YA 1ZMNA 3RU4E 2ZTXA 5EQQA 7KMEH 2FWWA 1PPBH 2QF0A 3AW0A 1TBRH 1C1QA 1ZHRA 3PTBA 3RXQA 2XYAA 2ZFRH 3STJA 1AO5A 1AE8H 1GBKA 3W94A 2ZHQH 1ANCA 1C2DA 3DD2H 4LXBH 3LIWA 2JIZD 3DA9B 3W95A 3MO6A 4MVNA 4FUBA 2CF9H 2M5TA 3RMOH 1GG6C 3S9AA 1QQ4A 2BMGB 3CS7A 5EW1H 2Y81A 1LHDH 1HAIH 2F4LA 4YOIA 2QIQA 3OAAD 3K6YA 3SV7A 4CHAB 1W13U 2ZPRA 4JZ1A 1L1NA 1ZHPA 4DIHH 1CT0E 1AY6H 1O0DH 2O8WA 4CREA 2JH6D 1OX1A 1OOKB 1A5GH 3PRBA 1UMAH 1WQVH 2HNTF 1DSUA 4CBNA 4ABDA 4JZIA 1BCUH 1O31A 1WU1A 2EI8A 3ODDA 2A4QA 2EC9H 1NFUA 5B6OA 1MKXK 1C1TA 3ATLA 3Q3YA 1Y5AT 4WXVA 1EPTB 3AW1A 8ESTE 4Z1MD 7ESTE 3ELAH 1O2JA 1PPFE 1O3BA 1Y3UA 2GDDA 3TLOA 1ANDA 2XCNA 2BDAA 5C5OA 3TU7H 2FX4A 1GBCA 2QC2A 3KEEA 1TX6A 2VWLA 4ABJA 4IN1A 4RT0A 3V13A 4KGAA 1MKWK 1HGTH 3RC5A 1GMHG 4ISOA 2F9UA 1W10U 3MO3A 3PRDA 3QZRA 4Q7ZA 3A81A 4NFFA 1CO7E 1BIOA 3GY8A 1NBMD 3GCTF 3JZ2B 1C2MA 3F0PA 3M3TA 1MMJN 4ISIH 1Z6JH 3BTFE 3S9CA 1PFXC 2J95A 1C1PA 3NWUA 1MABB 3V3MA 4B71A 4K1EA 1Z6EA 1KXAA 4ZKNU 3M5MA 2BDCA 4IGDA 3QGNB 3P8FA 4YT7H 1QURH 2JDID 1UTPA 4CRGA 1Q3XA 5L2ZH 1T8OA 1O3AA 5F53A 4F49A 1L4DA 4MNYA 3SU5A 2A4GA 1MD8A 2GP9B 1FI8A 2GKVE 3RXAA 1O3GA 1H4WA 2GGVB 4K5ZA 2BY8X 1XUGA 1LHEH 1PPEE 3MU1A 3A80A 3STIA 4X1NU 1E1RD 2OXSA 1TB6H 1EAWA 3L6PA 2YMSD 2XTTB 1GPZA 3TITA 2TGPZ 3SGAE 3PM3A 2KCAA 1FY8E 1KXEA 1C1SA 1BZXE 2HPPH 3KQDA 1QIXB 4UDWH 1DFPA 1C5PA 2Z3CA 4J1YA 2A45B 1NU7B 1P10A 1TQ0B 3SNDA 5DP4A 3DHKH 3FP7E 1GVZA 1TNIA 3TJNA 3F2HA 1UCYK 4XDEA 1N1LA 1P2OA 4X1SU 4NGAH 2BQ6B 1O5AB 5C17A 4AN7A 1BITA 2GCTB 3N7DA 2ZFPH 2Y5FA 4WH8A 3M5LA 2WV4A 1ZTJA 1KIGH 5KECA 1TNKA 2V6NA 2GCHG 2QF5A 4NA8A 3UWJH 1A0JA 2ZKSA 1TGTA 4FXGH 4I8JA 1BDAA 1KY9A 1DX5M 1HJAC 1FPCH 3VB4A 1P2IA 4HFPB 3VPKA 1IOEA 1D6WA 1N6YA 2VIWA 2RCEA 1GCTB 3A7VA 1GHVH 2ZDKA 1O2NA 2YMSB 1L4ZA 4Q7YA 1XVMA 2QXIA 3GDUA 3A86A 1HFDA 3PTNA 2KM0A 1GBLA 3AAUA 3UNQA 1S82A 3H7TA 4KTSA 1G3EA 3RXCA 2SGAA 4Z0KA 2QGRA 5EQSA 1TOCB 1QB6A 3QTOH 5E0HA 1TNHA 1SPJA 4NIXA 2PKSB 3F68H 2Q6GA 2BYAX 2A2QH 1HB0B 1SLUB 2GMTB 5AFZH 7LPRA 3H7OA 2ZPSA 5GXPA 2A7JA 3VG8A 2R3UA 1YM0A 1PYTD 5IYTA 3T25A 2H9EH 1ELVA 1QA0A 3K65B 4Y79A 3SYJA 1F5KU 2BXTH 2C8XB 1P09A 2HLDD 3I77A 4JZDH 2C8ZB 2PWXA 4M9FA 2Y5GA 1SLWB 3P92A 1QL7A 1SGEE 4IC6A 2KCPA 1MD7A 4FVBA 1LPGB 1KXCA 2FIRH 2XWAA 6GCHF 1GHZA 1W7XH 1C5VA 1G3CA 1NT1A 5I46H 2WPDD 2VVVA 2ZG0H 3TJVA 3RP2A 1GJ6A 5GNDA 5DP8A 3U8RH 2AIPA 1ANBA 1O2IA 3QTVH 3LOXA 4K8BA 4ZMAH 3BTQE 4ABFA 1NBME 1UHBB 4YM9A 3LH1A 4YXWD 5T3HA 1MBQA 4AYYB 4E05H 1TNLA 1YWUA 2P8OC 3SU1A 1EATA 6CHAC 4FUCA 2FOGA 1HJ8A 2YMSC 1P05A 2JETB 1CA8B 1W0JD 2ZTZA 1EB1H 1BTZA 2O9QA 4CHAC 1CQQA 1COWD 2PLXA 1ELTA 5JBBS 1AD8H 1C2LA 2HWLB 1SFQB 4YOJA 1CSOE 1XUIA 5TCCA 3MNCA 4K69A 1GBMA 2R0KA 5F03A 1O3NA 5FHTA 4XD7D 5C94A 4VGCB 4FU9A 4K3JA 1IAUA 3RXSA 3E0NB 1SI5H 3BTEE 2XBXA 2R3YA 3C1KA 1CE5A 3TJUA 2PV9B 3E91A 4GHQA 1SG8B 2RG3A 1TNGA 2XNDD 2J94A 1W2KH 2A2XH 1UTKA 1QR3E 1PPHE 3NPSA 5DP3A 4X0WU 1NTPA 1AB9C 3MWIU 1TGCA 3ATMA 2IJD1 4YESB 1FLEE 3KQEA 1H9IE 2ZPQA 3ATIA 1NN6A 3LJJA 1Y5BT 2O8UA 3MU0A 8LPRA 1W0YH 3GY7A 5HM2A 3A87A 1D3QB 1NRRH 5C2ZA 1KDQB 1MAYA 2R2WU 1GCTC 2JJ2D 2FOMB 2XRCA 3UR6A 3SU4A 1V2KT 3ZYEA 2EY4C 1MU8B 1NC6A 4ACBA 1D6RA 1LCYA 2K8IA 3PV4A 5EJLA 2FXRA 1CHGA 1BT7A 1TIOA 4ABGA 5EW2H 3SUFA 3C27B 1EZSC 2Y5HA 1C1UH 4X1PU 3V7TA 4THNH 3SQEE 4XOJA 4UFFH 1SHHB 3NZIA 3SW2B 1W11U 1LPKB 4AC9A 3GY2A 1DVAH 3QLPH 1GI4A 1OWDA 3BG8A 3FOAA 1F2SE 3M7TA 2BQ7B 1XUFA 1AUTC 3M61U 2PKAB 1DITH 3PLKA 2FS9A 1VCPA 2P3UB 4ISHH 1V2PT 5DG6A 4CRBA 2VNTA 3T62A 1FIZA 2P94A 3LJOA 3OEHD 1SKYE 2EI7A 4NWLA 1EZXC 1UO6A 1PJPA 5EU8A 3T5FH 1MUEB 1O5GH 1S0RA 3KL6A 2C90B 1AU8A 4M7GA 1MTVA 1EZQA 2BDIA 1FDPA 3E0PB 1SGTA 1SQOA 3RXTA 2AMPA 1VJAU 4ISNA 3LC3A 2J34A 1GHBF 1O38A 1SQTA 4R0IA 4NWKA 2PHBA 2AS9A 3MNBA 2P59A 3AVZA 4Y0ZE 2L6OA 3URDA 1C1OA 2JKHA 5GIBA 3UNSA 3E8LA 3R3GB 1V2QT 1GHAF 5TJXA 3SNAA 3MFJA 2WYJA 2Z6BD 3SU3A 1B5GH 4O03A 2VVUA 1QL9A 4X6MA 1BMLA 1J8AA 2GD4B 2G5NA 4D9QA 4I7YH 1UTLM 1ARCA 2PTNA 3A85A 5AFYH 2V3HH 1BRBE 2AHME 3DFJA 4FUJA 1GG6B 1GJ7B 3RXFA 2BY9X 4X8VH 1ZRKA 5EXMA 1GHXH 4AFUA 1IQNA 1QBNA 4NZQA 3ZVDA 4LZ1H 2H6MA 3LGYA 7GCHF 2NU1E 2WPLS 5TCAA 4IC5A 2ALVA 4Q63A 1Z8RA 1O39A 1F92A 1EKBB 3UNRA 4AFZA 3OEED 1J15A 3PMJA 3A8AA 1EJNA 4NCYA 1HAHH 3AASA 1QA7A 4BAKB 3RXGA 4A7IB 4IMQA 1DSTA 4RKJB 2XOKD 1BA8B 4RT1A 1S83A 1E1QD 2FTLE 2AGIX 1ELDE 2G81E 2VBCA 2BD3A 3K6ZA 1YPEH 5FPTA 2CV3A 3LT3A 1BMAA 1BTYA 4K1TA 2C4FH 1U6QA 1C4V2 2BX4A 3BV9B 1YPHC 4NSYA 1CA0C 2PUQH 4X2XA 3SV6A 4ABEA 3VB3A 3F3BA 4A1XA 1WTGH 3P8GA 3PMAB 4WF8A 5GJ4B 3AK5A 2QE7D 2THFB 1AI8H 2EEKA 3KHVA 1SGQE 3E1XB 2FESH 3RLYH 1LKBA 2Y80A 1G37A 1DLKB 2Y82A 3OX7U 3VXEH 1C2HA 4KKDA 3MU4A 4K60A 5F8TA 4AB9A 5L30H 3RXEA 4ACAA 2OCVB 4Y0YE 1EAXA 4FUHA 4BANB 4AX9H 5JBAS 1LPZB 4U2WA 3DSOA 4WH6A 1QCPA 3EAJA 5G4BA 4DURA 2Y7XA 5B6LA 1H8HD 2F43B 2ZTYA 2ILNA 1O2QA 3O8DA 1H1BA 4KELA 5ABWA 2BLOA 1BHXB 2WINI 4FETA 2ZGCA 1OP2A 3NXPA 2R0LA 5J4SA 1ESBA 1G2LA 1CBWB 2PGBB 5EPNA 1EXFA 1P2JA 2ZFFH 3DUXH 4OS4A 3P95A 4OS7A 1KTTB 4MNWA 1Y3XA 1KLTA 3IG6B 5A2MH 4XBCA 1NY22 1AIXH 1GJBB 1WUNH 2VWOA 2Z3EA 4OS6A 1F7ZA 1FAXA 2ZGJA 5T6FA 1HAYB 1UK4A 5AHGH 1WTHD 2G5VA 2F9NA 1OS8A 1ANEA 2ANMH 4AZ2B 1ARBA 1ZOMA 1ETSH 1S81A 1FNIA 3PV5A 1TPAE 3HPTB 1GMDG 5L2YH 1YPGH 4ZHAA 5JBCS 2EA3A 2ZU4A 3SHAH 2JJ1D 2KZ4A 2F9BH 1QRWA 4NA9H 1QNJA 2G55A 2UUYA 2FDAA 3FAOA 1J16A 1G3DA 1QRXA 4I8LA 5FPSA 1HIAA 1MZDA 1Q31A 1A7SA 1HCGA 2WYGA 1G3BA 3QUMP 2XC5A 3NK8A 3OY5U 3RC4A 1CU1A 1ELCA 1K1JA 1DXPA 1FPHH 3QX5H 2FO9A 4CRAA 1GJCB 3WY8A 2GT8A 4DIIH 1O2KA 5SGAE 3RXKA 1VR1H 4K8YA 1TFXA 1TRMA 5E2OA 1O34A 3FZZA 2J38A 2W6ID 1SOZA 3NCLA 3U1JB 2BD2A 1IQIA 4WY3A 4TSFD 1MTNC 5GCHF 3SHCH 5CHAC 4Y7BA 4WXIA 3A83A 3DSGA 1T7CA 2UUJB 1C1RA 2FM2A 2ZHWH 5EIYA 1XM1A 1LTOA 1O2ZA 1KYNA 1F0UA 3EE7A 3ZZDA 2CMYA 5I25A 5JB8S 2A5AA 4IN2A 1L2EA 3RXOA 1DXWA 3ESTA 1QHRB 3WWBA 1TMBH 1GBAA 5HGGA 2H5CA 4H6SB 2P3TB 1HNEE 4AOQA 1O2PA 4CR9A 2IN2A 1UVOA 2FZZA 1BTXA 4FUIA 2J98A 2WPKS 2BLVA 1BTHH 2O8MA 3ZZ6A 1C1MA 3KNXA 3ZYDA 1O3CA 1KDQA 2H9HA 1SGYE 1MQ6A 1YYY1 1AWHB 2J92A 3RMNH 3P8OA 3ZVCA 5EJZA 4NSVA 2D1JA 3CS0A 4AORA 1FUJA 1BRAA 2D26C 1XXFA 5JPMH 3EYDA 3VB7A 2XNIA 1V2JT 1Z1IA 1GDNA 3EDXB 1GJ4H 4WWYA 4YLUA 1AKSA 4D9RA 1QJ7B 1JMOH 2A0QB 4B6FA 1O3HA 1JBUH 2IOTA 1C5LH 1BRCE 4X6PA 3SUEA 1E79D 3RXIA 1LVOA 3ZZAA 2GT7A 3A7XA 1GBEA 2P3FH 1K1IA 3RM0H 4ZXXH 1E35B 2VH0A 4JZEH 1S85A 5C67A 2ODPA 1EB2A 2RA0A 1MZAA 1HXFH 1O33A 1GI7B 2O8TA 3PV2A 5A8YA 4GSOA 1ZZZA 4MNVA 1ABIH 4F55A 1BTPA 4CH2B 1GBFA 2V3OH 3VB6A 3UQVA 1GI5A 5EOKA 1MTNB 4B1TA 4PROA 1G9IE 1CVWH 1VITG 3LGIA 1WQSA 1TPSA 5F8ZA 1O3LA 4JZFH 3TK6A 4D76A 2JETC 3EA9A 1TWXB 3BTME 1NPMA 2KAIB 4RSPA 1GHAG 3LU9B 3ENSB 4TPYA 4Q4LA 2GTBA 3PO1B 1T31A 2ZF0H 3GS9A 4MNXA 2OBOA 1K21H 2EQNA 2LELA 3D49H 3RU4D 3M7UA 3T29A 1G32B 1NO9H 2Z7FE 3F9GA 2AH4X 1D9IA 2ZGHA 1ZRBA 1EPTC 1TABE 1ELEE 4JMYA 1VZQH 1QRZA 2C93B 2BDYA 1FQ3A 3ZZCA 1RFNA 4P02A 2TGDA 3MH5A 1GBIA 1TBZH 1P2NA 1LVBA 4HG6A 4X8UH 3ZVAA 2VINA 2ZIQH 1C4U2 1SC8U 1JWTA 3RXVA 1JIRA 3SV2H 1HJAB 1AZZA 1E37B 1NZQH 2Z9JA 4OGYA 2HGTH 1Y5UT 1GL0E 2BD4A 1TONA 3SN8A 4X6NA 3Q3KA 5DP9A 1NROH 1D4PB 1HAOH 4Y7AA 3BN9A 2AGGX 3ZV8A 1BJVA 1MTUA 1THRH 3PMHB 1T8NA 4HZHA 3ZVGA 1ZPCA 4J2YB 3JZ1B 1AN1E 1CT4E 4O3UA 1GWAA 3WW7A 3ZV9A 4F4OC 1EOJA 2Z9IA 3UAIC 4MLFB 1O2HA 1GHYH 5AVDA 5DGJA 3KQCA 3RXLA 3SU6A 2GVFA 4WJG2 1QBVH 1P8VC 3P6ZB 2WUBA 1TX7A 4Y71A 1O2LA 1QJ1B 3ATKA 2ZHEH 1YPHE 1V2LT 1W0ZU 2QXHA 2BD8A 3TH4H 1K1OA 1TRNA 1GI8B 2VJ1A 3U8OH 2A7CA 4B6EA 2J98B 2TGTA 1VCWA 5E0JA 3IWMA 3TH2H 3SO3A 5LPRA 3BTDE 5EGMA 2SNVA 2PSYA 1GBDA 2G00A 1FIWA 2PSXA 1YKTA 2HNTE 4NIYA 2ZC9H 1VGCB 2FS8A 1ZPBA 3M5NA 1YBWA 4YLQH 1TNJA 1YLCA 2PUXB 4ZH8A 3M3SA 1V2MT 1DOJA 1ETTH 2RA3A 3E3TA 5A0AE 1DWCH 3SI4H 3GY4A 1D3PB 1G36A 1DUAA 1ZR0A 4UD9H 3U9AH 4R8TB 3O8BA 1KXBA 4D8NA 1D3TB 3N7OA 3QK1A 1UTNA 1C5UA 4AG1A 3P17H 4MTBA 3RXUA 1MAXA 4Q80A 2ANKH 1A3BH 1QB9A 2K1QA 3F9EA 3M5OA 4Q2KA 1PPGE 2BHGA 4UFDH 3EA8A 1FJSA 2Y6TA 1GI1A 3MU5A 4O9VA 4A5TS 2FLRH 3B23B 4FU8A 3BIUH 4Y76A 1FY5A 1AFQB 2QV1A 1O3DA 2FP7B 3EQ0H 3FVFB 5FXLA 1GMCF 2D2DA 4HI3A 1S6FA 1E34B 1SQAA 4DCDA 3BG4B 3LH3A 3SJKA 4BNRA 1ZSLA 3SGQE 1K1LA 4BAQB 2XBWA 3GY5A 3PO1C 1YPMH 2G8TA 2IPQX 2ZQ1A 1MCTA 4UONA 1LMWB 1ZSJA 2ODQA 2BY6X 4TY7A 2HVYB 1O2XA 2KCYA 1NESE 1O3IA 3G01A 1MTSA 3Q3XA 5FPYA 2NU3E 3MQKC 2TBSA 2FLBH 3FKSD 2P93A 5BPEA 3TIUA 1EP6A 3BEFB 1A4WH 2SGPE 1FV9A 3FFGA 3M35A 3D65E 4FVDA 1AVGH 1E0FD 1ELGA 2W7SA 1CGJE 3UB0A 1NRQH 3SNCA 2VVCA 1HYLA 1TOMH 1GJ5H 2QA9E 1ID5H 3QO6A 4GCHF 3VGCC 3M3VA 2F91A 3OU0A 1D3DB 3KQ5A 5FBEA 1ACBE 2ZHDA 3F2GA 1OSSA 2C8WB 1H9HE 2VIVA 1HAZB 1HBTH 1DWEH 1XVOA 4OM9A 1NRNH 2BZ6H 2ALPA 5CHAB 4ZKOU 2GJGA 1T4UH 1H9LB 2TRMA 2B5TB 4A1TA 2XWBI 2F9VA 3SZEA 3KQBA 4UFGH 2ZECA 3T27A 3ITIA 1DUEA 1CGHA 1ESAA 1RD3B 3OE7D 1LO6A 4ABIA 1A3EH 2JH5D 4U30A 4NIWA 1TE0A 1ZYOA 1N6XA 1TAWA 1W0KD 1S84A 1DLEA 1O2TA 4INHA 3P70B 4BAMB 4X2YA 5EQRA 1OWKA 2ULLA 4ASUD 5DSFA 3D23A 2OC8A 2PR3A 2VB0A 2SGFE 1O35A 2SGEE 5ESBA 3H5CB 1GBTA 3GCHC 2BLQA 1DM4B 4NA7A 2QF4A 1LQEA 3GCOA 3MTYA 3FP6E 2OC1A 1C5ZB 3CP7A 1LKAA 3SQHE 2GZ7A 5BRRE 4X2WA 2KX4A 4BTUB 2BVRH 4OS2A 3TNSA 3SJ9A 1RRKA 1S5SA 3LC5A 1B7XB 3ZVFA 2HOBA 3FO8D 3U8TH 1H8ED 2F9PA 3UTUH 3MHWU 4ISLA 3N99A 1C9PA 2WV5A 5L6NH 3GY3A 2GMTC 2NWNA 2HVXA 1DY9A 5KGOA 1EJAA 2XBVA 4DGJA 2GV6A 3QGJA 3TK5A 4FU7A 4B2AA 2G51A 1SLVB 3UUZA 4CRCA 1A0HB 2HPQH 5DK1A 4OS1A 3B8JA 2RDEA 5A8XA 4ZXYH 5GDSH 2G52A 2FOBA 3ZZ7A 1CT2E 1YY3A 3QN7A 1FZZA 3S69A 1HDTH 1VJ9U 2GV7A 1TYNA 1OKXA 1HV7A 4LOYH 2XW9A 1FXYA 4BXSA 2UWLA 4NG9H 3LGTA 3F1SB 5IK2D 2BD7A 1Y3WA 1IQJA 3P8NA 3BTTE 4XBBA 4XE4A 5C0TA 1FMGA 1HAXB 4BOHA 1BJUA 1IHSH 1V2TT 4WMFA 5EPYA 3URCA 4BXWA 3HKJB 4AGKA 4ZKRU 1DS2E 5C1XA 2VGCC 3UR9A 3FN8A 1GBHA 2NU2E 3A8CA 2OTVA 3HK6B 1WDIA 4INKA 2WPIS 1EFRD 1SSXA 3RXDA 2CJIA 1XX9A 2J4IA 3E16B 4MPWA 5JDUB 1OXGA 2FOAA 1TPPA 2WZQA 1C2FA 4B76A 5EG4A 1IQEA 5FX6A 4FOUC 1QGFA 5CDFE 2GX4A 3L3TA 5DJ7A 2OP9A 2ZDNA 2OK5A 3GICB 1G30B 4GLYA 3A8DA 1GI0A 2PFEA 3KCGH 1P9SA 5EXLA 2P16A 1RTFB 2STAE 3M37A 1P2QA 3A7ZA 1VKYA 3ZZ4A 2OQ5A 4AB8A 3NRLA 1A0LA 1A61H 2GZ8A 2Z9KA 2VIQA 2STBE 1SGCA 2BDHA 1OP0A 4KTUA 2Z94A 3PWBA 4H4FA 5DP7A 2A1DB 4CBOA 1XUKA 4BAOB 1ESTA 1L0ZA 1P04A 1CHOG 3D62A 4X8TH 5FCRA 1VITH 3UOPA 1PQ7A 3LGWA 1JIMA 4I8HA 3VGCB 1GI9B 2H1UA 3BTGE 1NFYA 3ZZ9A 1VCQA 1UVPA 2GCTC 1BRUP 2VWMA 3VXFH 1O2YA 3F9FA 1GI6A 3W1EA 1P57B 3SJOA 5F8XA 1RTLA 3U98H 3A7WA 1BTUA 1UW7A 1EAIA 1WCZA 1GGDB 2AFQB 1ELAA 4UFEH 3EGKH 1YPKH 1BMMH 1GDQA 3RU4T 1C5MD 1JOUB 4FUFA 5F6MA 1CHOF 1KXFA 3MMGA 1QTFA 2WUCA 3MH6A 5HKKD 1AVXA 3ZZ8A 3OSYA 4XSKU 1AMHA 4RKOB 3MH4A 1C5OH 3N7EA 2H9TH 2OUAA 1IHTH 1GVLA 3PMBB 4DY7B 3UFAA 1HJ9A 3V0XA 4CRDA 1Z8GA 4CR5A 1GI2A 1GMCG 2VIOA 2CHAB 2DUCA 2ZHFH 4INLA 3SV8A 2BTCE 3S0NA 4BTTB 4AFQA 1RIWC 2ZFQH 3GDVA 2V0BA 1C5TA 1OP8A 1SGFG 2ZDVH 5EXNA 1AQ7A 3E6PH 5FL7D 4ASHA 3L33A 5A0CA 6GCHG 1LQDB 1O36A 2FX6A 5ETXA 5JBTA 3S9BA 1XKBC 3MYWA 2QXJA 3DFLA 5IDKA 1K9OE 5HM9A 2BDGA 1A2CH 1THSH 4D7GA 3SUDA 5A8ZA 2V3MA 2QN5T 1C2KA 5T6DA 1YC0A 2DE9A 1RIWB 1DICA 1MH0A 2V7QD 3TH3H 1OHHD 3PROA 2H5DA 2SGDE 1UK3A 1A5IA 1GJAB 3EE0B 1WAYB 3HGNA 1QZ8A 1TGNA 3KN2A 2FTMA 5HIYA 3RUOA 5E2PA 1HXEH 1O3FA 2ZU2A 1MKXH 2LNCA 2WPHS 1IQLA 2AGEX 1BTWA 1EAUA 1NS3A 1PQ5A 3RXPA 3MNXA 1AE5A 1F5RA 4TT3D 8GCHF 1Z8JB 3LPRA 1SB1H 2FODA 3MOCA 4AFSA 1ETRH 5HMAA 5ESTE 1A46H 2RDLA 2VIDA 1UTQA 2G4UA 2ZNKH 3A82A 1MKWH 1MQ5A 1FY1A 2QXGA 5CHBA 1MBMA 1C2EA 1C5RA 2A5KA 3KGPA 2WPMS 5C1UA 4RI0A 1BMFD 1ZSKA 3OTPA 1EJMA 5GPIB 4YZUA 2ZU5A 2ZEBA 1C5YB 4JK5A 1C1VH 1O30A 4ABHA 1C2GA 3SV9A 1BOQA 4ZROA 1ZHMA 1C5SA 3F6UH 5EODA 3MNSA 1V2OT 1NFWA 1T4VH 8KME2 8GCHG 4UEHH 4YTAA 3SZNA 1HUTH 3U1IB 1SGPE 2C8YB 1TPOA 2FYQA 2FI3E 1FY3A 4LK4A 2M2AA 4X8SH 1B0EA 1HPGA 3A88A 3RLWH 3SORA 2G4TA 6ESTA 3F9HA 5E8EH 2F3CE 4DT7B 1JRSA 2A5IA 1W12U 1O3MA 1T32A 1P3CA 1YCPM 1EX3A 1JXPA 2FEQH 3QDZB 1L1GA 2ZGBH 3I78A 1O2OA 1Z71A 4B73A 1BBRK 4E7NA 3RXMA 4ZAEA 2TIOA 5GWZA 2XC4A 1BMNH 5A0BA 2P8OB 2ESTE 3ZVBA 2ZCLP 2C3SA 3OTJE 5T1VA 3BTHE 1EASA 1V2NT 1P2MA 2ZDMA 1N8OC 1ZTLA 2QF3A 1V6DA 4FUGA 1C1NA 3BTKE 2FMJA 3GDSA 1FONA 2A31A 1Z1JA 4DJZB 1LDTT 1OYTH 1FAKH 3LGUA 2H2ZA 1YP9A 2HNTC 3S7HB 4X1RU 4LZ4B 4XRNA 1Q2WA 3TGKE 5JB9S 5J4QA 2VGCB 1BBRH 3B9FH 5FBIA 1C9TA 1P12E 3AAVA 4IW4E 4VGCC 2TGAA 1PQAA 1HAPH 2OC7A 1MCVA 1K1NA 3RMMH 2BX3A 1O2MA 1SFIA 1NRPH 3T28A 1SOTA 5C20A 3Q00A 1ZMLA 1BUIA 2BY5X 4ESTE 4DT4A 4ZHMU 1BQYA 5FX5A 2PP6A 2W3IA 1UVUH 3ZZ5A 3O8RA 1OPHB 5K0HA 5HXFA 1RGQA 1EQ9A 1QB1A 1WSSH 1IQHA 3RMLH 1TA6A 3DCLA 4I31A 3TK9A 1OWIA 4GHTA 4MPXA 1GMHF 3PB1E 2SNWA 1UTJA 2A7HA 2PKAA 2PW8H 1UVTH 4BTIB 3A89A 4OS5A 2QCYA 1O5EH 4DVAU 1AHTH 3GCTG 3PLBA 2QY0B 1TALA 1ELBA 1O2SA 1W3CA 2CK3D 1LHGH 1C2JA 3TJOA 2DE8A 1TMTH 2UUKB 2AIQA 1YPLH 1GHWH 1UHBA 1P03A 3TVJB 1SLXB 2HLCA 1DPOA 3PWCA 3LDXH 3BG4C 1DANH 3BF6H
chains in the Genus database with same CATH topology
2FOEA 1V2RT 1KSNA 1XKAC 1Z7KA 3E90B 1AGJA 4B2CA 3OY6U 4TPIZ 3M36A 3A8BA 1F0RA 1GDUA 3GCHB 3KIDU 1TGSZ 1P0SH 2PKSC 2BZAA 1IQKA 2BOHB 3BEIB 3GYLB 7GCHG 4TWWA 4CRFA 4QT8C 4Z6AH 3RXRA 3SUGA 2XBYA 1O2WA 2OQUA 3PLPA 2Z9LA 2UWPA 5HYOA 1WOFA 1YCPK 1SGIB 4ZUHA 4O3TA 1QFKH 2ZDLA 4X2VA 3GY6A 3R0FA 2A4OA 2CF8H 4I8GA 1EUFA 2A4RA 4Y11E 3IITA 2BB4A 1RTKA 1HAGE 2F83A 1BHXF 2CHAC 4A1VA 1WYKA 1P3EA 5FAHA 1XUJA 1GBJA 4GCHG 5DO4H 3KF2A 1GJ8B 1NM6A 1V2WT 4E7RG 1P9UA 2BXUH 2BY7X 1V2UT 1PPZA 2IPHA 3ZVEA 1YLDA 3T26A 1PPCE 2W26A 4H6TA 3RC6A 3HKIB 2ZI2H 9LPRA 5H4IB 3A7YA 4JYTA 3TGJE 3ODFA 2ZA5A 2Z9GA 1AWFH 1OWJA 2ZP0H 1O5CB 3RDZA 3MI4A 4YT6H 1GI3A 2GCHF 4IS5A 3SGBE 1UVSH 4SGAE 3HK3B 1Y3YA 2PTCE 5DPAA 4YOGA 2FPZA 1B0FA 4NZLA 2W7UA 2W5EA 3I29A 1ZGIA 1C5NH 1UTOA 1V3XA 1ZMJA 3FZDA 2I6QA 5LPFA 5JYIA 4GPGA 3UREA 5GCHG 3UIRA 2P95A 4BAHB 1PQ8A 5C3NA 1GBBA 1QQUA 3LGVA 3HGPA 1JRTA 4XFQA 1RXPA 1RS0A 1O3EA 5A09A 4Y8ZA 2UWOA 2JH0D 1GJ9B 3S7KB 4O97A 4XBDA 4WMEA 2FOCA 4TYDA 3LKWA 1O3KA 2CGAA 1A1RA 1N8OB 1AVWA 4ZHLU 1V2VT 1CGIE 4NFEA 2Q6FA 2YOLA 3VB5A 3RXHA 2CXVA 2FI5E 3M7QA 1DWDH 2BD9A 3UPEA 1J17T 4WVPE 1SGNE 2ZU1A 4K2YA 1E36B 4DOQA 1J9CH 1AFQC 3SJIA 2BVSH 2AEIH 4IMZA 1LHFH 2BLWA 1IQFA 4ABBA 1S6HA 1Y59T 2VU8E 2J2UA 4MQAA 1C5WB 1P11E 4WMDA 1GMDF 3UQOA 3NUMA 1DDJA 2GZ9A 1FN8A 4B75A 1YCPH 2OD3B 2CN0H 1O2GH 2BD5A 2VIPA 4JYUH 4KP0A 4TY6A 2Y7ZA 3QZQA 2BDBA 1FY4A 1KTSB 1KLJH 1PYTC 2VWNA 1MU6B 4H42U 3HATH 2ZCHP 1SHYA 1J14A 1CBWC 1P02A 2ANYA 4JYVH 4ZKSU 2ZZUH 2FYRA 1KLIH 1V2ST 2R9PA 4A6LA 4D7FA 2ZQ2A 1DE7H 1QJ6B 3UOUA 1WV7H 3FP8E 4FUEA 2HRVA 3K2UA 1AKSB 2V35A 5AF9H 4AYVB 1T8MA 1IQGA 1O5BB 2ZDAH 1SGRE 1LHCH 2BQWB 2Z3DA 1ZLRA 3DT0H 1AZ8A 1DY8A 2OINA 1SR5C 2YNAA 3ATWA 1IQMA 1LVMA 4U32A 1DWBH 4A92A 4GAWA 1O2RA 3TPIZ 2B7DH 4KTCA 1ABJH 2ANWA 2LPRA 3A84A 2OBQA 3UWIA 2HALA 1W14U 3MO9A 3Q76A 4UE7H 2ZGXH 1ORFA 1EZUC 1NFXA 1O3OA 1CA0B 1W7GH 3BTWE 1GVKB 4MDSA 4ABAA 1F5LA 2WPJS 1BB0B 2ZFSA 2NU0E 4HTCH 1UCYH 4Y6DA 1TQ7B 2A32A 1TBQH 2OLGA 1SGDE 1HRTH 1O3JA 1LVYA 3NKKA 1C1WH 2FOFA 2SFAA 5LH8A 2TPIZ 3VFEA 4GVUA 2Q1JA 2XXLA 3SU0A 1UCYE 3SJ8A 1O3PB 1C2IA 2QYIA 4X1QU 1Z8IB 2XCFA 3TNTA 1E38B 5CMXH 1QBOA 2F9OA 2VH6A 5K7RA 1TX8A 1OWEA 1H8DH 3UY9A 3SNBA 1NU9A 4AGJA 1XXDA 2O8LA 1YGCH 1K1MA 2B0FA 2EI6A 5PTPA 4K1SA 4I33A 1ZTKA 2Q6DA 2XC0A 3OYPA 3MU8A 3BEUA 1TMUH 4GUXA 1F0SA 4Y8XA 2FOHA 1ZJDA 3TGIE 4MPUA 1YF4A 2R2MB 3GYMA 1HAVA 2FI4E 1EPTA 1F0TA 2AMDA 2AERH 2I6SA 3SI3H 2W3KA 1W8BH 2ASUB 1GGDC 1L1JA 5E0GA 5C5NA 6LPRA 4JK6A 3O8CA 1VITF 3SBKA 2IJOB 1TGBA 1C4Y2 3QWCH 1THPB 4SGBE 1P2KA 2ODYB 4MPVA 3T2NA 3MH7A 3LONA 2ZCKP 1OYQA 4FUDA 2ZFTA 1EOLA 1O37A 3ZZBA 2B9LA 1SVPA 1SBWA 3RXJA 4B74A 2BOKA 9ESTA 1X7AC 1P01A 4CH8B 5LGOA 4HGCA 1MTWA 2GDEH 3RXBA 3ZZ3A 1O32A 1TLDA 1AUJA 1GCDA 2UUFB 2ZWLH 4I32A 3FANA 1K22H 1INCA 4TWYA 4MG3A 3U69H 1GHBG 2BVXH 1SL3A 1BBRE 5CE1A 3VEQB 1Y8TA 4U01A 1HLTH 4AG2A 2QAAA 5DP6A 5DP5A 1EP5A 4OGXA 1ZJKA 1ZPZA 1M9UA 1HIAB 1KXDA 5LPEA 1NRSH 1AB9B 1O5FH 1H8IH 1TA2A 5FCKA 3CENA 4RN6A 3Q77A 1Y3VA 1C5XB 2AMQA 1K1PA 5T6GA 1O5DH 2PGQB 2NU4E 1AFEH 1XUHA 3EA7A 1DT2A 4E06H 1HAVB 1TRYA 2AYWA 3K9XB 3V12A 1UK2A 2BM2A 1ZGVA 2OC0A 2YNBA 2D8WA 1K28D 1O2UA 3RM2H 3PYHA 2ZU3A 1XMNB 2KAIA 4DG4A 1UTMA 1GJDB 2ZO3H 2J9NA 4YO9A 4X6OA 4Y8YA 2B8OH 5DKMA 3GISB 1RJXB 3GOVB 1OWHA 1QL8A 1SMFE 4Y10E 3GCNA 4JCNA 1FN6A 4IBLH 2SGQE 1K2I1 3SNEA 3BIVH 1S0QA 1C5QA 1VGCC 3SU2A 1GL1A 6CHAB 4Q7XA 1A5HA 1P06A 1UJ1A 3A7TA 4B2BA 1G2MA 4NIVA 1T8LA 1ELFA 3SOSA 4DW2U 1YPJH 1QY6A 3BSQA 4I8KA 1O2VA 1SGFA 1WBGB 5C1YA 1ZMNA 3RU4E 2ZTXA 5EQQA 7KMEH 2FWWA 1PPBH 2QF0A 3AW0A 1TBRH 1C1QA 1ZHRA 3PTBA 3RXQA 2XYAA 2ZFRH 3STJA 1AO5A 1AE8H 1GBKA 3W94A 2ZHQH 1ANCA 1C2DA 3DD2H 4LXBH 3LIWA 3DA9B 3W95A 3MO6A 4MVNA 4FUBA 2CF9H 2M5TA 3RMOH 1GG6C 3S9AA 1QQ4A 2BMGB 3CS7A 5EW1H 2Y81A 1LHDH 1HAIH 4YOIA 2QIQA 3K6YA 3SV7A 4CHAB 1W13U 2ZPRA 4JZ1A 1L1NA 1ZHPA 4DIHH 1CT0E 1AY6H 1O0DH 2O8WA 4CREA 2JH6D 1OX1A 1OOKB 1A5GH 1UMAH 1WQVH 2HNTF 1DSUA 4CBNA 4ABDA 4JZIA 1BCUH 1O31A 1WU1A 2EI8A 3ODDA 2A4QA 2EC9H 1NFUA 5B6OA 1MKXK 1C1TA 3ATLA 3Q3YA 1Y5AT 4WXVA 1EPTB 3AW1A 8ESTE 7ESTE 3ELAH 1O2JA 1PPFE 1O3BA 1Y3UA 2GDDA 3TLOA 1ANDA 2XCNA 2BDAA 5C5OA 3TU7H 2FX4A 1GBCA 2QC2A 3KEEA 1TX6A 2VWLA 4ABJA 4IN1A 3V13A 4KGAA 1MKWK 1HGTH 3RC5A 1GMHG 4ISOA 2F9UA 1W10U 3MO3A 3QZRA 4Q7ZA 3A81A 4NFFA 1CO7E 1BIOA 3GY8A 3GCTF 3JZ2B 1C2MA 3M3TA 1MMJN 4ISIH 1Z6JH 3BTFE 3S9CA 1PFXC 2J95A 1C1PA 3NWUA 3V3MA 4B71A 4K1EA 1Z6EA 1KXAA 4ZKNU 3M5MA 2BDCA 4IGDA 3QGNB 3P8FA 4YT7H 1QURH 1UTPA 4CRGA 1Q3XA 5L2ZH 1T8OA 1O3AA 4F49A 1L4DA 4MNYA 3SU5A 2A4GA 1MD8A 2GP9B 1FI8A 2GKVE 3RXAA 1O3GA 1H4WA 2GGVB 4K5ZA 2BY8X 1XUGA 1LHEH 1PPEE 3MU1A 3A80A 3STIA 4X1NU 2OXSA 1TB6H 1EAWA 3L6PA 2XTTB 1GPZA 3TITA 2TGPZ 3SGAE 3PM3A 1FY8E 1KXEA 1C1SA 1BZXE 2HPPH 3KQDA 1QIXB 4UDWH 1DFPA 1C5PA 2Z3CA 4J1YA 2A45B 1NU7B 1P10A 1TQ0B 3SNDA 5DP4A 3DHKH 3FP7E 1GVZA 1TNIA 3TJNA 4XDEA 1UCYK 1N1LA 1P2OA 4X1SU 4NGAH 2BQ6B 1O5AB 4AN7A 1BITA 2GCTB 2ZFPH 2Y5FA 4WH8A 3M5LA 2WV4A 1ZTJA 1KIGH 1TNKA 2V6NA 2GCHG 4NA8A 3UWJH 1A0JA 2ZKSA 1TGTA 4FXGH 4I8JA 1BDAA 1KY9A 1DX5M 1HJAC 1FPCH 3VB4A 1P2IA 4HFPB 3VPKA 1IOEA 1D6WA 1N6YA 2VIWA 2RCEA 1GCTB 3A7VA 1GHVH 2ZDKA 1O2NA 1L4ZA 4Q7YA 1XVMA 2QXIA 3GDUA 3A86A 1HFDA 3PTNA 1GBLA 3AAUA 3UNQA 1S82A 3H7TA 4KTSA 1G3EA 3RXCA 2SGAA 4Z0KA 2QGRA 5EQSA 1TOCB 1QB6A 3QTOH 5E0HA 1TNHA 1SPJA 4NIXA 2PKSB 3F68H 2Q6GA 2BYAX 2A2QH 1HB0B 1SLUB 2GMTB 5AFZH 7LPRA 3H7OA 2ZPSA 5GXPA 2A7JA 2R3UA 1YM0A 1PYTD 5IYTA 3T25A 2H9EH 1ELVA 1QA0A 3K65B 4Y79A 1F5KU 2BXTH 2C8XB 1P09A 3I77A 4JZDH 2C8ZB 2PWXA 2Y5GA 1SLWB 3P92A 1QL7A 1SGEE 4IC6A 1MD7A 4FVBA 1LPGB 1KXCA 2FIRH 2XWAA 6GCHF 1GHZA 1W7XH 1C5VA 1G3CA 1NT1A 5I46H 2VVVA 2ZG0H 3TJVA 3RP2A 1GJ6A 5DP8A 3U8RH 2AIPA 1ANBA 1O2IA 3QTVH 3LOXA 4K8BA 4ZMAH 3BTQE 4ABFA 1UHBB 4YM9A 3LH1A 5T3HA 1MBQA 4AYYB 4E05H 1TNLA 2P8OC 3SU1A 1EATA 6CHAC 4FUCA 2FOGA 1HJ8A 1P05A 2JETB 1CA8B 2ZTZA 1EB1H 1BTZA 2O9QA 4CHAC 1CQQA 2PLXA 1ELTA 5JBBS 1AD8H 1C2LA 2HWLB 1SFQB 4YOJA 1CSOE 1XUIA 5TCCA 3MNCA 4K69A 1GBMA 2R0KA 5F03A 1O3NA 5FHTA 4VGCB 4FU9A 4K3JA 1IAUA 3RXSA 3E0NB 1SI5H 3BTEE 2XBXA 2R3YA 3C1KA 1CE5A 3TJUA 2PV9B 3E91A 4GHQA 1SG8B 2RG3A 1TNGA 2J94A 1W2KH 2A2XH 1UTKA 1QR3E 1PPHE 3NPSA 5DP3A 4X0WU 1NTPA 1AB9C 3MWIU 1TGCA 3ATMA 4YESB 1FLEE 3KQEA 1H9IE 2ZPQA 3ATIA 1NN6A 3LJJA 1Y5BT 2O8UA 3MU0A 8LPRA 1W0YH 3GY7A 5HM2A 3A87A 1D3QB 1NRRH 5C2ZA 1KDQB 1MAYA 2R2WU 1GCTC 2FOMB 2XRCA 3UR6A 3SU4A 1V2KT 3ZYEA 1MU8B 1NC6A 1D6RA 1LCYA 3PV4A 2FXRA 1CHGA 1BT7A 1TIOA 4ABGA 5EW2H 3SUFA 3C27B 1EZSC 2Y5HA 1C1UH 4X1PU 3V7TA 4THNH 3SQEE 4XOJA 4UFFH 1SHHB 3NZIA 3SW2B 1W11U 1LPKB 3GY2A 1DVAH 3QLPH 1GI4A 1OWDA 3BG8A 1F2SE 3M7TA 2BQ7B 1XUFA 1AUTC 3M61U 2PKAB 1DITH 3PLKA 2FS9A 1VCPA 2P3UB 4ISHH 1V2PT 5DG6A 4CRBA 2VNTA 3T62A 1FIZA 2P94A 3LJOA 2EI7A 4NWLA 1EZXC 1UO6A 1PJPA 5EU8A 3T5FH 1MUEB 1O5GH 1S0RA 3KL6A 2C90B 1AU8A 4M7GA 1MTVA 1EZQA 2BDIA 1FDPA 3E0PB 1SGTA 1SQOA 3RXTA 2AMPA 1VJAU 4ISNA 3LC3A 2J34A 1GHBF 1O38A 1SQTA 4R0IA 4NWKA 2PHBA 2AS9A 3MNBA 2P59A 3AVZA 4Y0ZE 3URDA 1C1OA 2JKHA 5GIBA 3UNSA 3E8LA 3R3GB 1V2QT 1GHAF 5TJXA 3SNAA 3MFJA 2WYJA 2Z6BD 3SU3A 1B5GH 4O03A 2VVUA 1QL9A 4X6MA 1BMLA 1J8AA 2GD4B 2G5NA 4D9QA 4I7YH 1UTLM 1ARCA 2PTNA 3A85A 5AFYH 2V3HH 1BRBE 3DFJA 4FUJA 1GG6B 1GJ7B 3RXFA 2BY9X 4X8VH 1ZRKA 5EXMA 1GHXH 4AFUA 1IQNA 1QBNA 4NZQA 3ZVDA 4LZ1H 2H6MA 3LGYA 7GCHF 2NU1E 2WPLS 5TCAA 4IC5A 2ALVA 1Z8RA 1O39A 1F92A 1EKBB 3UNRA 4AFZA 3PMJA 1J15A 3A8AA 1EJNA 4NCYA 1HAHH 3AASA 1QA7A 4BAKB 3RXGA 4A7IB 4IMQA 1DSTA 4RKJB 1BA8B 1S83A 2FTLE 2AGIX 1ELDE 2G81E 2BD3A 3K6ZA 1YPEH 5FPTA 2CV3A 3LT3A 1BMAA 1BTYA 4K1TA 2C4FH 1U6QA 1C4V2 2BX4A 3BV9B 1YPHC 4NSYA 1CA0C 2PUQH 4X2XA 3SV6A 4ABEA 3VB3A 4A1XA 1WTGH 3P8GA 3PMAB 4WF8A 5GJ4B 2THFB 1AI8H 2EEKA 3KHVA 1SGQE 3E1XB 2FESH 3RLYH 1LKBA 2Y80A 1G37A 1DLKB 2Y82A 3OX7U 3VXEH 1C2HA 4KKDA 3MU4A 4K60A 5F8TA 4AB9A 5L30H 3RXEA 2OCVB 4Y0YE 1EAXA 4FUHA 4BANB 4AX9