1K1MA

Bovine trypsin-inhibitor complex
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
223
structure length
223
Chain Sequence
IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TRYPSIN
publication title Factorising ligand affinity: a combined thermodynamic and crystallographic study of trypsin and thrombin inhibition.
pubmed doi rcsb
molecule tags Hydrolase
total genus 55
structure length 223
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 2001-09-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1k1mA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1k1mA02
4LZ4B 3BG4C 3RXUA 5HYOA 1WCZA 3S9AA 4I31A 3MHWU 4CRCA 1GI0A 2SGQE 3MWIU 4SGBE 3TH3H 4BTTB 2SNVA 2ZTYA 2P3FH 2WPLS 3MFJA 4TWYA 3SNCA 2C8WB 2BDHA 3F9EA 1GHZA 4KGAA 4GLYA 1C9PA 1PQ7A 3O8CA 4MG3A 4BNRA 1O2XA 1CBWB 1O2VA 1D3QB 2GDDA 1VGCB 4INHA 4FU7A 1V2VT 4X2WA 1DICA 4B71A 1GBFA 3RC5A 1CA8B 1RTLA 1C1VH 2QYIA 1GI2A 4KP0A 4MNVA 1AVWA 1V2LT 2KAIA 3WY8A 3RXKA 1RTKA 1HAGE 2ZI2H 5C67A 8GCHG 3GY5A 1V2QT 2WPHS 2C90B 3RXGA 3RMNH 5FBEA 2ZEBA 1ZHPA 1NTPA 4GCHF 3K9XB 1HJ8A 1SOTA 1C2KA 1CHOG 1AQ7A 1TRMA 2B5TB 1ZPZA 1ARCA 1A5HA 1O2KA 4GVUA 3ZVAA 1GI8B 1X7AC 1F5RA 3FVFB 2BY5X 3RLWH 1AKSB 1CVWH 1P57B 1EOLA 4IW4E 5FCKA 2CHAB 1QR3E 1KLTA 3MH4A 2FYRA 1TQ7B 2ZU2A 4UEHH 1ZZZA 1LDTT 3K6YA 5TCCA 1IQHA 1UJ1A 1ORFA 2B0FA 1DUEA 1J15A 5L2YH 1O2HA 1T4VH 2FOAA 2QCYA 3PO1C 1HB0B 2VJ1A 1DDJA 2PWXA 5HM9A 4I8HA 1TB6H 3KIDU 1O3MA 1UTJA 4NIXA 1XKAC 5EOKA 2Z3DA 1MTNB 3A8AA 1GGDC 3VB3A 1THPB 3LKWA 1Z8GA 4U2WA 3SGQE 1GHBF 3RDZA 1UHBA 1GJDB 1WAYB 2O8WA 2R2WU 2UUYA 3ZVEA 1HAVA 4CBOA 1T7CA 1ELAA 1SI5H 3HGPA 4JCNA 8LPRA 1LHEH 1YF4A 3SU1A 1ZTLA 2ZPRA 1QL9A 2AS9A 2WUCA 2SFAA 4AZ2B 1ANDA 3TGJE 1AVXA 1K1IA 4I8LA 2P16A 5FPTA 1OYTH 3A81A 1KLIH 3OY6U 2C93B 1VITH 1ZSKA 2VNTA 2FP7B 1OP0A 2FI5E 1P04A 3H7OA 3RP2A 1OKXA 4U01A 1YLCA 2FOFA 1NFXA 5FX6A 1FPHH 1IQMA 3V7TA 4B1TA 1Z8RA 2YNBA 2VIVA 1QQUA 3P6ZB 1C4Y2 2J92A 4JYVH 2GV6A 3RXOA 5ESBA 2C4FH 5JPMH 3PO1B 3QWCH 3PMAB 3SU5A 3GY3A 1AD8H 4I8JA 2QN5T 4UFEH 4AFUA 1WQSA 1O32A 2A32A 2ZGXH 1C5UA 1GGDB 1FXYA 1CSOE 2QF0A 3K65B 3KEEA 2RA3A 1O33A 4JZDH 1BUIA 2CV3A 1QRXA 2WV4A 3MNXA 1XUJA 3TK5A 2BYAX 4U32A 3SORA 3QZRA 2QIQA 1UVSH 5AFZH 1VR1H 1XUKA 2BDGA 3MNBA 1J9CH 3K6ZA 2W7UA 1H8IH 1MAYA 3KQDA 3SU4A 4Y79A 2BD4A 3TVJB 1DT2A 2R0KA 1DOJA 1F0SA 1VCPA 4XDEA 3SO3A 2ZP0H 3O8BA 1O2QA 1GBIA 1GCTC 2Z9LA 4ZHMU 2C8ZB 5EXMA 1K22H 3A8CA 5C1UA 3RLYH 4F49A 1KXDA 3VGCB 5A0CA 2D1JA 1EJAA 1O3BA 3A7ZA 3AW0A 1O3KA 1FY5A 2QAAA 3P92A 2OD3B 3RXMA 3TU7H 4ABEA 1SG8B 1XVMA 1B7XB 5IYTA 1VCQA 4X1RU 1FPCH 4ABBA 2W5EA 1SGTA 3BEIB 2FZZA 2RA0A 2GT7A 3MTYA 2OBQA 1KXAA 5E0GA 1CT4E 1YP9A 1S0RA 1GHXH 1ZR0A 3CS7A 3OY5U 1ZJKA 2QA9E 2GDEH 1HNEE 3GY8A 1TGBA 1TGSZ 1GBTA 1LPGB 3LGYA 2FS9A 1LPKB 3AASA 3NZIA 5HMAA 1NT1A 5EQQA 1W7XH 1NROH 3A7WA 1E37B 4IGDA 3ZVCA 3RXSA 3T26A 4JZ1A 4K5ZA 1FAKH 2G5VA 1EZSC 2ZECA 2BD2A 3SZNA 2TGAA 3LIWA 2QXJA 5T6DA 4MPWA 1O2LA 2VH0A 1OP2A 2O8TA 2VIOA 2F9PA 3Q76A 1O31A 4RKOB 3UOPA 1SGEE 1K2I1 1DM4B 2CMYA 4CR5A 3HPTB 2OQ5A 1TALA 4DGJA 2ANYA 2Y82A 1ZHRA 3A7XA 1THRH 2BY8X 3PTBA 2P3UB 1MCTA 5GCHF 6GCHG 1JRSA 2BX3A 1IQEA 1VITG 2JKHA 1W2KH 1GL1A 2AIPA 4GHQA 1DLEA 2FLRH 5E2OA 1P01A 1WYKA 1O35A 1J14A 4JZFH 1HYLA 5JB9S 3DD2H 5GCHG 5TCAA 4TWWA 4B75A 2ZDLA 5LPEA 3TJUA 3A82A 1PPBH 3SV2H 1W14U 1UK2A 4Y8XA 1HAXB 3ZVBA 2VGCC 2ZDKA 1JOUB 1O3LA 1TX7A 3MH6A 4X6PA 2O9QA 4MQAA 3QO6A 5LPRA 1A5IA 5FHTA 1AE8H 2ZU3A 2Y5HA 3E0PB 4GHTA 2ZDAH 3TJVA 1C5SA 2J9NA 5F6MA 3V12A 1YPLH 4D7FA 1S84A 1YPHE 1RD3B 1N1LA 5FPSA 1Y8TA 2A45B 1IQNA 2P8OC 4JZEH 1FDPA 2Y5GA 1GI7B 2F9VA 1BRCE 1CA0B 1O2NA 2BZAA 1NRQH 1O37A 3A7TA 2F9OA 3AAVA 2FMJA 3A89A 3U69H 5G4BA 2ZCHP 1O2TA 1SB1H 1FY1A 4B76A 1BOQA 2HNTC 2FO9A 3FP6E 4Q7ZA 3SBKA 3MU5A 2FWWA 4UFDH 1T8OA 4UD9H 1JIMA 2QXGA 4WVPE 2A4OA 3PLPA 1PYTC 1HCGA 1A1RA 3R3GB 5CMXH 1XXDA 5GWZA 1WBGB 3BTWE 4IN2A 1O3JA 3M35A 1BRAA 4LOYH 2IJOB 2RCEA 1UHBB 1L1JA 1GI3A 3GY4A 1HAVB 1QB1A 3SN8A 1D4PB 1P2JA 3QTOH 2FI3E 1KY9A 3OX7U 4AFQA 1XM1A 1HGTH 2BOKA 1QRZA 2LPRA 4MNWA 3I29A 1PPGE 1N6YA 1QJ6B 1XUFA 1GDQA 3DFLA 1TNKA 1Z8IB 3RXDA 3GISB 1LMWB 2P8OB 3E8LA 3PM3A 3BTHE 2W7SA 4FVDA 1O2PA 4FUDA 2Y80A 1XKBC 4O97A 1EJMA 3SJIA 3P95A 1GBHA 4IMZA 1HV7A 2BDCA 1VJAU 1C1NA 3D23A 5DJ7A 3STJA 3QZQA 1G3DA 1FY3A 3GY2A 1Y5AT 1GI1A 5EG4A 2ANMH 7ESTE 1NRSH 4KTCA 3RU4D 1MCVA 2EI8A 1PQ8A 3U8OH 2XBYA 2H1UA 1H1BA 4R0IA 2Y81A 4ZHLU 2A1DB 3UFAA 1O5FH 3V3MA 2Z9IA 2AGIX 4TPYA 2ZF0H 1BZXE 2GGVB 2VU8E 2NU3E 1WU1A 2WPMS 4A5TS 4D8NA 1MTWA 4FUHA 1ELTA 2NU2E 1H9IE 1PQ5A 4CH2B 1Z6EA 3D65E 3LJJA 1SR5C 1DVAH 4Y71A 3SU3A 1TNIA 2IOTA 5F8ZA 3RU4T 3S7KB 1KTTB 1S83A 3NK8A 1QY6A 1EQ9A 5ESTE 4ABIA 2A31A 2I6SA 1SSXA 2B8OH 4BAHB 2DUCA 2STAE 1ZGVA 1XMNB 1GDNA 5BRRE 1G9IE 1VCWA 2H9EH 1ZRBA 1NPMA 4ZMAH 4AYYB 2GCTB 4RKJB 1TOCB 4CHAC 3SNAA 1O2GH 4IN1A 3RXIA 1AGJA 2VH6A 4Z0KA 5LGOA 4AX9H 1KDQA 2XC0A 2XCNA 3IWMA 1D3DB 1UTOA 3UPEA 4E05H 1A0LA 4R8TB 4AG1A 4JYUH 3ATWA 1CT0E 1TABE 1Y3UA 3RXLA 4BOHA 1C5QA 1C5RA 1C2HA 1FI8A 4I32A 1LPZB 4WF8A 2Q6FA 4KKDA 2ZCKP 1A46H 2HGTH 5IDKA 4GAWA 3SGAE 1DSUA 1AN1E 1P05A 1L1NA 1QQ4A 3Q00A 3TNTA 5JBTA 4H4FA 1TGTA 1PYTD 4Y0YE 1S82A 3ITIA 2GD4B 1Z1JA 1PFXC 1W0ZU 1HAYB 2FTLE 3I78A 2FODA 4IC6A 1V3XA 4JMYA 1FUJA 4ZXXH 4Z6AH 2XW9A 1TNJA 3FZDA 4CHAB 1JBUH 1SHYA 2NU1E 4ZKSU 3KN2A 3DA9B 2Y5FA 1C5NH 1EOJA 1PPHE 1SGNE 3F9GA 3FAOA 2ZHQH 1O3IA 4O3UA 2HPPH 2PR3A 3PV4A 3ODFA 5AVDA 3EA9A 2OINA 2FOBA 3M3TA 3RXTA 1O5DH 1ZRKA 1K1OA 2ZDNA 3F6UH 3GDVA 3OTJE 4YZUA 2SGAA 1SHHB 1P2IA 1HAPH 1ZTKA 3E16B 2WYJA 5DPAA 4TPIZ 2A4QA 2ULLA 2VB0A 1IOEA 1G36A 1AZ8A 3GYLB 3LH3A 1GI4A 1EKBB 1P8VC 1N8OB 1Q2WA 1YPJH 5A2MH 4YT7H 5AHGH 1UMAH 1NFYA 2PKAA 2HPQH 2ALVA 2ZQ2A 4IMQA 1G32B 2OTVA 1O0DH 4DCDA 1HXEH 3RMLH 1A61H 3BTME 2OCVB 1GI9B 2JH6D 2TGPZ 4D9QA 8GCHF 1GJ4H 1O3PB 3KGPA 1O2OA 4NFFA 3VXFH 3LGIA 4SGAE 1EX3A 1CHOF 3A84A 3M7QA 5F03A 5DP7A 5C5NA 5C2ZA 3SNDA 3ZVFA 5T6GA 1GJ8B 1A2CH 1AIXH 2ZIQH 2ZDVH 2GCHF 2XWBI 4ZKOU 1QBNA 1TBZH 1DXWA 3JZ2B 2J34A 1O2YA 1P0SH 3L6PA 3UNSA 1P2NA 2WINI 4TY7A 4O9VA 1LKBA 3QK1A 5FBIA 2Z9JA 7GCHG 2OC1A 2OUAA 1OWIA 1SC8U 1VZQH 5DG6A 4LZ1H 1W8BH 2QXIA 4D76A 2GCHG 1DLKB 2J4IA 4RSPA 1BMMH 3ZZ6A 1DS2E 3LGVA 2BM2A 3BG4B 3T5FH 3VXEH 1BIOA 1BA8B 1EAUA 1GHAF 3AW1A 1W7GH 2G00A 1DITH 5A8YA 1P2QA 1QB6A 1TONA 1V2NT 3ZZ5A 1UK3A 2OQUA 3BTFE 3VFEA 1DE7H 3NXPA 4K3JA 2Q6DA 2ZFPH 1V2KT 1GHAG 2QV1A 3P8FA 4U30A 1D9IA 2ZGHA 4ZUHA 2WPKS 4YLQH 1BHXB 2EI6A 3IG6B 3M3SA 3QGJA 1V2TT 2FI4E 3A8BA 3GDSA 4H6SB 1IQIA 3E1XB 2I6QA 1WQVH 1O3EA 1KXCA 1TFXA 1MKXK 1SGCA 4WMEA 2ZWLH 3M36A 3DUXH 1GBCA 1BMAA 4FUEA 5C1XA 2SGFE 1BRBE 1HRTH 3ZVGA 1TMUH 1CQQA 3E91A 4X8SH 2RG3A 1YCPK 3HK3B 4AB8A 3M3VA 1FJSA 4NWKA 4K1SA 4ZXYH 1EPTA 3E90B 3KL6A 4D7GA 3SJKA 1FAXA 1EB2A 4CRGA 4Q2KA 3SUGA 2B9LA 1MBQA 5A8XA 1G30B 5DP8A 3M61U 1BB0B 7KMEH 1D6RA 2ZQ1A 4X8UH 3UNQA 1C1TA 1J16A 4AFSA 3A86A 2QF3A 3PLKA 3U1JB 1TGNA 3VB5A 2ZA5A 5HXFA 5EPYA 2GZ9A 4HFPB 3S9CA 1BITA 1V2UT 2BD5A 4BTIB 2ZPQA 1NY22 8KME2 4X1NU 2R9PA 2ZTXA 3R0FA 5JYIA 1CU1A 2ZDMA 4MTBA 1FY8E 1OWDA 2PSYA 1EAWA 1KDQB 4OGXA 3BTTE 4F4OC 2Z7FE 3EDXB 5K0HA 1HXFH 1M9UA 2BLOA 1GMHG 2G4UA 2VVUA 3BTGE 4I33A 3LGWA 3SU0A 3ZZ8A 1ZPCA 1FONA 4UDWH 1Y59T 4XOJA 4LXBH 3HATH 1JRTA 3TJOA 2BX4A 4H6TA 1L4ZA 1SMFE 1BJVA 2HWLB 2OLGA 1LVMA 2AMQA 1Z6JH 1O2WA 1GI5A 5FPYA 2J94A 4B74A 1EP6A 4AYVB 4BAKB 1HAHH 3EQ0H 4CREA 3SV8A 1ZPBA 3LGUA 1UTKA 3PYHA 3P8GA 4M7GA 4I8KA 2J2UA 3TGKE 1YKTA 2SGDE 1EZXC 2VWNA 1DWBH 3P8OA 4NA9H 3A8DA 3TJNA 1ARBA 3FZZA 4E06H 1EP5A 3QX5H 4DJZB 2WYGA 3VB7A 1C9TA 1EZUC 1BTWA 1ANBA 3SNEA 3TH2H 4ISNA 4ISLA 3RXAA 3QN7A 5DP5A 1RFNA 4FXGH 4ISIH 3TLOA 1P9UA 1LKAA 4ESTE 1NS3A 3MO3A 1AWHB 2V3OH 2BOHB 2F9NA 3E6PH 3RU4E 1K28D 2OC0A 4NG9H 2F83A 2Z3EA 2XYAA 1V2JT 1C1MA 1QA0A 2Z3CA 3A7VA 3EYDA 1YC0A 1S85A 2D2DA 4ABAA 6GCHF 2ZCLP 4UFGH 1NN6A 1GCTB 3URDA 3BN9A 1OOKB 1OWJA 1T8NA 1VITF 4UE7H 2PKAB 3NUMA 5DGJA 1A5GH 3BV9B 4A1XA 1TPPA 3PTNA 2PFEA 4NSVA 2XC5A 1O5AB 1WV7H 2BQ7B 4XBDA 1L2EA 2O8LA 1BTHH 3MO6A 2VIDA 1CHGA 1ZLRA 1UVTH 2A2XH 4NGAH 1DFPA 1HIAA 4BANB 4BXSA 1MKXH 2GTBA 3SHAH 1O2JA 3U9AH 4NZLA 1ZGIA 1HAZB 4NWLA 3N7OA 3RC6A 5LH8A 2P95A 1HAOH 4Y10E 1P2MA 4Y7AA 2R3UA 1LTOA 2KAIB 1YCPH 1GBAA 3T62A 4D9RA 1GMDF 3BTEE 1C5ZB 3PLBA 4OGYA 1XXFA 3LJOA 1UVOA 4YOGA 1BTYA 2Q1JA 4JYTA 2ZGCA 1VJ9U 1TWXB 2R0LA 3UR9A 2TIOA 1O36A 1JMOH 3ZVDA 1C1UH 1FIWA 1YPEH 3F68H 4GSOA 1LHCH 2VWOA 1EPTC 1GMDG 1AUJA 4Q80A 1SGYE 3SOSA 1HDTH 1BJUA 4AFZA 1V2RT 1ESTA 1PPEE 2PUQH 2HNTE 1WOFA 2XXLA 4INKA 1T4UH 2IN2A 2PUXB 3ZV8A 2D26C 4FU9A 3O8RA 3HKIB 1T32A 5A8ZA 4CBNA 4BTUB 1MZDA 3A7YA 1Y5BT 2H6MA 3RXHA 1C1QA 1SQOA 4K1TA 1A0JA 5PTPA 1GBBA 2AEIH 1KLJH 6CHAC 2ODQA 4NA8A 2BHGA 1A3EH 1GBMA 1N6XA 1RS0A 3ATKA 3TK9A 5I25A 2BDIA 4GPGA 1FN8A 3ZZ4A 1GDUA 1CGIE 1DWDH 4UFFH 4FU8A 1J8AA 1CE5A 4B2AA 1ETTH 2AIQA 2PKSC 2ZFTA 1RXPA 1UTPA 2JETC 3ZZ9A 2VGCB 1YM0A 4YOIA 1AVGH 5C1YA 2VIPA 3Q3XA 1KYNA 3NKKA 3P8NA 4CR9A 1FZZA 3B23B 3QUMP 5I46H 1OX1A 1W10U 1EPTB 4Y8ZA 4NIYA 5SGAE 1GBEA 1Y3VA 3P70B 1AKSA 3ZZDA 1TRNA 4CH8B 1MKWK 1NRNH 1BBRK 4TY6A 2DE8A 1ID5H 1O34A 1S6HA 2ASUB 1NU9A 4Q7YA 5AF9H 1K1MA 4NSYA 1QGFA 5A0BA 4NCYA 5EU8A 1TQ0B 1ZYOA 3S69A 4MDSA 4X8VH 1O3CA 1C5YB 1DPOA 1K21H 4DIHH 3U98H 4WY3A 3ZYEA 6CHAB 1MH0A 3MU0A 2YNAA 2NU0E 3K2UA 1TX6A 3SU2A 1B5GH 1UTNA 1LVBA 2YOLA 1ZJDA 2G4TA 4GUXA 1QURH 3LT3A 4ZAEA 3SU6A 1E34B 1H9LB 1ELVA 4WXVA 1W0YH 5CE1A 3F9FA 4MLFB 1D3PB 3GCHC 5ABWA 2FLBH 3SJ9A 3SUFA 2BQ6B 1C4U2 3LC5A 3RXVA 5BPEA 4UONA 1C2FA 2ZO3H 2H9HA 2ALPA 2A5KA 5E0HA 3DFJA 2ZKSA 3RXJA 1E35B 2FOHA 1ELEE 1SGDE 1C1RA 3V0XA 2VIQA 1QCPA 4AOQA 1C2JA 2FM2A 3EE0B 5FCRA 1O3GA 1SLXB 3MU8A 4YO9A 4WWYA 2BMGB 5HM2A 1HLTH 1ZSJA 2GMTC 3BIUH 2FOEA 2PTNA 3A80A 2FS8A 2XRCA 1FIZA 1ANEA 3A87A 3KF2A 1V2WT 1P3EA 2SGEE 3SNBA 2W26A 2JH0D 1TPOA 1S81A 1O30A 1W3CA 3H5CB 3TH4H 1MUEB 1BTXA 1BTUA 4ISHH 4Y6DA 3LU9B 1C5TA 1YGCH 1O3NA 1ZSLA 3RMMH 1P10A 1DSTA 1RJXB 2FXRA 4CRBA 3B8JA 5J4QA 1NZQH 4MVNA 1TMBH 4IBLH 4A92A 2ANKH 1F92A 3W94A 3A83A 4K69A 3GCHB 2ODPA 4J1YA 4E7RG 2ZC9H 3SQEE 1AY6H 1KXFA 2BXUH 1GJ9B 1UO6A 2FEQH 3BTKE 2ODYB 1UVUH 4ABDA 1EAXA 6ESTA 2ILNA 2F9BH 1ABJH 3RXCA 1INCA 2UUKB 4VGCC 4IC5A 4MNXA 2XNIA 3LOXA 3SW2B 1HPGA 1TAWA 2ZHWH 4CRDA 5T6FA 3UY9A 4DW2U 8ESTE 4Y11E 1LHGH 3TIUA 3ZZCA 1C5XB 1DX5M 1C2LA 1LVYA 4NIVA 3SJ8A 9LPRA 1O2IA 4ABHA 1IAUA 2GMTB 1B0FA 1GJAB 2GZ8A 3FFGA 5TJXA 5DO4H 4ASHA 2BD8A 2XTTB 3LGTA 1Z71A 2G81E 1O5BB 3PROA 1OWKA 5L2ZH 1H8DH 1TPSA 1DANH 1HIAB 5LPFA 1EB1H 1O38A 1UTQA 3C27B 3P17H 3E0NB 3D49H 3S9BA 1GMCG 2HOBA 3PMHB 3RXPA 4X2XA 1V2MT 2XC4A 3L3TA 3SI4H 2QXHA 1GBJA 1ELBA 1TNGA 3A88A 4HZHA 3CENA 2OBOA 1QA7A 1SQTA 1TRYA 1V2ST 1C1PA 3UIRA 2D8WA 2UUFB 3SQHE 4MPXA 1MKWH 4DIIH 1P11E 1BBRH 1G3EA 1T31A 1XX9A 1SGFG 3KQBA 1RIWC 2ZHFH 1E38B 2AFQB 1HJAC 1MAXA 3ESTA 2WUBA 3UTUH 3DHKH 1WSSH 4B2BA 5DP3A 1CO7E 1L0ZA 2Z9GA 2BB4A 2CHAC 2J38A 3FP7E 2GP9B 1S5SA 2VIWA 3BEFB 3LDXH 3RXRA 1F0TA 1F5LA 1MTUA 4A1VA 1Y3XA 1YPMH 2VWMA 1QRWA 3AAUA 1TA2A 1NC6A 2CF8H 2BXTH 4B73A 1IQFA 2ZHDA 3VEQB 1AMHA 3EGKH 2ESTE 1F0UA 1QIXB 2A5IA 2AGGX 5CHAC 5FX5A 4ZHAA 7GCHF 1MTSA 1P2OA 3QDZB 2ZPSA 4A6LA 4ZKRU 4X2VA 1AZZA 1QJ7B 2VVCA 1O2MA 2FTMA 5L6NH 2BLVA 1BMLA 1L4DA 5C3NA 2ZGBH 1O2UA 4WMFA 2CXVA 4K2YA 2A5AA 3QLPH 1C1OA 1OWEA 1MTNC 4WMDA 2UWPA 3BIVH 1O3OA 1P09A 1PQAA 4FUGA 1GHYH 5E8EH 2F91A 4DURA 5EODA 1G3CA 2XBVA 1ACBE 5L30H 2EA3A 1GG6C 1IQKA 1TIOA 4THNH 4ZROA 5ETXA 5GIBA 3ATIA 1FV9A 3JZ1B 1MBMA 3QGNB 2NU4E 2Z94A 4OS1A 1SPJA 3STIA 1DY8A 1ESBA 3IITA 4K8BA 3D62A 1K1PA 1FLEE 4KELA 4OS5A 1RIWB 3PMJA 4LK4A 3SHCH 1HJAB 4Q7XA 1H9HE 2FIRH 2H9TH 3HK6B 1HJ9A 2BTCE 1WTGH 4GCHG 3MO9A 1AO5A 2BVRH 3QTVH 1C1WH 1ELCA 2TPIZ 1LHDH 3KHVA 4AG2A 1GHWH 2HRVA 5GPIB 1BDAA 3ZZ3A 2FX6A 4NZQA 3LH1A 1EATA 1SLUB 3KNXA 1GBKA 1NO9H 4FVBA 2H5DA 3EA8A 5CHAB 1GL0E 1BQYA 2BD7A 2GV7A 2NWNA 3OU0A 1YPKH 2VINA 3CS0A 2QY0B 1GJ5H 2Z9KA 1OWHA 3UUZA 2ZG0H 4AN7A 1PJPA 1ETSH 1YLDA 3M5LA 4RN6A 2P59A 3C1KA 3O8DA 4FUJA 1BRUP 4AGJA 4YM9A 1ZTJA 4TYDA 5JBAS 2BQWB 4Y7BA 4I8GA 1GG6B 3UWIA 1LVOA 2TGTA 4PROA 5JB8S 1EJNA 1WUNH 1MMJN 2A2QH 3G01A 2GT8A 1GHBG 5EGMA 5FAHA 2ZHEH 1P06A 3MI4A 4HTCH 4BAOB 2BVSH 3TGIE 1QTFA 1PPCE 4JK6A 3SV9A 1IQJA 2B7DH 3M5NA 1K1NA 1GMHF 1SGPE 1QBOA 1BTZA 2FDAA 2G5NA 1QL8A 3MU4A 1AHTH 1S0QA 2OXSA 2A7CA 2M5TA 3MOCA 1O5CB 2GVFA 1D3TB 5DP9A 1TA6A 4O03A 3VGCC 2FX4A 1T8MA 3GY6A 2JH5D 2C8XB 1IHSH 3BTDE 1V2PT 3SGBE 3OYPA 1OSSA 1AI8H 1BT7A 1KSNA 3RMOH 4KTSA 1AFEH 3RXFA 2GZ7A 1IQLA 3PB1E 4J2YB 1ABIH 1FMGA 1JIRA 4WH6A 4K60A 2LNCA 4O3TA 4NA7A 1LHFH 1W13U 4DOQA 1SFQB 4NIWA 1NFUA 4QT8C 5T3HA 2BDBA 3ELAH 4DG4A 3MH5A 1S6FA 5JBBS 3T2NA 3FP8E 2K1QA 1K9OE 2BDAA 2BZ6H 1NM6A 1U6QA 3ZV9A 1NU7B 1T8LA 2XCFA 2AH4X 4H42U 2DE9A 2Y7ZA 5EW1H 1YPGH 2THFB 1NRPH 4YESB 3RM2H 4X1PU 2CN0H 1ZMNA 2ZU4A 4WJG2 1GBDA 2HNTF 3U1IB 3VB4A 1GI6A 1GCDA 1SOZA 3HKJB 5A0AE 3AVZA 3SJOA 1C2EA 1EUFA 4ZH8A 1TNHA 3S0NA 3UNRA 2BLWA 2GKVE 2PHBA 2PTCE 2V3HH 4KTUA 4X8TH 1QFKH 2GX4A 1OPHB 4XBCA 1OXGA 1UCYE 1GJBB 1TLDA 1BMNH 2O8UA 1C1SA 6LPRA 2ZTZA 3GDUA 3UR6A 1UK4A 4ISOA 3GCOA 2A7JA 2V35A 2VWLA 4XSKU 3PWBA 1TBRH 2O8MA 3SUDA 2ZGJA 2FPZA 2TGDA 1C5PA 4XE4A 1F2SE 1XUIA 1GHVH 1GVKB 1UVPA 4MNYA 1KTSB 3NWUA 1Z7KA 3F1SB 5EW2H 1EXFA 4A1TA 4DY7B 1V2OT 1BBRE 4X6NA 2H5CA 4XFQA 1RRKA 1O2RA 5A09A 3CP7A 4AGKA 1YBWA 1SLVB 1G37A 3URCA 1JXPA 1O5EH 4X1SU 1TMTH 2XBWA 2AYWA 3UQVA 5C5OA 3GY7A 2ZFQH 1AFQC 3Q3YA 2OP9A 3M5MA 4FUFA 5EQRA 1O2SA 1SGRE 1XUGA 1TGCA 1O3FA 1JWTA 1EAIA 3Q3KA 5GJ4B 4AB9A 2FESH 1CA0C 3EA7A 1ZMJA 5H4IB 1WTHD 1SQAA 4K1EA 2V0BA 4IS5A 4ABGA 1DXPA 1NRRH 5EPNA 2Q6GA 4AORA 1P02A 2W3IA 3BSQA 4Y8YA 4DVAU 1QL7A 3B9FH 3TPIZ 3MNCA 1MZAA 1GJ6A 1EASA 3SV6A 3UREA 2FOCA 4NFEA 5C20A 1ELDE 1QJ1B 4FUCA 2CJIA 2PV9B 4WH8A 2ZFRH 4OS2A 4ZKNU 5B6OA 1G2LA 4BAMB 1EZQA 1Y3WA 1C2GA 2HALA 1DWCH 3M7TA 3GCTF 1TE0A 5EXLA 5J4SA 3M37A 2XBXA 1TNLA 3VB6A 3Q77A 3UOUA 1QNJA 1RTFB 1TPAE 2AMPA 5JDUB 1GJCB 4Y76A 4INLA 1P03A 1P12E 2HVXA 1QBVH 1ANCA 1AFQB 4X2YA 3RUOA 1SL3A 3GCTG 4MPUA 4FUIA 3H7TA 3GICB 5DP6A 2G51A 3MYWA 2AGEX 2UUJB 3ATLA 3M5OA 4CRFA 1IQGA 2UWLA 5FXLA 5E2PA 1NESE 1SVPA 3A85A 2ZFSA 1UCYK 3FANA 1YPHC 5HGGA 1HBTH 4XBBA 4X0WU 1HAIH 1YCPM 3NPSA 4A7IB 3T29A 1TBQH 1G2MA 4X6OA 3BF6H 1DY9A 2A0QB 1L1GA 3BEUA 1QB9A 1P2KA 1ETRH 2W3KA 4YLUA 2J95A 5K7RA 1BCUH 1Z1IA 1XVOA 1MTVA 5EQSA 2RDLA 1K1JA 1P3CA 2TBSA 1KXEA 1TOMH 7LPRA 3GCNA 2ANWA 3ZZAA 4CRAA 1O2ZA 1C5OH 2QC2A 1C5LH 1J17T 2SNWA 3ODDA 3NCLA 4OS7A 5DP4A 4I7YH 1E0FD 1A4WH 4FUBA 2PGQB 2ZU5A 2C8YB 1H4WA 1TYNA 1A0HB 2ZFFH 1C4V2 3DT0H 1O3AA 2V6NA 1FNIA 1AWFH 2H2ZA 1ELGA 3UQOA 1OYQA 5E0JA 2VVVA 2FOGA 2Z6BD 1MU8B 3L33A 2CF9H 2G8TA 1YYY1 2HLCA 3E3TA 1IHTH 2PGBB 1O3HA 2GCTC 1LQDB 4OS4A 2TRMA 2BVXH 2SGPE 1HFDA 3BTQE 3SI3H 1ELFA 3UWJH 3RM0H 3V13A 2PKSB 2G55A 1GBLA 3PMBB 2WPJS 2FYQA 2G52A 4E7NA 1DWEH 4BXWA 2JETB 3U8RH 1UTMA 1THSH 1SBWA 3RC4A 1UTLM 1AB9C 3RXEA 3MH7A 5DKMA 2BY6X 1SGIB 4DT7B 3T25A 1BTPA 3OSYA 1F5KU 1O5GH 3KQEA 2BD3A 4Y0ZE 1LO6A 1MD7A 2OC8A 2ZZUH 5EXNA 2EC9H 2Y6TA 1C5VA 1ZMLA 4HGCA 3ENSB 3RXBA 2P3TB 3HGNA 2R2MB 3KCGH 2OC7A 1XUHA 1C5WB 1C2IA 1BHXF 3TNSA 1Y5UT 5JBCS 1MQ6A 2QGRA 3I77A 4ABJA 2A7HA 1FY4A 1O39A 3LONA 5DK1A 2C3SA 2PSXA 1GPZA 2XWAA 3BG8A 1NFWA 3EAJA 2BD9A 2F3CE 4WXIA 1SFIA 2ZU1A 1OP8A 1SLWB 1LCYA 1E36B 2BLQA 2STBE 3VPKA 1FN6A 4YT6H 2UWOA 1KXBA 4K8YA 1Y3YA 1A7SA 3TK6A 1GVZA 1P9SA 1RGQA 1F0RA 2PW8H 2WV5A 2EEKA 3SV7A 1CGJE 1LQEA 5F8TA 1K1LA 2Y7XA 1Q31A 4YTAA 1GJ7B 2BY9X 1PPFE 3MMGA 4JK5A 2F9UA 4YOJA 1AB9B 2FOMB 1PPZA 1AE5A 1G3BA 1SGFA 2WPIS 4MPVA 1TX8A 1ESAA 3SUEA 3GOVB 5F8XA 1QHRB 3LC3A 9ESTA 3ZYDA 1D6WA 3KQCA 1W12U 2EI7A 4B2CA 1N8OC 1GVLA 3PWCA 1GWAA 1CT2E 1ZHMA 1CGHA 3LPRA 3MU1A 1MQ5A 4BAQB 1A3BH 5AFYH 1GMCF 1MD8A 3RXQA 1F7ZA 1ZOMA 1DUAA 1OS8A 4HI3A 2BY7X 1C2DA 2P93A 4ABFA 1UCYH 2ZNKH 2P94A 1B0EA 2AERH 4X6MA 1HUTH 4X1QU 1Z8JB 5GDSH 1CBWC 3ZZBA 2AMDA 1VGCC 1Q3XA 3MNSA 1C5MD 1KIGH 3W95A 4JZIA 2A4RA 1AUTC 2A4GA 3TITA 3ATMA 2IPHA 1V6DA 1W11U 4OS6A 3M7UA 3T27A 2CGAA 1O3DA 1SGQE 3ZZ7A 1MU6B 5GXPA 1FQ3A 3U8TH 2PLXA 3F9HA 2R3YA 3GYMA 3T28A 4VGCB 1AU8A 2BDYA 3S7HB 1C2MA
chains in the Genus database with same CATH superfamily
4LZ4B 3BG4C 3RXUA 5HYOA 1WCZA 3S9AA 4I31A 5KEDA 3MHWU 4CRCA 1GI0A 2SGQE 3MWIU 4SGBE 5KGOA 3TH3H 4BTTB 2SNVA 2ZTYA 2P3FH 2WPLS 3MFJA 4TWYA 3SNCA 2C8WB 2BDHA 3F9EA 1GHZA 4KGAA 4GLYA 1C9PA 1PQ7A 3O8CA 4MG3A 4BNRA 1O2XA 3F2HA 1CBWB 1O2VA 1D3QB 2GDDA 1VGCB 4INHA 4FU7A 1V2VT 4X2WA 5C0UA 1DICA 4B71A 1GBFA 3RC5A 1CA8B 1RTLA 1C1VH 2QYIA 1GI2A 4KP0A 4MNVA 1AVWA 1V2LT 2KAIA 3WY8A 3RXKA 1RTKA 1HAGE 2ZI2H 5C67A 8GCHG 3GY5A 1V2QT 2WPHS 2C90B 3RXGA 2EQNA 3RMNH 5FBEA 2ZEBA 1ZHPA 1NTPA 4GCHF 3K9XB 1HJ8A 1SOTA 1C2KA 1CHOG 1AQ7A 1TRMA 2B5TB 1ZPZA 1ARCA 1A5HA 1O2KA 4GVUA 3ZVAA 1GI8B 1X7AC 1F5RA 3FVFB 2BY5X 3RLWH 1AKSB 1CVWH 1P57B 2J5UA 1EOLA 4IW4E 5FCKA 2CHAB 1QR3E 1KLTA 3MH4A 2FYRA 1TQ7B 3DCLA 4F48B 2ZU2A 4UEHH 1ZZZA 1LDTT 3OEED 3K6YA 5TCCA 1IQHA 1UJ1A 1ORFA 2B0FA 1DUEA 1J15A 5L2YH 1O2HA 3KQ5A 1T4VH 5EJZA 2FOAA 2QCYA 3PO1C 1HB0B 2VJ1A 1DDJA 2PWXA 5HM9A 4I8HA 1TB6H 3KIDU 1O3MA 1UTJA 4NIXA 3SYJA 1XKAC 5EOKA 2Z3DA 3WWFA 1MTNB 3A8AA 1GGDC 3VB3A 1FX0B 1THPB 3LKWA 1Z8GA 4U2WA 3SGQE 1GHBF 3RDZA 1UHBA 1GJDB 1WAYB 2O8WA 2R2WU 2UUYA 3ZVEA 1HAVA 4CBOA 1T7CA 1ELAA 1SI5H 3HGPA 4JCNA 5EJ1A 8LPRA 1LHEH 1YF4A 3SU1A 1ZTLA 2ZPRA 1QL9A 2AS9A 2WUCA 2SFAA 4AZ2B 1ANDA 3TGJE 1AVXA 1K1IA 4I8LA 2P16A 5FPTA 1OYTH 2QF4A 1QZ8A 3A81A 1KLIH 3OY6U 2C93B 1VITH 1ZSKA 2VNTA 2WZQA 2FP7B 1OP0A 2FI5E 1P04A 3H7OA 3RP2A 1OKXA 4U01A 1YLCA 2FOFA 1NFXA 1W0JD 5FX6A 1FPHH 3PRBA 1IQMA 3V7TA 3DSPA 4B1TA 1Z8RA 2YNBA 2VIVA 1QQUA 3P6ZB 1C4Y2 2J92A 4JYVH 2GV6A 3RXOA 5ESBA 2C4FH 5JPMH 3PO1B 3QWCH 3PMAB 3SU5A 3GY3A 1AD8H 4I8JA 2QN5T 4UFEH 4AFUA 1WQSA 1O32A 2A32A 2ZGXH 1C5UA 1GGDB 1FXYA 1CSOE 2QF0A 3K65B 3KEEA 2RA3A 1O33A 4JZDH 1BUIA 2CV3A 1QRXA 2WV4A 3MNXA 1XUJA 3TK5A 2BYAX 4U32A 3SORA 3QZRA 2QIQA 1UVSH 5AFZH 1VR1H 1XUKA 2BDGA 5EIYA 3MNBA 1J9CH 3K6ZA 2W7UA 4B6EA 1H8IH 1MAYA 3KQDA 3SU4A 4Y79A 2BD4A 3TVJB 1DT2A 5HIYA 2R0KA 1DOJA 1F0SA 1VCPA 4XDEA 3SO3A 2ZP0H 3O8BA 1O2QA 1GBIA 1GCTC 2Z9LA 4ZHMU 2C8ZB 5EXMA 1K22H 3A8CA 5C1UA 3PRDA 3RLYH 4F49A 1KXDA 3VGCB 5HKKD 5A0CA 2D1JA 1EJAA 1O3BA 3A7ZA 3AW0A 1O3KA 1FY5A 2QAAA 3P92A 2OD3B 3RXMA 3TU7H 4ABEA 1SG8B 1XVMA 1B7XB 5IYTA 1VCQA 4X1RU 1FPCH 4ABBA 2HVYB 2W5EA 1SGTA 4M9FA 3BEIB 2FZZA 2RA0A 2GT7A 3MTYA 2OBQA 1KXAA 5E0GA 1CT4E 1YP9A 1S0RA 1GHXH 1ZR0A 3CS7A 3OY5U 1ZJKA 2QA9E 2GDEH 1HNEE 3GY8A 2J97A 1TGBA 1TGSZ 1GBTA 1LPGB 3LGYA 2FS9A 1LPKB 3AASA 3NZIA 2WPDD 5HMAA 1NT1A 5EQQA 1W7XH 1NROH 3A7WA 1E37B 4IGDA 3ZVCA 3RXSA 3T26A 1UW7A 4JZ1A 4K5ZA 1FAKH 2G5VA 1EZSC 2ZECA 2BD2A 3SZNA 4ACBA 2TGAA 3LIWA 2QXJA 5T6DA 4MPWA 1O2LA 2VH0A 1OP2A 2O8TA 2VIOA 2F9PA 3Q76A 1O31A 4RKOB 3UOPA 1SGEE 1K2I1 1DM4B 2CMYA 4CR5A 3HPTB 2OQ5A 1TALA 4DGJA 2ANYA 2Y82A 2F4LA 1ZHRA 3A7XA 1THRH 2WHXA 2BY8X 3PTBA 2P3UB 1MCTA 5GCHF 6GCHG 1JRSA 2BX3A 1IQEA 2JDID 1VITG 2JKHA 1W2KH 1GL1A 2AIPA 4GHQA 1DLEA 2FLRH 5E2OA 1P01A 3F0PA 1WYKA 1O35A 1J14A 4JZFH 1HYLA 5JB9S 3DD2H 5GCHG 5TCAA 4TWWA 4B75A 2ZDLA 5LPEA 3TJUA 3A82A 5KECA 1PPBH 3SV2H 1W14U 1UK2A 4Y8XA 1HAXB 3UB0A 3ZVBA 2VGCC 2ZDKA 1JOUB 1O3LA 1TX7A 4XD7D 3MH6A 4X6PA 2O9QA 4MQAA 3QO6A 5LPRA 1A5IA 5FHTA 1AE8H 2ZU3A 2Y5HA 3E0PB 4GHTA 3VG8A 3EE7A 2ZDAH 3TJVA 1C5SA 2J9NA 5F6MA 3V12A 1YPLH 4D7FA 1S84A 1YPHE 1RD3B 1N1LA 5FPSA 1Y8TA 2A45B 5B6LA 1IQNA 2P8OC 4JZEH 1FDPA 2Y5GA 1GI7B 2F9VA 1BRCE 1CA0B 1O2NA 2BZAA 1NRQH 1O37A 3A7TA 2F9OA 3AAVA 2FMJA 3A89A 3U69H 5G4BA 2ZCHP 1O2TA 1SB1H 1FY1A 4B76A 1BOQA 2HNTC 2FO9A 3FP6E 4Q7ZA 3SBKA 3MU5A 2FWWA 4UFDH 4TSFD 1T8OA 4UD9H 3W1EA 1JIMA 2QXGA 4WVPE 2KFWA 2A4OA 3PLPA 1PYTC 1HCGA 1A1RA 3R3GB 5CMXH 1XXDA 5GWZA 1WBGB 3BTWE 4IN2A 1O3JA 3M35A 1BRAA 4LOYH 2IJOB 2RCEA 1UHBB 1L1JA 1GI3A 3GY4A 1HAVB 1QB1A 3SN8A 1D4PB 1P2JA 3QTOH 2FI3E 1KY9A 5HIZA 3OX7U 4AFQA 1XM1A 1HGTH 2BOKA 1QRZA 2LPRA 4MNWA 3I29A 1PPGE 1N6YA 1QJ6B 1XUFA 1GDQA 3DFLA 1TNKA 1Z8IB 3RXDA 3GISB 1LMWB 2P8OB 3E8LA 3PM3A 3BTHE 2W7SA 4FVDA 1O2PA 4FUDA 2Y80A 1XKBC 4O97A 4P00A 1EJMA 3SJIA 3P95A 1GBHA 4IMZA 1HV7A 2BDCA 1VJAU 1C1NA 3D23A 5DJ7A 3STJA 4Z1MD 3QZQA 1G3DA 1FY3A 3GY2A 1Y5AT 1GI1A 5EG4A 2ANMH 7ESTE 1NRSH 4KTCA 3RU4D 1MCVA 2EI8A 1PQ8A 3U8OH 2XBYA 2H1UA 4ZCNA 1H1BA 4R0IA 2Y81A 4ZHLU 2A1DB 3UFAA 1O5FH 3V3MA 2Z9IA 2AGIX 4TPYA 2ZF0H 1BZXE 2GGVB 2VU8E 2NU3E 1WU1A 2WPMS 4A5TS 4D8NA 1MTWA 4FUHA 1ELTA 3FO8D 2NU2E 1H9IE 1PQ5A 4CH2B 1Z6EA 3D65E 3LJJA 1SR5C 1DVAH 4Y71A 3SU3A 1TNIA 2IOTA 5F8ZA 3RU4T 3S7KB 1KTTB 1S83A 3NK8A 1QY6A 1EQ9A 5ESTE 4ABIA 2A31A 1YLNA 2I6SA 1SSXA 2B8OH 4BAHB 2DUCA 2STAE 1ZGVA 1XMNB 1GDNA 5BRRE 1G9IE 1VCWA 2H9EH 1ZRBA 1NPMA 4ZMAH 4AYYB 2GCTB 4RKJB 1TOCB 4CHAC 3SNAA 1O2GH 4IN1A 3RXIA 1AGJA 2VH6A 4Z0KA 5LGOA 4AX9H 1KDQA 2XC0A 2XCNA 3IWMA 1D3DB 1UTOA 3UPEA 1WXRA 2J98A 4E05H 1A0LA 4R8TB 4AG1A 4JYUH 3ATWA 1CT0E 1TABE 1Y3UA 3RXLA 4BOHA 1C5QA 1C5RA 1C2HA 1FI8A 4I32A 1LPZB 3F2FA 4WF8A 2Q6FA 4KKDA 2ZCKP 1A46H 2HGTH 5IDKA 4GAWA 3SGAE 1DSUA 1AN1E 1P05A 1L1NA 1QQ4A 3Q00A 3TNTA 5JBTA 4H4FA 1TGTA 1PYTD 4Y0YE 1S82A 3ITIA 2GD4B 1Z1JA 1PFXC 1W0ZU 1HAYB 2FTLE 3I78A 3MQKC 2FODA 4IC6A 1V3XA 4JMYA 1FUJA 4ZXXH 4Q63A 2LP6A 4Z6AH 2XW9A 1TNJA 3FZDA 4CHAB 1JBUH 1SHYA 2NU1E 4ZKSU 1E1RD 3KN2A 3DA9B 2Y5FA 1C5NH 1EOJA 1PPHE 1SGNE 3F9GA 3FAOA 2ZHQH 1O3IA 1NBMD 4O3UA 2HPPH 2PR3A 3PV4A 3ODFA 5AVDA 3EA9A 2OINA 2FOBA 3M3TA 3RXTA 1O5DH 1ZRKA 1K1OA 2ZDNA 3F6UH 3GDVA 3OTJE 1SQRA 4YZUA 2SGAA 1SHHB 1P2IA 1HAPH 1ZTKA 3E16B 2WYJA 5DPAA 4TPIZ 2A4QA 2ULLA 2VB0A 1IOEA 1G36A 1AZ8A 3GYLB 3LH3A 1GI4A 1EKBB 1P8VC 1N8OB 1Q2WA 1YPJH 5A2MH 4YT7H 5AHGH 1UMAH 1NFYA 2PKAA 2HPQH 2ALVA 2ZQ2A 4IMQA 1G32B 2OTVA 1O0DH 4DCDA 1HXEH 3RMLH 1A61H 3BTME 2OCVB 1GI9B 2JH6D 2TGPZ 4D9QA 8GCHF 1GJ4H 1O3PB 3KGPA 1O2OA 4NFFA 3VXFH 3LGIA 4SGAE 1EX3A 1CHOF 3A84A 3M7QA 5F03A 5DP7A 5C5NA 5C2ZA 3SNDA 3ZVFA 5T6GA 1GJ8B 1A2CH 1AIXH 2ZIQH 2ZDVH 2GCHF 2XWBI 4ZKOU 1QBNA 2F43B 1TBZH 1DXWA 3JZ2B 2J34A 1O2YA 1P0SH 3L6PA 3UNSA 1P2NA 2WINI 4TY7A 4O9VA 1LKBA 3QK1A 5FBIA 2Z9JA 7GCHG 2OC1A 2OUAA 1OWIA 1SC8U 1VZQH 5DG6A 4LZ1H 1W8BH 2QXIA 4D76A 2GCHG 1DLKB 2J4IA 4RSPA 1BMMH 3ZZ6A 1DS2E 3LGVA 2BM2A 3BG4B 3T5FH 3VXEH 1BIOA 1BA8B 1EAUA 1GHAF 3AW1A 1W7GH 2G00A 1DITH 5A8YA 1P2QA 4ASUD 1QB6A 4TT3D 1TONA 1V2NT 3ZZ5A 2RDEA 1UK3A 2OQUA 3BTFE 3VFEA 1DE7H 3NXPA 4K3JA 2Q6DA 2ZFPH 1V2KT 1GHAG 2QV1A 3P8FA 4U30A 1D9IA 2ZGHA 4ZUHA 1OHHD 2WPKS 4YLQH 1BHXB 2EI6A 3IG6B 3M3SA 3QGJA 1V2TT 2FI4E 3A8BA 3GDSA 4H6SB 1IQIA 3E1XB 2I6QA 2L74A 1WQVH 1O3EA 1KXCA 1TFXA 1MKXK 1SGCA 4WMEA 2ZWLH 3M36A 3DUXH 1GBCA 1BMAA 4FUEA 5C1XA 2SGFE 1BRBE 1HRTH 3ZVGA 1TMUH 1CQQA 3E91A 4X8SH 2RG3A 1YCPK 3HK3B 4AB8A 3M3VA 1FJSA 4NWKA 4K1SA 4ZXYH 1EPTA 3E90B 3KL6A 4D7GA 3F2GA 3SJKA 1FAXA 1EB2A 4CRGA 4XRNA 4Q2KA 3SUGA 2B9LA 1MBQA 5A8XA 1G30B 2KX4A 5DP8A 3M61U 3N99A 1BB0B 7KMEH 1D6RA 2ZQ1A 4X8UH 3UNQA 1C1TA 1J16A 4AFSA 3OFND 3A86A 2QF3A 3PLKA 3U1JB 2QE7D 1TGNA 3VB5A 2ZA5A 5HXFA 5EPYA 2GZ9A 4HFPB 3S9CA 1BITA 1V2UT 2BD5A 4BTIB 2ZPQA 1NY22 8KME2 4X1NU 2R9PA 2ZTXA 3R0FA 5JYIA 1CU1A 2ZDMA 4MTBA 1FY8E 1OWDA 2PSYA 1EAWA 1KDQB 4OGXA 3BTTE 4F4OC 2Z7FE 3EDXB 5K0HA 3PV5A 1HXFH 1M9UA 2BLOA 1GMHG 2G4UA 2VVUA 3BTGE 4I33A 3LGWA 3SU0A 3ZZ8A 1ZPCA 1FONA 4UDWH 1Y59T 2IJD1 4XOJA 2V3MA 4LXBH 3PV2A 3HATH 1JRTA 3TJOA 2BX4A 4H6TA 1L4ZA 1SMFE 1BJVA 2HWLB 2OLGA 1LVMA 2AMQA 1Z6JH 1O2WA 1GI5A 5FPYA 2J94A 4B74A 1EP6A 2XOKD 4AYVB 4BAKB 1HAHH 3EQ0H 4CREA 3SV8A 1ZPBA 3LGUA 1VKYA 4B6FA 1UTKA 3PYHA 3P8GA 4M7GA 4I8KA 2J2UA 3TGKE 1YKTA 2SGDE 1EZXC 2VWNA 1W0KD 1DWBH 2JJ2D 3P8OA 4NA9H 3A8DA 3TJNA 1ARBA 3DSGA 3FZZA 4E06H 1EP5A 3QX5H 4DJZB 2WYGA 3VB7A 1C9TA 1EZUC 1BTWA 1ANBA 3SNEA 3TH2H 4ISNA 4ISLA 3RXAA 3QN7A 5DP5A 1RFNA 4FXGH 4ISIH 3TLOA 1P9UA 1LKAA 4ESTE 1NS3A 3MO3A 1AWHB 2V3OH 2BOHB 2F9NA 3E6PH 3RU4E 1K28D 2OC0A 4NG9H 2F83A 2Z3EA 2HLDD 3AK5A 2XYAA 1V2JT 3WWBA 1C1MA 1QA0A 2Z3CA 3A7VA 4YXWD 3GS9A 3EYDA 1H8ED 1YC0A 1S85A 2D2DA 4ABAA 6GCHF 2ZCLP 4UFGH 1NN6A 1GCTB 3URDA 3BN9A 1OOKB 1OWJA 1T8NA 1VITF 4UE7H 2PKAB 3NUMA 5DGJA 1A5GH 3BV9B 4A1XA 1TPPA 3PTNA 2PFEA 4NSVA 4FETA 2XC5A 1O5AB 1WV7H 2BQ7B 4XBDA 1L2EA 2O8LA 1BTHH 3MO6A 2VIDA 1CHGA 1ZLRA 1UVTH 2A2XH 4NGAH 1DFPA 1HIAA 5CDFE 4BANB 4BXSA 1MKXH 2GTBA 3SHAH 2KCAA 1O2JA 3U9AH 4NZLA 1ZGIA 1HAZB 4NWLA 3N7OA 3RC6A 5LH8A 2P95A 1HAOH 4Y10E 1P2MA 4Y7AA 2R3UA 1LTOA 2KAIB 1YCPH 1GBAA 2WV9A 3T62A 4D9RA 1GMDF 3BTEE 1C5ZB 3PLBA 4OGYA 1XXFA 3LJOA 1UVOA 4YOGA 1BTYA 2Q1JA 4JYTA 2ZGCA 1VJ9U 1TWXB 2R0LA 3UR9A 1COWD 2TIOA 3FOAA 1O36A 1JMOH 3ZVDA 1C1UH 1FIWA 1YPEH 3F68H 4GSOA 1LHCH 2VWOA 1EPTC 1GMDG 1AUJA 4Q80A 1SGYE 3SOSA 1HDTH 1BJUA 4AFZA 1V2RT 1ESTA 1PPEE 2PUQH 2HNTE 1WOFA 2XXLA 4INKA 1T4UH 2IN2A 2PUXB 3ZV8A 2D26C 4FU9A 3O8RA 3HKIB 1T32A 5A8ZA 4CBNA 4BTUB 1MZDA 3A7YA 1Y5BT 2H6MA 5EJLA 3RXHA 1C1QA 1SQOA 4K1TA 1A0JA 5PTPA 1GBBA 2AEIH 1KLJH 6CHAC 2ODQA 4NA8A 2BHGA 1A3EH 1GBMA 1N6XA 1RS0A 3ATKA 3TK9A 5I25A 2BDIA 4GPGA 1FN8A 3ZZ4A 1GDUA 1CGIE 1DWDH 4UFFH 4FU8A 1J8AA 1CE5A 4B2AA 1ETTH 2AIQA 2PKSC 2ZFTA 1RXPA 1NBME 1UTPA 2JETC 3ZZ9A 2VGCB 1YM0A 4YOIA 1AVGH 5C1YA 2VIPA 3Q3XA 1KYNA 3NKKA 3P8NA 4CR9A 1FZZA 3B23B 4I86A 3QUMP 5I46H 1OX1A 1W10U 1EPTB 4Y8ZA 4NIYA 5SGAE 1GBEA 1Y3VA 3P70B 1AKSA 3ZZDA 1TRNA 4CH8B 1MKWK 3UAIC 1NRNH 1BBRK 4TY6A 2DE8A 1WDIA 1ID5H 1O34A 1S6HA 2ASUB 1NU9A 4Q7YA 5AF9H 1K1MA 4NSYA 1QGFA 2M2AA 5A0BA 4NCYA 5EU8A 1TQ0B 1ZYOA 3S69A 4ACAA 2KCYA 4MDSA 4X8VH 1O3CA 1C5YB 1DPOA 1K21H 4DIHH 3U98H 4WY3A 3ZYEA 6CHAB 1MH0A 3MU0A 2YNAA 2NU0E 3K2UA 5C0TA 1TX6A 3SU2A 1B5GH 1UTNA 1LVBA 2YOLA 1ZJDA 2G4TA 4GUXA 1QURH 3LT3A 4ZAEA 3SU6A 1SKYE 1E34B 1H9LB 1ELVA 4WXVA 1W0YH 5CE1A 3F9FA 4MLFB 1D3PB 3GCHC 5ABWA 2FLBH 3SJ9A 3SUFA 2BQ6B 1C4U2 3LC5A 3RXVA 5BPEA 4UONA 1C2FA 2ZO3H 2H9HA 2ALPA 2A5KA 5E0HA 3DFJA 2ZKSA 3RXJA 1E35B 2FOHA 1ELEE 1SGDE 1C1RA 3V0XA 2VIQA 1QCPA 4AOQA 1C2JA 2FM2A 3EE0B 5FCRA 1O3GA 1SLXB 3MU8A 4YO9A 4WWYA 2BMGB 5HM2A 1HLTH 1ZSJA 2GMTC 3BIUH 2FOEA 2PTNA 3A80A 2FS8A 2XRCA 1FIZA 1ANEA 3A87A 3KF2A 1V2WT 4OM9A 1P3EA 2SGEE 3SNBA 2W26A 2JH0D 1TPOA 1S81A 1O30A 1W3CA 3H5CB 3TH4H 1MUEB 1BTXA 1BTUA 5IK2D 4ISHH 4Y6DA 3LU9B 1C5TA 1YGCH 5FL7D 1O3NA 1ZSLA 3RMMH 1P10A 1DSTA 1RJXB 2FXRA 4CRBA 3B8JA 5J4QA 1NZQH 4MVNA 1TMBH 2YMSC 4IBLH 4A92A 2ANKH 1F92A 3W94A 3A83A 4K69A 3GCHB 2ODPA 4J1YA 4E7RG 2ZC9H 3SQEE 1AY6H 1KXFA 2BXUH 1GJ9B 1UO6A 2FEQH 3BTKE 2ODYB 1UVUH 4ABDA 1EAXA 6ESTA 2ILNA 2F9BH 1ABJH 3RXCA 1INCA 2UUKB 4VGCC 4IC5A 4MNXA 2XNIA 3LOXA 3SW2B 1HPGA 1TAWA 2ZHWH 4CRDA 2QF5A 5T6FA 3UY9A 4DW2U 8ESTE 4Y11E 1LHGH 3TIUA 3ZZCA 1C5XB 1DX5M 1C2LA 1LVYA 4NIVA 3SJ8A 1S6LA 9LPRA 1O2IA 4ABHA 1IAUA 2GMTB 1B0FA 1GJAB 2GZ8A 3FFGA 5TJXA 5DO4H 4ASHA 2BD8A 2XTTB 3LGTA 1Z71A 5T1VA 2G81E 3OE7D 1O5BB 3PROA 1OWKA 5L2ZH 1H8DH 1TPSA 1DANH 1HIAB 5LPFA 1EB1H 1O38A 1UTQA 1EFRD 3C27B 3P17H 3E0NB 3D49H 3S9BA 1GMCG 2HOBA 3PMHB 3RXPA 4X2XA 1V2MT 2XC4A 3L3TA 3SI4H 2QXHA 1GBJA 1ELBA 1TNGA 3A88A 2YMSB 4HZHA 3CENA 2OBOA 1QA7A 2CK3D 2V7QD 1SQTA 5C94A 1TRYA 1V2ST 1C1PA 3UIRA 2D8WA 2UUFB 3SQHE 4MPXA 1MKWH 4DIIH 1P11E 1BBRH 1G3EA 1T31A 1XX9A 1SGFG 3KQBA 1RIWC 2ZHFH 1E38B 2AFQB 1HJAC 1MAXA 3ESTA 2WUBA 3UTUH 3DHKH 1WSSH 4B2BA 5DP3A 1CO7E 1L0ZA 2Z9GA 2BB4A 2CHAC 2J38A 3FP7E 2GP9B 1S5SA 2VIWA 3BEFB 3LDXH 3RXRA 1F0TA 1F5LA 1MTUA 4A1VA 1Y3XA 1YPMH 2VWMA 1QRWA 3AAUA 1TA2A 1NC6A 2CF8H 2BXTH 4B73A 1IQFA 2ZHDA 3VEQB 1AMHA 3EGKH 2ESTE 1F0UA 1QIXB 2A5IA 2AGGX 5CHAC 5FX5A 4ZHAA 7GCHF 1MTSA 1P2OA 3QDZB 2ZPSA 4A6LA 4ZKRU 2GJGA 4X2VA 1AZZA 1MABB 1QJ7B 2VVCA 1O2MA 2RFKC 2FTMA 5L6NH 2BLVA 1BMLA 1L4DA 2K8IA 5C3NA 2ZGBH 1O2UA 4WMFA 2CXVA 4K2YA 2A5AA 3WW7A 3QLPH 1C1OA 1OWEA 1MTNC 5F53A 4WMDA 2UWPA 3BIVH 1O3OA 1P09A 1PQAA 4FUGA 1GHYH 5E8EH 2F91A 4DURA 5EODA 1G3CA 2XBVA 1ACBE 5L30H 2EA3A 1GG6C 1IQKA 1TIOA 4THNH 4ZROA 5ETXA 5GIBA 3ATIA 1FV9A 3JZ1B 1MBMA 3QGNB 2WSSD 2NU4E 2Z94A 4OS1A 1SPJA 3STIA 1DY8A 1ESBA 3IITA 3N7EA 3D62A 4K8BA 1K1PA 1FLEE 4KELA 4OS5A 1RIWB 3PMJA 4LK4A 3SHCH 1HJAB 4Q7XA 1H9HE 2FIRH 2H9TH 3HK6B 1HJ9A 2BTCE 2YMSD 1WTGH 4GCHG 3MO9A 1AO5A 2BVRH 3QTVH 1C1WH 1ELCA 2TPIZ 1LHDH 3KHVA 4AG2A 1GHWH 2HRVA 5GPIB 1BDAA 3ZZ3A 2FX6A 4NZQA 3LH1A 1EATA 1SLUB 3KNXA 1GBKA 1NO9H 4FVBA 4DT4A 2H5DA 3EA8A 5CHAB 1GL0E 1BQYA 2BD7A 2GV7A 2NWNA 3OU0A 1YPKH 2VINA 3CS0A 2QY0B 4HG6A 1GJ5H 2Z9KA 1OWHA 3UUZA 2ZG0H 4AN7A 1PJPA 4Q4LA 1ETSH 1YLDA 3M5LA 4RN6A 2P59A 3C1KA 3O8DA 4FUJA 1BRUP 4AGJA 4YM9A 1ZTJA 4TYDA 5JBAS 2BQWB 4Y7BA 2EY4C 4I8GA 1GG6B 3UWIA 1LVOA 2TGTA 4PROA 5JB8S 1EJNA 1WUNH 1MMJN 2A2QH 3G01A 2GT8A 1GHBG 5EGMA 5FAHA 2ZHEH 1P06A 3MI4A 4HTCH 4BAOB 2BVSH 2LELA 3TGIE 1QTFA 1PPCE 4JK6A 5CHBA 3SV9A 1IQJA 2B7DH 3M5NA 1K1NA 1GMHF 1SGPE 1QBOA 1BTZA 2FDAA 2G5NA 1QL8A 3MU4A 3SZEA 1AHTH 1S0QA 2OXSA 2A7CA 2KZ4A 2M5TA 3MOCA 1O5CB 2GVFA 1D3TB 2L6OA 4AC9A 5DP9A 1TA6A 4O03A 3VGCC 2FX4A 1T8MA 3GY6A 2JH5D 2C8XB 1IHSH 3BTDE 1V2PT 3SGBE 2J98B 3OYPA 1OSSA 1AI8H 1BT7A 1KSNA 3RMOH 4KTSA 1AFEH 3RXFA 2GZ7A 1IQLA 3PB1E 4J2YB 1ABIH 1FMGA 1JIRA 4WH6A 4K60A 2LNCA 4O3TA 4NA7A 1LHFH 1W13U 4DOQA 1SFQB 4NIWA 1NFUA 4QT8C 5T3HA 2BDBA 3ELAH 4DG4A 3MH5A 1S6FA 5JBBS 3T2NA 3FP8E 2K1QA 1K9OE 2BDAA 2BZ6H 1NM6A 1U6QA 3ZV9A 1NU7B 1T8LA 2XCFA 2AH4X 4H42U 2DE9A 2JJ1D 2Y7ZA 5EW1H 1YPGH 2THFB 1NRPH 4YESB 3RM2H 4X1PU 2CN0H 1ZMNA 2ZU4A 4WJG2 4RT1A 1GBDA 2HNTF 3U1IB 3VB4A 1GI6A 1GCDA 2OK5A 1SOZA 3HKJB 5A0AE 3AVZA 3SJOA 1C2EA 4F55A 1EUFA 4ZH8A 1TNHA 3S0NA 3UNRA 2BLWA 2GKVE 2PHBA 2PTCE 2V3HH 4KTUA 4X8TH 1QFKH 2GX4A 1OPHB 4XBCA 1OXGA 1UCYE 1GJBB 1TLDA 1BMNH 2O8UA 1C1SA 6LPRA 2ZTZA 3GDUA 3UR6A 1UK4A 4ISOA 3GCOA 2A7JA 2V35A 2VWLA 4XSKU 3PWBA 2W6JD 1TBRH 2O8MA 4FOUC 3SUDA 2ZGJA 2FPZA 2TGDA 2XNDD 1C5PA 4XE4A 1F2SE 1XUIA 1GHVH 1GVKB 1UVPA 4MNYA 1KTSB 3NWUA 1Z7KA 3F1SB 5EW2H 1EXFA 4A1TA 4DY7B 1V2OT 1BBRE 4X6NA 2H5CA 4XFQA 1RRKA 1O2RA 5A09A 3CP7A 4AGKA 1YBWA 1SLVB 1G37A 3URCA 1JXPA 1O5EH 4X1SU 1TMTH 2XBWA 2AYWA 3UQVA 4P02A 5C5OA 3GY7A 2AHME 2ZFQH 1AFQC 3NRLA 3Q3YA 2OP9A 3M5MA 4FUFA 5EQRA 1O2SA 1SGRE 1XUGA 1TGCA 1O3FA 1JWTA 2W6ID 1EAIA 3Q3KA 2KCOA 5GJ4B 4AB9A 2FESH 1CA0C 3EA7A 1ZMJA 5H4IB 1WTHD 1SQAA 4K1EA 2V0BA 4IS5A 4ABGA 1DXPA 1NRRH 5EPNA 2Q6GA 4AORA 2VBCA 1P02A 2W3IA 3BSQA 4Y8YA 4DVAU 1QL7A 1YY3A 3B9FH 3TPIZ 3MNCA 1MZAA 1GJ6A 1EASA 3SV6A 3UREA 2FOCA 4NFEA 5C20A 1ELDE 1QJ1B 4FUCA 2CJIA 2PV9B 4WH8A 2ZFRH 4OS2A 4ZKNU 5B6OA 1G2LA 4BAMB 1EZQA 1Y3WA 1C2GA 2HALA 1DWCH 3M7TA 3GCTF 1TE0A 5EXLA 5J4SA 3M37A 2XBXA 1TNLA 3VB6A 3Q77A 3DSOA 3UOUA 1QNJA 1RTFB 1TPAE 2AMPA 5JDUB 1GJCB 4Y76A 4INLA 1P03A 1P12E 5GNDA 2HVXA 1QBVH 1ANCA 1AFQB 4X2YA 3RUOA 1SL3A 3GCTG 4MPUA 4FUIA 3H7TA 3GICB 3H09A 5DP6A 2G51A 3MYWA 2AGEX 2UUJB 3ATLA 3M5OA 4CRFA 1IQGA 2UWLA 1H8HD 5FXLA 5E2PA 1NESE 1SVPA 3A85A 2ZFSA 1UCYK 3FANA 1YPHC 5HGGA 1HBTH 4XBBA 4X0WU 1HAIH 1YCPM 3NPSA 3OTPA 3U28C 4A7IB 3T29A 1TBQH 1G2MA 4X6OA 3BF6H 1DY9A 2A0QB 1L1GA 3BEUA 1QB9A 1P2KA 1ETRH 2W3KA 4YLUA 2J95A 5K7RA 1BCUH 1Z1IA 1XVOA 1MTVA 5EQSA 2RDLA 3OEHD 1K1JA 1P3CA 2TBSA 1KXEA 1TOMH 7LPRA 3GCNA 2ANWA 3F0OA 3ZZAA 4CRAA 1O2ZA 1C5OH 2QC2A 1C5LH 1J17T 2SNWA 3ODDA 3NCLA 4OS7A 5DP4A 4I7YH 1E0FD 1A4WH 4FUBA 2PGQB 2ZU5A 2C8YB 1H4WA 1TYNA 1K0HA 1A0HB 2KR7A 2ZFFH 1C4V2 4RT0A 3DT0H 1O3AA 2V6NA 1FNIA 1AWFH 2H2ZA 1ELGA 3UQOA 4RI0A 1OYQA 5E0JA 2VVVA 2FOGA 2Z6BD 1MU8B 3L33A 3ZIAD 2CF9H 2G8TA 1YYY1 2HLCA 3E3TA 1IHTH 2PGBB 1O3HA 2GCTC 1LQDB 4OS4A 2TRMA 2BVXH 2SGPE 1HFDA 3BTQE 2KM0A 3SI3H 1ELFA 3FKSD 3UWJH 3RM0H 3V13A 2PKSB 2G55A 1GBLA 3PMBB 2WPJS 2FYQA 2G52A 4E7NA 1DWEH 4BXWA 2JETB 3U8RH 1UTMA 1THSH 1SBWA 3RC4A 1UTLM 1AB9C 2PP6A 3RXEA 3MH7A 5DKMA 2BY6X 1SGIB 4DT7B 3T25A 1BTPA 3OSYA 1F5KU 1O5GH 3KQEA 2BD3A 4Y0ZE 1LO6A 1MD7A 2OC8A 2ZZUH 5EXNA 2EC9H 2JIZD 1C5VA 2Y6TA 1ZMLA 4HGCA 3ENSB 3RXBA 2P3TB 3HGNA 2R2MB 3KCGH 2OC7A 1XUHA 1C5WB 1C2IA 1BHXF 3TNSA 3N7DA 1Y5UT 5JBCS 1MQ6A 2QGRA 3I77A 4ABJA 2A7HA 3CNRA 1FY4A 1O39A 3LONA 5DK1A 2C3SA 2PSXA 1GPZA 2XWAA 3BG8A 1NFWA 3EAJA 2BD9A 2F3CE 4WXIA 1SFIA 2ZU1A 2K0QA 1OP8A 1YWUA 1SLWB 1LCYA 1E36B 1BMFD 2BLQA 2STBE 3VPKA 1FN6A 4YT6H 5C17A 2UWOA 2KCPA 1KXBA 4K8YA 1Y3YA 1A7SA 3FN8A 1GVZA 3TK6A 1P9SA 1E1QD 1F0RA 1RGQA 1KMHB 1E79D 2PW8H 2WV5A 2EEKA 3SV7A 1CGJE 1LQEA 5F8TA 1K1LA 2Y7XA 1Q31A 4YTAA 1GJ7B 2BY9X 1PPFE 3MMGA 5DSFA 4JK5A 2F9UA 4YOJA 1AB9B 2FOMB 1PPZA 1AE5A 1G3BA 1SGFA 2IPQX 2WPIS 1TX8A 1ESAA 4MPVA 3SUEA 3GOVB 5F8XA 3KYGA 1QHRB 3LC3A 9ESTA 3ZYDA 1D6WA 3KQCA 1W12U 2EI7A 4B2CA 1N8OC 1GVLA 3PWCA 1GWAA 1CT2E 1ZHMA 1CGHA 3LPRA 3MU1A 1MQ5A 4BAQB 1A3BH 5AFYH 1GMCF 1MD8A 3RXQA 1F7ZA 1ZOMA 1DUAA 1OS8A 4HI3A 2BY7X 1C2DA 2P93A 4ABFA 1UCYH 2ZNKH 2P94A 1B0EA 2AERH 4X6MA 1HUTH 4X1QU 1Z8JB 5GDSH 1CBWC 3ZZBA 2AMDA 1VGCC 1Q3XA 3MNSA 1C5MD 1KIGH 3W95A 4JZIA 3OAAD 2A4RA 1AUTC 2A4GA 3TITA 3ATMA 2IPHA 1V6DA 1W11U 4OS6A 5DN6D 3M7UA 3T27A 2CGAA 1O3DA 1SGQE 3ZZ7A 1MU6B 5GXPA 1FQ3A 3U8TH 2PLXA 3F9HA 2R3YA 3KYFA 3F3BA 3GYMA 3T28A 4VGCB 1AU8A 2BDYA 3S7HB 1C2MA
chains in the Genus database with same CATH topology
4LZ4B 3BG4C 3RXUA 5HYOA 1WCZA 3S9AA 4I31A 3MHWU 4CRCA 1GI0A 2SGQE 3MWIU 4SGBE 3TH3H 4BTTB 2SNVA 2ZTYA 2P3FH 2WPLS 3MFJA 4TWYA 3SNCA 2C8WB 2BDHA 3F9EA 1GHZA 4KGAA 4GLYA 1C9PA 1PQ7A 3O8CA 4MG3A 4BNRA 1O2XA 1CBWB 1O2VA 1D3QB 2GDDA 1VGCB 4INHA 4FU7A 1V2VT 4X2WA 1DICA 4B71A 1GBFA 3RC5A 1CA8B 1RTLA 1C1VH 2QYIA 1GI2A 4KP0A 4MNVA 1AVWA 1V2LT 2KAIA 3WY8A 3RXKA 1RTKA 1HAGE 2ZI2H 5C67A 8GCHG 3GY5A 1V2QT 2WPHS 2C90B 3RXGA 3RMNH 5FBEA 2ZEBA 1ZHPA 1NTPA 4GCHF 3K9XB 1HJ8A 1SOTA 1C2KA 1CHOG 1AQ7A 1TRMA 2B5TB 1ZPZA 1ARCA 1A5HA 1O2KA 4GVUA 3ZVAA 1GI8B 1X7AC 1F5RA 3FVFB 2BY5X 3RLWH 1AKSB 1CVWH 1P57B 1EOLA 4IW4E 5FCKA 2CHAB 1QR3E 1KLTA 3MH4A 2FYRA 1TQ7B 2ZU2A 4UEHH 1ZZZA 1LDTT 3K6YA 5TCCA 1IQHA 1UJ1A 1ORFA 2B0FA 1DUEA 1J15A 5L2YH 1O2HA 1T4VH 2FOAA 2QCYA 3PO1C 1HB0B 2VJ1A 1DDJA 2PWXA 5HM9A 4I8HA 1TB6H 3KIDU 1O3MA 1UTJA 4NIXA 1XKAC 5EOKA 2Z3DA 1MTNB 3A8AA 1GGDC 3VB3A 1THPB 3LKWA 1Z8GA 4U2WA 3SGQE 1GHBF 3RDZA 1UHBA 1GJDB 1WAYB 2O8WA 2R2WU 2UUYA 3ZVEA 1HAVA 4CBOA 1T7CA 1ELAA 1SI5H 3HGPA 4JCNA 8LPRA 1LHEH 1YF4A 3SU1A 1ZTLA 2ZPRA 1QL9A 2AS9A 2WUCA 2SFAA 4AZ2B 1ANDA 3TGJE 1AVXA 1K1IA 4I8LA 2P16A 5FPTA 1OYTH 3A81A 1KLIH 3OY6U 2C93B 1VITH 1ZSKA 2VNTA 2FP7B 1OP0A 2FI5E 1P04A 3H7OA 3RP2A 1OKXA 4U01A 1YLCA 2FOFA 1NFXA 5FX6A 1FPHH 1IQMA 3V7TA 4B1TA 1Z8RA 2YNBA 2VIVA 1QQUA 3P6ZB 1C4Y2 2J92A 4JYVH 2GV6A 3RXOA 5ESBA 2C4FH 5JPMH 3PO1B 3QWCH 3PMAB 3SU5A 3GY3A 1AD8H 4I8JA 2QN5T 4UFEH 4AFUA 1WQSA 1O32A 2A32A 2ZGXH 1C5UA 1GGDB 1FXYA 1CSOE 2QF0A 3K65B 3KEEA 2RA3A 1O33A 4JZDH 1BUIA 2CV3A 1QRXA 2WV4A 3MNXA 1XUJA 3TK5A 2BYAX 4U32A 3SORA 3QZRA 2QIQA 1UVSH 5AFZH 1VR1H 1XUKA 2BDGA 3MNBA 1J9CH 3K6ZA 2W7UA 1H8IH 1MAYA 3KQDA 3SU4A 4Y79A 2BD4A 3TVJB 1DT2A 2R0KA 1DOJA 1F0SA 1VCPA 4XDEA 3SO3A 2ZP0H 3O8BA 1O2QA 1GBIA 1GCTC 2Z9LA 4ZHMU 2C8ZB 5EXMA 1K22H 3A8CA 5C1UA 3RLYH 4F49A 1KXDA 3VGCB 5A0CA 2D1JA 1EJAA 1O3BA 3A7ZA 3AW0A 1O3KA 1FY5A 2QAAA 3P92A 2OD3B 3RXMA 3TU7H 4ABEA 1SG8B 1XVMA 1B7XB 5IYTA 1VCQA 4X1RU 1FPCH 4ABBA 2W5EA 1SGTA 3BEIB 2FZZA 2RA0A 2GT7A 3MTYA 2OBQA 1KXAA 5E0GA 1CT4E 1YP9A 1S0RA 1GHXH 1ZR0A 3CS7A 3OY5U 1ZJKA 2QA9E 2GDEH 1HNEE 3GY8A 1TGBA 1TGSZ 1GBTA 1LPGB 3LGYA 2FS9A 1LPKB 3AASA 3NZIA 5HMAA 1NT1A 5EQQA 1W7XH 1NROH 3A7WA 1E37B 4IGDA 3ZVCA 3RXSA 3T26A 4JZ1A 4K5ZA 1FAKH 2G5VA 1EZSC 2ZECA 2BD2A 3SZNA 2TGAA 3LIWA 2QXJA 5T6DA 4MPWA 1O2LA 2VH0A 1OP2A 2O8TA 2VIOA 2F9PA 3Q76A 1O31A 4RKOB 3UOPA 1SGEE 1K2I1 1DM4B 2CMYA 4CR5A 3HPTB 2OQ5A 1TALA 4DGJA 2ANYA 2Y82A 1ZHRA 3A7XA 1THRH 2BY8X 3PTBA 2P3UB 1MCTA 5GCHF 6GCHG 1JRSA 2BX3A 1IQEA 1VITG 2JKHA 1W2KH 1GL1A 2AIPA 4GHQA 1DLEA 2FLRH 5E2OA 1P01A 1WYKA 1O35A 1J14A 4JZFH 1HYLA 5JB9S 3DD2H 5GCHG 5TCAA 4TWWA 4B75A 2ZDLA 5LPEA 3TJUA 3A82A 1PPBH 3SV2H 1W14U 1UK2A 4Y8XA 1HAXB 3ZVBA 2VGCC 2ZDKA 1JOUB 1O3LA 1TX7A 3MH6A 4X6PA 2O9QA 4MQAA 3QO6A 5LPRA 1A5IA 5FHTA 1AE8H 2ZU3A 2Y5HA 3E0PB 4GHTA 2ZDAH 3TJVA 1C5SA 2J9NA 5F6MA 3V12A 1YPLH 4D7FA 1S84A 1YPHE 1RD3B 1N1LA 5FPSA 1Y8TA 2A45B 1IQNA 2P8OC 4JZEH 1FDPA 2Y5GA 1GI7B 2F9VA 1BRCE 1CA0B 1O2NA 2BZAA 1NRQH 1O37A 3A7TA 2F9OA 3AAVA 2FMJA 3A89A 3U69H 5G4BA 2ZCHP 1O2TA 1SB1H 1FY1A 4B76A 1BOQA 2HNTC 2FO9A 3FP6E 4Q7ZA 3SBKA 3MU5A 2FWWA 4UFDH 1T8OA 4UD9H 1JIMA 2QXGA 4WVPE 2A4OA 3PLPA 1PYTC 1HCGA 1A1RA 3R3GB 5CMXH 1XXDA 5GWZA 1WBGB 3BTWE 4IN2A 1O3JA 3M35A 1BRAA 4LOYH 2IJOB 2RCEA 1UHBB 1L1JA 1GI3A 3GY4A 1HAVB 1QB1A 3SN8A 1D4PB 1P2JA 3QTOH 2FI3E 1KY9A 3OX7U 4AFQA 1XM1A 1HGTH 2BOKA 1QRZA 2LPRA 4MNWA 3I29A 1PPGE 1N6YA 1QJ6B 1XUFA 1GDQA 3DFLA 1TNKA 1Z8IB 3RXDA 3GISB 1LMWB 2P8OB 3E8LA 3PM3A 3BTHE 2W7SA 4FVDA 1O2PA 4FUDA 2Y80A 1XKBC 4O97A 1EJMA 3SJIA 3P95A 1GBHA 4IMZA 1HV7A 2BDCA 1VJAU 1C1NA 3D23A 5DJ7A 3STJA 3QZQA 1G3DA 1FY3A 3GY2A 1Y5AT 1GI1A 5EG4A 2ANMH 7ESTE 1NRSH 4KTCA 3RU4D 1MCVA 2EI8A 1PQ8A 3U8OH 2XBYA 2H1UA 1H1BA 4R0IA 2Y81A 4ZHLU 2A1DB 3UFAA 1O5FH 3V3MA 2Z9IA 2AGIX 4TPYA 2ZF0H 1BZXE 2GGVB 2VU8E 2NU3E 1WU1A 2WPMS 4A5TS 4D8NA 1MTWA 4FUHA 1ELTA 2NU2E 1H9IE 1PQ5A 4CH2B 1Z6EA 3D65E 3LJJA 1SR5C 1DVAH 4Y71A 3SU3A 1TNIA 2IOTA 5F8ZA 3RU4T 3S7KB 1KTTB 1S83A 3NK8A 1QY6A 1EQ9A 5ESTE 4ABIA 2A31A 2I6SA 1SSXA 2B8OH 4BAHB 2DUCA 2STAE 1ZGVA 1XMNB 1GDNA 5BRRE 1G9IE 1VCWA 2H9EH 1ZRBA 1NPMA 4ZMAH 4AYYB 2GCTB 4RKJB 1TOCB 4CHAC 3SNAA 1O2GH 4IN1A 3RXIA 1AGJA 2VH6A 4Z0KA 5LGOA 4AX9H 1KDQA 2XC0A 2XCNA 3IWMA 1D3DB 1UTOA 3UPEA 4E05H 1A0LA 4R8TB 4AG1A 4JYUH 3ATWA 1CT0E 1TABE 1Y3UA 3RXLA 4BOHA 1C5QA 1C5RA 1C2HA 1FI8A 4I32A 1LPZB 4WF8A 2Q6FA 4KKDA 2ZCKP 1A46H 2HGTH 5IDKA 4GAWA 3SGAE 1DSUA 1AN1E 1P05A 1L1NA 1QQ4A 3Q00A 3TNTA 5JBTA 4H4FA 1TGTA 1PYTD 4Y0YE 1S82A 3ITIA 2GD4B 1Z1JA 1PFXC 1W0ZU 1HAYB 2FTLE 3I78A 2FODA 4IC6A 1V3XA 4JMYA 1FUJA 4ZXXH 4Z6AH 2XW9A 1TNJA 3FZDA 4CHAB 1JBUH 1SHYA 2NU1E 4ZKSU 3KN2A 3DA9B 2Y5FA 1C5NH 1EOJA 1PPHE 1SGNE 3F9GA 3FAOA 2ZHQH 1O3IA 4O3UA 2HPPH 2PR3A 3PV4A 3ODFA 5AVDA 3EA9A 2OINA 2FOBA 3M3TA 3RXTA 1O5DH 1ZRKA 1K1OA 2ZDNA 3F6UH 3GDVA 3OTJE 4YZUA 2SGAA 1SHHB 1P2IA 1HAPH 1ZTKA 3E16B 2WYJA 5DPAA 4TPIZ 2A4QA 2ULLA 2VB0A 1IOEA 1G36A 1AZ8A 3GYLB 3LH3A 1GI4A 1EKBB 1P8VC 1N8OB 1Q2WA 1YPJH 5A2MH 4YT7H 5AHGH 1UMAH 1NFYA 2PKAA 2HPQH 2ALVA 2ZQ2A 4IMQA 1G32B 2OTVA 1O0DH 4DCDA 1HXEH 3RMLH 1A61H 3BTME 2OCVB 1GI9B 2JH6D 2TGPZ 4D9QA 8GCHF 1GJ4H 1O3PB 3KGPA 1O2OA 4NFFA 3VXFH 3LGIA 4SGAE 1EX3A 1CHOF 3A84A 3M7QA 5F03A 5DP7A 5C5NA 5C2ZA 3SNDA 3ZVFA 5T6GA 1GJ8B 1A2CH 1AIXH 2ZIQH 2ZDVH 2GCHF 2XWBI 4ZKOU 1QBNA 1TBZH 1DXWA 3JZ2B 2J34A 1O2YA 1P0SH 3L6PA 3UNSA 1P2NA 2WINI 4TY7A 4O9VA 1LKBA 3QK1A 5FBIA 2Z9JA 7GCHG 2OC1A 2OUAA 1OWIA 1SC8U 1VZQH 5DG6A 4LZ1H 1W8BH 2QXIA 4D76A 2GCHG 1DLKB 2J4IA 4RSPA 1BMMH 3ZZ6A 1DS2E 3LGVA 2BM2A 3BG4B 3T5FH 3VXEH 1BIOA 1BA8B 1EAUA 1GHAF 3AW1A 1W7GH 2G00A 1DITH 5A8YA 1P2QA 1QB6A 1TONA 1V2NT 3ZZ5A 1UK3A 2OQUA 3BTFE 3VFEA 1DE7H 3NXPA 4K3JA 2Q6DA 2ZFPH 1V2KT 1GHAG 2QV1A 3P8FA 4U30A 1D9IA 2ZGHA 4ZUHA 2WPKS 4YLQH 1BHXB 2EI6A 3IG6B 3M3SA 3QGJA 1V2TT 2FI4E 3A8BA 3GDSA 4H6SB 1IQIA 3E1XB 2I6QA 1WQVH 1O3EA 1KXCA 1TFXA 1MKXK 1SGCA 4WMEA 2ZWLH 3M36A 3DUXH 1GBCA 1BMAA 4FUEA 5C1XA 2SGFE 1BRBE 1HRTH 3ZVGA 1TMUH 1CQQA 3E91A 4X8SH 2RG3A 1YCPK 3HK3B 4AB8A 3M3VA 1FJSA 4NWKA 4K1SA 4ZXYH 1EPTA 3E90B 3KL6A 4D7GA 3SJKA 1FAXA 1EB2A 4CRGA 4Q2KA 3SUGA 2B9LA 1MBQA 5A8XA 1G30B 5DP8A 3M61U 1BB0B 7KMEH 1D6RA 2ZQ1A 4X8UH 3UNQA 1C1TA 1J16A 4AFSA 3A86A 2QF3A 3PLKA 3U1JB 1TGNA 3VB5A 2ZA5A 5HXFA 5EPYA 2GZ9A 4HFPB 3S9CA 1BITA 1V2UT 2BD5A 4BTIB 2ZPQA 1NY22 8KME2 4X1NU 2R9PA 2ZTXA 3R0FA 5JYIA 1CU1A 2ZDMA 4MTBA 1FY8E 1OWDA 2PSYA 1EAWA 1KDQB 4OGXA 3BTTE 4F4OC 2Z7FE 3EDXB 5K0HA 1HXFH 1M9UA 2BLOA 1GMHG 2G4UA 2VVUA 3BTGE 4I33A 3LGWA 3SU0A 3ZZ8A 1ZPCA 1FONA 4UDWH 1Y59T 4XOJA 4LXBH 3HATH 1JRTA 3TJOA 2BX4A 4H6TA 1L4ZA 1SMFE 1BJVA 2HWLB 2OLGA 1LVMA 2AMQA 1Z6JH 1O2WA 1GI5A 5FPYA 2J94A 4B74A 1EP6A 4AYVB 4BAKB 1HAHH 3EQ0H 4CREA 3SV8A 1ZPBA 3LGUA 1UTKA 3PYHA 3P8GA 4M7GA 4I8KA 2J2UA 3TGKE 1YKTA 2SGDE 1EZXC 2VWNA 1DWBH 3P8OA 4NA9H 3A8DA 3TJNA 1ARBA 3FZZA 4E06H 1EP5A 3QX5H 4DJZB 2WYGA 3VB7A 1C9TA 1EZUC 1BTWA 1ANBA 3SNEA 3TH2H 4ISNA 4ISLA 3RXAA 3QN7A 5DP5A 1RFNA 4FXGH 4ISIH 3TLOA 1P9UA 1LKAA 4ESTE 1NS3A 3MO3A 1AWHB 2V3OH 2BOHB 2F9NA 3E6PH 3RU4E 1K28D 2OC0A 4NG9H 2F83A 2Z3EA 2XYAA 1V2JT 1C1MA 1QA0A 2Z3CA 3A7VA 3EYDA 1YC0A 1S85A 2D2DA 4ABAA 6GCHF 2ZCLP 4UFGH 1NN6A 1GCTB 3URDA 3BN9A 1OOKB 1OWJA 1T8NA 1VITF 4UE7H 2PKAB 3NUMA 5DGJA 1A5GH 3BV9B 4A1XA 1TPPA 3PTNA 2PFEA 4NSVA 2XC5A 1O5AB 1WV7H 2BQ7B 4XBDA 1L2EA 2O8LA 1BTHH 3MO6A 2VIDA 1CHGA 1ZLRA 1UVTH 2A2XH 4NGAH 1DFPA 1HIAA 4BANB 4BXSA 1MKXH 2GTBA 3SHAH 1O2JA 3U9AH 4NZLA 1ZGIA 1HAZB 4NWLA 3N7OA 3RC6A 5LH8A 2P95A 1HAOH 4Y10E 1P2MA 4Y7AA 2R3UA 1LTOA 2KAIB 1YCPH 1GBAA 3T62A 4D9RA 1GMDF 3BTEE 1C5ZB 3PLBA 4OGYA 1XXFA 3LJOA 1UVOA 4YOGA 1BTYA 2Q1JA 4JYTA 2ZGCA 1VJ9U 1TWXB 2R0LA 3UR9A 2TIOA 1O36A 1JMOH 3ZVDA 1C1UH 1FIWA 1YPEH 3F68H 4GSOA 1LHCH 2VWOA 1EPTC 1GMDG 1AUJA 4Q80A 1SGYE 3SOSA 1HDTH 1BJUA 4AFZA 1V2RT 1ESTA 1PPEE 2PUQH 2HNTE 1WOFA 2XXLA 4INKA 1T4UH 2IN2A