1K1PA

Bovine trypsin-inhibitor complex
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
223
structure length
223
Chain Sequence
b'IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TRYPSIN
publication title Factorising ligand affinity: a combined thermodynamic and crystallographic study of trypsin and thrombin inhibition.
pubmed doi rcsb
molecule tags Hydrolase
total genus 50
structure length 223
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 2001-09-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1k1pA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1k1pA02
4J2YB 1UO6A 3ZZ8A 4FU7A 1GJBB 4U2WA 3SJ9A 2WINI 3NKKA 5HYOA 1TX8A 1Y3YA 3Q3XA 1L0ZA 1ZPCA 5EXNA 2G55A 3MYWA 5A2MH 2HPQH 2PWXA 2FWWA 2V3OH 4H6TA 1NROH 5E8EH 1YM0A 5SGAE 2BDAA 2UWLA 1TPAE 4I32A 1UTJA 1K1NA 3S69A 1G9IE 1XUKA 4JCNA 4X2VA 2XYAA 4LOYH 3TPIZ 3A7XA 3P92A 1C1TA 1VR1H 1DSUA 1LHDH 1WQVH 5ETXA 2ZNKH 1O3AA 1QQ4A 2BVSH 5DP6A 1DE7H 1MH0A 3RXLA 1FY1A 1Z1IA 1PJPA 3E90B 1PYTC 1OYTH 1O2GH 3E3TA 3BG4B 3TU7H 1PYTD 2FOGA 2J38A 1MQ6A 1WAYB 1O2SA 3RXQA 1OP2A 2BDYA 1LHEH 3FZZA 1TNHA 1TMBH 1CT4E 6GCHG 1T31A 2IOTA 4VGCB 1SC8U 1WQSA 1DICA 1GBDA 2XCFA 1UTPA 3QZRA 1VITG 1C2HA 4X1QU 4UD9H 2QN5T 1OWDA 3MH5A 1W0YH 3RXRA 3ZZ6A 1O2KA 2H2ZA 1A46H 1D3TB 1HAVA 3UNSA 4H6SB 4TPYA 3TNTA 1H4WA 1BJVA 5CHAC 2O9QA 1SQOA 1DWCH 3A81A 4INKA 1FNIA 3RXUA 2VVCA 3BTKE 5I25A 1LVBA 2VIDA 3T27A 1QRXA 1K22H 2G5NA 5EQQA 4WMEA 1C5ZB 3RXBA 1C5UA 1GI0A 4BTUB 3FAOA 4MNYA 3GDVA 2PKSC 3HPTB 1P2NA 3BTQE 3DFLA 1ZSKA 4JZEH 2ANYA 4XBDA 4WY3A 1CO7E 1YPHC 1TBZH 1WU1A 1SVPA 1EZSC 4FUGA 1TRMA 4BTIB 3LJJA 2VWNA 4I8HA 2HOBA 2ZP0H 1FAXA 2Z9IA 1MMJN 5F8TA 9ESTA 1LKBA 3SHAH 1LHCH 1UTQA 4I33A 4IGDA 1T4UH 2G51A 4AFQA 1NO9H 1VJAU 1ESAA 1ZTJA 4DOQA 4A6LA 1OKXA 2VIOA 5DP4A 4B73A 1BDAA 1GBAA 1O3PB 5L6NH 3U9AH 3KQDA 3RXKA 2NU4E 2BYAX 1O3EA 1DFPA 1TOMH 2EA3A 1Z7KA 1HBTH 1MZDA 3RXSA 1UMAH 3ZZ7A 1GBHA 1E35B 1F0SA 3KNXA 1A5GH 3OU0A 2BY9X 1GMDF 1C9TA 4MLFB 3OY6U 1SHYA 1UVOA 1PPHE 1BMLA 1L1JA 2G4UA 3LC5A 4JYUH 4INLA 1SGQE 2VVVA 3K9XB 1AKSA 1O2HA 1GCTB 4F4OC 1QFKH 1N8OB 2O8TA 1BTYA 2EC9H 4AX9H 2OCVB 1F0UA 1O5FH 2OD3B 2TGAA 5EQSA 1V2ST 2AIQA 4WVPE 5EQRA 3RXMA 2ZDVH 3A7VA 3BF6H 2P93A 2ZPRA 4CH8B 1U6QA 1TGTA 3E0NB 1K1OA 1TB6H 3Q3YA 4MNXA 3U1JB 1LHFH 2C8WB 4MPXA 4Y71A 1SR5C 2J4IA 4XFQA 5DP9A 1T8MA 1K1LA 5F03A 4Q80A 1P01A 2GT7A 1P57B 3A87A 2BY7X 2ZKSA 4FUIA 3SJ8A 2WUCA 7GCHF 2SGPE 1SG8B 4ZXYH 5FX6A 4WF8A 3RDZA 1GBMA 1CE5A 1C1MA 3ZV9A 1ZGVA 3KHVA 1A1RA 2Y5HA 3TVJB 1GI6A 1O3GA 5DP7A 2ANMH 1NS3A 2VNTA 3ATWA 4ZMAH 1CHOF 5C2ZA 2A5AA 5DP3A 5J4QA 2BD3A 1O30A 1S6HA 2WPLS 1THPB 1LHGH 3PMHB 1O2RA 5GCHF 3FANA 1DWBH 5T6FA 2ZEBA 1LO6A 2BY5X 2IN2A 1SGTA 4Y6DA 4OS2A 2FP7B 4MQAA 1IQKA 3VB4A 1P09A 3HKJB 1SLXB 3MU8A 2VWOA 3JZ1B 4NIYA 3UOPA 4B2BA 4KP0A 4YOIA 1QIXB 4LXBH 1FN8A 1ZHPA 2BD2A 3OYPA 2BDBA 3CENA 4ZHAA 3SOSA 1CGJE 3B8JA 3BTFE 2BD7A 1DSTA 4NFEA 1LQDB 4IBLH 2A5KA 5H4IB 4UE7H 4IC5A 2FESH 4WWYA 5A8XA 3FP8E 2OXSA 2GD4B 1C2KA 1GBEA 1CA0B 3M5NA 3SJIA 5C1XA 3BEUA 3PO1B 4Y7BA 1B0FA 1GHYH 2BZAA 2R2MB 4AGJA 1GBJA 2B8OH 3TIUA 2VIVA 3SNCA 3HATH 1BTHH 1XUGA 2FOEA 3UREA 1C5YB 2OBQA 3FFGA 1J14A 2WV5A 3AASA 1O39A 4OGXA 2C3SA 2UUYA 1JBUH 3VB6A 2ZDKA 1XKAC 1TAWA 1HAVB 4DT7B 1SQTA 4IN1A 2ZC9H 4X8UH 4XBBA 3A88A 3KQCA 2F9UA 1F92A 4MNVA 3ENSB 2C93B 4BAKB 1C1SA 2A2XH 4UFDH 1NN6A 1FY5A 3E16B 1GVLA 5GWZA 1PQAA 4FUJA 4CREA 3BTGE 1CA8B 2KAIA 4YESB 1VITH 1C2MA 1V2WT 1HAPH 1GHBF 1EZQA 2OINA 2ZU2A 1J17T 2F9OA 1TWXB 1BIOA 1D9IA 1NRPH 4X1NU 2AGIX 1GI3A 3SNEA 3MFJA 2CF8H 1GDNA 1O2JA 2A32A 1NFUA 1AWFH 1GBCA 4BXSA 4RN6A 1DS2E 1HV7A 3MU1A 3BTHE 1OXGA 1X7AC 2ZF0H 2FZZA 1T8OA 3EGKH 2D26C 4U01A 3KF2A 3RMNH 2FLBH 5C67A 1V3XA 3ODFA 1QJ1B 1T8NA 4IMZA 3A89A 3LGYA 1HAXB 1NZQH 3TH4H 2BQWB 4YOJA 3A86A 2BD8A 3ZVGA 1V2UT 2B7DH 4X2YA 3PMBB 1BA8B 3E8LA 3NCLA 1C1OA 1JXPA 1FPHH 1LVMA 2PKAA 1LPKB 3M61U 1P2JA 1QNJA 1F2SE 1GHAG 4HGCA 3I29A 1EZUC 2Z3CA 1GHXH 2GZ9A 1VCWA 1KTSB 3UOUA 1HJ8A 3T2NA 3P70B 2FTLE 1H9IE 1OWHA 2FOAA 5FHTA 3GY7A 2V3HH 2CMYA 2FOCA 4MPUA 4MPVA 1ARCA 5FCRA 4Z6AH 1AKSB 3R0FA 3SU4A 2BZ6H 1S85A 1RTKA 1V2OT 4BAMB 4WXVA 3STIA 4K3JA 1LDTT 2VJ1A 2BLWA 3ZVEA 3BIUH 4O3TA 3K6ZA 2GCTB 2ALVA 1O35A 1ZHMA 4K1EA 4GPGA 3SGQE 2FMJA 1THSH 5PTPA 1IQJA 1BTPA 4WXIA 1O2YA 1ANDA 2ZGXH 4B2AA 2R2WU 1L4ZA 3GDUA 1AWHB 3KGPA 1C5XB 4CRGA 4TY7A 1BT7A 4NG9H 4TYDA 2V0BA 2FEQH 1D3PB 1WUNH 4ESTE 4YM9A 1BITA 1SOTA 3M3SA 3LIWA 4I8KA 1JIMA 4YOGA 1TE0A 3L6PA 3M5MA 3GCHC 2A7HA 4Y0YE 2AGEX 3FVFB 2NU3E 2ZGJA 5G4BA 2H6MA 1G2LA 1SGDE 3RUOA 2XBVA 1TPPA 2JKHA 2ZZUH 2ZU3A 3GY5A 1GJCB 2ZFRH 4WMDA 5EODA 1O5DH 1P2IA 2XW9A 4TY6A 4TWYA 4HTCH 1UTMA 2FYQA 1A5IA 4CHAC 3ZZ4A 3S9BA 4CR9A 1W12U 3DA9B 3QUMP 4FVDA 1RIWC 3RC4A 1EKBB 4D76A 4KELA 3NPSA 1ZMLA 1BMAA 1ESTA 2H1UA 3MNBA 1IQNA 2J34A 2TBSA 3BEIB 5JDUB 1GHVH 2Y80A 2RA0A 1MBMA 2JH0D 1C1QA 3FP7E 2J2UA 3F9HA 2QCYA 1AVGH 1Z6JH 2H9EH 1P3CA 4D8NA 1ETRH 1AMHA 5GDSH 1MD8A 1G30B 1AB9C 1ELCA 2BD9A 2A5IA 2YNBA 2ZU1A 4WMFA 4UFEH 1ELEE 4O97A 3SO3A 1G3CA 3A7ZA 1W0ZU 4GHQA 1BBRH 1UVUH 3P6ZB 3HKIB 5BRRE 1ANBA 3MO3A 1WBGB 2Y6TA 1SMFE 3TITA 1YPMH 5TCCA 1K1MA 8GCHF 1ZJKA 3UR6A 1UVSH 4ABAA 5F8XA 1SBWA 1O2UA 2VWMA 4X6OA 1EAUA 5LPEA 1B5GH 4ABBA 1HAOH 1GJ6A 6LPRA 1LVOA 1ANCA 1GG6C 3ZV8A 2EI6A 1UVTH 5C3NA 3SUFA 3W95A 3RU4T 2R3UA 3A84A 3MNCA 1AFQC 3ATIA 1Y3WA 1WYKA 2SGDE 2D8WA 3SQEE 1GBIA 1FZZA 2GZ7A 1BTUA 3UR9A 5FCKA 3SZNA 3E1XB 5E2OA 1TBQH 1EAIA 1GJAB 2WUBA 2ZDAH 2NU0E 3M37A 1MU6B 2A4GA 3UQOA 2XWBI 1G36A 5AHGH 2ASUB 1TOCB 2W7UA 1KXBA 4AGKA 1BTXA 1T32A 3UUZA 2OUAA 1THRH 3MMGA 1BMNH 1VZQH 2A2QH 2ZTXA 2BM2A 3CP7A 3MNXA 1F5RA 2BX3A 2VINA 3H5CB 1G3DA 4ZKOU 3C1KA 5L2ZH 4A92A 2Y82A 2KAIB 1C4U2 1TPOA 1OWJA 3KQEA 1AUJA 1KXEA 2BQ6B 1YP9A 2FIRH 2F9VA 5JBBS 1UHBA 5FPSA 3M3VA 3PTNA 4K8YA 1V2LT 1TNIA 2CXVA 5DK1A 4BXWA 1Y8TA 4NGAH 3V13A 1WSSH 3SI3H 2OC8A 4K1SA 2CHAB 3SV7A 4B75A 1GI9B 4I8GA 3TJUA 2NU2E 1DLKB 1IQMA 4DY7B 5TJXA 4NIWA 1VGCB 2V35A 4I31A 1CBWB 1W14U 3MO6A 1MCVA 3PM3A 1H1BA 4ISOA 3U8TH 3P8GA 1DPOA 2QGRA 4BTTB 2PKAB 1AVXA 2ZTYA 3VB3A 3PWBA 1TONA 3LOXA 1SGRE 1K1IA 1W10U 4ZKSU 1GDQA 4X6NA 5ESTE 5L2YH 3PMAB 4Y11E 3SQHE 3EDXB 4AZ2B 4R8TB 2BDHA 3VGCB 4JZIA 5EXLA 2ODYB 1GBLA 5A0BA 1UCYE 1EB2A 1E36B 2XC5A 3RU4E 3A7WA 4NFFA 1C5TA 2ZPSA 2AS9A 1GJ9B 4HZHA 1AO5A 1A61H 3TJOA 1GL1A 1Z8IB 4WJG2 1XKBC 1J16A 3HK3B 9LPRA 2Z6BD 2XRCA 2ZA5A 1O2MA 3UPEA 3F68H 1C5SA 3RMOH 2BXTH 4X8VH 1O2NA 2OC1A 1MKWH 3ODDA 2GCHF 1MKXK 1O3HA 2GX4A 1YF4A 5A09A 3PYHA 1GJ7B 4DIIH 2W5EA 3V12A 1GPZA 1FIWA 1S81A 5E2PA 2BY8X 4A1XA 1WCZA 1O3KA 3P8OA 1HCGA 1KSNA 1AZZA 3MWIU 3ZZDA 1Y5BT 3RU4D 3TK9A 1NU9A 1FXYA 1V2KT 5FXLA 2QXHA 1RTLA 4CBNA 3QO6A 1AHTH 1BTZA 4NA9H 2BX4A 2THFB 4IS5A 2GDEH 3IITA 1W2KH 3VPKA 3RXTA 2TGTA 1SL3A 1NFWA 4GCHG 3MOCA 4GCHF 1JWTA 3LGTA 2GV6A 2F3CE 1ZSLA 3UNRA 1SGPE 2ILNA 1FDPA 1SQAA 2P8OC 1C4Y2 4YZUA 1DX5M 1O2QA 4ABEA 1XMNB 4U30A 1Q31A 1C2GA 3M5OA 1AGJA 5EPYA 1N6XA 1UK3A 1JRTA 1C2FA 2Q1JA 1BBRK 5E0JA 3SNBA 1GI7B 4QT8C 4UFFH 3RMLH 2ZDNA 4BNRA 1OS8A 1GMDG 4X0WU 2WPJS 3DFJA 4Y8ZA 2ZDMA 2FOHA 3MH4A 2VIPA 5CHAB 1AQ7A 1NESE 2B5TB 1GI5A 2WPKS 1TGCA 1EAXA 1TNGA 1MTVA 2XC0A 4Y0ZE 7ESTE 1Q2WA 5AFYH 2A1DB 3GY3A 2C8YB 3GICB 1NC6A 3RXEA 1O31A 1O2XA 1O5AB 3LGVA 4BAQB 3C27B 1MTSA 2XWAA 2PKSB 1Y3VA 4RKJB 3SNDA 1B0EA 1SHHB 2ANKH 2UUKB 1S0RA 3U69H 1AZ8A 1G37A 2ZHEH 1O36A 1HXEH 1ZTKA 3EQ0H 2Y7ZA 4Z0KA 3ZVDA 3B23B 2V6NA 2YOLA 1DDJA 1CQQA 4GLYA 4UEHH 2ZI2H 2A45B 3GY2A 5A8YA 3D23A 1C4V2 5FBIA 1WOFA 2QF0A 2H5CA 3F6UH 3U8RH 3O8RA 4YLQH 3KIDU 7GCHG 3SGBE 4DCDA 3SHCH 4O03A 4MDSA 4Y79A 3URCA 1BJUA 1ZTLA 2HGTH 6CHAC 4X1RU 2CF9H 1TGBA 1XXDA 2GDDA 3Q77A 4NIXA 4PROA 4ASHA 1LCYA 1F5KU 1JOUB 4ZXXH 1KLIH 3CS7A 1WTHD 1C2EA 2BLQA 1CHOG 1HJAC 3S0NA 3NUMA 1HRTH 1JRSA 1Z8GA 1Y3UA 4B2CA 2DE9A 1O2LA 4CRAA 1C5QA 1QBVH 5GCHG 1QA0A 1QRWA 1SGEE 4I8LA 3V0XA 2D2DA 2FTMA 1ORFA 1V2JT 3LKWA 3S9AA 4ISHH 1PPGE 5AF9H 3EAJA 1MTNC 1BHXF 3GCTF 1PQ5A 1EB1H 4NCYA 1TYNA 4FXGH 1YPGH 1SLVB 2A4QA 2K1QA 4ISNA 3SGAE 3K2UA 1FN6A 3NK8A 3RMMH 5FX5A 1P9UA 3RXIA 4XBCA 4AFZA 2XBXA 1KXCA 1NRQH 3U8OH 4XE4A 1HAZB 1CSOE 2AMPA 1EPTC 2W26A 5HGGA 1AE8H 1O0DH 1RS0A 5HMAA 1OP0A 5DGJA 1N1LA 2FI4E 1O33A 3BV9B 1E0FD 1ELBA 3BTDE 2GTBA 2XCNA 2BMGB 1NY22 3E91A 3RXGA 1H9LB 3K6YA 4A1VA 1TX7A 4NIVA 3RC5A 2BB4A 1W3CA 5BPEA 5DJ7A 3IG6B 1L4DA 2ZFFH 2BTCE 5C5OA 3OY5U 1G3EA 1QJ7B 5DKMA 3URDA 1HFDA 1ESBA 3UIRA 1O3NA 1KY9A 1TGNA 5E0GA 1S6FA 2M5TA 3A8BA 3SU6A 3ZYEA 1YCPK 1CT2E 3A80A 1MKWK 3PWCA 1XM1A 3GCOA 2G52A 1SFIA 2RDLA 5DPAA 1MQ5A 5A8ZA 4LK4A 1ZYOA 1NFYA 4X2WA 1EX3A 3ZVCA 1GHBG 3ZZCA 3H7OA 4E05H 2QC2A 2VB0A 2TRMA 4KGAA 1KXDA 2Z3DA 1AI8H 4INHA 1NRSH 1OX1A 2FLRH 3KCGH 4GAWA 3OTJE 5JBAS 1TNJA 3M7QA 5LH8A 1W13U 1IQEA 1A2CH 1HGTH 2JH5D 1XUIA 5A0CA 1EP6A 2VH0A 1GI4A 2BDGA 2GVFA 3O8DA 1HLTH 2DUCA 3SBKA 3SU5A 4JMYA 2C8ZB 1FUJA 3M36A 1TNLA 1D3QB 3M7UA 2ZCKP 3VXFH 2P3UB 3HGPA 2QAAA 1DWDH 1EZXC 5LGOA 3EA8A 1BCUH 4YT6H 1UVPA 5JB8S 3MO9A 4HFPB 3A7YA 3EYDA 1TFXA 3NXPA 1VCPA 3MU0A 1GBKA 1ELAA 4KTCA 2VH6A 4MVNA 8ESTE 1O2TA 4FUDA 4R0IA 1V2NT 3GCNA 4JK5A 1TX6A 3MU5A 1FONA 3RXOA 1C5PA 1PPFE 4YLUA 1GMCF 5ABWA 1P06A 2ZFSA 2GMTC 3PV4A 1L1NA 2P59A 1IQGA 4BANB 1SI5H 3TK6A 3SV2H 2ZHDA 1N6YA 3I77A 3SUGA 3UTUH 3P17H 1IQIA 1YCPM 3RC6A 2ZFTA 1BTWA 2ZHFH 2G81E 5T6DA 1CVWH 1EUFA 3TJNA 1YPEH 2AH4X 2STAE 1KDQA 1A5HA 1C2DA 4NWKA 4LZ4B 1KXAA 4X8TH 5AVDA 5EOKA 1GI1A 1UJ1A 1H8IH 3QX5H 5C1UA 8KME2 3RLYH 2NWNA 4B74A 1TA6A 4DURA 1Q3XA 1TRNA 2PV9B 4FUBA 1VJ9U 4X6PA 1ELTA 4AG2A 7LPRA 1QTFA 1HPGA 2OBOA 1EATA 2QXIA 2ZDLA 2ZHQH 1AVWA 1OWEA 4Y8YA 1TALA 2O8LA 1MKXH 1HJ9A 1C5OH 3RXJA 2GGVB 3VB5A 4X1PU 1MD7A 3MH7A 2FPZA 2R0KA 1TQ7B 2DE8A 1XVOA 4A5TS 3U1IB 2OP9A 3F9FA 3MH6A 5GJ4B 4OS4A 1C1UH 1YC0A 3BTTE 4GSOA 4ABJA 5DP8A 1S83A 2Z7FE 1A4WH 2HWLB 3LH1A 2PGQB 1GVZA 3RXVA 5I46H 3TGKE 1TIOA 4ZHMU 4DJZB 1BUIA 5K0HA 1O5BB 5JBCS 3SU0A 3PROA 2ODPA 4DW2U 2TPIZ 2YNAA 2FS8A 1YGCH 1G32B 2R0LA 2QA9E 1QQUA 1WTGH 4FU9A 1P9SA 5C5NA 1QHRB 3EE0B 1T4VH 4UDWH 2VIWA 2AERH 1AUTC 4DVAU 3F9GA 1ZGIA 4OS1A 1UCYK 4O9VA 2Q6GA 4IN2A 3GYLB 5C1YA 3A8DA 4K8BA 2JETC 3MNSA 1WV7H 1V2MT 1Y5AT 2ZTZA 1DANH 3ZVFA 1IAUA 1XUFA 3A83A 4BOHA 1QRZA 1F0TA 4CRBA 2C8XB 1Z8JB 1FIZA 3T26A 1C5RA 1OP8A 4CRDA 1O2ZA 1GGDC 8GCHG 1XUJA 4JZ1A 4JZDH 3GISB 1EOLA 3QGJA 4BAHB 5T6GA 3VXEH 3STJA 1BMMH 2P3FH 3PTBA 1S82A 2FI3E 1HDTH 2SNWA 4YTAA 1C5MD 1SLUB 4ZROA 1DVAH 2PSXA 2PUXB 5IYTA 3QK1A 2LNCA 1C1RA 1QURH 3GCHB 3LONA 1EJMA 3BN9A 3BIVH 2Z9GA 4Q7ZA 3RXFA 1HB0B 3ZVBA 1C1PA 1YKTA 1IQLA 3QTOH 1ABIH 1Z8RA 1TBRH 1GBFA 2VIQA 2GP9B 1C2IA 2PR3A 2SGAA 4FVBA 1ANEA 4CHAB 3D62A 1O5EH 1RIWB 1W7XH 1EOJA 1O3LA 3S7HB 3I78A 1K28D 1MAYA 1QJ6B 4OGYA 4THNH 4I7YH 4FUCA 1KLJH 1PQ7A 1Y5UT 4TWWA 3RXDA 2PUQH 1LVYA 3BG4C 2SGFE 2AMDA 2F83A 1BRUP 1AD8H 1O3DA 2W3KA 2J9NA 5LPRA 3SUEA 2WPHS 1IHTH 1AB9B 1IQFA 3OSYA 2QXJA 1J15A 4VGCC 3QGNB 3DT0H 3E0PB 2EI7A 2ZCHP 3SU3A 2D1JA 2P94A 2GKVE 4D7GA 1ARBA 3LU9B 3QN7A 1O37A 2H5DA 2PTNA 3T29A 1GG6B 5F6MA 1DXPA 1C5LH 4IMQA 4NA8A 4X1SU 1QL9A 4JYTA 4UONA 2BD4A 4I8JA 1ETTH 2XBWA 1AFQB 1RD3B 1NRRH 1HAHH 1FAKH 3ESTA 1S5SA 1LTOA 4IW4E 1V2RT 5ESBA 1DY8A 3Q3KA 3A8CA 1ZJDA 2STBE 1ZLRA 1NM6A 4U32A 4GVUA 1W11U 1EJAA 1ZRKA 2OTVA 3PLPA 4F49A 1SOZA 1UTOA 3N7OA 2FODA 2LPRA 1PPZA 2PGBB 4AYYB 3CS0A 4MG3A 1L1GA 1GI2A 2OQ5A 1JIRA 1UK2A 2Q6FA 2ZECA 2F9PA 3H7TA 2RA3A 2SFAA 1GJDB 1FPCH 2XNIA 4Q7YA 1BRBE 3MTYA 2A7CA 5DP5A 1KDQB 1UTNA 1W7GH 4ABGA 3L33A 1CU1A 1C1NA 2GZ8A 2SNVA 1O2IA 2EEKA 1S0QA 4AN7A 6GCHF 1UTLM 2A7JA 3HK6B 3SN8A 3W94A 1K9OE 1YLCA 2PFEA 1VITF 1XX9A 1P8VC 3D49H 1O34A 1YCPH 1YPHE 2GCHG 1FY3A 1Z6EA 4H42U 4NZQA 5EU8A 2I6SA 2HALA 1ELFA 1F7ZA 1ZMJA 1CT0E 3RM2H 2PHBA 1BOQA 4ISLA 1EP5A 4WH8A 2FOFA 5J4SA 1ELDE 2XBYA 4B1TA 1PFXC 1DT2A 1QB6A 2PTCE 1FJSA 3QWCH 1GCTC 1UTKA 1N8OC 3AAVA 1BRAA 2HPPH 3PLBA 1GBBA 1ZSJA 2ULLA 3A8AA 4FUHA 1A3BH 1EPTA 1Z1JA 3UWJH 1HAIH 4CRCA 1P0SH 3O8CA 4CR5A 1TQ0B 3PB1E 6ESTA 1ZHRA 1EASA 3ZZ3A 3Q00A 1C2LA 3BTME 1SFQB 1PPEE 2A31A 3KN2A 1SGYE 1D6WA 1GJ8B 3WY8A 4B71A 4KKDA 2BHGA 5HM2A 1O5CB 1JMOH 3RLWH 4M7GA 1DITH 2NU1E 4AOQA 3G01A 1HYLA 1O3FA 2WPIS 1IHSH 2ZQ1A 1INCA 3L3TA 4Y7AA 1RRKA 2VU8E 5DG6A 1C5VA 1P11E 2H9TH 2F9NA 1A0LA 1GJ5H 1OYQA 4Y76A 1K21H 4Q2KA 2B9LA 3BG8A 2Z94A 4X6MA 2JH6D 2AGGX 2BY6X 2IJOB 2FOMB 2VVUA 1EQ9A 1HIAA 3E6PH 1ETSH 2FM2A 2BQ7B 4D9RA 3QTVH 3K65B 1C5WB 3M3TA 2J95A 3UY9A 1J8AA 1V2TT 1TLDA 3GY8A 4Q7XA 4ZKNU 2J94A 4NWLA 5EW2H 2FO9A 2CV3A 3AAUA 4AG1A 1QA7A 3FP6E 2H9HA 1FY8E 2WYJA 1G3BA 1KTTB 1M9UA 4OS7A 1P04A 1HNEE 5HM9A 1S84A 3EA9A 2ZU5A 4JK6A 3LC3A 1O3OA 2G8TA 1MTUA 1FQ3A 1V2PT 2G5VA 3F9EA 1LPGB 5LPFA 3MU4A 1C9PA 1BQYA 3EA7A 4ABFA 1A7SA 1EJNA 2VWLA 2HNTF 1GBTA 2Z9LA 2BVXH 1FY4A 3OX7U 2J92A 1ABJH 4A1TA 2UWOA 2OC7A 3LH3A 2ZU4A 3ZZAA 2P8OB 2C90B 3TK5A 3S7KB 3DHKH 4NSVA 2PLXA 5A0AE 1DUAA 1YLDA 1HUTH 3AVZA 3MHWU 1CA0C 1O3BA 3PO1C 5JYIA 1AFEH 1UHBB 3B9FH 3PLKA 3RXAA 1GVKB 3TH3H 3LPRA 3TJVA 1RFNA 2QY0B 3BTEE 4NZLA 2TGPZ 1HXFH 1SGIB 1D3DB 3SORA 1Y3XA 1K1JA 2AYWA 2BLVA 4ABHA 3GOVB 2OLGA 2PSYA 2AFQB 5E0HA 3FZDA 3GCTG 2Y7XA 3QDZB 4H4FA 1UCYH 3D65E 1ZOMA 4JYVH 3RP2A 1O38A 2UUFB 2WV4A 1TGSZ 2P3TB 4LZ1H 1RJXB 3ATKA 2GT8A 1L2EA 2ALPA 2I6QA 3BSQA 1ACBE 2AIPA 5GIBA 3A82A 2P16A 2QIQA 1OSSA 3F1SB 2HNTE 2CGAA 4K5ZA 4O3UA 5TCAA 1ELGA 1YYY1 2Q6DA 2HLCA 2R9PA 5EXMA 3UNQA 4GUXA 1ZPBA 1CGHA 2FS9A 4OS5A 1O3IA 3A85A 5GPIB 2A0QB 2R3YA 1OOKB 2WPMS 2QV1A 1CHGA 6CHAB 3DUXH 3SUDA 3M5LA 1F5LA 4K69A 2Z3EA 3RXHA 4HI3A 1W8BH 1MZAA 1D6RA 1OWIA 4AB8A 4AFSA 2CJIA 3TNSA 2XC4A 2G4TA 1P2QA 1HJAB 1SGNE 4Y8XA 3SJOA 1SGCA 3ATMA 1DUEA 1F0RA 1MU8B 1V6DA 2BDCA 2HNTC 4MPWA 1K2I1 4GHTA 4UFGH 3RM0H 5HXFA 1BBRE 1P2OA 3T28A 1G2MA 3RXCA 1FLEE 3HGNA 1QBNA 3JZ2B 1MAXA 2G00A 2F91A 4WH6A 1MTNB 1ZRBA 1UK4A 3LDXH 4K2YA 2PW8H 1MTWA 3VB7A 2ANWA 4DIHH 2B0FA 1SPJA 1IQHA 2Y5FA 2W3IA 5K7RA 2W7SA 1ZPZA 2ZG0H 3LGIA 3P95A 2BDIA 8LPRA 1V2VT 2P95A 1ELVA 2ZPQA 1EPTB 1LKAA 1RXPA 1O2WA 4NA7A 4X2XA 3BTWE 3ZZBA 4A7IB 2GCTC 1C5NH 1AE5A 1ZR0A 1H9HE 3TGIE 2A4OA 3SI4H 1T8LA 2ZO3H 1D4PB 1GHWH 3AW0A 2ZFQH 1TABE 1A0HB 1RTFB 4K60A 2Z9KA 2BXUH 1Y59T 4E06H 2ODQA 2OC0A 3V7TA 2AEIH 1FV9A 2ZWLH 5DO4H 4ZAEA 5F8ZA 3T5FH 5FAHA 2QXGA 5B6OA 5JB9S 1GMCG 2ZQ2A 5T3HA 4CRFA 4OS6A 4XDEA 1J9CH 1AN1E 1EAWA 5EPNA 5JBTA 4BAOB 4E7RG 4X8SH 3UFAA 1O2PA 1TPSA 3GYMA 3MI4A 5AFZH 3BEFB 1GDUA 1TRYA 1CGIE 1FI8A 2AMQA 1NT1A 1O2VA 2O8WA 1K1PA 3PMJA 1PQ8A 1KYNA 1GHAF 2XTTB 1QB9A 1QR3E 4SGBE 1O3MA 4D7FA 2UWPA 4CBOA 1O32A 3TH2H 1YPLH 1DY9A 5L30H 1HIAB 1C1VH 3TLOA 3LT3A 5GXPA 2ZCLP 2UUJB 1LMWB 1GMHG 1O2OA 5EG4A 1DLEA 3T62A 1GMHF 2FI5E 1O5GH 2CN0H 2FX4A 3ZZ9A 4DG4A 1XXFA 1E34B 1P2KA 2QYIA 1AY6H 2ESTE 1RGQA 1NTPA 1SB1H 1DOJA 1NPMA 4ZHLU 3SV6A 3AW1A 4TPIZ 1QL8A 1NFXA 1MUEB 1E37B 1GCDA 3ZZ5A 3IWMA 2HVXA 1P02A 5CE1A 1BHXB 2FOBA 1QY6A 3V3MA 5EGMA 3NZIA 3QLPH 3GY6A 1QGFA 2SGQE 1O3CA 4YO9A 3U98H 1GJ4H 1DXWA 2RG3A 2BLOA 1ID5H 5FPYA 3SU1A 1TNKA 1Z71A 2ZGCA 3GY4A 1HAYB 2Y5GA 1DWEH 3SNAA 4ZUHA 3ZVAA 1C2JA 1KLTA 1V2QT 3KEEA 1IOEA 1VCQA 3RXPA 1TMTH 3ITIA 2XXLA 2GMTB 5FBEA 1XVMA 2OQUA 3SJKA 2BVRH 1E38B 2F9BH 3ELAH 1SLWB 2VGCC 1LQEA 1YPJH 4XSKU 1SGFA 1B7XB 3LJOA 1QB1A 4MNWA 1P10A 3VEQB 1LPZB 1C1WH 2O8MA 1P03A 3TGJE 4D9QA 2FDAA 3Q76A 1AIXH 1NRNH 4ZH8A 1FMGA 1KIGH 1ZZZA 3A7TA 1AU8A 3O8BA 3QZQA 3NWUA 1XUHA 4CH2B 1SSXA 2GV7A 1QL7A 3KL6A 4K1TA 1QCPA 3M7TA 2FYRA 1P2MA 4JZFH 4FUFA 1PPBH 5CMXH 1MCTA 3M35A 1KXFA 1NU7B 1YBWA 2HRVA 2WYGA 3ZYDA 4ISIH 2C4FH 1GL0E 4E7NA 4FUEA 4KTUA 3SV9A 1SGFG 3T25A 2CHAC 4AYVB 2ZHWH 4ABDA 1DM4B 3SW2B 3S9CA 1P12E 2FXRA 3KQBA 1PPCE 3LGWA 4NSYA 1OWKA 3P8FA 1MBQA 1EXFA 1GHZA 1YPKH 1VGCC 5EW1H 2EI8A 2A4RA 2TGDA 5JPMH 2ZGHA 4AB9A 1CBWC 2Z9JA 1A3EH 4ZKRU 1H8DH 2SGEE 2Y81A 4AFUA 3VFEA 3DD2H 4RKOB 1GWAA 4YT7H 5C20A 3ATLA 3SV8A 1A0JA 2VGCB 4B76A 1OPHB 1BZXE 2QF3A 1HAGE 3GDSA 1GI8B 2FX6A 2ZFPH 3UQVA 4SGAE 2ZGBH 1ZMNA 4AORA 3LGUA 4IC6A 1O3JA 2JETB 2BOHB 5FPTA 3R3GB 1BB0B 4RSPA 1TMUH 7KMEH 2RCEA 4XOJA 2O8UA 2ZIQH 3VGCC 4Y10E 4DGJA 2IPHA 1P05A 2TIOA 3SU2A 1GGDB 3P8NA 4FU8A 3UWIA 4J1YA 1TA2A 4ABIA 1BRCE 2BD5A 1P3EA 2BOKA 4KTSA 5IDKA 1QBOA 1T7CA 4MTBA
chains in the Genus database with same CATH superfamily
4J2YB 1UO6A 3ZZ8A 4FU7A 1GJBB 4U2WA 3SJ9A 2WINI 4YXWD 3NKKA 5HYOA 1TX8A 1Y3YA 3Q3XA 1L0ZA 1ZPCA 5EXNA 2G55A 3MYWA 5A2MH 2HPQH 2PWXA 2FWWA 2V3OH 4H6TA 1NROH 5E8EH 1YM0A 5SGAE 2BDAA 2UWLA 1TPAE 4I32A 1UTJA 1K1NA 3S69A 3SZEA 1G9IE 1XUKA 4JCNA 1OHHD 1YY3A 4X2VA 2XYAA 4LOYH 3TPIZ 3A7XA 3P92A 1C1TA 1VR1H 1DSUA 1LHDH 1WQVH 5ETXA 2ZNKH 1O3AA 1QQ4A 2BVSH 5DP6A 1DE7H 4ACAA 1MH0A 3RXLA 1FY1A 1Z1IA 1PJPA 3E90B 1PYTC 1OYTH 1O2GH 3E3TA 3BG4B 3TU7H 2JJ2D 1PYTD 2FOGA 2J38A 1MQ6A 1WAYB 1O2SA 3RXQA 1OP2A 2BDYA 4AC9A 1LHEH 3FZZA 3F0PA 1TNHA 1TMBH 1CT4E 6GCHG 1T31A 2IOTA 4VGCB 1SC8U 1WQSA 1DICA 1GBDA 2XCFA 1UTPA 3QZRA 1VITG 1C2HA 4X1QU 4UD9H 2QN5T 1OWDA 3MH5A 1W0YH 3RXRA 3ZZ6A 1O2KA 2H2ZA 1A46H 1D3TB 1HAVA 3UNSA 4H6SB 4TPYA 3TNTA 1H4WA 1EFRD 1BJVA 5CHAC 2O9QA 1SQOA 1DWCH 3A81A 4INKA 1FNIA 3RXUA 2VVCA 3BTKE 5I25A 1LVBA 2VIDA 3T27A 1QRXA 1K22H 2G5NA 5EQQA 4WMEA 1C5ZB 3RXBA 1C5UA 1GI0A 4BTUB 3FAOA 4MNYA 3GDVA 2PKSC 3HPTB 1P2NA 3BTQE 3DFLA 1ZSKA 4JZEH 2ANYA 4XBDA 4WY3A 1CO7E 1YPHC 1TBZH 1WU1A 1SVPA 1EZSC 4FUGA 1TRMA 4BTIB 3LJJA 2VWNA 4I8HA 2HOBA 2ZP0H 1FAXA 2Z9IA 1MMJN 5F8TA 5DSFA 9ESTA 1LKBA 3SHAH 1LHCH 1UTQA 4I33A 4IGDA 1T4UH 2G51A 4AFQA 1NO9H 1VJAU 1ESAA 1ZTJA 3UAIC 4DOQA 4A6LA 1OKXA 2VIOA 5DP4A 4B73A 1BDAA 2V7QD 1GBAA 1O3PB 5L6NH 3U9AH 3KQDA 3RXKA 2NU4E 2BYAX 1O3EA 1DFPA 1TOMH 2EA3A 1Z7KA 1HBTH 1MZDA 3RXSA 1UMAH 3ZZ7A 1GBHA 1E35B 1F0SA 5T1VA 3KNXA 1A5GH 3OU0A 2BY9X 1GMDF 1C9TA 4MLFB 3PV5A 2F4LA 3OY6U 1SHYA 1UVOA 1PPHE 1BMLA 1L1JA 2G4UA 3LC5A 1E1RD 4INLA 4JYUH 1SGQE 2VVVA 3K9XB 2KR7A 1AKSA 1O2HA 1GCTB 4F4OC 1QFKH 1N8OB 2O8TA 1BTYA 2EC9H 4AX9H 2OCVB 1F0UA 1O5FH 2OD3B 2TGAA 5EQSA 1V2ST 2AIQA 4WVPE 5EQRA 3RXMA 2ZDVH 3A7VA 3BF6H 2P93A 2ZPRA 4CH8B 1U6QA 1TGTA 3E0NB 1K1OA 1TB6H 3Q3YA 4MNXA 3U1JB 1LHFH 2C8WB 4MPXA 4Y71A 1SR5C 2J4IA 4XFQA 5DP9A 1T8MA 1K1LA 5F03A 4Q80A 1P01A 2GT7A 1P57B 3A87A 2BY7X 2ZKSA 4FUIA 4ZCNA 3SJ8A 2WUCA 7GCHF 2SGPE 1SG8B 4ZXYH 5FX6A 4WF8A 3RDZA 1GBMA 1CE5A 1C1MA 3ZV9A 1ZGVA 3KHVA 1A1RA 2K8IA 2Y5HA 3TVJB 1GI6A 1O3GA 5DP7A 2ANMH 1NS3A 2VNTA 3ATWA 4ZMAH 1CHOF 5C2ZA 2WZQA 2A5AA 5DP3A 5J4QA 2BD3A 1O30A 1S6HA 2WPLS 1THPB 1LHGH 3PMHB 4XRNA 1O2RA 5GCHF 3FANA 1DWBH 5T6FA 2ZEBA 1LO6A 2BY5X 2IN2A 1SGTA 4Y6DA 4OS2A 2FP7B 4MQAA 1IQKA 3VB4A 1P09A 3HKJB 1SLXB 3MU8A 2VWOA 3JZ1B 4NIYA 3UOPA 4B2BA 4KP0A 4YOIA 1QIXB 4LXBH 1FN8A 1ZHPA 2BD2A 3OYPA 2BDBA 3CENA 3KYGA 4ZHAA 3SOSA 1CGJE 3B8JA 3BTFE 2BD7A 1DSTA 4NFEA 1LQDB 4IBLH 2A5KA 5H4IB 4UE7H 4IC5A 2FESH 3N7EA 4WWYA 5A8XA 3FP8E 2OXSA 2GD4B 1C2KA 1GBEA 1CA0B 3M5NA 3SJIA 5CHBA 3BEUA 5C1XA 3PO1B 4Y7BA 1B0FA 1GHYH 2BZAA 2R2MB 4AGJA 1GBJA 2B8OH 3TIUA 2VIVA 3SNCA 3HATH 1BTHH 1XUGA 2FOEA 3UREA 1C5YB 2OBQA 3FFGA 1J14A 2WV5A 3AASA 1O39A 4OGXA 2C3SA 2UUYA 1JBUH 3VB6A 2ZDKA 1XKAC 1TAWA 1HAVB 4DT7B 1SQTA 4IN1A 2ZC9H 4X8UH 4XBBA 3A88A 3KQCA 2F9UA 1F92A 4MNVA 3ENSB 2C93B 3KQ5A 4BAKB 2W6JD 4B6FA 1C1SA 2A2XH 4UFDH 1NN6A 1FY5A 3E16B 1GVLA 5GWZA 1PQAA 4FUJA 4CREA 3BTGE 1CA8B 2KAIA 4YESB 1VITH 1C2MA 1V2WT 1HAPH 1GHBF 1EZQA 2OINA 2ZU2A 1J17T 2F9OA 1TWXB 1BIOA 1D9IA 1NRPH 4X1NU 2AGIX 1GI3A 3SNEA 3MFJA 2CF8H 1GDNA 2LP6A 1O2JA 2A32A 1NFUA 1AWFH 1GBCA 4BXSA 4RN6A 1DS2E 1HV7A 3MU1A 3BTHE 1OXGA 1X7AC 2ZF0H 2FZZA 1T8OA 3EGKH 2D26C 4U01A 3KF2A 3RMNH 2FLBH 5C67A 1V3XA 3ODFA 1QJ1B 1T8NA 4IMZA 3A89A 3LGYA 1HAXB 2AHME 1NZQH 3TH4H 2BQWB 4YOJA 5KGOA 2K0QA 3A86A 2BD8A 3ZVGA 3U28C 1V2UT 2B7DH 4X2YA 3PMBB 1BA8B 3E8LA 3NCLA 1C1OA 1JXPA 1FPHH 1LVMA 2PKAA 1LPKB 3M61U 1P2JA 3PRDA 1QNJA 1F2SE 1GHAG 4HGCA 3I29A 1EZUC 2Z3CA 3DSOA 1GHXH 2GZ9A 1VCWA 1KTSB 3UOUA 1HJ8A 3T2NA 3P70B 2FTLE 1H9IE 1OWHA 2FOAA 5FHTA 3GY7A 2V3HH 2CMYA 2FOCA 4MPUA 4MPVA 1ARCA 5FCRA 4Z6AH 1AKSB 3R0FA 3SU4A 2BZ6H 1S85A 1RTKA 1V2OT 4BAMB 4WXVA 3STIA 4K3JA 1LDTT 2VJ1A 2BLWA 3ZVEA 2YMSC 3BIUH 4O3TA 3K6ZA 2GCTB 2ALVA 3WWBA 1O35A 1ZHMA 4K1EA 4GPGA 3SGQE 2FMJA 5FL7D 1THSH 5PTPA 1IQJA 1BTPA 4WXIA 1O2YA 1ANDA 2ZGXH 4B2AA 2R2WU 1L4ZA 3GDUA 1AWHB 3KGPA 1C5XB 4CRGA 4TY7A 1BT7A 4NG9H 4TYDA 2V0BA 2FEQH 1D3PB 1WUNH 4ESTE 4YM9A 1BITA 1SOTA 3M3SA 3LIWA 4I8KA 1JIMA 4YOGA 3WWFA 1TE0A 3L6PA 3M5MA 2KCOA 3GCHC 2A7HA 4Y0YE 2AGEX 3FVFB 2NU3E 2ZGJA 5G4BA 2H6MA 1G2LA 1SGDE 3RUOA 2XBVA 1TPPA 2JKHA 2ZZUH 2ZU3A 3GY5A 1GJCB 2ZFRH 4WMDA 5EODA 1O5DH 1P2IA 2XW9A 4TY6A 4TWYA 4HTCH 1UTMA 2FYQA 1A5IA 4Z1MD 4CHAC 2HLDD 3ZZ4A 3S9BA 4CR9A 1W12U 3DA9B 3QUMP 4FVDA 1RIWC 3F3BA 1EKBB 3RC4A 4KELA 4D76A 1KMHB 3NPSA 1ZMLA 2IJD1 1BMAA 1ESTA 2H1UA 3MNBA 1IQNA 2J34A 2TBSA 3BEIB 5JDUB 1GHVH 2Y80A 2RA0A 1MBMA 2JH0D 1C1QA 3FP7E 2J2UA 3F9HA 2QCYA 1AVGH 1Z6JH 2H9EH 1P3CA 4D8NA 1S6LA 1ETRH 1AMHA 5GDSH 1MD8A 1G30B 1AB9C 1ELCA 2BD9A 2A5IA 2YNBA 2ZU1A 4WMFA 4UFEH 5HKKD 1ELEE 4O97A 4ASUD 3SO3A 1G3CA 3A7ZA 1W0ZU 4GHQA 1BBRH 1UVUH 3P6ZB 3HKIB 5BRRE 1ANBA 3MO3A 1WBGB 2Y6TA 1SMFE 3TITA 1YPMH 5TCCA 1K1MA 8GCHF 1ZJKA 3UR6A 1UVSH 4ABAA 5F8XA 1SBWA 1O2UA 2VWMA 4X6OA 1EAUA 5LPEA 1B5GH 4ABBA 1HAOH 1GJ6A 6LPRA 1LVOA 1ANCA 1GG6C 3ZV8A 2EI6A 1UVTH 5C3NA 3SUFA 3W95A 3RU4T 2R3UA 3A84A 3MNCA 5C17A 1AFQC 3ATIA 1Y3WA 1WYKA 2SGDE 1QZ8A 2D8WA 3SQEE 2JJ1D 1GBIA 1FZZA 2GZ7A 1BTUA 3UR9A 5FCKA 3SZNA 3E1XB 5E2OA 1TBQH 1EAIA 1GJAB 2WUBA 2ZDAH 2NU0E 3M37A 1MU6B 2A4GA 3UQOA 2XWBI 1G36A 5AHGH 2ASUB 1TOCB 2W7UA 1KXBA 4AGKA 1BTXA 1T32A 3UUZA 2OUAA 1THRH 3MMGA 3CNRA 3VG8A 1BMNH 1VZQH 2A2QH 2ZTXA 2BM2A 3CP7A 3MNXA 1F5RA 2BX3A 2VINA 3H5CB 1G3DA 4ZKOU 3C1KA 5L2ZH 4A92A 2Y82A 2KAIB 1C4U2 1TPOA 1OWJA 3KQEA 1AUJA 1KXEA 2BQ6B 1YP9A 2FIRH 2F9VA 5JBBS 1UHBA 5FPSA 3M3VA 3PTNA 4K8YA 1V2LT 1TNIA 2CXVA 5DK1A 4BXWA 1Y8TA 4NGAH 3V13A 1WSSH 3SI3H 2OC8A 3F2GA 2CHAB 4K1SA 3PRBA 3SV7A 4B75A 1GI9B 4I8GA 4TSFD 3N99A 3F0OA 3TJUA 2NU2E 1DLKB 1IQMA 4DY7B 2KM0A 5TJXA 4NIWA 1VGCB 2V35A 4I31A 1CBWB 1W14U 3MO6A 1MCVA 3PM3A 3PV2A 1H1BA 4ISOA 3U8TH 3P8GA 1DPOA 2QGRA 4BTTB 2PKAB 1AVXA 2ZTYA 3VB3A 3PWBA 1TONA 3LOXA 1SGRE 1K1IA 1W10U 4ZKSU 1GDQA 4X6NA 5ESTE 5L2YH 3PMAB 4Y11E 3SQHE 3EDXB 3GS9A 2KZ4A 4AZ2B 4R8TB 2BDHA 3VGCB 4JZIA 5EXLA 2ODYB 1GBLA 3F2FA 5A0BA 1UCYE 1EB2A 1E36B 2XC5A 3RU4E 3A7WA 4NFFA 1C5TA 5KEDA 2ZPSA 2AS9A 1GJ9B 4HZHA 1AO5A 1A61H 3TJOA 1GL1A 1Z8IB 4WJG2 1XKBC 1J16A 3HK3B 9LPRA 2Z6BD 2XRCA 2ZA5A 1O2MA 3UPEA 3F68H 1C5SA 3RMOH 2BXTH 4X8VH 1O2NA 2QE7D 2OC1A 1MKWH 3ODDA 2GCHF 1MKXK 1O3HA 2GX4A 1YF4A 2M2AA 3PYHA 1GJ7B 5A09A 4DIIH 2W5EA 3V12A 1GPZA 1FIWA 1S81A 5E2PA 2BY8X 4RT1A 4A1XA 1WCZA 1O3KA 3P8OA 5CDFE 3H09A 1HCGA 1KSNA 1AZZA 3MWIU 3ZZDA 1Y5BT 3RU4D 3TK9A 1NU9A 1FXYA 1V2KT 5FXLA 1H8HD 2QXHA 2VBCA 1RTLA 4CBNA 3QO6A 1AHTH 1W0JD 1BTZA 4NA9H 2BX4A 2THFB 4IS5A 2GDEH 1VKYA 3IITA 1W2KH 3VPKA 3RXTA 2TGTA 1SL3A 1NFWA 4GCHG 5C94A 3MOCA 4GCHF 1JWTA 3LGTA 2GV6A 2F3CE 1ZSLA 5F53A 3UNRA 1SGPE 2ILNA 1FDPA 1SQAA 2P8OC 1C4Y2 4YZUA 1DX5M 1O2QA 4ABEA 1XMNB 4U30A 1Q31A 1C2GA 3M5OA 1AGJA 5EPYA 1N6XA 1UK3A 1JRTA 1C2FA 2Q1JA 1BBRK 5E0JA 3SNBA 1GI7B 4QT8C 4UFFH 3RMLH 2ZDNA 4BNRA 1OS8A 1GMDG 4X0WU 2WPJS 3DFJA 4Y8ZA 2ZDMA 2FOHA 5IK2D 3MH4A 2VIPA 5CHAB 1AQ7A 5HIYA 1NESE 2B5TB 1GI5A 2WPKS 1TGCA 1EAXA 1TNGA 1MTVA 2XC0A 4Y0ZE 7ESTE 1Q2WA 5AFYH 2A1DB 3GY3A 2C8YB 3GICB 1NC6A 3OTPA 3RXEA 1O31A 1O2XA 1O5AB 3LGVA 4BAQB 3C27B 1MTSA 2XWAA 2PKSB 1Y3VA 4RKJB 3SNDA 1B0EA 1SHHB 2ANKH 2UUKB 1S0RA 3U69H 1AZ8A 1G37A 2ZHEH 1O36A 1HXEH 1NBME 1ZTKA 3EQ0H 2Y7ZA 3SYJA 4Z0KA 3ZVDA 3B23B 2V6NA 2YOLA 1DDJA 1CQQA 4GLYA 4UEHH 2ZI2H 2A45B 3GY2A 5A8YA 3D23A 1C4V2 5FBIA 1WOFA 2QF0A 2H5CA 3F6UH 3U8RH 3O8RA 4YLQH 3KIDU 7GCHG 3SGBE 4DCDA 3SHCH 4O03A 4MDSA 4Y79A 3URCA 1BJUA 1ZTLA 2HGTH 6CHAC 4X1RU 2CF9H 1TGBA 1XXDA 2GDDA 3Q77A 4NIXA 4PROA 4ASHA 1LCYA 1F5KU 2J97A 1JOUB 4ZXXH 1KLIH 2XNDD 3CS7A 1WTHD 1C2EA 2BLQA 1CHOG 1HJAC 3S0NA 3NUMA 1HRTH 1JRSA 1Z8GA 1NBMD 1Y3UA 4B2CA 2DE9A 1O2LA 4CRAA 1C5QA 1QBVH 5GCHG 1QA0A 1QRWA 1SGEE 4I8LA 3V0XA 2D2DA 2FTMA 1ORFA 1V2JT 3LKWA 3S9AA 4ISHH 1PPGE 5AF9H 3EAJA 1MTNC 1BHXF 3GCTF 1PQ5A 1EB1H 4NCYA 1TYNA 4FXGH 1YPGH 1SLVB 2A4QA 2K1QA 4ISNA 3SGAE 3K2UA 1FN6A 3NK8A 3RMMH 5FX5A 1P9UA 3RXIA 4XBCA 4AFZA 2XBXA 1KXCA 1NRQH 3U8OH 4XE4A 1HAZB 1CSOE 2AMPA 1EPTC 2W26A 5HGGA 1AE8H 1O0DH 1RS0A 5HMAA 1OP0A 5DGJA 1N1LA 2FI4E 1O33A 3BV9B 1E0FD 1ELBA 3BTDE 2GTBA 2XCNA 2BMGB 1NY22 3E91A 3RXGA 1H9LB 3K6YA 4A1VA 1TX7A 4NIVA 3RC5A 2BB4A 1W3CA 5BPEA 1YWUA 3IG6B 5DJ7A 1L4DA 2ZFFH 2BTCE 5C5OA 3OY5U 1G3EA 1QJ7B 2F43B 5DKMA 3OEHD 3URDA 1HFDA 1ESBA 3UIRA 5GNDA 2HVYB 1O3NA 1KY9A 1TGNA 5E0GA 1S6FA 4ACBA 3W1EA 2M5TA 3A8BA 3SU6A 3ZYEA 1YCPK 1CT2E 3A80A 1MKWK 3PWCA 1XM1A 3GCOA 2G52A 1SFIA 2RDLA 5DPAA 1MQ5A 5A8ZA 4LK4A 1ZYOA 1NFYA 4X2WA 1EX3A 3ZVCA 2WPDD 1GHBG 3ZZCA 3H7OA 4E05H 2QC2A 2VB0A 2TRMA 4KGAA 1KXDA 2Z3DA 1AI8H 4INHA 1NRSH 1OX1A 2FLRH 3KCGH 4GAWA 3OTJE 5JBAS 1TNJA 3M7QA 5LH8A 1W13U 1IQEA 1A2CH 1HGTH 2JH5D 3FOAA 1XUIA 5A0CA 1EP6A 2VH0A 1GI4A 2BDGA 2GVFA 3O8DA 1HLTH 2DUCA 3SBKA 3SU5A 4JMYA 2C8ZB 1FUJA 3M36A 1TNLA 1D3QB 3M7UA 2ZCKP 3VXFH 2P3UB 3HGPA 2QAAA 1DWDH 1EZXC 5LGOA 3EA8A 1BCUH 4YT6H 1UVPA 5JB8S 3MO9A 4HFPB 3A7YA 3EYDA 3ZIAD 1TFXA 3NXPA 1VCPA 3MU0A 1GBKA 1ELAA 4KTCA 2VH6A 4MVNA 8ESTE 1O2TA 4FUDA 4R0IA 1V2NT 3GCNA 4JK5A 1TX6A 3MU5A 1FONA 3RXOA 1C5PA 1PPFE 4YLUA 1GMCF 5ABWA 1P06A 2ZFSA 2GMTC 3PV4A 1L1NA 2P59A 1IQGA 4BANB 1SI5H 3TK6A 3SV2H 2ZHDA 1N6YA 3I77A 3SUGA 3UTUH 3P17H 1IQIA 1YCPM 3RC6A 2ZFTA 1BTWA 2ZHFH 2G81E 5T6DA 1CVWH 1EUFA 3DSPA 3OFND 1YPEH 3TJNA 2AH4X 2STAE 1KDQA 1A5HA 1C2DA 4NWKA 4LZ4B 1KXAA 4P02A 4X8TH 5AVDA 5EOKA 1GI1A 1UJ1A 1H8IH 3QX5H 2IPQX 5C1UA 8KME2 3RLYH 2NWNA 4B74A 1TA6A 4DURA 1Q3XA 1TRNA 2PV9B 4FUBA 1VJ9U 4X6PA 1ELTA 2LELA 4AG2A 7LPRA 1QTFA 1HPGA 2OBOA 1EATA 2QXIA 2ZDLA 2ZHQH 1AVWA 1OWEA 4Y8YA 1TALA 2O8LA 1MKXH 1HJ9A 1C5OH 3RXJA 2GGVB 3VB5A 4X1PU 1MD7A 3MH7A 2FPZA 2J5UA 2R0KA 1TQ7B 2DE8A 1XVOA 4A5TS 3U1IB 2OP9A 3F9FA 3MH6A 5KECA 5GJ4B 4OS4A 1C1UH 1YC0A 3BTTE 4GSOA 4ABJA 5DP8A 1S83A 2Z7FE 1A4WH 2HWLB 2CK3D 3LH1A 2PGQB 1GVZA 2WHXA 3RXVA 5I46H 3TGKE 1TIOA 4ZHMU 4DJZB 1BUIA 3DCLA 5K0HA 1O5BB 5JBCS 3SU0A 3PROA 2ODPA 4RI0A 4DW2U 2TPIZ 2YNAA 2FS8A 3NRLA 1YGCH 1G32B 2R0LA 2QA9E 1QQUA 1WTGH 4FU9A 1P9SA 5C5NA 1QHRB 3EE0B 1T4VH 4UDWH 2VIWA 2AERH 1AUTC 2L6OA 4DVAU 3F9GA 1ZGIA 4OS1A 1UCYK 4O9VA 2Q6GA 4IN2A 3GYLB 5C1YA 3A8DA 1SKYE 4K8BA 2JETC 3MNSA 1WV7H 1V2MT 1Y5AT 2ZTZA 1DANH 2YMSB 3ZVFA 3UB0A 1IAUA 1XUFA 3A83A 2JDID 1YLNA 4BOHA 1QRZA 1F0TA 4CRBA 2C8XB 1WDIA 1Z8JB 1FIZA 3T26A 1C5RA 1OP8A 4CRDA 1O2ZA 1GGDC 8GCHG 1XUJA 4JZ1A 4JZDH 3GISB 1EOLA 3QGJA 4BAHB 5T6GA 3VXEH 3STJA 1BMMH 2P3FH 3PTBA 1S82A 2FI3E 1HDTH 2SNWA 4YTAA 1C5MD 1SLUB 4ZROA 1DVAH 2PSXA 2PUXB 5IYTA 3QK1A 3EE7A 2LNCA 1C1RA 1QURH 3GCHB 3LONA 1EJMA 3BN9A 3BIVH 2Z9GA 4Q7ZA 3RXFA 2XOKD 1HB0B 3ZVBA 1C1PA 1YKTA 1IQLA 2WSSD 3QTOH 1ABIH 1Z8RA 1TBRH 1GBFA 2VIQA 2GP9B 1C2IA 2PR3A 2SGAA 4FVBA 1ANEA 4CHAB 3D62A 1O5EH 1RIWB 1W7XH 1EOJA 1O3LA 3S7HB 3I78A 1K28D 1MAYA 1QJ6B 4OGYA 4THNH 4I7YH 4FUCA 1KLJH 1PQ7A 1Y5UT 4TWWA 3RXDA 2PUQH 1LVYA 3BG4C 2SGFE 2AMDA 2F83A 1BRUP 1AD8H 1O3DA 2W3KA 2J9NA 5LPRA 3SUEA 2WPHS 1IHTH 1AB9B 1IQFA 3OSYA 2QXJA 1J15A 4VGCC 2OK5A 3QGNB 3DT0H 3E0PB 2EI7A 2ZCHP 3SU3A 2D1JA 2P94A 2GKVE 4D7GA 1ARBA 2KFWA 3LU9B 3QN7A 1O37A 2H5DA 2PTNA 3T29A 1GG6B 5F6MA 2QF5A 1DXPA 1C5LH 4IMQA 4NA8A 4X1SU 1QL9A 4JYTA 4UONA 2BD4A 4I8JA 1ETTH 2XBWA 1AFQB 1RD3B 1NRRH 1HAHH 1FAKH 3ESTA 1S5SA 1LTOA 3DSGA 3N7DA 1V2RT 4IW4E 5ESBA 4DT4A 1DY8A 3Q3KA 3A8CA 1ZJDA 2STBE 1ZLRA 1NM6A 4U32A 4GVUA 1W11U 1EJAA 1ZRKA 2OTVA 3PLPA 4F49A 1SOZA 1UTOA 3N7OA 2FODA 2LPRA 1PPZA 2PGBB 4AYYB 3CS0A 4MG3A 1L1GA 1GI2A 2OQ5A 1JIRA 1UK2A 2Q6FA 2ZECA 2F9PA 3H7TA 2W6ID 2RA3A 3FO8D 2SFAA 1GJDB 1FPCH 2XNIA 2KCPA 4Q7YA 4P00A 1BRBE 3MTYA 2A7CA 5DP5A 1KDQB 1UTNA 1W7GH 4ABGA 3L33A 1CU1A 1C1NA 2GZ8A 2SNVA 1O2IA 2EEKA 1S0QA 4AN7A 6GCHF 1UTLM 2A7JA 3HK6B 3SN8A 1WXRA 3W94A 1K9OE 1YLCA 2PFEA 1VITF 1XX9A 1P8VC 3D49H 1O34A 1YCPH 1YPHE 2GCHG 1FY3A 1Z6EA 4H42U 4NZQA 5EU8A 2I6SA 5EIYA 2HALA 1ELFA 1F7ZA 1ZMJA 1CT0E 3RM2H 2PHBA 1BOQA 4ISLA 1EP5A 4WH8A 2FOFA 5J4SA 1ELDE 2XBYA 4B1TA 1PFXC 1DT2A 1QB6A 2PTCE 1FJSA 3QWCH 1GCTC 1UTKA 1N8OC 3AAVA 1BRAA 2HPPH 3PLBA 1GBBA 1ZSJA 2ULLA 3A8AA 4FUHA 1A3BH 1EPTA 1Z1JA 3UWJH 1HAIH 4CRCA 5EJZA 1P0SH 3O8CA 4CR5A 1TQ0B 3PB1E 4B6EA 1K0HA 2KCYA 6ESTA 1ZHRA 4Q63A 1EASA 3ZZ3A 3Q00A 1C2LA 3BTME 1SFQB 1SQRA 1PPEE 2A31A 3KN2A 1SGYE 1D6WA 1GJ8B 3WY8A 4B71A 4KKDA 2BHGA 5HM2A 1O5CB 3F2HA 1JMOH 3RLWH 4M7GA 1DITH 1E1QD 2NU1E 4AOQA 3G01A 3OEED 1HYLA 1O3FA 2WPIS 1IHSH 2ZQ1A 3OE7D 1INCA 3L3TA 4Y7AA 1RRKA 2VU8E 4Q4LA 5DG6A 1C5VA 1P11E 2H9TH 2F9NA 1A0LA 1GJ5H 1OYQA 4Y76A 1COWD 1K21H 4Q2KA 4HG6A 2B9LA 3BG8A 2Z94A 4X6MA 2JH6D 2AGGX 2BY6X 2IJOB 2FOMB 2VVUA 1EQ9A 1HIAA 3E6PH 1ETSH 2FM2A 2BQ7B 4D9RA 3QTVH 3K65B 1C5WB 3M3TA 2J95A 3UY9A 1J8AA 1V2TT 1TLDA 3GY8A 4Q7XA 4ZKNU 2J94A 4NWLA 5EW2H 2FO9A 2CV3A 3AAUA 2JIZD 4AG1A 1QA7A 3FP6E 2H9HA 1FY8E 2L74A 2WYJA 1G3BA 1KTTB 1M9UA 4OS7A 1P04A 1HNEE 5DN6D 5HM9A 1BMFD 1S84A 3EA9A 2ZU5A 4JK6A 3LC3A 1O3OA 2G8TA 1MTUA 1FQ3A 1V2PT 2G5VA 3F9EA 1LPGB 5LPFA 3MU4A 1C9PA 1BQYA 3EA7A 4ABFA 1A7SA 1EJNA 2VWLA 2HNTF 1GBTA 2Z9LA 2BVXH 1FY4A 3OX7U 2J92A 1ABJH 4A1TA 2UWOA 2OC7A 3LH3A 2ZU4A 3ZZAA 2P8OB 2C90B 3TK5A 3S7KB 3DHKH 4NSVA 3MQKC 2PLXA 5A0AE 1DUAA 1YLDA 1HUTH 1W0KD 3AVZA 3MHWU 1CA0C 1O3BA 2J98A 3PO1C 5JYIA 1AFEH 1UHBB 3B9FH 4M9FA 3PLKA 3RXAA 1GVKB 3TH3H 3LPRA 3TJVA 1RFNA 2KCAA 2QY0B 3BTEE 4FOUC 4NZLA 2TGPZ 1HXFH 1SGIB 1D3DB 3SORA 1Y3XA 1K1JA 2AYWA 2BLVA 4ABHA 3GOVB 2OLGA 2PSYA 2AFQB 5E0HA 2EQNA 3FZDA 3GCTG 2Y7XA 3QDZB 4H4FA 1UCYH 3D65E 1ZOMA 4JYVH 3RP2A 1O38A 2UUFB 2RDEA 2WV4A 1TGSZ 2P3TB 4LZ1H 1RJXB 3ATKA 2GT8A 1L2EA 2ALPA 2I6QA 3BSQA 1ACBE 2AIPA 5GIBA 3A82A 2P16A 2QIQA 1OSSA 3F1SB 2HNTE 2CGAA 4K5ZA 4O3UA 5TCAA 1ELGA 1YYY1 2Q6DA 2HLCA 2KX4A 2R9PA 5EXMA 3UNQA 4GUXA 1ZPBA 3OAAD 1CGHA 2FS9A 4OS5A 4I86A 1O3IA 2EY4C 3A85A 5GPIB 2A0QB 2R3YA 1OOKB 2WPMS 2GJGA 2QV1A 1CHGA 6CHAB 3DUXH 3SUDA 3M5LA 1F5LA 4K69A 2Z3EA 3RXHA 4HI3A 1W8BH 1MZAA 1D6RA 1OWIA 4AB8A 4AFSA 2CJIA 3TNSA 2XC4A 2G4TA 1P2QA 1HJAB 1SGNE 4Y8XA 3SJOA 1SGCA 3ATMA 3KYFA 1DUEA 1F0RA 1MU8B 1V6DA 5EJ1A 2BDCA 2HNTC 4MPWA 3AK5A 1K2I1 4GHTA 4UFGH 3RM0H 5HXFA 1BBRE 2RFKC 1P2OA 3T28A 1G2MA 3RXCA 1FLEE 3HGNA 1QBNA 4OM9A 3JZ2B 1MAXA 2G00A 2F91A 4WH6A 1MTNB 1ZRBA 1UK4A 3LDXH 4K2YA 2PW8H 1MTWA 3VB7A 2ANWA 4DIHH 2B0FA 1SPJA 1IQHA 2Y5FA 2W3IA 5K7RA 2W7SA 1ZPZA 2ZG0H 3LGIA 1UW7A 3P95A 2BDIA 8LPRA 1V2VT 2P95A 1ELVA 2ZPQA 1EPTB 1LKAA 1RXPA 1O2WA 4NA7A 4X2XA 3BTWE 3ZZBA 4A7IB 2GCTC 1C5NH 1AE5A 1ZR0A 1H9HE 3TGIE 2A4OA 3SI4H 1T8LA 2ZO3H 1D4PB 1GHWH 3AW0A 2ZFQH 1TABE 1A0HB 1RTFB 4K60A 2Z9KA 2BXUH 1Y59T 4E06H 2ODQA 2OC0A 4RT0A 4XD7D 3V7TA 2AEIH 1FV9A 2ZWLH 5DO4H 4ZAEA 5F8ZA 3T5FH 5FAHA 2QXGA 5B6OA 5JB9S 1GMCG 2ZQ2A 5EJLA 5T3HA 4CRFA 4OS6A 4XDEA 1J9CH 1AN1E 1EAWA 5EPNA 5JBTA 4BAOB 4E7RG 4X8SH 3UFAA 1O2PA 1TPSA 3GYMA 3MI4A 5AFZH 3BEFB 1GDUA 1TRYA 1CGIE 1FI8A 2AMQA 1NT1A 1O2VA 2O8WA 1K1PA 3PMJA 1PQ8A 1KYNA 1GHAF 2XTTB 1QB9A 1QR3E 4SGBE 1O3MA 4D7FA 2UWPA 4CBOA 1O32A 3TH2H 1YPLH 1DY9A 5L30H 1HIAB 1C1VH 3TLOA 3LT3A 5GXPA 2ZCLP 2UUJB 1LMWB 1GMHG 1O2OA 5EG4A 1DLEA 3T62A 1GMHF 2FI5E 1O5GH 2CN0H 2FX4A 3ZZ9A 4TT3D 4DG4A 1XXFA 1E34B 1P2KA 2QYIA 1AY6H 2ESTE 1RGQA 1NTPA 1SB1H 1DOJA 1NPMA 4ZHLU 3SV6A 3AW1A 3WW7A 4TPIZ 1QL8A 1NFXA 1MUEB 1E37B 1GCDA 2YMSD 3ZZ5A 3IWMA 2HVXA 1P02A 5CE1A 1BHXB 2FOBA 1QY6A 3V3MA 5EGMA 3NZIA 2V3MA 3QLPH 3GY6A 1QGFA 2SGQE 1O3CA 4YO9A 3U98H 1GJ4H 1DXWA 2RG3A 2BLOA 1ID5H 5FPYA 3SU1A 1TNKA 1Z71A 2ZGCA 3GY4A 1HAYB 2Y5GA 1DWEH 3SNAA 4ZUHA 3ZVAA 1C2JA 1KLTA 2J98B 1V2QT 3KEEA 1IOEA 1VCQA 3RXPA 1TMTH 3ITIA 2XXLA 2PP6A 2GMTB 5FBEA 1XVMA 2OQUA 3SJKA 2BVRH 1E38B 2F9BH 3ELAH 1SLWB 2VGCC 4F55A 1LQEA 1YPJH 4XSKU 1SGFA 1B7XB 3LJOA 1QB1A 4MNWA 1P10A 3VEQB 1LPZB 1C1WH 2O8MA 1P03A 3TGJE 4D9QA 2FDAA 3Q76A 1AIXH 1NRNH 4ZH8A 1FMGA 1KIGH 1ZZZA 3A7TA 1AU8A 3O8BA 3QZQA 3NWUA 1XUHA 4CH2B 2WV9A 1SSXA 2GV7A 1QL7A 4F48B 3KL6A 4K1TA 1QCPA 3M7TA 2FYRA 1P2MA 4JZFH 5HIZA 4FUFA 1PPBH 5CMXH 1MCTA 3M35A 1KXFA 1NU7B 1YBWA 2HRVA 2WYGA 3ZYDA 4ISIH 2C4FH 3FKSD 1GL0E 4E7NA 4FUEA 4KTUA 3SV9A 1SGFG 3T25A 2CHAC 4AYVB 2ZHWH 4ABDA 1DM4B 3SW2B 3S9CA 1P12E 2FXRA 3KQBA 1PPCE 3LGWA 4NSYA 5C0TA 1OWKA 3P8FA 1MBQA 1EXFA 1GHZA 1YPKH 1VGCC 5EW1H 2EI8A 2A4RA 2TGDA 5JPMH 2ZGHA 4AB9A 1CBWC 2Z9JA 1A3EH 4ZKRU 5C0UA 1H8DH 2SGEE 2Y81A 4AFUA 3VFEA 3DD2H 3FN8A 4RKOB 1GWAA 4YT7H 5C20A 3ATLA 3SV8A 1A0JA 2VGCB 4B76A 1OPHB 1BZXE 2QF3A 1HAGE 1MABB 3GDSA 1GI8B 2FX6A 2ZFPH 3UQVA 4SGAE 2ZGBH 1ZMNA 4AORA 4FETA 3LGUA 4IC6A 1O3JA 2JETB 2BOHB 5FPTA 3R3GB 1BB0B 1FX0B 1TMUH 4RSPA 7KMEH 2RCEA 4XOJA 2O8UA 2ZIQH 3VGCC 4Y10E 4DGJA 2IPHA 1P05A 2TIOA 3SU2A 1GGDB 3P8NA 4FU8A 3UWIA 4J1YA 1TA2A 1E79D 4ABIA 1BRCE 2BD5A 1P3EA 2BOKA 1H8ED 4KTSA 5IDKA 2QF4A 1QBOA 1T7CA 5B6LA 4MTBA
chains in the Genus database with same CATH topology
4J2YB 1UO6A 3ZZ8A 4FU7A 1GJBB 4U2WA 3SJ9A 2WINI 3NKKA 5HYOA 1TX8A 1Y3YA 3Q3XA 1L0ZA 1ZPCA 5EXNA 2G55A 3MYWA 5A2MH 2HPQH 2PWXA 2FWWA 2V3OH 4H6TA 1NROH 5E8EH 1YM0A 5SGAE 2BDAA 2UWLA 1TPAE 4I32A 1UTJA 1K1NA 3S69A 1G9IE 1XUKA 4JCNA 4X2VA 2XYAA 4LOYH 3TPIZ 3A7XA 3P92A 1C1TA 1VR1H 1DSUA 1LHDH 1WQVH 5ETXA 2ZNKH 1O3AA 1QQ4A 2BVSH 5DP6A 1DE7H 1MH0A 3RXLA 1FY1A 1Z1IA 1PJPA 3E90B 1PYTC 1OYTH 1O2GH 3E3TA 3BG4B 3TU7H 1PYTD 2FOGA 2J38A 1MQ6A 1WAYB 1O2SA 3RXQA 1OP2A 2BDYA 1LHEH 3FZZA 1TNHA 1TMBH 1CT4E 6GCHG 1T31A 2IOTA 4VGCB 1SC8U 1WQSA 1DICA 1GBDA 2XCFA 1UTPA 3QZRA 1VITG 1C2HA 4X1QU 4UD9H 2QN5T 1OWDA 3MH5A 1W0YH 3RXRA 3ZZ6A 1O2KA 2H2ZA 1A46H 1D3TB 1HAVA 3UNSA 4H6SB 4TPYA 3TNTA 1H4WA 1BJVA 5CHAC 2O9QA 1SQOA 1DWCH 3A81A 4INKA 1FNIA 3RXUA 2VVCA 3BTKE 5I25A 1LVBA 2VIDA 3T27A 1QRXA 1K22H 2G5NA 5EQQA 4WMEA 1C5ZB 3RXBA 1C5UA 1GI0A 4BTUB 3FAOA 4MNYA 3GDVA 2PKSC 3HPTB 1P2NA 3BTQE 3DFLA 1ZSKA 4JZEH 2ANYA 4XBDA 4WY3A 1CO7E 1YPHC 1TBZH 1WU1A 1SVPA 1EZSC 4FUGA 1TRMA 4BTIB 3LJJA 2VWNA 4I8HA 2HOBA 2ZP0H 1FAXA 2Z9IA 1MMJN 5F8TA 9ESTA 1LKBA 3SHAH 1LHCH 1UTQA 4I33A 4IGDA 1T4UH 2G51A 4AFQA 1NO9H 1VJAU 1ESAA 1ZTJA 4DOQA 4A6LA 1OKXA 2VIOA 5DP4A 4B73A 1BDAA 1GBAA 1O3PB 5L6NH 3U9AH 3KQDA 3RXKA 2NU4E 2BYAX 1O3EA 1DFPA 1TOMH 2EA3A 1Z7KA 1HBTH 1MZDA 3RXSA 1UMAH 3ZZ7A 1GBHA 1E35B 1F0SA 3KNXA 1A5GH 3OU0A 2BY9X 1GMDF 1C9TA 4MLFB 3OY6U 1SHYA 1UVOA 1PPHE 1BMLA 1L1JA 2G4UA 3LC5A 4JYUH 4INLA 1SGQE 2VVVA 3K9XB 1AKSA 1O2HA 1GCTB 4F4OC 1QFKH 1N8OB 2O8TA 1BTYA 2EC9H 4AX9H 2OCVB 1F0UA 1O5FH 2OD3B 2TGAA 5EQSA 1V2ST 2AIQA 4WVPE 5EQRA 3RXMA 2ZDVH 3A7VA 3BF6H 2P93A 2ZPRA 4CH8B 1U6QA 1TGTA 3E0NB 1K1OA 1TB6H 3Q3YA 4MNXA 3U1JB 1LHFH 2C8WB 4MPXA 4Y71A 1SR5C 2J4IA 4XFQA 5DP9A 1T8MA 1K1LA 5F03A 4Q80A 1P01A 2GT7A 1P57B 3A87A 2BY7X 2ZKSA 4FUIA 3SJ8A 2WUCA 7GCHF 2SGPE 1SG8B 4ZXYH 5FX6A 4WF8A 3RDZA 1GBMA 1CE5A 1C1MA 3ZV9A 1ZGVA 3KHVA 1A1RA 2Y5HA 3TVJB 1GI6A 1O3GA 5DP7A 2ANMH 1NS3A 2VNTA 3ATWA 4ZMAH 1CHOF 5C2ZA 2A5AA 5DP3A 5J4QA 2BD3A 1O30A 1S6HA 2WPLS 1THPB 1LHGH 3PMHB 1O2RA 5GCHF 3FANA 1DWBH 5T6FA 2ZEBA 1LO6A 2BY5X 2IN2A 1SGTA 4Y6DA 4OS2A 2FP7B 4MQAA 1IQKA 3VB4A 1P09A 3HKJB 1SLXB 3MU8A 2VWOA 3JZ1B 4NIYA 3UOPA 4B2BA 4KP0A 4YOIA 1QIXB 4LXBH 1FN8A 1ZHPA 2BD2A 3OYPA 2BDBA 3CENA 4ZHAA 3SOSA 1CGJE 3B8JA 3BTFE 2BD7A 1DSTA 4NFEA 1LQDB 4IBLH 2A5KA 5H4IB 4UE7H 4IC5A 2FESH 4WWYA 5A8XA 3FP8E 2OXSA 2GD4B 1C2KA 1GBEA 1CA0B 3M5NA 3SJIA 5C1XA 3BEUA 3PO1B 4Y7BA 1B0FA 1GHYH 2BZAA 2R2MB 4AGJA 1GBJA 2B8OH 3TIUA 2VIVA 3SNCA 3HATH 1BTHH 1XUGA 2FOEA 3UREA 1C5YB 2OBQA 3FFGA 1J14A 2WV5A 3AASA 1O39A 4OGXA 2C3SA 2UUYA 1JBUH 3VB6A 2ZDKA 1XKAC 1TAWA 1HAVB 4DT7B 1SQTA 4IN1A 2ZC9H 4X8UH 4XBBA 3A88A 3KQCA 2F9UA 1F92A 4MNVA 3ENSB 2C93B 4BAKB 1C1SA 2A2XH 4UFDH 1NN6A 1FY5A 3E16B 1GVLA 5GWZA 1PQAA 4FUJA 4CREA 3BTGE 1CA8B 2KAIA 4YESB 1VITH 1C2MA 1V2WT 1HAPH 1GHBF 1EZQA 2OINA 2ZU2A 1J17T 2F9OA 1TWXB 1BIOA 1D9IA 1NRPH 4X1NU 2AGIX 1GI3A 3SNEA 3MFJA 2CF8H 1GDNA 1O2JA 2A32A 1NFUA 1AWFH 1GBCA 4BXSA 4RN6A 1DS2E 1HV7A 3MU1A 3BTHE 1OXGA 1X7AC 2ZF0H 2FZZA 1T8OA 3EGKH 2D26C 4U01A 3KF2A 3RMNH 2FLBH 5C67A 1V3XA 3ODFA 1QJ1B 1T8NA 4IMZA 3A89A 3LGYA 1HAXB 1NZQH 3TH4H 2BQWB 4YOJA 3A86A 2BD8A 3ZVGA 1V2UT 2B7DH 4X2YA 3PMBB 1BA8B 3E8LA 3NCLA 1C1OA 1JXPA 1FPHH 1LVMA 2PKAA 1LPKB 3M61U 1P2JA 1QNJA 1F2SE 1GHAG 4HGCA 3I29A 1EZUC 2Z3CA 1GHXH 2GZ9A 1VCWA 1KTSB 3UOUA 1HJ8A 3T2NA 3P70B 2FTLE 1H9IE 1OWHA 2FOAA 5FHTA 3GY7A 2V3HH 2CMYA 2FOCA 4MPUA 4MPVA 1ARCA 5FCRA 4Z6AH 1AKSB 3R0FA 3SU4A 2BZ6H 1S85A 1RTKA 1V2OT 4BAMB 4WXVA 3STIA 4K3JA 1LDTT 2VJ1A 2BLWA 3ZVEA 3BIUH 4O3TA 3K6ZA 2GCTB 2ALVA 1O35A 1ZHMA 4K1EA 4GPGA 3SGQE 2FMJA 1THSH 5PTPA 1IQJA 1BTPA 4WXIA 1O2YA 1ANDA 2ZGXH 4B2AA 2R2WU 1L4ZA 3GDUA 1AWHB 3KGPA 1C5XB 4CRGA 4TY7A 1BT7A 4NG9H 4TYDA 2V0BA 2FEQH 1D3PB 1WUNH 4ESTE 4YM9A 1BITA 1SOTA 3M3SA 3LIWA 4I8KA 1JIMA 4YOGA 1TE0A 3L6PA 3M5MA 3GCHC 2A7HA 4Y0YE 2AGEX 3FVFB 2NU3E 2ZGJA 5G4BA 2H6MA 1G2LA 1SGDE 3RUOA 2XBVA 1TPPA 2JKHA 2ZZUH 2ZU3A 3GY5A 1GJCB 2ZFRH 4WMDA 5EODA 1O5DH 1P2IA 2XW9A 4TY6A 4TWYA 4HTCH 1UTMA 2FYQA 1A5IA 4CHAC 3ZZ4A 3S9BA 4CR9A 1W12U 3DA9B 3QUMP 4FVDA 1RIWC 3RC4A 1EKBB 4D76A 4KELA 3NPSA 1ZMLA 1BMAA 1ESTA 2H1UA 3MNBA 1IQNA 2J34A 2TBSA 3BEIB 5JDUB 1GHVH 2Y80A 2RA0A 1MBMA 2JH0D 1C1QA 3FP7E 2J2UA 3F9HA 2QCYA 1AVGH 1Z6JH 2H9EH 1P3CA 4D8NA 1ETRH 1AMHA 5GDSH 1MD8A 1G30B 1AB9C 1ELCA 2BD9A 2A5IA 2YNBA 2ZU1A 4WMFA 4UFEH 1ELEE 4O97A 3SO3A 1G3CA 3A7ZA 1W0ZU 4GHQA 1BBRH 1UVUH 3P6ZB 3HKIB 5BRRE 1ANBA 3MO3A 1WBGB 2Y6TA 1SMFE 3TITA 1YPMH 5TCCA 1K1MA 8GCHF 1ZJKA 3UR6A 1UVSH 4ABAA 5F8XA 1SBWA 1O2UA 2VWMA 4X6OA 1EAUA 5LPEA 1B5GH 4ABBA 1HAOH 1GJ6A 6LPRA 1LVOA 1ANCA 1GG6C 3ZV8A 2EI6A 1UVTH 5C3NA 3SUFA 3W95A 3RU4T 2R3UA 3A84A 3MNCA 1AFQC 3ATIA 1Y3WA 1WYKA 2SGDE 2D8WA 3SQEE 1GBIA 1FZZA 2GZ7A 1BTUA 3UR9A 5FCKA 3SZNA 3E1XB 5E2OA 1TBQH 1EAIA 1GJAB 2WUBA 2ZDAH 2NU0E 3M37A 1MU6B 2A4GA 3UQOA 2XWBI 1G36A 5AHGH 2ASUB 1TOCB 2W7UA 1KXBA 4AGKA 1BTXA 1T32A 3UUZA 2OUAA 1THRH 3MMGA 1BMNH 1VZQH 2A2QH 2ZTXA 2BM2A 3CP7A 3MNXA 1F5RA 2BX3A 2VINA 3H5CB 1G3DA 4ZKOU 3C1KA 5L2ZH 4A92A 2Y82A 2KAIB 1C4U2 1TPOA 1OWJA 3KQEA 1AUJA 1KXEA 2BQ6B 1YP9A 2FIRH 2F9VA 5JBBS 1UHBA 5FPSA 3M3VA 3PTNA 4K8YA 1V2LT 1TNIA 2CXVA 5DK1A 4BXWA 1Y8TA 4NGAH 3V13A 1WSSH 3SI3H 2OC8A 4K1SA 2CHAB 3SV7A 4B75A 1GI9B 4I8GA 3TJUA 2NU2E 1DLKB 1IQMA 4DY7B 5TJXA 4NIWA 1VGCB 2V35A 4I31A 1CBWB 1W14U 3MO6A 1MCVA 3PM3A 1H1BA 4ISOA 3U8TH 3P8GA 1DPOA 2QGRA 4BTTB 2PKAB 1AVXA 2ZTYA 3VB3A 3PWBA 1TONA 3LOXA 1SGRE 1K1IA 1W10U 4ZKSU 1GDQA 4X6NA 5ESTE 5L2YH 3PMAB 4Y11E 3SQHE 3EDXB 4AZ2B 4R8TB 2BDHA 3VGCB 4JZIA 5EXLA 2ODYB 1GBLA 5A0BA 1UCYE 1EB2A 1E36B 2XC5A 3RU4E 3A7WA 4NFFA 1C5TA 2ZPSA 2AS9A 1GJ9B 4HZHA 1AO5A 1A61H 3TJOA 1GL1A 1Z8IB 4WJG2 1XKBC 1J16A 3HK3B 9LPRA 2Z6BD 2XRCA 2ZA5A 1O2MA 3UPEA 3F68H 1C5SA 3RMOH 2BXTH 4X8VH 1O2NA 2OC1A 1MKWH 3ODDA 2GCHF 1MKXK 1O3HA 2GX4A 1YF4A 5A09A 3PYHA 1GJ7B 4DIIH 2W5EA 3V12A 1GPZA 1FIWA 1S81A 5E2PA 2BY8X 4A1XA 1WCZA 1O3KA 3P8OA 1HCGA 1KSNA 1AZZA 3MWIU 3ZZDA 1Y5BT 3RU4D 3TK9A 1NU9A 1FXYA 1V2KT 5FXLA 2QXHA 1RTLA 4CBNA 3QO6A 1AHTH 1BTZA 4NA9H 2BX4A 2THFB 4IS5A 2GDEH 3IITA 1W2KH 3VPKA 3RXTA 2TGTA 1SL3A 1NFWA 4GCHG 3MOCA 4GCHF 1JWTA 3LGTA 2GV6A 2F3CE 1ZSLA 3UNRA 1SGPE 2ILNA 1FDPA 1SQAA 2P8OC 1C4Y2 4YZUA 1DX5M 1O2QA 4ABEA 1XMNB 4U30A 1Q31A 1C2GA 3M5OA 1AGJA 5EPYA 1N6XA 1UK3A 1JRTA 1C2FA 2Q1JA 1BBRK 5E0JA 3SNBA 1GI7B 4QT8C 4UFFH 3RMLH 2ZDNA 4BNRA 1OS8A 1GMDG 4X0WU 2WPJS 3DFJA 4Y8ZA 2ZDMA 2FOHA 3MH4A 2VIPA 5CHAB 1AQ7A 1NESE 2B5TB 1GI5A 2WPKS 1TGCA 1EAXA 1TNGA 1MTVA 2XC0A 4Y0ZE 7ESTE 1Q2WA 5AFYH 2A1DB 3GY3A 2C8YB 3GICB 1NC6A 3RXEA 1O31A 1O2XA 1O5AB 3LGVA 4BAQB 3C27B 1MTSA 2XWAA 2PKSB 1Y3VA 4RKJB 3SNDA 1B0EA 1SHHB 2ANKH 2UUKB 1S0RA 3U69H 1AZ8A 1G37A 2ZHEH 1O36A 1HXEH 1ZTKA 3EQ0H 2Y7ZA 4Z0KA 3ZVDA 3B23B 2V6NA 2YOLA 1DDJA 1CQQA 4GLYA 4UEHH 2ZI2H 2A45B 3GY2A 5A8YA 3D23A 1C4V2 5FBIA 1WOFA 2QF0A 2H5CA 3F6UH 3U8RH 3O8RA 4YLQH 3KIDU 7GCHG 3SGBE 4DCDA 3SHCH 4O03A 4MDSA 4Y79A 3URCA 1BJUA 1ZTLA 2HGTH 6CHAC 4X1RU 2CF9H 1TGBA 1XXDA 2GDDA 3Q77A 4NIXA 4PROA 4ASHA 1LCYA 1F5KU 1JOUB 4ZXXH 1KLIH 3CS7A 1WTHD 1C2EA 2BLQA 1CHOG 1HJAC 3S0NA 3NUMA 1HRTH 1JRSA 1Z8GA 1Y3UA 4B2CA 2DE9A 1O2LA 4CRAA 1C5QA 1QBVH 5GCHG 1QA0A 1QRWA 1SGEE 4I8LA 3V0XA 2D2DA 2FTMA 1ORFA 1V2JT 3LKWA 3S9AA 4ISHH 1PPGE 5AF9H 3EAJA 1MTNC 1BHXF 3GCTF 1PQ5A 1EB1H 4NCYA 1TYNA 4FXGH 1YPGH 1SLVB 2A4QA 2K1QA 4ISNA 3SGAE 3K2UA 1FN6A 3NK8A 3RMMH 5FX5A 1P9UA 3RXIA 4XBCA 4AFZA 2XBXA 1KXCA 1NRQH 3U8OH 4XE4A 1HAZB 1CSOE 2AMPA 1EPTC 2W26A 5HGGA 1AE8H 1O0DH 1RS0A 5HMAA 1OP0A 5DGJA 1N1LA 2FI4E 1O33A 3BV9B 1E0FD 1ELBA 3BTDE 2GTBA 2XCNA 2BMGB 1NY22 3E91A 3RXGA 1H9LB 3K6YA 4A1VA 1TX7A 4NIVA 3RC5A 2BB4A 1W3CA 5BPEA 5DJ7A 3IG6B 1L4DA 2ZFFH 2BTCE 5C5OA 3OY5U 1G3EA 1QJ7B 5DKMA 3URDA 1HFDA 1ESBA 3UIRA 1O3NA 1KY9A 1TGNA 5E0GA 1S6FA 2M5TA 3A8BA 3SU6A 3ZYEA 1YCPK 1CT2E 3A80A 1MKWK 3PWCA 1XM1A 3GCOA 2G52A 1SFIA 2RDLA 5DPAA 1MQ5A