1K23A

Inorganic pyrophosphatase (family ii) from bacillus subtilis
Total Genus 98
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
98
sequence length
307
structure length
307
Chain Sequence
MEKILIFGHQNPDTDTICSAIAYADLKNKLGFNAEPVRLGQVNGETQYALDYFKQESPRLVETAANEVNGVILVDHNERQQSIKDIEEVQVLEVIDHHRIANFETAEPLYYRAEPVGCTATILNKMYKENNVKIEKEIAGLMLSAIISDSLLFKSPTCTDQDVAAAKELAEIAGVDAEEYGLNMLKAGADLSKKTVEELISLDAKEFTLGSKKVEIAQVNTVDIEDVKKRQAELEAVISKVVAEKNLDLFLLVITDILENDSLALAIGNEAAKVEKAFNVTLENNTALLKGVVSRKKQVVPVLTDAM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The "open" and "closed" structures of the type-C inorganic pyrophosphatases from Bacillus subtilis and Streptococcus gordonii.
pubmed doi rcsb
source organism Bacillus subtilis
molecule tags Hydrolase
molecule keywords Manganese-dependent inorganic pyrophosphatase
total genus 98
structure length 307
sequence length 307
chains with identical sequence B, C, D
ec nomenclature ec 3.6.1.1: Inorganic diphosphatase.
pdb deposition date 2001-09-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01368 DHH DHH family
A PF02833 DHHA2 DHHA2 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.310.20 Alpha Beta Roll Diaminopimelate Epimerase; Chain A, domain 1 Diaminopimelate Epimerase; Chain A, domain 1 1k23A02
3.90.1640.10 Alpha Beta Alpha-Beta Complex inorganic pyrophosphatase (n-terminal core) inorganic pyrophosphatase (n-terminal core) 1k23A01
1WPMA 1WPPA 1I74A 1K23A 2QB7A 2QB6A 2HAWA 2QB8A 1K20A 4RPAA 3DEVA 3W5WA 2IW4A 4PY9A 2ENXA 4LS9A 1WPNA 2EB0A
chains in the Genus database with same CATH superfamily
2KPTA 3PW9A 4J9WA 1QYAA 2ENXA 5IWEA 2ZXOA 3G98A 1BWZA 2ZXRA 3FVEA 1YM5A 2Q9HA 1W61A 1WPNA 2LT2A 3G7KA 4JD7A 4DWZA 1XUAA 5H2GA 3WQZA 2GKJA 1TM0A 4K7XA 2OTNA 2Q9JA 4LB0A 2QB7A 2QB8A 2ZVFA 3EDNA 3EKMA 5GL2A 5ANPA 3EJXA 4IK0A 1WPPA 4RPAA 2H9FA 2EB0A 2IW4A 5HA4A 1GQZA 1U1XA 1XUBA 3IGHX 4OA3A 1S7JA 4LG3A 4Q60A 2AZPA 2QB6A 2HAWA 2KW7A 4K7GB 4JBDA 2YMAA 1K23A 1W62A 1SDJA 4FC5A 2ZXPA 5H2YA 3ICJA 3W5WA 4GL6A 3PTJA 5M47A 5GL3A 4LS9A 4Q2HA 4JUUA 4K8LA 4PY9A 2PVZA 1T6KA 1WPMA 1U1VA 5GL4A 3DEVA 1QY9A 1U0KA 2GKEA 1U1WA 2MPBA 4IJZA 1IR6A 1K20A 3PVHA 2PW0A 5GKXA 4JCIA 4DUNA 1I74A 4J9XA
chains in the Genus database with same CATH topology
2KPTA 3PW9A 4J9WA 1QYAA 2ENXA 5IWEA 2ZXOA 3G98A 1BWZA 2ZXRA 3FVEA 1YM5A 2Q9HA 1W61A 1WPNA 2LT2A 3G7KA 4JD7A 4DWZA 1XUAA 5H2GA 3WQZA 2GKJA 1TM0A 4K7XA 2OTNA 2Q9JA 4LB0A 2QB7A 2QB8A 2ZVFA 3EDNA 3EKMA 5GL2A 5ANPA 3EJXA 4IK0A 1WPPA 4RPAA 2H9FA 2EB0A 2IW4A 5HA4A 1GQZA 1U1XA 1XUBA 3IGHX 4OA3A 1S7JA 4LG3A 4Q60A 2AZPA 2QB6A 2HAWA 2KW7A 4K7GB 4JBDA 2YMAA 1K23A 1W62A 1SDJA 4FC5A 2ZXPA 5H2YA 3ICJA 3W5WA 4GL6A 3PTJA 5M47A 5GL3A 4LS9A 4Q2HA 4JUUA 4K8LA 4PY9A 2PVZA 1T6KA 1WPMA 1U1VA 5GL4A 3DEVA 1QY9A 1U0KA 2GKEA 1U1WA 2MPBA 4IJZA 1IR6A 1K20A 3PVHA 2PW0A 5GKXA 4JCIA 4DUNA 1I74A 4J9XA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1WPM A;  1WPP A;  1I74 A;  1K23 A;  2QB7 A;  2QB6 A;  2HAW A;  2QB8 A;  1K20 A;  4RPA A;  3DEV A;  3W5W A;  2IW4 A;  4PY9 A;  2ENX A;  4LS9 A;  1WPN A;  2EB0 A; 
#chains in the Genus database with same CATH topology
 2KPT A;  3PW9 A;  4J9W A;  1QYA A;  2ENX A;  5IWE A;  2ZXO A;  3G98 A;  1BWZ A;  2ZXR A;  3FVE A;  1YM5 A;  2Q9H A;  1W61 A;  1WPN A;  2LT2 A;  3G7K A;  4JD7 A;  4DWZ A;  1XUA A;  5H2G A;  3WQZ A;  2GKJ A;  1TM0 A;  4K7X A;  2OTN A;  2Q9J A;  4LB0 A;  2QB7 A;  2QB8 A;  2ZVF A;  3EDN A;  3EKM A;  5GL2 A;  5ANP A;  3EJX A;  4IK0 A;  1WPP A;  4RPA A;  2H9F A;  2EB0 A;  2IW4 A;  5HA4 A;  1GQZ A;  1U1X A;  1XUB A;  3IGH X;  4OA3 A;  1S7J A;  4LG3 A;  4Q60 A;  2AZP A;  2QB6 A;  2HAW A;  2KW7 A;  4K7G B;  4JBD A;  2YMA A;  1K23 A;  1W62 A;  1SDJ A;  4FC5 A;  2ZXP A;  5H2Y A;  3ICJ A;  3W5W A;  4GL6 A;  3PTJ A;  5M47 A;  5GL3 A;  4LS9 A;  4Q2H A;  4JUU A;  4K8L A;  4PY9 A;  2PVZ A;  1T6K A;  1WPM A;  1U1V A;  5GL4 A;  3DEV A;  1QY9 A;  1U0K A;  2GKE A;  1U1W A;  2MPB A;  4IJZ A;  1IR6 A;  1K20 A;  3PVH A;  2PW0 A;  5GKX A;  4JCI A;  4DUN A;  1I74 A;  4J9X A; 
#chains in the Genus database with same CATH homology
 2KPT A;  3PW9 A;  4J9W A;  1QYA A;  2ENX A;  5IWE A;  2ZXO A;  3G98 A;  1BWZ A;  2ZXR A;  3FVE A;  1YM5 A;  2Q9H A;  1W61 A;  1WPN A;  2LT2 A;  3G7K A;  4JD7 A;  4DWZ A;  1XUA A;  5H2G A;  3WQZ A;  2GKJ A;  1TM0 A;  4K7X A;  2OTN A;  2Q9J A;  4LB0 A;  2QB7 A;  2QB8 A;  2ZVF A;  3EDN A;  3EKM A;  5GL2 A;  5ANP A;  3EJX A;  4IK0 A;  1WPP A;  4RPA A;  2H9F A;  2EB0 A;  2IW4 A;  5HA4 A;  1GQZ A;  1U1X A;  1XUB A;  3IGH X;  4OA3 A;  1S7J A;  4LG3 A;  4Q60 A;  2AZP A;  2QB6 A;  2HAW A;  2KW7 A;  4K7G B;  4JBD A;  2YMA A;  1K23 A;  1W62 A;  1SDJ A;  4FC5 A;  2ZXP A;  5H2Y A;  3ICJ A;  3W5W A;  4GL6 A;  3PTJ A;  5M47 A;  5GL3 A;  4LS9 A;  4Q2H A;  4JUU A;  4K8L A;  4PY9 A;  2PVZ A;  1T6K A;  1WPM A;  1U1V A;  5GL4 A;  3DEV A;  1QY9 A;  1U0K A;  2GKE A;  1U1W A;  2MPB A;  4IJZ A;  1IR6 A;  1K20 A;  3PVH A;  2PW0 A;  5GKX A;  4JCI A;  4DUN A;  1I74 A;  4J9X A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...