1K23A

Inorganic pyrophosphatase (family ii) from bacillus subtilis
Total Genus 98
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
98
sequence length
307
structure length
307
Chain Sequence
MEKILIFGHQNPDTDTICSAIAYADLKNKLGFNAEPVRLGQVNGETQYALDYFKQESPRLVETAANEVNGVILVDHNERQQSIKDIEEVQVLEVIDHHRIANFETAEPLYYRAEPVGCTATILNKMYKENNVKIEKEIAGLMLSAIISDSLLFKSPTCTDQDVAAAKELAEIAGVDAEEYGLNMLKAGADLSKKTVEELISLDAKEFTLGSKKVEIAQVNTVDIEDVKKRQAELEAVISKVVAEKNLDLFLLVITDILENDSLALAIGNEAAKVEKAFNVTLENNTALLKGVVSRKKQVVPVLTDAM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The "open" and "closed" structures of the type-C inorganic pyrophosphatases from Bacillus subtilis and Streptococcus gordonii.
pubmed doi rcsb
source organism Bacillus subtilis
molecule tags Hydrolase
molecule keywords Manganese-dependent inorganic pyrophosphatase
total genus 98
structure length 307
sequence length 307
chains with identical sequence B, C, D
ec nomenclature ec 3.6.1.1: Inorganic diphosphatase.
pdb deposition date 2001-09-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01368 DHH DHH family
A PF02833 DHHA2 DHHA2 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.310.20 Alpha Beta Roll Diaminopimelate Epimerase; Chain A, domain 1 Diaminopimelate Epimerase; Chain A, domain 1 1k23A02
3.90.1640.10 Alpha Beta Alpha-Beta Complex inorganic pyrophosphatase (n-terminal core) inorganic pyrophosphatase (n-terminal core) 1k23A01
2HAWA 3DEVA 2QB8A 1WPMA 3W5WA 4RPAA 2QB7A 2EB0A 1I74A 4PY9A 1WPPA 1K23A 4LS9A 2IW4A 2ENXA 1WPNA 2QB6A 1K20A
chains in the Genus database with same CATH superfamily
4JD7A 5H2GA 4PY9A 2H9FA 3WQZA 2IW4A 4K7XA 4LB0A 1GQZA 1TM0A 1U1VA 5H2YA 4J9XA 4FC5A 2ZXOA 2ZXPA 1YM5A 2ZXRA 2MPBA 4Q2HA 4JCIA 4LG3A 1SDJA 1T6KA 4JBDA 1U1WA 1QY9A 2GKJA 4GL6A 3EDNA 1S7JA 4LS9A 4RPAA 3FVEA 1QYAA 2Q9JA 4Q60A 3W5WA 3ICJA 1W62A 5GL2A 3PTJA 2QB7A 1U1XA 1WPPA 3PVHA 4IK0A 1WPMA 3EJXA 2PW0A 4J9WA 5GL4A 4DWZA 1XUBA 2ZVFA 5M47A 1U0KA 2QB8A 2Q9HA 2OTNA 4JUUA 2EB0A 5IWEA 1I74A 3G7KA 3EKMA 4DUNA 1W61A 5GL3A 1BWZA 1WPNA 2QB6A 5HA4A 2HAWA 2PVZA 5GKXA 4IJZA 2LT2A 2AZPA 2KW7A 2YMAA 3DEVA 4K8LA 3G98A 5ANPA 2GKEA 3IGHX 1K23A 2ENXA 1K20A 4OA3A 2KPTA 1IR6A 3PW9A 4K7GB 1XUAA
chains in the Genus database with same CATH topology
4JD7A 5H2GA 4PY9A 2H9FA 3WQZA 2IW4A 4K7XA 4LB0A 1GQZA 1TM0A 1U1VA 5H2YA 4J9XA 4FC5A 2ZXOA 2ZXPA 1YM5A 2ZXRA 2MPBA 4Q2HA 4JCIA 4LG3A 1SDJA 1T6KA 4JBDA 1U1WA 1QY9A 2GKJA 4GL6A 3EDNA 1S7JA 4LS9A 4RPAA 3FVEA 1QYAA 2Q9JA 4Q60A 3W5WA 3ICJA 1W62A 5GL2A 3PTJA 2QB7A 1U1XA 1WPPA 3PVHA 4IK0A 1WPMA 3EJXA 2PW0A 4J9WA 5GL4A 4DWZA 1XUBA 2ZVFA 5M47A 1U0KA 2QB8A 2Q9HA 2OTNA 4JUUA 2EB0A 5IWEA 1I74A 3G7KA 3EKMA 4DUNA 1W61A 5GL3A 1BWZA 1WPNA 2QB6A 5HA4A 2HAWA 2PVZA 5GKXA 4IJZA 2LT2A 2AZPA 2KW7A 2YMAA 3DEVA 4K8LA 3G98A 5ANPA 2GKEA 3IGHX 1K23A 2ENXA 1K20A 4OA3A 2KPTA 1IR6A 3PW9A 4K7GB 1XUAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2HAW A;  3DEV A;  2QB8 A;  1WPM A;  3W5W A;  4RPA A;  2QB7 A;  2EB0 A;  1I74 A;  4PY9 A;  1WPP A;  1K23 A;  4LS9 A;  2IW4 A;  2ENX A;  1WPN A;  2QB6 A;  1K20 A; 
#chains in the Genus database with same CATH topology
 4JD7 A;  5H2G A;  4PY9 A;  2H9F A;  3WQZ A;  2IW4 A;  4K7X A;  4LB0 A;  1GQZ A;  1TM0 A;  1U1V A;  5H2Y A;  4J9X A;  4FC5 A;  2ZXO A;  2ZXP A;  1YM5 A;  2ZXR A;  2MPB A;  4Q2H A;  4JCI A;  4LG3 A;  1SDJ A;  1T6K A;  4JBD A;  1U1W A;  1QY9 A;  2GKJ A;  4GL6 A;  3EDN A;  1S7J A;  4LS9 A;  4RPA A;  3FVE A;  1QYA A;  2Q9J A;  4Q60 A;  3W5W A;  3ICJ A;  1W62 A;  5GL2 A;  3PTJ A;  2QB7 A;  1U1X A;  1WPP A;  3PVH A;  4IK0 A;  1WPM A;  3EJX A;  2PW0 A;  4J9W A;  5GL4 A;  4DWZ A;  1XUB A;  2ZVF A;  5M47 A;  1U0K A;  2QB8 A;  2Q9H A;  2OTN A;  4JUU A;  2EB0 A;  5IWE A;  1I74 A;  3G7K A;  3EKM A;  4DUN A;  1W61 A;  5GL3 A;  1BWZ A;  1WPN A;  2QB6 A;  5HA4 A;  2HAW A;  2PVZ A;  5GKX A;  4IJZ A;  2LT2 A;  2AZP A;  2KW7 A;  2YMA A;  3DEV A;  4K8L A;  3G98 A;  5ANP A;  2GKE A;  3IGH X;  1K23 A;  2ENX A;  1K20 A;  4OA3 A;  2KPT A;  1IR6 A;  3PW9 A;  4K7G B;  1XUA A; 
#chains in the Genus database with same CATH homology
 4JD7 A;  5H2G A;  4PY9 A;  2H9F A;  3WQZ A;  2IW4 A;  4K7X A;  4LB0 A;  1GQZ A;  1TM0 A;  1U1V A;  5H2Y A;  4J9X A;  4FC5 A;  2ZXO A;  2ZXP A;  1YM5 A;  2ZXR A;  2MPB A;  4Q2H A;  4JCI A;  4LG3 A;  1SDJ A;  1T6K A;  4JBD A;  1U1W A;  1QY9 A;  2GKJ A;  4GL6 A;  3EDN A;  1S7J A;  4LS9 A;  4RPA A;  3FVE A;  1QYA A;  2Q9J A;  4Q60 A;  3W5W A;  3ICJ A;  1W62 A;  5GL2 A;  3PTJ A;  2QB7 A;  1U1X A;  1WPP A;  3PVH A;  4IK0 A;  1WPM A;  3EJX A;  2PW0 A;  4J9W A;  5GL4 A;  4DWZ A;  1XUB A;  2ZVF A;  5M47 A;  1U0K A;  2QB8 A;  2Q9H A;  2OTN A;  4JUU A;  2EB0 A;  5IWE A;  1I74 A;  3G7K A;  3EKM A;  4DUN A;  1W61 A;  5GL3 A;  1BWZ A;  1WPN A;  2QB6 A;  5HA4 A;  2HAW A;  2PVZ A;  5GKX A;  4IJZ A;  2LT2 A;  2AZP A;  2KW7 A;  2YMA A;  3DEV A;  4K8L A;  3G98 A;  5ANP A;  2GKE A;  3IGH X;  1K23 A;  2ENX A;  1K20 A;  4OA3 A;  2KPT A;  1IR6 A;  3PW9 A;  4K7G B;  1XUA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...