1K23A

Inorganic pyrophosphatase (family ii) from bacillus subtilis
Total Genus 98
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
98
sequence length
307
structure length
307
Chain Sequence
b'MEKILIFGHQNPDTDTICSAIAYADLKNKLGFNAEPVRLGQVNGETQYALDYFKQESPRLVETAANEVNGVILVDHNERQQSIKDIEEVQVLEVIDHHRIANFETAEPLYYRAEPVGCTATILNKMYKENNVKIEKEIAGLMLSAIISDSLLFKSPTCTDQDVAAAKELAEIAGVDAEEYGLNMLKAGADLSKKTVEELISLDAKEFTLGSKKVEIAQVNTVDIEDVKKRQAELEAVISKVVAEKNLDLFLLVITDILENDSLALAIGNEAAKVEKAFNVTLENNTALLKGVVSRKKQVVPVLTDAM'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Manganese-dependent inorganic pyrophosphatase
publication title The "open" and "closed" structures of the type-C inorganic pyrophosphatases from Bacillus subtilis and Streptococcus gordonii.
pubmed doi rcsb
source organism Bacillus subtilis
molecule tags Hydrolase
total genus 98
structure length 307
sequence length 307
chains with identical sequence B, C, D
ec nomenclature ec 3.6.1.1: Inorganic diphosphatase.
pdb deposition date 2001-09-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01368 DHH DHH family
A PF02833 DHHA2 DHHA2 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.310.20 Alpha Beta Roll Diaminopimelate Epimerase; Chain A, domain 1 Diaminopimelate Epimerase; Chain A, domain 1 1k23A02
3.90.1640.10 Alpha Beta Alpha-Beta Complex inorganic pyrophosphatase (n-terminal core) inorganic pyrophosphatase (n-terminal core) 1k23A01
3DEVA 2HAWA 4LS9A 2QB6A 1WPNA 2QB7A 4RPAA 3W5WA 1K20A 1WPMA 2ENXA 2QB8A 1K23A 2EB0A 1WPPA 4PY9A 1I74A 2IW4A
chains in the Genus database with same CATH superfamily
1S7JA 4J9XA 1XUAA 3W5WA 4IJZA 2GKJA 5ANPA 4OA3A 2PW0A 2MPBA 5GL2A 2ZXPA 5IWEA 4GL6A 4LG3A 2HAWA 4K7GB 4LB0A 4Q60A 2QB7A 3ICJA 4IK0A 5M47A 4JD7A 3EKMA 1WPPA 2GKEA 1BWZA 5HA4A 4LS9A 4Q2HA 1T6KA 5GL3A 2YMAA 1I74A 3G98A 4DWZA 2QB6A 3PVHA 2KW7A 4DUNA 1U1VA 1YM5A 1W61A 1GQZA 4RPAA 4K7XA 5H2YA 5GL4A 3FVEA 2ZXRA 1K23A 2EB0A 2H9FA 2ENXA 4K8LA 2IW4A 1K20A 5GKXA 4PY9A 3G7KA 2LT2A 1QYAA 3DEVA 1WPNA 2PVZA 1WPMA 4JCIA 4J9WA 1U0KA 4JBDA 4FC5A 2Q9JA 1W62A 1U1WA 3PW9A 3EDNA 2OTNA 1U1XA 2AZPA 1QY9A 1SDJA 3IGHX 3WQZA 1IR6A 2QB8A 1XUBA 2ZXOA 5H2GA 4JUUA 2ZVFA 3EJXA 3PTJA 1TM0A 2Q9HA 2KPTA
chains in the Genus database with same CATH topology
1S7JA 4J9XA 1XUAA 3W5WA 4IJZA 2GKJA 5ANPA 4OA3A 2PW0A 2MPBA 5GL2A 2ZXPA 5IWEA 4GL6A 4LG3A 2HAWA 4K7GB 4LB0A 4Q60A 2QB7A 3ICJA 4IK0A 5M47A 4JD7A 3EKMA 1WPPA 2GKEA 1BWZA 5HA4A 4LS9A 4Q2HA 1T6KA 5GL3A 2YMAA 1I74A 3G98A 4DWZA 2QB6A 3PVHA 2KW7A 4DUNA 1U1VA 1YM5A 1W61A 1GQZA 4RPAA 4K7XA 5H2YA 5GL4A 3FVEA 2ZXRA 1K23A 2EB0A 2H9FA 2ENXA 4K8LA 2IW4A 1K20A 5GKXA 4PY9A 3G7KA 2LT2A 1QYAA 3DEVA 1WPNA 2PVZA 1WPMA 4JCIA 4J9WA 1U0KA 4JBDA 4FC5A 2Q9JA 1W62A 1U1WA 3PW9A 3EDNA 2OTNA 1U1XA 2AZPA 1QY9A 1SDJA 3IGHX 3WQZA 1IR6A 2QB8A 1XUBA 2ZXOA 5H2GA 4JUUA 2ZVFA 3EJXA 3PTJA 1TM0A 2Q9HA 2KPTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3DEV A;  2HAW A;  4LS9 A;  2QB6 A;  1WPN A;  2QB7 A;  4RPA A;  3W5W A;  1K20 A;  1WPM A;  2ENX A;  2QB8 A;  1K23 A;  2EB0 A;  1WPP A;  4PY9 A;  1I74 A;  2IW4 A; 
#chains in the Genus database with same CATH topology
 1S7J A;  4J9X A;  1XUA A;  3W5W A;  4IJZ A;  2GKJ A;  5ANP A;  4OA3 A;  2PW0 A;  2MPB A;  5GL2 A;  2ZXP A;  5IWE A;  4GL6 A;  4LG3 A;  2HAW A;  4K7G B;  4LB0 A;  4Q60 A;  2QB7 A;  3ICJ A;  4IK0 A;  5M47 A;  4JD7 A;  3EKM A;  1WPP A;  2GKE A;  1BWZ A;  5HA4 A;  4LS9 A;  4Q2H A;  1T6K A;  5GL3 A;  2YMA A;  1I74 A;  3G98 A;  4DWZ A;  2QB6 A;  3PVH A;  2KW7 A;  4DUN A;  1U1V A;  1YM5 A;  1W61 A;  1GQZ A;  4RPA A;  4K7X A;  5H2Y A;  5GL4 A;  3FVE A;  2ZXR A;  1K23 A;  2EB0 A;  2H9F A;  2ENX A;  4K8L A;  2IW4 A;  1K20 A;  5GKX A;  4PY9 A;  3G7K A;  2LT2 A;  1QYA A;  3DEV A;  1WPN A;  2PVZ A;  1WPM A;  4JCI A;  4J9W A;  1U0K A;  4JBD A;  4FC5 A;  2Q9J A;  1W62 A;  1U1W A;  3PW9 A;  3EDN A;  2OTN A;  1U1X A;  2AZP A;  1QY9 A;  1SDJ A;  3IGH X;  3WQZ A;  1IR6 A;  2QB8 A;  1XUB A;  2ZXO A;  5H2G A;  4JUU A;  2ZVF A;  3EJX A;  3PTJ A;  1TM0 A;  2Q9H A;  2KPT A; 
#chains in the Genus database with same CATH homology
 1S7J A;  4J9X A;  1XUA A;  3W5W A;  4IJZ A;  2GKJ A;  5ANP A;  4OA3 A;  2PW0 A;  2MPB A;  5GL2 A;  2ZXP A;  5IWE A;  4GL6 A;  4LG3 A;  2HAW A;  4K7G B;  4LB0 A;  4Q60 A;  2QB7 A;  3ICJ A;  4IK0 A;  5M47 A;  4JD7 A;  3EKM A;  1WPP A;  2GKE A;  1BWZ A;  5HA4 A;  4LS9 A;  4Q2H A;  1T6K A;  5GL3 A;  2YMA A;  1I74 A;  3G98 A;  4DWZ A;  2QB6 A;  3PVH A;  2KW7 A;  4DUN A;  1U1V A;  1YM5 A;  1W61 A;  1GQZ A;  4RPA A;  4K7X A;  5H2Y A;  5GL4 A;  3FVE A;  2ZXR A;  1K23 A;  2EB0 A;  2H9F A;  2ENX A;  4K8L A;  2IW4 A;  1K20 A;  5GKX A;  4PY9 A;  3G7K A;  2LT2 A;  1QYA A;  3DEV A;  1WPN A;  2PVZ A;  1WPM A;  4JCI A;  4J9W A;  1U0K A;  4JBD A;  4FC5 A;  2Q9J A;  1W62 A;  1U1W A;  3PW9 A;  3EDN A;  2OTN A;  1U1X A;  2AZP A;  1QY9 A;  1SDJ A;  3IGH X;  3WQZ A;  1IR6 A;  2QB8 A;  1XUB A;  2ZXO A;  5H2G A;  4JUU A;  2ZVF A;  3EJX A;  3PTJ A;  1TM0 A;  2Q9H A;  2KPT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...