1K27A

Crystal structure of 5'-deoxy-5'-methylthioadenosine phosphorylase in complex with a transition state analogue
Total Genus 92
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
92
sequence length
273
structure length
270
Chain Sequence
AVKIGIIGGTGLDDPEILEGRTEKYVDTPFGKPSDALILGKIKNVDCVLLARHGRQHTIMPSKVNYQANIWALKEEGCTHVIVTTACGSLREEIQPGDIVIIDQFIDRTTMRPQSFYDGSHSCARGVCHIPMAEPFCPKTREVLIETAKKLGLRCHSKGTMVTIEGPRFSSRAESFMFRTWGADVINMTTVPEVVLAKEAGICYASIAMATDYDCWEEAVSVDRVLKTLKENANKAKSLLLTTIPQIGSTEWSETLHNLKNMAQFSVLLP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Picomolar transition state analogue inhibitors of human 5'-methylthioadenosine phosphorylase and X-ray structure with MT-immucillin-A
pubmed rcsb
source organism Homo sapiens
molecule tags Transferase
molecule keywords 5'-Deoxy-5'-Methylthioadenosine Phosphorylase
total genus 92
structure length 270
sequence length 273
ec nomenclature ec 2.4.2.28: S-methyl-5'-thioadenosine phosphorylase.
pdb deposition date 2001-09-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01048 PNP_UDP_1 Phosphorylase superfamily
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1580 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1k27A00
4TYMA 3GB9A 1VHJA 3OOEA 4NSNA 3LBAA 1A69A 4LNAA 5CYGA 1Z34A 2PGAA 1PR6A 4M3NA 1A9OA 3KU4A 4KN5A 3SCZA 5B7QA 2OXFA 2HSWA 1TGVA 3FOWA 2QPLA 3KVRA 1LX7A 1JDUA 2QSUA 1YR3A 4QATA 3UAZA 1CB0A 1U1EA 1ZOSA 4G41A 5B7NA 3QPBA 3KVYA 1YRYE 1FXUA 2B94A 4JP5A 3DF9A 4F3KA 4BMZA 3E9ZA 4TXNA 4D8XA 5F7XA 4I2VA 1YBFA 1Z35A 3C74A 1B8NA 1U1FA 5F76A 1Z33A 3FUCA 4L5AA 1JDTA 1ODLA 1NC1A 1SD2A 4TTAA 3IOMA 1PF7E 4GMHA 3OZBA 4TXHA 1RCTE 3KUKA 1OUMA 2Q7OE 4EB8A 3ODGA 1OVGA 1G2OA 1A9PA 1V48A 4BN0A 4OEHA 2HN9A 4GKAA 3PHBE 4D8VA 5EUBA 5JPCA 4F1WA 3BJEA 4PNPA 4F2PA 3FAZA 1ZL2A 3NM4A 1RFGE 1TD1A 4TS3A 1K3FA 1C3XA 4TXMA 4WKCA 1PR4A 1RR6A 1A9RA 4OF4A 4L0MA 4OJTA 3P0FA 1ODKA 1WTAA 4R31A 4BMXA 1TGYA 1Z37A 5F7OA 5CCDA 4DA7A 2QTTA 4DA0A 3K8OE 1YQQA 1A9SA 4YNBA 4DABA 4M7WA 3OF3A 4JWTA 4QEZA 4TTJA 4WKNA 1JE1A 5B7PA 1JE0A 1NW4A 4DA8A 3NM6B 1V4NA 1Y6QA 1V2HE 4UC0A 1B8OA 3TL6A 5IU6A 4DAOA 4L5CA 4DARA 2I8AA 4MCHA 1Q1GA 1SQ6A 1SJ9A 1Z39A 3K8QA 4WKPA 1JDZA 1PR5A 4LNHA 1RXYA 3KHSA 3PHCA 4M1EA 4JOSA 1T8SA 4BMYA 4E1VA 3GGSA 2IQ5A 1V41E 3P0EA 5CYFA 4OGLA 2AI2A 4G8JA 1RSZA 3DJFA 5I3CA 3O6VA 3OPVA 4NS1A 1PR2A 1ULAA 4H1TA 3PNSA 1PW7A 1A9QA 5F77A 4DA6A 1NC3A 4U2KA 1V45E 3E0QA 3F8WA 5IFKA 3UT6A 4P54A 3UAXA 2ISCA 1I80A 2QDKA 4ECEA 1LV8A 2AI3A 3EUEA 5F7JA 1Z5PA 2A8YA 1VFNA 4L5YA 1TCVA 1T8WA 3KVVA 4QAQA 4YMLA 1VHWA 3FNQA 3OCCA 3EMVA 4R2XA 1JDSA 4OY3A 3OZDA 1N3IA 3T94A 1PKEA 3EEIA 1U1CA 3IEXA 3U40A 2OECA 3ENZA 5CXSA 1U1DA 1Y1SA 1RXUA 1LVUA 2XRFA 1ODJA 2GUWA 1PBNA 2H8GA 1Y1QA 3UAYA 3BL6A 1VMKA 1RXCA 4DANA 4IP0A 3E9RA 4RJ2A 3NM5A 1YQUA 1SD1A 4GLFA 4TS9A 1PK7A 3D1VA 4GLJA 4PR3A 1Y6RA 1QE5A 4WKBA 3BSFA 4K6OA 2OC9A 2QTGA 1K9SA 1M73E 2ON6A 4YJKA 1PWYE 4QASA 3INYA 3UAVA 1CG6A 5ETJA 4MARA 1Z5OA 2AC7A 3EUFA 4F2WA 1TCUA 5K1ZA 5CXQA 4WKOA 1V3QE 5F78A 4L6IA 1OTYA 3MB8A 1RYZA 2HWUA 3NBQA 4D98A 3DPSA 4NY1A 2RJ3A 1OV6A 1T8RA 5EPUA 1ODIA 1Y1TA 4LZWA 2P4SA 5DK6A 4LKRA 1RT9A 4MCIA 3BGSA 1A9TA 1K27A 1Y1RA 5FAKA 4TTIA 2I4TA 3DP9A 3OOHA 1ULBA 1T8YA 4D8YA 4TXLA 1T0UA 1PK9A 2HRDA 4OGKA 3FB1A 5KB3A 1JDVA 1U1GA 5F7ZA 5EFOA 4EARA 3UAWA 1OTXA 2BSXA 4QARA 1JP7A 4F3CA 4YO8A 3OZCA 3OZEA 3FWPA 1RXSA 1Z5NA 4LDNA 2A0YA 5C80A 3LGSA 4DAEA 1XE3A 1JPVA 4FFSA 4R2WA 1PR0A 3ONVA 1Z36A 2A0XA 3PNPA 5F73A 4TXJA 2AI1A 1Z38A 4X24A 3DDOA 1ECPA 3O4VA 1OU4A 1PR1A 3MMSA 1JYSA 5CCEA 4D9HA 2A0WA 4QFBA 3LA8A 2OC4A 5B7GA 4G89A
chains in the Genus database with same CATH superfamily
3AUSA 3TIGA 1K3TA 4L27A 1IPHA 3FG9A 1X7XA 4TYMA 4D5GA 2DBQA 3VQTA 2AR0A 3SM9A 4WXMA 2DX7A 4FW9A 3U62A 1NQTA 1T36A 1DX4A 4FJ1A 1WLYA 1A71A 4LDAA 2JCSA 1X7XB 3ELBA 5LIRA 3X0DA 4EJSB 4HDNB 3Q40A 2HSEA 2X40A 1XC7A 3ZD7A 1GGNA 3HL0A 5CDGA 3AUFA 3AEKB 1QQTA 2N1BA 1E4YA 3BIJA 5A6SA 1LPAB 2R1TA 3PU6A 4LOAA 5IZCA 3R9XB 5JROA 1T4DA 3WMGA 4BKQA 1HH4A 2BGNA 2ZYTX 1NVTA 3EXHA 3OMXA 5K0FA 4CEJB 2J9FA 2VK8A 4N39A 3NHLA 1GQRA 4X41A 1COWD 1Z9BA 3IELA 4X65B 2FGKA 3ITDA 4KZPA 5DWDA 1RQNA 3H5OA 5K3DA 2HSWA 5FPSA 3FYUA 5KOYA 3WNQA 1CQJB 1LK0A 3LUAA 1C9YA 4MWTA 2O4UX 3EIFA 5FOTA 5DN6A 3FOWA 4OHXA 4BRSA 3H11A 3AW9A 3D59A 3QGMA 4I3FA 4JJ8A 5TNXA 3O8CA 4RDCA 5ITSA 2BH2A 4Y0VA 1ZCZA 1KY3A 4EZEA 1PFQA 4LOKA 3QTBA 4JUBA 5A0TA 1SIBE 2ZTLA 1DPGA 2IYQA 2VCEA 3QLTA 2PU5A 2F43B 3HA7A 1R00A 5ED4A 4LJRA 4MUKA 1WW3A 5AVTA 1WS6A 3LBHA 2IZ0A 4ZDKA 3EW9A 4QOGA 4CI0B 4JUCA 4M1YA 4OVKA 4AZ3B 1KYYA 2OGSA 3Q5GA 4EJ2A 2JDID 4DQVA 4MEBA 2WABA 4K6KA 4XQEA 1E4VA 3AERA 3I6QA 4AQDA 2NTJA 2B94A 3ILXA 4GQBA 5BUCA 4ZKDA 3JXEA 1RVDA 1HYBA 1XL0A 5BPHA 2BE7A 1NA5A 2FI1A 4EB6A 3I34X 4TXNA 5JBIA 1QGOA 4NXNB 4RF3A 3QBDA 1NXXA 2MSCB 4TYWA 3T41A 2AFIE 2QQ5A 3PHJA 1SXJA 3BDAA 2NNLD 5AXDA 2OQRA 4XXHA 5B1HA 2UZ0A 1RYBA 1FYXA 2OCKA 4INOA 3GPCA 4UD2A 1AKEA 3LUDA 1K8ZB 1BS2A 2W5UA 5H3CA 4D80A 1LPPA 1EUDB 1BVUA 1G9TA 1K6IA 1L5MA 4OCZA 2NVOA 1UC8A 2YN0A 3E9EA 4PPYA 3VC2A 4BFSA 4E46A 4BTEA 1X7YB 3WBKA 3KTAA 3EVGA 1UXHA 4URUR 3TZEA 4OXXA 2V0CA 2DECA 3VR4D 5K3SA 1YRBA 4E4RA 3UCXA 3C87A 3ZY4A 1XRRA 3EFEA 2OCPA 3ESRA 1Z5WA 3RLFA 5KNCH 3AESA 3NHYA 1I9CA 3GU3A 1JXAA 1TDJA 4QM7A 2D5AA 2P6OA 3NOQA 4WN9B 4UDYX 5H7XA 2QM0A 4FONA 5KYYA 3GV0A 3L8HA 3JARB 1RJEA 3M6UA 2OKGA 4AG6A 4YY3B 4IOMA 4YMSA 4DSZA 4QRHA 2WP0A 2TYSB 2XQKA 3L1KA 3V33A 1XVAA 1JQ5A 2G71A 3I42A 2HXSA 3GLTA 4OP2A 3FJ1A 4HB4A 3G8CA 1RBQA 1XZDA 1C8VB 2D06A 3NGLA 3PF9A 3LUBA 4RA9A 2BGTA 5T57A 4G1BA 4JKOA 2BBOA 4JU9A 2GCEA 1RHJA 2ZSBA 1M6WA 1BFUA 4W1RA 5CW1A 3V34A 2PD3A 3I6MA 4A0HA 1JHRA 1D6JA 4QTZA 1EK5A 1WZCA 2R4TA 3D7MA 4YJ3B 4ZKEA 1KVSA 4JVOA 3RS2A 1TZBA 1UK7A 2B98A 4OEHA 3V4ZA 5IBCA 2BF4A 3FFTA 4MDFA 1IZ8A 1RMYA 1VZ2A 4K6FA 1E5VA 1BWQA 1KMHB 4ALKA 3E27A 2ACEA 2QS9A 3QMWA 3SE0A 4C0QC 1X1AA 2E21A 4BX8A 4QZVA 1AE1A 2CFTA 2B8WA 3SC4A 3ITNA 1RABA 2ZS8A 3N2YA 4F1WA 2KPOA 5AW7A 2O8BB 1OVMA 1R0XA 4KQEA 3CB2A 1C0KA 2BM9A 3FOZA 1Z18A 2DCUA 3NIDB 4PBRA 2PIDA 1RFGE 1AQNA 4RA6B 4W9NC 3OQOA 1I1NA 2GZHA 4GZMA 4BGIA 2R1VB 4H6WA 1IATA 2XDQB 3LY5A 2ZUTA 1QGUA 5BOSA 3ZWYA 1ZD1A 3GEPA 1K3FA 3MYYA 1NY6A 4WKCA 1OYVA 4ZDIA 3OKFA 4WMLA 4WERA 3IKTA 4UUMA 4C7OB 1G8KA 3I6YA 1AKWA 5EE0A 3AM5A 4TTPA 2G4VA 3ACDA 3QUBA 3FM9A 4YHBA 4NZ9A 2QBYB 1PFWA 4DNPA 1C9NA 5B30A 1O97C 1SBNE 4B6QA 4MUNA 4FX5A 2MYUA 3AOGA 3IVGA 2C84A 2GBFA 3VR4H 4AXBA 1G21A 1NP3A 3DEAA 3E1SA 3SN6A 2V96A 3LWBA 2VT6A 4TKUA 2WWTA 1YZHA 3TW0A 1WUJS 1COWA 1CZHA 1X7ZB 2DBVO 2BFAA 3HKDB 1P2DA 3RRFA 2FSVA 3TL2A 2WNIA 2Z1NA 2LPMA 1ZOIA 3A3KA 5JQGF 1ZIDA 2RCYA 2H3HA 2RHHA 4LYDA 5FLEX 4BX3A 4DUPA 1NN5A 3KOMA 4MQ4A 4OHKA 2H7VA 4MICA 5GQSA 3TPCA 1A9SA 3HCFA 4EVQA 3HBLA 3UOWA 2GTPA 5B36A 2FSVC 4LDRA 1GYPA 3DTVB 4CV1A 1F20A 2C92A 2O5VA 3O75A 4J2HA 2OM2A 2XAUA 1HDOA 4TT8A 4CL0A 5DCLA 3MT8A 1JUDA 2QHXA 4UVEA 4EO7A 3FJOA 4RXTA 1OB5A 3PKZA 2X22A 2HAEA 5IVDA 2V6JA 2FG6C 1VFPA 3GH3A 3P2EA 3ER9A 2VWHA 4IOJA 2HHLA 4K6HA 4J2TA 1E0SA 5AXAA 3JQ9A 4G2NA 4ZDWA 2OGUA 2VQDA 4X7BA 3ZWKA 2IF0A 3VZRA 3IDZA 4G4SP 3V1KA 4JP3A 4L5CA 1ZSVA 4TQUS 4MKGA 3QVXA 1SQ5A 4N18A 3LC1O 4MCHA 2FZGA 3ENKA 4WBSA 3ZWOA 1I30A 4Y6GB 3T1NA 3S8MA 3AL2A 4OK3A 3TQIA 3WLQA 2VSFA 2GZSA 5AVUA 1ORRA 1USWA 2FLVA 3D5EA 2DR2A 1ULTA 3QYFA 4V1CI 1RXYA 4ECAA 3R4VA 4IGKA 4RNCA 1ZINA 1J07A 1E5XA 1TD9A 1ECBA 1W1UA 1C7ZA 1UM9B 2E85A 2YMQA 4GHWA 4NK4A 1O6ZA 3SSNA 2ZTHA 3WYDA 4B3BA 1T8SA 2QYTA 2JK1A 2J0VA 3LKVA 1UDRA 1C8LA 1XD2A 2X76A 5CDHA 4Z4IA 5P21A 4AUKA 4HLUC 3DL4A 4B46A 4F4FA 3INTA 2FB9A 1U4SA 2KB0A 2AHRA 2RDMA 3QNUA 2AF4C 5CK5A 5JPIA 3S1SA 4HSEA 3RJ9A 4Q4JB 2H9YA 4NS1A 3O92A 2GPWA 2G28A 4Y30A 5G3ZA 1Y1KE 5E2AA 2O8NA 2BGKA 2BI4A 1IDOA 3Q41A 5JAUA 1I32A 1MV8A 2DQ4A 1GYRA 3KLNA 4QDUA 5KOHB 5EN4A 1EAYA 2IIBA 3WKAA 1S8FA 3AKEA 1XFDA 2WWRA 4QSMA 4XWAA 4PINA 5TGZA 3OOYA 1CT9A 3TSAA 3BEDA 2BM0A 5EJEA 5LXTB 3SYNA 4GXRA 5IW8A 3ZWMA 4E14A 3W06A 4BV9A 1L4NA 1I80A 4IH1A 3QKTA 4HRAA 5CT9A 4TM7A 2HXYA 2HB6A 1SA0A 2P7HA 2LD4A 1LNZA 1BCSA 4QUEA 1NUPA 1G20A 4XCVA 1DFIA 2IPNA 3D3EA 3OD5A 5FKJA 1XJ5A 1YZYA 1RJFA 4X8MA 2VRWA 1LPOA 3C5WP 4FI3F 1K6MA 4Q3LA 2FEWB 5DHTA 4OAQA 4CDMA 2BGUA 3UWMA 4ZXFA 2WIAA 2DQYA 2FK7A 5EQDA 4EAAA 1U4NA 1ULHA 5FWXB 1SVSA 1R4NB 1YS2X 2I8CA 3VX4A 3X43A 2XCTB 3TKLA 5L6LB 4W82A 3B52X 4FYYA 1ZD2P 2IYVA 1SNYA 4UUAA 1BXZA 3CSSA 2AJLI 1P9LA 4DT1B 3M5PA 1YJCA 4UUPA 4X6YA 1AH2A 4JLDA 4H3VA 3FFWA 2HMUA 1Z6AA 2D5LA 2PCLA 1C9EA 2XNDD 1Z4LA 2E4UA 1NVKA 1BEEA 3LUKA 3Q3IA 2GWRA 4WBNF 4BP8A 1R2QA 1YIAA 2WF9A 2ZAGA 1J97A 2FEOA 1KP9A 4K3UA 2FE1A 3OO1A 1IIBA 2GI4A 2NU7B 1T5DX 1LBTA 3FNEA 5JDIA 2AZ4A 3N8NA 1JKFA 4FLFA 3B38A 2PXCA 3UJAA 3U16A 1OU0A 4RSRA 2QAJA 1VGRA 3WSTA 3GP5A 4MI1A 1YVEI 1O9GA 4L75A 1AUVA 2FN9A 4RPKA 1QMPA 1FC0A 1IG3A 4Z1MD 5K6RA 3IAAA 1GKYA 3QXCA 1YDMA 1ATZA 3R2JA 5FOSA 2ET6A 2MYTA 5HKLA 2HWXA 4F56A 1MTOA 2D62A 1Z5ZA 5UKDA 1XQ9A 3WMEA 1ETUA 4AJEA 5LLDA 2QDXA 4HK4A 4K9KA 3OEYA 4UDOA 3DZFA 3SPXA 2ASVA 2B8JA 2ZBVA 4M8IA 4O4LF 4O8ZA 4S12A 4DWWA 1P0MA 3HP4A 2V7XA 1Y48E 3HG7A 1YQUA 4C2AA 3SD7A 4BB9A 2CLLB 2NU8B 3E9CA 4HAOA 2XMRA 4TUYB 4RTKA 2IS1A 2FPGB 1ZSYA 1HPLA 3IPCA 1WMBA 3CWCA 4FN5A 4GLJA 2ZBUA 4CMCA 5IAOA 4GMXA 1YK0A 4X61A 4R0MA 2RONA 3CTPA 4MUJA 1ZGBA 1W52X 2CK3D 1BGVA 3C3AA 1WUTA 4ARCA 5H0IA 3ZS8A 5BWCA 1IK6A 4LHZA 3TDMA 1Q0ZA 1SBYA 1TJ3A 2AQIA 1SD5A 2ZUSA 4HXFB 1P7YA 5CX4A 2OGWA 2O2IA 1FMCA 2WYOA 3PQ6A 5JCJA 3WKEA 4R9SA 3RSFA 1DC8A 4YRSA 4GSLA 5LU9A 4R1QA 2FVYA 4I1VA 4JFRA 3WHLA 4C0XA 1PDWA 3E82A 1FYDA 3KSBC 4BE4A 1E9DA 1T6BY 3BK1A 3VKGA 4TQGA 1YQGA 2HQBA 3UJ8A 3GRUA 1D4OA 4Y2JA 5HS6A 4BVLA 4CV0A 4G3XA 3BTVA 3O3NB 4C07A 3PQ3A 5EVJA 3MWJA 4RE5A 5IVIA 3G8DA 3OEHA 1FMLA 1HSZA 4FGSA 4HV4A 1BWPA 1MA0A 1O54A 4JJAA 4UD6A 2JBAB 2DHQA 1XTBA 1AXGA 1ZHFA 3BBLA 3CMMA 1IVNA 2FPPA 1CD5A 3NBQA 4X91A 5G0TA 1WZEA 3DCYA 5KX5F 1W36B 4Y7DA 4DV4B 1D9ZA 1ZSNA 3CZ4A 4KGZA 2PV0A 4XGIA 4GSKA 3ZJ5A 1L5QA 4IFEA 2BEUB 4KRXA 2NMVA 4PG6A 4WJKB 2P4SA 4ZU1X 1U7XA 3R3ZA 3UW3A 4AMZA 1Y8QA 3RJZA 4JQOA 3VR6D 4EGSA 4GPZA 1RRPA 1A8SA 1RYEA 4UVIA 5JAZA 2RGYA 3QUQA 4ZRMA 5JY1A 4B3MB 2HF8A 3I04A 3BGSA 1QFMA 2VHQA 3D7NA 4XM1A 1GADO 2VYQA 3GNQA 4MVJF 1MLDA 1KE1A 2NACA 1P18A 1U3WA 4FYKA 4RENA 5FPYA 5KJCA 5K0BA 4QJ5A 5DULA 4WZBE 2O2YA 2WSIA 4RANA 2QLJA 3RDPA 2ATIA 4CMBA 3HZHA 4RACA 2GEVA 3BF7A 2C98A 4QBGB 5GGXA 4ZZ0A 2G9UA 1IZZA 1X7WA 3OJCA 5EP3A 1WXHA 5CDTA 3V1YA 1BMFA 5E38A 1T0UA 3X44A 3V4SA 3KL4A 4GZ3A 3O8DA 4DVGA 4U9HS 4BQFA 2RB4A 4YJGB 1N33B 4KUHA 2C99A 2HU5A 3NWBA 5JWOA 2QENA 4U2CA 2I78A 1A9XB 1JG7A 3PVCA 4XCXA 2PLNA 4QXAA 1R0WA 1X7GA 3PD1A 4GKBA 3F74A 2J9FB 4N49A 2D13A 1GL6A 4Q39A 4YMUA 3T9DA 2LIVA 2EKDA 3R9XA 5EYPA 5LMZA 3NKVA 2PLRA 4K9SA 4G5OA 4R8SA 2GKGA 1NIPA 4N3AA 4CV3A 2XWJI 4XEHA 2XUGA 3L6BA 3CLTC 2IUUA 4X3PA 1VPWA 2AYZA 3BD8A 3JWGA 3CH7A 3GCZA 4P8RA 5NLLA 4CLEA 3HJAA 2JFZA 1ST2A 3H0EA 1T1JA 4Y3UA 4XYMA 2OCXA 2VIIA 3PA6A 3ETHA 3ZGOA 2A0XA 4M9QA 3C1AA 5HQJA 2Q4DA 5FNZA 3ROEA 2YXEA 5LOVF 1S8AA 3DT8A 4I4IA 4BV8A 5L3SA 1JYFA 3EAQA 1CJKC 5I7EA 2CHFA 4L8WB 2QSJA 3OSUA 2FW7A 3DOFA 5HIAA 4CEJA 1OU4A 5EMLA 2AQKA 3IP3A 1ZLXA 2FPXA 4FNAA 4AP5A 1IQ0A 4HPJB 1HMPA 2XZDA 4K46A 4EJ6A 2ZSHA 2JFWA 4RL6A 1QHEA 4B35A 3A1UA 5SY6A 1E5QA 1X8XA 2I3AA 3A9UA 3B8EA 3FCYA 5K0TA 2XB2A 3KJXA 4INJA 1K98A 2V7UA 2ZI4A 3HVJA 3GB9A 1N5LA 2OO3A 4UCFA 3KKMA 2XTZA 3Q7RA 3VOAA 2ID8A 2P1RA 4LSGA 3N2KA 3CS3A 1ABFA 1H2XA 5LYJB 4EJ0A 3AONB 3PDJA 4MQEA 4IQFA 3HEMA 4D9KA 3DULA 2YQZA 3D7KA 4FQ5A 2WAOA 1N6NA 1DO0A 2XMCA 3WGHA 5BSVA 4G0WA 3BFKA 1LPMA 1VKZA 3B3QA 3ICOA 2BHTA 4LW8A 4MCJA 5IAAA 1MDFA 1D09A 4V03A 3OQVA 3PXUA 1AF4A 4JL6A 2HRRA 3GQBB 3BGWA 1A9OA 1C5KA 2VK2A 3DE1X 4MVJD 4EG8A 4D1YA 2UUBB 4KN5A 4J3JA 3SDSA 4WY8A 5DYGA 2YY6A 1XQ1A 3A1NA 3I9OA 4FYPA 4KYVA 1S01A 3CKLA 3MN1A 5SZJA 3IR5A 1XT6A 2JD2A 5ITZB 4XX0A 4CLDA 2PKWA 5HMMA 1WOMA 3TNLA 4XOIA 2BZ0A 4ZEOA 2QLBA 4EW6A 3HCNA 1DTWB 4P2BA 1RD4A 1NWCA 2HTFA 1W8IA 2YJ3A 2BL4A 3NCTA 3W3AH 2DG2A 3FSJX 3U31A 4AF8A 1DGQA 4DQKA 3VH4A 2V9ZA 1TQHA 3KPWA 4S2EA 1QE3A 1TCAA 1UFRA 5A9TA 5JZBA 2YWEA 3A2MA 1KY2A 1M5RA 2B5VA 5T6MA 3K70B 1CB0A 1EZ4A 4MQFA 2B7LA 1IN7A 1UJ6A 1CC1S 2GILA 1ZGAA 2WJHA 4MS4A 4MR8A 5IXSA 4AJOA 4BKOA 1OH7A 2GBPA 3RYHA 4C3VA 4IUBS 4KXMA 5I51A 5HCUA 5FF9A 3HFSA 4JP5A 2H52A 3OP4A 4RABA 2G0AA 2YW9A 2ZAMA 1RLUA 1FUKA 5HOEA 2R84A 3P2IA 3AV3A 4DG5A 4HLUA 1T0IA 4KQXA 1EE1A 2VZ9A 5FTWA 1RBZA 1W49A 2F2TA 1EX9A 2OMEA 4KL8S 4WK6A 4ZVRA 1QQBA 4ND2A 5T7BA 3QX3A 1K08A 4J0QA 2BHLA 4E08A 4E2YA 4PX9A 1U9IC 1SCKA 4HWOA 1EWYA 2GN0A 1PV2A 3B53X 3Q2KA 4G63A 4LV6A 4TVKA 5KNCA 1SKAA 5AM2A 4H18A 3L4BA 1W6RA 4F04A 3F47A 3OQBA 2GBLC 5DNWA 2PZ8A 3IEUA 4UZFA 2OV2A 1HBJA 5L4LA 4AO8A 2X0NA 2AOTB 2WJYA 3DE0X 3LCUA 4BPRA 4E13A 1D0VA 1XK6A 2AR9A 2RC5A 2XJ4A 4L74A 4RO0A 5BUZA 3CXRA 2QD4A 1E9EA 1XU7A 2QZSA 4IDBA 5CG1A 4G5RA 1YZGA 1A88A 3REOA 1DOAA 1ORVA 1LLDA 1GRRA 4PCAA 4J3NA 3RSLA 3ZK7A 4L9RA 4ER7A 1RXWA 4FWBA 5FCDA 3IODA 4UXHA 3SJ7A 1DV1A 3N5KA 1C1XA 2GESA 4G5HA 2EATA 2C7OA 3JQ8B 4KKVA 4IXNA 1U2RA 4LYEA 3TRDA 3PEUA 5DE3A 5JVDF 1XBTA 2WKSA 2B2CA 3GPDG 1JQEA 4D6XA 2FV8A 2VQ6A 3UAGA 3DT9A 1GZUA 3HADA 2R8ZA 2JFBA 4N8DA 4JT9A 4Z1MA 1QRUA 4BBAA 2ZJ5A 5CT5A 3QNWA 1TUBA 1TZ2A 3K09A 1YL6A 2HA4A 1N2ZA 1FVHA 5E7MA 1D5WA 4CMEA 4F6LA 2PO7A 5K6AC 4GOND 3NNSA 1N7HA 5DW0A 1NX6A 1YU9A 2O7VA 3LL7A 3UHFA 4AKTA 3PNVA 3TGWA 2VDJA 3V7YA 3UAOA 4JI2B 5F1KA 2XVAA 2AMFA 4AO7A 3EAFA 3VPCA 1V47A 4FSXA 4RVFA 3G59A 2PEYA 2OENG 3FIJA 3GN1A 1ZISA 3EF0A 3IVRA 3AHIA 2RJNA 1E7QA 4TSFA 5CK4A 3N8HA 4KQIA 3CZMA 2R5NA 3UFBA 4BDSA 2DXIA 1CY7A 4PSDA 1AVTA 2V59A 4BZQA 2ZRKA 4KU4A 2C4KA 2P79A 1WRBA 4DDUA 3TR6A 5D3QA 4I50F 4QE3A 3S81A 1ZUNA 3JZMA 4X54A 5HX7A 4J0HA 1CZUA 1S2IA 2PL3A 2W8ZA 3C8ZA 1Q6YA 1J1IA 3KJQA 5IK2A 4TXMA 1PGQA 1YOVB 4FC6A 3TSYA 3ZY5A 4CGYA 4YRMA 1ZR2A 2V6FA 4EG0A 1YDEA 1AKMA 1SWVA 1Z6YA 3N2NA 2WV7A 1UOOA 4I99A 5EIWA 2IOYA 2ACVA 2DWPA 3LF1A 2H5EA 3N0VA 1DAGA 1KIMA 1JJVA 1VE9A 4CNQA 5JMWA 4OJTA 5KEIA 3GQVA 1I4LD 3HNPA 1M2HA 1K5PA 3P96A 1W47A 4R31A 4C22A 4NWIA 3KPUA 4B9AA 4EPXA 3KQVA 3OIUA 1X7HA 4I1OA 3STUA 3O8BA 4TRJA 3O3CA 1JBQA 2EG5A 4ZQHA 3STXA 4PFJA 1EVQA 2VK4A 1LBIA 3H42B 3BHNA 3L1JA 3ZE1B 1XP5A 3MT0A 4DRXA 1SVUA 1EH5A 1NI4B 4HRVA 1F2TB 3VDNB 1LLUA 1G5PA 4RZ3A 1V11A 3IP6A 5HOQA 3MT7A 1RAEA 3MUFA 2RHCA 3DLHA 4LXHA 2QMYA 1HMYA 1FP6A 4WBNB 3JQGA 4DRXB 1M9NA 5E6SA 1W4BA 1C0LA 3K53A 3IO3A 4LX0A 1FQOA 4TKLA 1JN0A 3TJRA 3WWYA 5EMHA 3RVSA 4GFDA 1QAOA 3IKVA 4FYXA 3IR7A 4IV8A 3U44B 3AM3A 3RC3A 4ER0A 5FH9A 3LUPA 4AG3A 3LPDA 3RSSA 3ND9A 3VYVA 3N2GA 4DBLC 1W88A 2H1LA 3KHTA 5GOZA 2Q1YA 4RETA 3RNOA 5DHPA 1SJ9A 3RVQA 2WF6A 5C8XA 2SNIE 3NEAA 1AGRA 2YIJA 5G0VA 3WL5A 7ABPA 1FPMA 5C9ZA 1UADA 1XN4A 4QU8A 1C2YA 1R6XA 4TMYA 5CEEA 3OT1B 2XTNA 3W8NA 5K3EA 3ZVNA 2QN1A 5D7BA 4D3ZA 1V1MB 2FPLA 1WTCA 5JO9A 3B48A 4XUEA 2IV7A 4BB0A 2A9JA 4GAEA 1ZHHA 4GL2A 2GKOA 3JRWA 4S04A 4XWTA 3TTYA 5JCJD 1GGEA 3ZWBA 1M8FA 2PQ2A 1GZ3A 3RTAA 4WJLA 1EXDA 4CIBA 1J9ZA 4FW8A 3IBCA 1WJGA 1CSEE 3EB9A 3PYMA 3TZBA 4E1BA 1ZDMA 2GJKA 4QT4A 4Q4LA 3GRRA 1GCUA 2AVDA 3KALA 1YRWA 5I5GA 5K3CA 1FLNA 3W6PA 4AYTA 2JLVA 1BW9B 1X8KA 3W7VA 1RQGA 1FUUA 2VYVA 1NC3A 4U2KA 5FNVF 5B3JA 1XZ8A 5FTMA 3TRJA 2BONA 4Z0PA 4AMBA 3CX4A 2IBMA 1VJ5A 2VZLA 1Y4DE 4P0QB 3VUEA 4Y2YA 2HF2A 1IYZA 1MVLA 3ESXA 1UMCB 1GL3A 3ZDRA 4CQNA 4YP1A 1UC5B 2P9GA 2O52A 1TVCA 2VAXA 3VHRA 2QPTA 2VPWA 2GMWA 3JQ8A 3D8RA 3CPSA 3ZWCA 3RIMA 4M9XA 5CVEA 2ZAYA 3AHJA 1DEHA 1T6XA 3NALA 1FMJA 4P7FA 3TEMA 3D4NA 2DUNA 4K9RA 4ZU6X 4HEA6 2HEGA 3GLFB 5ELLA 4OX9Y 1YVDA 4HQKA 4XDHA 1V1RB 1XHLA 3GMDA 5SZIA 3O8RA 1JG4A 1AKVA 1AB5A 3WHPA 2DLCX 1B8PA 3FLAA 3PSHA 1UK6A 3BDVA 4RLHA 4AS1A 1JFLA 1OX6A 1R0CA 1EGMB 3BB4A 3CIOA 1GQFA 4ED9A 5D5HA 1UDWA 3AX6A 4YRJA 1U9CA 2XMQA 2YYZA 4XI9A 2W43A 3OZDA 4LGMA 2X13A 2GBLA 3NBMA 1IY2A 1GUDA 1J0CA 3M6FA 2VHXA 4MV6A 4A2WA 5IKMA 1T25A 4XB6B 5KQLA 1LS1A 4HP8A 4DV3B 2A1TR 3K73O 2ADMA 3ICEA 1VL5A 3RSGA 3U4CA 2ASEA 2XA9A 3SP1A 1N0HA 4W5OA 4I1UA 4R1SA 1KQFA 3SIWA 1KJZA 2C2YA 2W2OA 1B1AA 1Y1SA 3EZNA 1KH2A 1DI0A 1XJ0A 4DA4A 4XW2A 1ZX1A 1ODJA 1PJZA 1SK9A 3PI7A 3TM4A 3DD5A 3V4RA 2ZUDA 2OPHA 1PZHA 1VA5A 2MOKA 1WP9A 2RI0A 5EIFA 4BE9A 1P1RA 4QBTA 3AVXA 4RMHA 3QI2A 1L4UA 1SVKA 2HIMA 3W9SA 2NZWA 3IGFA 3H87A 4PXAA 1B73A 4E33A 1QK3A 1CNEA 4HKTA 4JEMA 3E4CA 1M6EX 1YVRA 3PEVA 3PUWA 3HA3A 1RCFA 4L50A 4QHYA 5A4FS 1SD1A 1ZK1A 2WRZA 2ZS7A 4RK1A 5FBWB 1FFCA 4CMEC 3T7SA 3NVKI 3LNTA 5H8WA 3FHLA 4BVFA 5FWXA 1S1CA 5A4MS 1TW2A 1T5SA 3FSRA 1CUIA 4UCXA 1QE5A 2Q9CA 1FLDA 4XDGA 4K81B 1L1RA 3CSDA 1E9VA 1LJLA 3KYDB 5ITZA 4MW5A 5A4AA 2W83A 1FLAA 4L28A 1VDZA 4MI6A 3LKZA 2WAAA 4L8GA 3FA2A 2YFQA 3G2HA 2YZ7A 5AJVB 4CU2A 4M7PA 2I99A 1VJDA 3KQQA 4J4BA 1ZD4A 1M2WA 3B6JA 4IMIB 5JQGB 1UAYA 3D02A 2AHOA 1N0VC 3JASB 4FC7A 5JHGB 1PWYE 4QASA 3CH5A 3K5WA 4Y0AA 4E5PA 1M1XB 2O2JA 2KMLA 4KUGA 4EABA 3K15A 5DH9A 3KB6A 3C6XA 3WFJA 3UXEA 2AC7A 1P77A 1Y9JA 3FAKA 3SJZA 3F6BX 3HDGA 1ACLA 2GDJA 2J0EA 4I8XA 4Q7JB 1KYQA 2VO1A 3WZ2A 4KN9S 3SHVA 5M7EA 3G5AA 2JGLA 4RY2A 4ZHQF 2JFGA 1EB9A 3NVDA 1YS1X 4QLBA 5CXQA 1Q1NA 3V2IA 1JVSA 4EITA 3JQAB 4YRKA 3UPUA 4I9FA 3GP3A 5JYBA 1W4LA 2DHDA 3D6NB 3G5TA 3RU2A 1JBKA 3DMYA 3T5DA 5BW4A 1JHUA 4FFPA 3LTEA 5LIPA 2CL6X 4YP0A 4ZT5A 4D74A 2D5CA 3BXGA 4ZQBA 5HRUA 3JYHA 3UK1A 1NW8A 1C41A 2IEBA 5HIIA 1UM9A 1U3VA 3OBIA 3GO4A 3P9IA 2ZJFA 3PUKA 4EW2A 1E8NA 4MUIA 1NN0A 1U2ZA 4EPRA 1W87A 1IHOA 3A3OA 1OKKD 1Z6ZA 1DIBA 2ZWAA 3NHFA 5DM1A 4GI5A 4X20B 4ACBA 1ZUHA 5JAIA 1P5FA 4Q4HA 5AJZA 1N5OX 1TZMA 1UP7A 1ZVJA 2WJAA 4RV5A 5G3YA 5AXBA 2PEZA 1M1YA 4OQMA 4UEKA 4M37A 3OHSX 1OIXA 4CETA 1YFZA 1NFQA 3CLUD 5EP2A 3MINB 5F35A 5LNK1 3FIUA 4BBJA 4DIFA 3TWOA 2Z6UA 3G0GA 4DXHA 4OJKA 3CVWA 4I8DA 3GCXA 2BH9A 2MSEB 4MJXA 4UCQA 4LXUA 4CT0A 4NG4A 2XMDA 4ZYUA 4W7IA 2QM7A 4YRTA 1ZONA 2AXQA 1KQPA 1ZK2A 3LQFA 3FMGA 1GGVA 3JD2A 2PWPA 5LLSA 5EPOA 2FR0A 3KZNA 1G19A 2AE2A 4OKIA 3S2FA 5KB3A 3P5SA 4A15A 3AR6A 5KPDA 2RGBA 4WNYA 5ICCA 1JDVA 2JFFA 1BQ4A 2WUEA 3ABIA 5EFOA 3A6HA 1V8BA 3TVYA 1LDYA 3N7AA 2V5AA 2Y0BA 5J2UB 1OGYA 5CLJA 3ZD6A 1QWOA 1N9KA 2EKLA 3PS9A 1R0SA 4GKJB 4Y1FA 4NAHA 1ISJA 5FHRA 1PSDA 3S2UA 4RGBA 1JSXA 3QYAA 3TXYA 4PLHA 4OUDB 4H6VA 3S55A 3D7RA 3E03A 3ZGLA 1DAHA 1KI6A 4CTJA 2HWWA 4DZTA 4E09A 1UQUA 1Z68A 5HR5A 4D8UA 4UU1A 4JQYA 1U28A 2GK6A 1JFFB 2IGBA 2W11A 3R5TA 1R9GA 3TOSA 3TIFA 1N5MA 1TCBA 3GEHA 3GLIE 1CUGA 1QG0A 3VM6A 1PLJA 4LQCA 4M0MA 3OTIA 5DU2A 1VHDA 2HQ1A 1S2DA 3W6NA 4CN8A 1NDQA 5BV8A 2WLSA 5AKYA 1GCOA 2WVHA 2JEYA 4BRWA 2C5HA 3UATA 4PYOA 3ZXIA 2V7QA 3D5QA 3NAMA 1ICEA 2CCKA 3T1HB 1WF6A 2ZIEA 3E8XA 3K8ZA 5FOWA 4AU1A 5T8KA 4HVLA 3IHKA 5CGZA 4FDUA 1CFZA 2P9ZA 2R8EA 3G9UA 2X8JB 1N2CE 3HY4A 1KTIA 3H2JA 3IE2A 5IWCA 1JYSA 3FF4A 1ZM3A 4HFRA 3OPQA 1TRKA 2BM1A 3CB4A 3Q72A 4PGAA 4QAJA 4U7FA 5F23A 5LMCA 1QZZA 2B6NA 5A9RA 1GY8A 4KFRA 3AUKA 1A7AA 5C51B 1QRSA 4CIYA 3N2LA 2IS6A 5LQKA 4RULA 3ORFA 1XTQA 1VCIA 4GGMX 2C3PA 1QONA 1EM8B 1J8FA 2R79A 3ESZA 5SV2A 1SELA 4IMRA 3U3XA 5CA1F 1P1BA 1YQXA 3N1UA 4LF8B 2PSEA 3IBFA 3IDFA 2GPBA 5JYDA 3ZNPA 4FE7A 4HEHA 2QRVB 1K7YA 2RARA 4RF5A 4GMDA 3NANA 3WV5A 5GY7A 2GT1A 3FRHA 5EJ5A 4GX1A 2QYHA 3AIMA 1UMDB 5FEUA 3NNNA 2INGX 2IP4A 3LY7A 1ECFA 4N4AA 3P71T 4QL3A 5I7RA 3BMNB 3DEJA 3L0YA 4MRAA 1LW7A 1Y7IA 2VJOA 4JEHA 3GPIA 5JD3A 2J85A 3I76A 4KQ1A 4NZPA 4DEVA 1SXIA 5D6NA 3I0MA 4N76A 3QXGA 5LQCA 3KFLA 2ZIXB 3RFCA 4C4YA 2QLFA 3IVMA 3K0AB 1OXMA 3AESB 2GN4A 3HCDA 3NI2A 3VYSB 3VNSA 3QU2A 4OFXA 3O2JA 4TWIA 5HIJA 1PFKA 1YJ8A 1D3AA 2E55A 3STYA 4NDAA 4CQMD 2C3OA 4EJFA 3ORSA 4OAOA 2C4VA 4MYTA 2IOFA 4II3A 1UT8A 2HV8A 3PDHA 4PN3A 5DEIA 4HFMA 3F6EX 4GI1A 3IAUA 2JA2A 3QE4A 4Q9LA 2R11A 4REOA 3D4PA 3ZCQA 2WU1A 1E2UA 2VDLB 3W1EA 1GQYA 3M82A 2ZRAA 2ZWIA 1D2RA 1OWPA 2J3KA 1NSYA 3N8KA 4XOUA 2VXBA 1Q0PA 4GIBA 3CKKA 3LP8A 3KVYA 1O94C 1YRYE 2RHJA 4ISBA 4MGZR 2C97A 4IX9A 1D6MA 2FOLA 2HRQA 4NV3A 3W9BA 1Z56C 2ZRLA 5KJFA 3IEPA 3B5EA 4OXKA 4I50A 2DEUA 2Q62A 4FYVA 1BW9A 2VLBA 4J07A 3HXQA 2I9KA 3T1VA 4DJAA 2NADA 2ZZNA 2ZJAA 2YASA 1OH6A 2OQIA 3IVAA 1QJCA 1ITZA 5KU7A 2PX5A 1UBNA 4NC9A 3KTAB 2A5JA 1QK4A 4IDCA 3K6SB 3BH6A 3CU5A 4L2IA 1MX1A 2HHHB 3V7WA 2Z4TA 1YB6A 1F60A 2C9CA 1P8JA 1DKPA 4DXAA 1ZOPA 1H3EA 3DZHA 2QXTA 4MJLA 3VNAA 4KPGA 1JXMA 1OFVA 1P9NA 5DYYA 1IHXA 3E3NA 4M1WA 2X9QA 2YWBA 3N2EA 3OZIA 2CLFB 1DC5A 5ANRB 2OO5A 3CSUA 4INZA 4MYSA 1OH5A 5GONA 1JR3E 1SD2A 4LHSA 2J0SA 5ICGA 5ITVA 1U8XX 3EWAA 2IYSA 3DSRA 3HJRA 3L49A 4OSOA 4TTSA 5GVRA 4MAAA 2I1WA 1E2FA 2OHOA 3LP5A 1BMDA 3RANA 1VE1A 4WCFB 1XLTA 4GRDA 3IQZA 4K9NA 3TW8A 4WCFC 1IJEA 3BCRA 2BUCA 3I2YX 1JQBA 2V6IA 2B9EA 2F17A 4L76A 4RJLA 1B6TA 4B75A 3U44A 4GR9A 5LZ8A 3E8MA 1FYVA 2UYQA 3I1JA 3P0HA 5A6SB 3BM5A 3KP1A 1C7EA 4F1JA 5KTNA 3NEJA 3H2BA 2YFHA 4F5ZA 1NF2A 3LZDA 3Q3EA 4WZAA 4BRZA 5HILA 1KSFX 4KV7A 5E7IA 3U3JA 3JQGB 2C5AA 2DCMA 1HZZC 3BREA 4KE9A 3FPGA 3K3PA 4L4RA 3QE9Y 2ODPA 3AWIA 2QI9C 2BOVA 3BK2A 3VPFA 1NI3A 5FFFA 1Y8AA 4AG5A 3TSOA 1REQB 2RIRA 1BJKA 2PPVA 1YNSA 3OLCX 4JVNA 2BMEA 3UA3A 3ZK8A 4D8VA 1ID8A 1SVIA 5DX0A 1K7XB 5KYKA 3S99A 3EDOA 3HZOA 1JHDA 2NG1A 3IURA 4MQLA 1AMOA 3L0SA 4ZMSA 1RE0A 1Z07A 3RTDA 1LEHA 1WXDA 3A25A 3FNIA 3NB0A 4TQAA 3R0IA 4HBZA 1GSHA 3GGJA 1P3Y1 2BUAA 1YU6A 3DB1A 3QWHA 3WTBA 3EXEA 1PP4A 2R5WA 4UM5A 5LYJA 3L7JA 3OOSA 3P8ZA 1VQ1A 3IMEA 5CH3A 4QUIA 4ZD6A 5AI6A 5TQVA 3GA0A 3WLOA 3LDAA 2WIGA 3UZUA 1NT4A 4O4IF 2HGSA 1X3LA 3LD9A 2FMXA 1GLNA 1PZEA 3DV0B 4LRUA 5FR1A 1FSGA 2ZOSA 4AJ2A 2VA8A 4R1NA 5JV5A 3EH2A 2J3JA 2FMKA 2AXNA 3QU7A 4H0FA 3RG2A 1YOVA 2PBRA 2WJVA 3E3LA 5JD6A 1S2GA 1GTZA 1PZGA 1SPBS 2JAHA 3LLUA 2YHAA 1MV5A 3PNYA 4FMPA 4NPAA 5K6TA 2J0UA 2QX6A 3DUFB 3UJNA 3E58A 3NEPX 2CLEB 1J2RA 4BMXA 1TGYA 4MWZA 1EQ2A 4JYZA 1UBEA 1GG8A 5AH0A 4ZEWA 3RG8A 1NV8A 3ETGA 3DVAA 5JEEA 1XDWA 4BGUA 3JAMA 1A95A 3RT7A 4GNKA 5BNWA 2E49A 1IRXA 2XF8A 5BOVA 1U0JA 5JSZB 2E37A 4D0LB 3PDCA 1HT2E 4RKFA 1V43A 4W1SA 4ZCLA 4OO3A 1UINA 1VP3A 4FVTA 3SBDA 1X1QA 3K5HA 3K9FC 3L05A 2H2WA 3HUEA 2Q1UA 5FUWA 3WOHA 4PZLA 2BLLA 4FPXA 5IAGA 4DABA 3EWNA 4EFLA 2PRYA 2RHRA 4B43A 4LHWA 1WVIA 2PT9A 3KZOA 1OT5A 1T9KA 1NW4A 2XDYA 3CH6A 2CXHA 2I6UA 2DY0A 2BJWA 3QLVA 5I7WA 1HE8B 3BIFA 4IVPA 3MRXA 1LRJA 5L3ZA 4BB6A 2UXBB 5HK8A 2PYZA 2PUEA 2GX6A 3MS4A 2H07A 3LRTA 1IN6A 1WZ2A 1ZRHA 4RVSA 5HGXA 2BGIA 4RFSA 2P4QA 4US2R 1AUOA 4HQNA 3GZTB 1V5IA 5EKSA 3S6JA 2O8DA 1U11A 4BO0A 5C8DA 2Q2OA 2FETA 3SF8A 3A36A 4LNHA 3OZRA 1COZA 1GA4A 2O3RA 1CJUC 3TIIA 1GCIA 3TW6A 3OLZA 2XDQA 3PGA1 5TX7A 4M1ZA 1E20A 2R2GA 5C3UA 2ABWA 2HQOA 3O8NA 3GGPA 1E3JA 2VNHA 1YRAA 2B6HA 5EXPA 2IXGA 3QPVA 4BBPA 3OI7A 3L7NA 4MKHA 4XPIA 4HGNA 1XR3A 3CVOA 3SYRA 4LEIA 3U2QA 1BE8A 2ZW9A 5JHHB 1IM2A 3OQNA 2O8BA 3P0EA 3IOBA 3L0IB 3AZOA 3LDUA 4G8JA 3PFBA 1V5GA 3B2NA 4Q3CA 1YXMA 2VEOA 2P90A 2Z98A 2PMKA 1J2YA 1A76A 1DV2A 3P9CA 1KMHA 1TKRA 5DDIP 5JAOA 4L3WA 2DWOA 5E0OA 2OBNA 3VAAA 2GH1A 5CGQB 3IHLA 4B3IA 4C4OA 4ZCMA 1Y34E 5HQ3A 4B3JA 4EA9A 1SUEA 4B6FA 1X1TA 3DDNA 2EFDB 1BEZA 5HCIA 4LYAA 1ISPA 2R6ZA 4F4DA 1W4CA 1XZQA 1UODA 1RHQA 1FDVA 1GTVA 2OE2A 2QDKA 1KXZA 3A9TA 3C4VA 3ZV7A 4PNZA 5IN4A 1LV8A 2LKCA 3L7AA 3R41A 3EVEA 2ECFA 1W59A 3FSGD 1XPRA 4AIRA 5EZ6B 4US0R 1Y42X 7REQA 5E1OA 2QL7A 2NYVA 2OCYC 3W5AA 4S2UA 3KLOA 4M0LA 3FVVA 4C5BA 3PTAA 1ZRMA 2D4HA 3O4JA 1SKUA 3DEYX 3IFSA 2I1VB 3SXPA 3WL3A 2OAQ1 5DWQA 3JQ7B 4E12A 1XZLA 2IKQA 4P93A 4YUYA 1IL0A 5F1YA 3PDUA 2Q8QA 4MX8A 5BQOA 1W85B 4BJ3A 1JDSA 3F7TA 3CX7A 4R84A 1LF0A 4WXPA 5DXJA 5BVHB 3GRAA 5EUMA 1IHYA 1WDKA 1CRLA 2ZQZA 3TVDA 1HLPA 1KS2A 1UEXC 1WG8A 1PGPA 2A5DA 1JIKA 3GJXC 4EMUA 1V71A 1RWKA 1P60A 2G80A 2HBRA 5HF8A 1XDDA 3L8FA 3Q9LA 3EG5A 5FUQA 4CKWB 5KSWB 1ONBA 2GXUA 4OHPA 3RIHA 2VYCA 4R7ZA 3SVZA 3LY8A 4FGJA 3W05A 3T1QA 5L4NA 1HKHA 3U3KA 4E30A 3H9QA 5C2JB 1KARA 3L0ZA 1G4HA 5DRYA 1NBHA 1DC7A 3H0KA 1QCDA 3Q9UA 1E0AA 4I5EA 2NM0A 4RHEA 5HE8A 2QT1A 1R16A 2P77A 2XE6A 3A7DA 3MJRA 3NASA 2VI5A 1BOOA 4RTPA 1OKKA 1FDOA 4DUGD 4ETIA 3E81A 2IPXA 3KWFA 4AUEA 4GVXA 4BZPA 1RTKA 2VH5R 4AKHA 2COKA 4N3GA 3IBTA 1PUXA 1E5DA 2OHFA 4BIIA 4URFA 1IQPA 4YRQA 1OZ0A 3VDQA 1N75A 1DT3A 1DO2A 2HK8A 2RHTA 4PHCA 1PRYA 2HBQA 3H5AA 3DDWA 2LZ0A 5FORA 4C7KA 4CLRA 1CUAA 3MF4A 2JVJA 3LVBA 2I2CA 4A6EA 3TOVA 5C5EA 3CISA 3TOZA 2B4KA 4LOIA 2JIZD 1P91A 1EFAA 3AG6A 2WWGA 5E8JA 1BKSB 3AHGA 3IXMA 3MK31 4Q3DA 3IV7A 4ZYZA 3DW1X 4JLKA 3W2GA 3S2IA 2HYDA 1TU3A 1ZVKA 3UMBA 1CG6A 1KBZA 2ZAOA 1ZRSA 3REQB 1FYFA 1W96A 4MARA 4Q1FA 4MVJG 3CPJB 2UZ4A 4QODA 4NMXB 3KR2A 1S9DA 5KJ1A 4P7JA 1YZ3A 5IJWA 3IQIX 2VRCA 3RAEC 3HBAA 3K2EA 3MG9A 4D45A 3IERA 4FZ3A 3B9QA 1A4RA 2H7YA 2AZMA 2JRLA 4WK0B 4Z7JA 3D3JA 3UC9A 3AR5A 4RHUA 4DHWA 4L9SA 4BQQA 4CDNA 2CYAA 4N5HX 4D4GA 4EFKA 5SYNA 3FOFC 4JD5A 1DC3A 2XVYA 1HQDA 1WPGA 1YZQA 1RYZA 1EZ1A 5TMDA 4HT3B 4IQGA 3JWPA 1CIVA 1G2PA 2IUEA 4HI0E 4GX2A 1IY9A 3QEOA 1MVNA 2VL7A 3N76A 4KQWA 2UYHA 1L7AA 4D4IA 1AZTA 1C3VA 1FW8A 2X86A 4BE7B 2ZYHA 4IIEA 4NY1A 4U2DA 5TRTA 1RC1A 1JH8A 2WG0A 5JS1A 4HQFA 2P9QA 2X0IA 3FZNA 3M6XA 1L5HA 4QSHA 1XCBA 3A7EA 3NBUA 4FYIA 3G2QA 5EC8A 3FNFA 1WZUA 4C0AC 1DFGA 2GFHA 3M1IA 3OFKA 1L1FA 2C9MA 1S3IA 1ZNYA 2PWBA 1GRCA 1D2GA 2OWEA 1E1YA 3A6KA 3H9GA 1J90A 1B93A 2ZATA 3RAGA 2R9VA 3AJAA 1P31A 1U8TA 5JAPA 5E9AA 1QTIA 3VAZA 4DR7B 4P0PB 1B4DA 2F48A 4QGAA 4CKBB 1DXQA 3Q11A 3I53A 2HEIA 3U1TA 1CV2A 1CQIB 3M4ZA 2QTWB 3Q6IA 3KEQA 1FBNA 2GRAA 4HDCA 3IUNA 1IQRA 4HOYA 2OQ2A 4DHEA 1G4AE 3PWKA 3KTFA 3QRWA 1AQIA 3WGJA 4AZVA 1US8A 3IA2A 4EHNA 4LF9B 2Q29A 1NSTA 2J45A 3ZHYA 1C7IA 2J07A 4G0QA 3TLZA 4YX9A 3LPCA 1KWKA 2ZXUA 1BDMA 2VTKA 3DFUA 2VJMA 4AF7A 5FA8A 3K94A 1UXOA 4S3MA 2WMNB 3HK2A 4YCBA 3T12A 2P0YA 3B6MA 2MMCA 3IUPA 2E4YA 4M1MA 1E1CB 2HIGA 1EPUA 3H5RA 1G8PA 3QXXA 4GGPA 4MA0A 4Q37A 1R12A 3ZHVA 4HXEB 2OR3A 5EZYB 4CM7A 3FRIA 3ESAA 2HIHA 1UR5A 3MOIA 4YO8A 2GFQA 4RLFA 3D54D 1UIMA 2AL7A 2OD2A 2PZKA 1M7HA 3Q8MA 3PFCA 4P4GA 3PJDA 3BN3A 3I64A 4HDKB 2GA8A 3ZX5A 2GQ0A 1ND6A 2YV2A 1DDGA 3DAFA 3R9KA 5DIFA 4I6GA 5A3RA 1D03A 2CXPA 1EZZA 4WXYB 2FRDA 5EIHA 3TFOA 5E3HA 3S2SA 4NBRA 4TWZA 3K1AB 4UUBA 4E2ZA 4A2QA 4KR6A 3C7AA 3LDGA 2A30A 3AETB 2QN7A 3AKZA 3T5BA 4O2AF 5K8LA 1BKDR 2FPIB 3ECCA 5IEBA 1UKVY 3TVTA 1T1EA 3L1IA 4JS0A 1H6BA 2L0XA 4XQGA 1HQCA 3SZRA 4B45A 4B6EA 5LUAA 3VPHA 1RU3A 5HTKA 3TIXB 3G1UA 4I3GA 1QVZA 1VBMA 3O4IA 4K86A 4LRWA 3UTDA 3W77A 5LP1A 4JI8B 2H2AA 2AFRA 3ZU5A 4OMFG 3R23A 1CUZA 2GYVA 3KBBA 4G5QA 1JI3A 1O58A 5CXUA 3A28A 1W1WA 2EKQA 4YJFB 3LPLA 1G5HA 2HMWA 3BWYA 2G0NA 4NCIA 4NNPA 1OROA 2IHYA 4YMGA 4GRAA 2AG1A 4LC1A 1BXGB 1XCLA 2I80A 4BNXA 4D3FA 5FPKA 5DHQA 5IZ4A 1NJFA 5DYNA 1JV2B 1MOQA 1WXIA 2F8SA 5ALHA 3GL9A 4C6SA 2EBHX 1EX1A 3BXEA 3E5MA 3MPOA 2Z6AA 1WDLA 2IU4A 4J1NA 4AKSA 1CNMA 1V35A 4YLEA 4CM8B 2X1HA 2A88A 4PLWA 5G0UA 5BV0A 2PWAA 4U5QA 4U3JB 1XZEA 1PL7A 3W3AD 2G17A 1G18A 1VXOA 4M89A 3EA4A 8ADHA 4LSWA 2NAPA 3OAAD 2YVLA 1DOHA 4YMWA 2GCOA 1PQUA 4DYVA 2PJUA 3JQFA 4N03A 1TAHA 4GYJA 1IZYA 4ZA2A 3SXUA 5EXEA 3OEWA 1U7PA 2C20A 1NP7A 4RKQA 1QVVA 4G0PA 4WH0A 1GPYA 3QNMA 221PA 4NRDA 3TLJA 3QBEA 2PY6A 1WKBA 3MWFA 2RK4A 3AL3A 3B9PA 1SU8A 3WMRA 2LTAA 2REOA 2VHEA 4QRIA 3QUCA 5LDGA 3SIXA 1ZZEA 4FXOA 3ZCRA 4ZHSA 1C3EA 1R4AA 2Y1CA 3R5SA 1KAHA 2PAFA 1RHMA 1WUHS 2F7SA 4JMLA 4AZTA 1E8DA 2FR1A 2VYFA 3DDCA 3MAGA 1QIHA 4OHRA 1U1EA 2AZTA 3T1OA 2FR8A 2QAIA 1XFAA 5TV2A 4NDZA 3IL2A 3ZDEA 1G8JA 2QTCA 2QRQA 2ZJ0A 1N6RA 3BMCB 3CVXA 1N2CA 3QOFA 1P7WA 4D43A 1IXRC 3FVTA 5DASA 2ZDQA 3NJ8A 2EX0A 1ZIPA 1WMFA 5IJ0A 1XDZA 2X77A 4TV8A 3RV3A 4OU5A 3ZE2B 1PGNA 2O50A 4O4HF 2UVDA 2R8XA 3M9LA 2V0GA 2PZEA 2GD1O 1S96A 3SYLA 1I4OA 1WZNA 3IOEA 3LE8A 4A91A 1E1RD 4Q9KA 4P0TA 4D92A 2JBHA 3Q4GA 4ZICA 4LZNA 1JLSA 2NTNA 3UB2A 1OOEA 2W2MA 1CYDA 1NAHA 1Q1ZA 3C3DA 3EZFA 4PZPA 5DGCA 4A0FA 4UOEA 1PG5A 1NG1A 5FR2A 2PANA 3IIKA 5JJCA 3WDSA 1UAGA 2PL5A 3R3WA 2QGZA 1RRGA 1CDZA 2V4MA 2B82A 2VRNA 3G6KA 2X9VA 5I9BA 4MLPA 4BNIA 3OWOA 1RHRA 1NC1A 1XZAA 3B9BA 4Q3KA 3TFQA 1TJNA 1UKZA 2QA5A 3TBHA 4PYJA 4ZAFA 3KOYA 1PF7E 4F06A 1VTKA 3B3FA 4DLRA 4FHGA 3I62A 3PQ7A 3Q5EA 4LAFA 3OOWA 4A3SA 5JNWA 4E6EA 2VZ0A 2WUFA 4IG9A 4KJZA 3CJQA 4LHXA 1Y3FE 5HGJA 4MLDA 2VDMB 3OCXA 4DMHA 1XEXB 3ISVA 3AIIA 4TXHA 4C9BA 4D3YA 4DSOA 3J7TA 3LW7A 2DSTA 3RRYA 3R7AA 1D1QA 3VDRA 3BJIC 3L6UA 3FTQA 2RAVA 3TQTA 4DNQA 1N2EA 4WFIA 1JHMA 3AM4A 4WZBB 3WIEA 3PE3A 4BHTA 4JN6B 2DPHA 3CRMA 1CS0A 4FGUA 1J2UA 1OVGA 1QBKC 3PJGA 1ZBQA 1G2OA 3W6ZA 1NJGA 2BW0A 3MIZA 3AEZA 3IAS6 4M7RA 3O26A 4DIMA 4R2LA 1IJBA 2YDXA 2QRPA 2IHUA 2HN9A 2YZGA 4R8MA 1Q3KA 3KSUA 5C5IA 2J4CA 3SG0A 4WNIA 1FFGA 3S1LA 3TSZA 3PENA 1Q92A 3V2GA 3VR6A 4QX6A 2QVXX 1Z8FA 4D7AA 5A5GA 2EP8A 5JPCA 1T3HA 3IP1A 2Z09A 4Q4CA 1USKA 2Q0SA 2I6XA 4EW1A 1VPEA 1HLFA 4Z0TA 3UWSA 2LV8A 3RK1A 4LJ7A 1ULUA 2Y99A 2JH8A 3SM3A 4CCSA 1T5IA 5GGYA 3UJDA 4CQLB 4LQDA 4LYGA 4F8YA 1AS2A 3H75A 3OQJA 4JYAB 1M54A 1SVNA 4RESA 3TTTA 2VTBA 3I5UA 3E9DA 4RWZA 2FPSA 1XI2A 1L4KA 3DCIA 3PWTA 4RUKA 4TVSA 1RR6A 3G2MA 4ARBA 2XEXA 5IANA 4YAIA 4P98A 1FNNA 4OF4A 4PZYA 5ALSA 1U7OA 2AX4A 1QGUB 3GY0A 4FQ7A 3H86A 1I13A 1ZU5A 2ZFUA 4D5EA 4Y2PA 4EF6A 3EZLA 4YACA 3CUWA 5FUVA 2VRCD 4NF2A 1V6SA 8OHMA 5CDUA 4EGJA 3OC0A 1L8XA 1XMQB 1PTKA 4NYJR 3WFIA 2PVSA 3BXOA 3ZQJA 3PQ2A 2FLKA 4F1KA 1A9YA 2REQB 4LVCA 3D3KA 4CM8A 2ZGVA 3WZLA 3JSAA 3BSSA 4WZZA 1C0PA 2PYIA 4JK3A 2AVNA 1EWQA 1H2HA 4NCKA 3RS3A 5IT5A 1PU2A 1V7CA 2R65A 2B34A 2PX6A 4HDRA 1KC1A 3L7BA 4JYCA 3ANSA 4WLEA 3DT6A 2BWJA 5J47A 1ZD9A 3QW4B 4ARIA 1R6VA 5ICMA 1FFYA 4RM2A 4A27A 3GLGA 3NDJA 2EYUA 2Y0CA 5H5JA 2X1VA 4ZU3A 4B09A 1LTKA 7REQB 3FHJA 2CKMA 1GIAA 2Z2KA 4GBGA 2B21A 4PRZA 1F3LA 3BE4A 3KR0A 5DTJA 2WB2A 3F49S 1QYIA 2V03A 3BK7A 4M1KA 4O2LA 2PRIA 3VPAA 4BVJA 3AUTA 4LK2A 1VG8A 2M6KA 1B7GO 5JADA 2LE0A 1XD8A 4O4IA 2PKRA 1H94A 4MV5A 1G3UA 3MRTA 1DPFA 4C3UA 2IDKA 2ZSFA 4ARSA 1EP2B 1HE2A 3C16C 2OO5C 3MUEA 2R7AA 4MUEA 2I76A 3CJTA 3KQWA 3STWA 1UJBA 1YCGA 5AOAA 2PZBA 5C1IA 4BO6A 4PRYA 2C5GA 1MC4A 3R7LA 2V6MA 4HDMA 1W76A 3KOXA 3L06A 1DQRA 1XJCA 3JQAD 4JOSA 4FBGA 3ZBPA 3FDXA 1XRSB 1BRMA 1X7YA 3JVDA 3VH1A 5KOJB 2H0AA 3ZIAA 1KDRA 1LTHR 3B3AA 3MW8A 4R1TA 2BFEA 5CLQA 1DHRA 1KJ8A 1MAVA 2FLWA 4OKSA 3I32A 4ZCIA 5JLAA 4IX1A 1V26A 4J7XA 1MA3A 2VDWA 2BUBA 3C8DA 4FS3A 5FHQA 2KSQA 5LWQA 1VLQA 1U80A 2IZ5A 4LBYA 3UK2A 3VKFA 3VXKA 4FXPA 4CR7A 3CQ9A 4BP1A 1QO0A 1T0HB 3QEBZ 4CM4B 2IW1A 4Y1RB 2QW0X 4G1CA 3BXFA 3ZWVA 3X1MA 4QKQA 1WNTA 2WV9A 3AF0A 3FOAA 2PK3A 1X14A 3KAJA 4QYWA 3F8WA 2H5LA 1T6NA 2R7LA 1B0PA 4IQ4A 1X86B 1NVWQ 3DEIA 3LP6A 1IMJA 1VL1A 2ISCA 2R4UA 4RK7A 2DFTA 3MM4A 2EV9A 3ORYA 4L6AA 4DDTA 2FWIA 4WVLA 3QUAA 1TAUA 1DHTA 3ZWQA 3ZHUA 1ANKA 1PJ2A 4QREA 1GU0A 2CUKA 3VSCA 2Z4SA 3OPNA 1LRLA 5BN3B 3EGOA 3UXYA 1ZM2A 2OG2A 2ZKIA 2ECPA 1ONNA 2HF9A 4J7AA 1RRMA 2OVBA 1GARA 4M99A 4MP3A 3TIVA 2O2HA 3T6KA 3VYTB 2I66A 3CW2A 1KYWA 3U7QB 1U0LA 3UXHA 4W5NA 2WU3A 4QDZA 3TLMA 2GM5A 3JD3A 1N5JA 4EEKA 5C1OA 3U17A 3UENA 4BP3A 3GAAA 4HDAA 5HZMA 1Q16A 5IT4A 2R96A 1H0HA 5CHYA 1ACJA 4O02B 4Z6KA 3ROGA 2L42A 4K8OA 4OQXA 3UWPA 4I55A 1MW8X 4P5DA 4OI2A 1FRZA 3O7WA 4O4JB 4AO6A 1A50B 2RD2A 1I2BA 4JBYA 4LOLA 4PYIA 1T0JB 2OY0A 5KINB 1T4BA 4B7CA 2BFBA 2YH2A 2OLEA 3WIDA 4JV5B 1DEAA 3PF8A 1QG6A 4CMIB 1K2WA 2IPOA 2GXSA 2C8KA 3DV2A 1XTIA 3H4IA 3U40A 4F38A 5CXSA 3OEED 2VDPB 2GYWA 3HZRA 4JBNA 3B6ZA 2WWHA 4HAWA 2F6RA 1V2GA 2VAVA 1FFEA 1PBNA 1B76A 3VNQA 2IF2A 3FTNA 3R09A 3T3DA 3ND8A 1NNI1 4RKEA 1RDFA 1A27A 4I4TB 1WCV1 1GPJA 2BEWB 2OUKA 4D4HA 3EIXA 3OVMA 1VMKA 5KDOA 5KJ6A 4QJBA 3VTFA 1M7BA 1N4DA 3PUHA 3HJCA 3LXMA 4PQFA 4KXFB 5ALJA 5EXSA 2RG7A 4J1QA 2VBFA 1UBRS 2Z5GA 1ZM9A 3NM5A 3V9AA 1R7RA 2WPNA 4YRNA 3TBKA 1LI5A 2I91A 2ZBPA 1ND5A 1KZ4A 1IM5A 1PK7A 1ZUIA 3EIEA 4H7PA 5AM4A 3GG9A 1DTSA 3KX2A 4K88A 1XV5A 2NV2B 3D1VA 1TAQA 4QBKA 4PR3A 4LJLA 1A96A 1U1IA 1KYXA 3KFXA 3ROQA 1W4RA 1O5OA 4RY8A 4ZI3A 1M83A 4G0UA 3IMFA 1CDDA 1KKUA 1LU9A 4YJ2F 3AF3A 1IUNA 4D0NA 3EHDA 1OFGA 1PT9A 3LQ1A 3P9ZA 4EYGA 1CJVC 1E3IA 1VPLA 1YHNA 1MN6A 3KT8A 3COJA 4DR4B 5DBOA 2AUNA 4TKVA 4QHSA 3EPJA 5LMUB 3N05A 1XZPA 2QQFA 5CA1A 2I6FA 2AN5A 3U4GA 2YOHA 3M3DA 5B1YA 1E9FA 2H1WA 1YI8A 3TW8B 1J7KA 5A4IS 1DCKA 3PT5A 3O9VA 1ST3A 4TT3A 2CJYA 3D3WA 5CYOA 3S7TA 4DCOA 4B6GA 2OWDA 2OAP1 3VNUA 4G5GA 4L57A 2EGHA 4Z0NA 4C7VA 1UFOA 1N9ZA 2ZAIA 1UBLS 2VYND 3CRQA 3FNRA 4OHMA 4YCJA 5B3AA 4YCCA 2C7VA 3FGNA 4TN5A 5ILQA 2WF7A 1YUBA 3AVYA 4ZCRA 2BHSA 4HS9A 2FPPB 3RADC 4B9EA 3HN6A 2YCLA 3W2EA 2ERCA 1EK2A 3D31A 3JPYA 4C14A 1D0IA 1P62B 1YCHA 3IPYA 1UBMS 2HJHA 3FPEA 3H1PA 4AJ4A 1ZQ9A 1XYGA 4RTQA 2A5FA 4YASA 1PL0A 1QKIA 2NYAA 5FD8A 4DC0A 3BTSA 4DQLA 4GLLA 3MGAA 4M54A 2YWFA 3L7MA 4M8LA 1S7CA 3A8TA 4JLSA 4AX8A 1XCJA 3ZKWA 4YDRA 5AVJA 3WGOA 2MMGA 4HQ6A 4OJNA 4E21A 5JWHA 3D8SA 2ZUEA 4Q05A 1IWOA 3DV9A 2NYRA 2VUSA 1XWWA 2ZIFA 4N7MA 3K96A 2F4NA 4ZT4A 3CRRA 3MWEA 1Q7GA 1EVKA 1MAWA 1W0KD 2BEUA 1K7SN 4FUTA 3L1UA 4I36A 3WXBA 1GUFA 1OXKB 1Y1RA 3MNFA 2YJGA 1YGYA 2ILTA 1YR1A 5FL7A 1FXWA 4V0MA 1QS0B 3D6MA 3FMOB 4LZOA 5EGNA 1XYYA 4CQJA 2A1UB 5EZSA 2HQSA 4QYIA 5H4HA 2XSZA 3H5IA 4TOIA 3BB3A 4EF5A 1JL3A 3RUPA 4L5JA 2OFPA 4EI7A 4O5AA 3V8PA 4ND3A 1I3LA 5FBHA 5JVDB 2R6FA 5TQ2A 5IUJC 1F0PA 1N5RA 3IUJA 2Q5JA 1Z28A 2A0UA 3GJQA 1PD1A 3I73A 5JTTA 1CF4A 1K68A 2V6BA 1KYVA 2ZDGA 1ZIOA 5E6UA 3U80A 3U39A 4BYGA 4CM4A 2NU8A 2DETA 2JFPA 1WDMA 1GFZA 2WZCA 2WINI 5FEMA 4NCAA 2XITA 2X5JO 4Z7NB 4P4TA 1A7UA 2W00A 3INNA 3BF8A 4U39A 3E9QA 4Y7CA 1BX1A 4QARA 3RRMA 3FUXA 1R8SA 2DFDA 1E18A 4GZ6A 4FR0A 3TUJC 1DAKA 1ZQ1A 4HH3C 1X70A 1ZN8A 4YUXA 4DJEC 2EG9A 2P0AA 1SURA 2BFDB 3FWKA 1UMDA 4C0KA 1E9CA 2XYHA 2O8VA 5I01A 3AZQA 3Q7SA 3VZBA 2BGJA 5B1IA 4LDNA 2A0YA 1GN9A 4I9UA 1CE8B 3OT4A 4KMSA 1AHIA 1RRVA 1SQSA 3PC6A 3PRHA 1V8OA 2J46A 3L79A 3HQ4O 1CIJA 3UKDA 3KWJA 4RTNA 1JEAA 1PEDA 2NPFA 4DMLA 3FKSA 1R18A 1C2TA 4HTFB 1SC1A 5D3ZA 2ODWA 3SZOA 4L4SA 5ECDA 3EVAA 3LX6A 3UGJA 1H0KA 2REXB 3CR7A 4RBNA 2C4MA 4L0CA 2GB4A 1Y8CA 2BFMA 3WWZA 4QU9A 4BJ6A 4ZCSA 1PR1A 4S0XA 4ZJZA 2MHCA 3KKPA 1DBIA 4JVLA 3IAM6 4KK4A 1Z5UA 1SRRA 1GQOA 4C6TA 2HZ7A 3V9PA 4J43A 4C6HA 4Z4QA 2J1LA 1YQDA 4MGKR 1Z22A 1YVUA 3RVJA 4D81A 5FL3A 5K6AA 1P0CA 1Q6ZA 2YN4A 4HQRA 4HYEA 5EA2A 4PFKA 3WHIA 3AF2A 3MTJA 1CJMA 3GNLA 4ETWA 1CRZA 2VP3A 4RPHA 3V8VA 4AULA 5CVTA 1XYVA 3KAQA 4WE3A 3PGLA 3BSWA 3A14A 4PU0A 2ZRGA 4P80A 2ZBEA 1JPNA 1LS6A 1BCSB 3S1AB 3LUCA 4HUJA 3WLEA 1N6IA 4QC2A 4U7GA 1ZCAA 3ON5A 4ZI7B 3I4FA 5HJ5A 1NUAA 1GZSA 1TADA 1LDEA 5ULLA 4BV3A 2ZSKA 1UFKA 3AJ8A 1NP6A 4G4GA 3ZDBA 1T9DA 3KU4A 2VJPA 2NP6A 3HCEA 1IK4A 4TL9A 1T9AA 2VNIA 3D8HA 5AM5A 1OE0A 3T9BA 1ECCA 2HW8A 5B7QA 1J2TA 2GXQA 2P9BA 4L16A 4UAGA 2I4IA 3ZU3A 2CGEA 5K3AA 3B20A 3UGKA 4AN1A 3DVRX 3QOYA 1HGXA 3MHTA 1Q5PA 1MOZA 3N2KB 4Q4JA 5FOXA 1Z83A 3P0RA 5B58T 4BFUA 4Z54A 3ZIDA 4YT5A 4GW3A 1L1QA 1EEHA 3BPSA 1OBHA 5THXA 4DIDA 3N59A 4POOA 1U9YA 4TYPA 3S27A 3FW1A 4BFYA 3R40A 5AKHA 2EJTA 3LUGA 4FKMA 2BISA 1WW2A 2H00A 4TRNA 4OI0A 4DPLA 4R2JA 1RTTA 3W5VA 1NVDA 4HAIA 4U7JA 4MTLA 4LY3A 1XA0A 2BR4A 5C7OO 4WQMA 1N3YA 2ZANA 1YS7A 2GJ4A 3M6MD 4E5VA 3QPBA 5CLGA 2IZ1A 5HJ2A 1G98A 1OMOA 4FE4A 1QG4A 2M98A 4X84A 4RZHA 2AWOA 2HBZA 3VYWA 1U65A 2C77A 3CM0A 4LTNA 4DM4A 1GOTA 3B7GA 1V9LA 3RRNA 2Q4TA 3ELUA 5DTRA 2AEEA 1MJHA 2G1UA 1I6MA 3EZ9A 2PE5A 1D1PA 2DQSA 2LXNA 4ZJPA 4CGZA 2FWAA 3R6DA 2A1TS 4WZBA 1IHUA 2UUAB 2EJBA 2R7MA 4QTTB 1Q0UA 1UWKA 3UW1A 2P3LA 1T9CA 3FPLA 3AO0B 1Z33A 4KYUA 3U6BA 3A05A 1QIFA 2O2XA 3JQBC 4HGZA 1SZDA 2XT9A 4C7JA 1S2OA 2UDPA 1SZCA 3DTVA 5ALNA 3ZE0B 2X58A 4RH3A 4NBVA 1N77A 3LC2O 1IMOA 2HIAA 1GUBA 4Y1GA 1ODLA 3COSA 4WA7A 4O4JF 2AR7A 2VP4A 4ML3A 5BV7A 4ALIA 1I6LA 4K05A 4FS8A 2X0EA 1NQWA 3LHDA 4L4XA 4WLVA 1C3OA 3I8SA 1TYBE 3WYCA 2WWVD 4KSBA 5CDSA 3WK6A 4X44A 2MINA 3CLKA 2KWIA 1ZJ6A 3Q7IA 4OYRA 1KI8A 4BQRA 2F55A 2VXOA 3VR0A 5IKEA 2MSDB 4MITA 5E0KB 1L7PA 2OA0A 2OD9A 2QV7A 1RLMA 2WSYB 1U3UA 2ZI3A 1GPH1 1UBCA 4TSFD 5EMKA 5PNTA 4YT4A 3O2QB 1BE1A 5FP0A 5SYMA 4PNEA 5ARDA 5CIYA 4OHYA 4I4TF 3RS7A 2J09A 1KJYA 1T3ZA 2PKEA 1F8UA 1ODCA 2Q6TA 3R4CA 4KQ6A 3RVDA 2BDEA 4L85A 4N0DA 4QVIA 1G1MA 4WD3A 1W19A 1QV7A 2XDWA 3PZBA 5CDFA 4HVCA 4V0RA 5CITA 3KKNA 4W9NA 4FDMA 1QZ3A 4UEQA 3LC0A 3A3YA 5BQXA 2Q4OA 3ZGYA 2NUAB 3TQFA 3W5JA 1WD7A 3LUHA 3QFHA 2JCXA 1LB1B 4Q03A 3RSQA 3OA2A 3KUDA 3E4DA 3IBSA 4YP9A 2UUCB 1QCZA 3AINA 4B81A 4R1MA 3FAZA 1GGJA 2NSYA 4PAMA 4BEWA 4R6WA 5AW8A 1ZW1A 5U4QA 1RM3A 2VSNA 1VM6A 1NPYA 5AW9A 3BAFA 1EM6A 1QZUA 3RHZA 2CDBA 2NTVA 5ERGB 3T4XA 4PQEA 4RSGA 3O94A 1YIDA 2AQ8A 4UHJA 3R8CA 3ZU4A 3RODA 4NU6A 4YAJA 1G42A 1LK7A 4TKUB 4LRYA 3OF5A 3TLXA 4BLVA 4FSDA 3RVKA 1TIPA 5DP1A 1X1RA 2VDRB 2ZUWA 3H2KA 4KDCA 3E0XA 2SKDA 2ZCJA 3IC5A 3GUUA 4PLVA 4XTCS 3V3TA 1E4OA 2OLKA 5AT1A 3O2NA 1TM5E 4KQHA 4MV3A 5CURA 4JEUA 1W85A 5CCDA 3DXFA 4CFSA 4LF5B 1XXHE 5IEJA 1O96A 4RYLA 2BHNA 2FFJA 4W9RA 2WTUA 3X1DA 4B84A 2XRZA 4IIXA 2OP1A 1L4LA 1XELA 4FT2A 4P6VF 2QTTA 1WL8A 4OV6B 2JJ2D 2ZYRA 2X9NA 3GPBA 1UBKS 5KAMA 4F6RB 1JWLA 1KF0A 3QMPA 5TQ2B 5ARBA 4G5SA 2G67A 1XTSA 1QYRA 2DWCA 3UCEA 3LO5A 3EEOA 3T4EA 2JEOA 4N6OA 5F2EA 2FPMA 4A1OA 4E6PA 5EXTA 5B3LA 3I9V6 1PX0A 3LVFO 4DA8A 4BFCA 3NM6B 4FWIB 2VUUA 3BT7A 1CZKA 4TKMA 4QDOA 3UT0A 4YCMA 2IBSA 3SKYA 2PUBA 4UC0A 2CFSA 1K8YB 5CT4A 1DKQA 3A26A 3G13A 4GWLA 2PZAA 4MDEA 2DBRA 3S2YA 4CNBA 3NXSA 1EWKA 2C8LA 1WBBA 4DARA 1KK0A 1YHZA 3HABA 1W75A 1ZZGA 3FBWA 4S1NA 1BIFA 3MWEB 3O47A 4FGKA 1NKVA 3CBGA 3GJZA 4PYNA 3H4TA 1D7AA 3DOJA 3HGQA 1J24A 1OPXA 1K86A 4MV7A 4Q1DA 3PJRA 2GHTA 5K09A 3RH0A 1NW3A 2PKCA 4WKPA 3KOWA 1PR5A 1FFDA 1E1RA 2GPTA 2UV8A 3L8YA 2IU6A 4KZKA 2AJBA 2F9MA 4LISA 1R10A 2JCYA 1LGYA 3EDRA 3GFGA 3H7IA 3M0EA 4ABYA 4B7UA 4E5DA 4J9UE 4QG7A 5EPEA 4YBRA 4BCCA 3LX8A 1GA6A 2JVKA 4UE3S 4EUNA 2NPOA 4KUEA 1FDRA 2C1XA 3TNFA 1ORHA 2VBGA 4ENVA 2XCSB 2WPDD 1MGPA 1DBRA 1XDGA 2IHTA 2YHIB 2JFVA 2Z2IA 2QZ4A 3OT1A 1SXQA 2R8PA 4HR7A 1EQUA 4IDPA 3H11B 5DYTA 3IT0A 4ZTUB 2JW5A 1WWKA 1S89A 4MAFA 1EXWA 1C3OB 1EBBA 4IDOA 2WSMA 3EC7A 1Z7YA 2ONZA 5ERXA 4EI8A 3DONA 2BE9A 4GT1A 3AKCA 1P4RA 2D1SA 5TPZD 1CULC 4ZT2A 5LJLA 4HB2A 1FZTA 1QH9A 2QNIA 1SHKA 3O8OA 4JDUA 4UTVA 3DVQX 2ZRBA 2Y93A 1Y80A 5IPFA 5KSOA 2QMHA 3C8HA 2D5BA 1SH7A 3RVMA 5JDCA 4TZ0A 5CA0A 1VSUA 2CWWA 2W2LD 4E11A 2K87A 1WUKS 1SCBA 4TVBA 2YX1A 3T5AA 1DUIA 3VNVA 1F0YA 1TF7A 2QAGA 4HDNA 5KREA 3L07A 3WTCA 1DAPA 2XIJA 4HF7A 1Z5PA 4BB5A 4WBNA 5HF5A 3QX9A 4A5OA 3K2IA 3QXHA 3L4KA 3GJYA 4DY4A 1A4UA 3PGVA 2AC2A 1BZYA 1CR6A 3ETJA 4IV5A 5EIBD 1FF9A 2HA0A 1W4ZA 4NVRA 2G5GX 2WIKA 3ZHCA 1I7QB 2X14A 1T4MA 3D7SA 4PZ0A 5C1BA 1N2IA 2E89A 3JAWA 4YMLA 1WBDA 4UBKA 3F46A 4M9CA 3EUWA 3OCCA 2H4WA 4QTUB 2W58A 1DVRA 5FV7A 3G0CA 2BYTA 3QV2A 4PRKA 4RPIA 5D01A 1S4QA 1LLCA 1I2CA 3L7YA 4YPOA 1MHPA 1VB3A 5FWNA 3ZPXA 1Z62A 1YFJA 4R2MA 3FTCA 2G63A 1OXBB 1M76A 3BORA 3EGXA 4ZI7F 3PTZA 4BN0A 1O2DA 2PGNA 2YVQA 1G60A 1JBEA 1LK5A 1A2OA 5IWAB 3L1VA 3IEXA 5J4KA 3F5FA 2G04A 3P9YA 1E79D 1I51A 1U1DA 2C1EA 2X4LA 2ZT8A 3E5HA 3F97A 3IPRA 3MFYA 2QLTA 5KQGA 2GBGA 2FZ4A 3LQ2A 1ZMBA 5DEOA 2PSJA 1ORWA 2JLAA 3IILA 2CZGA 4C06A 6AT1A 1X9GA 2CXRA 3KE8A 1HE1C 3LT1A 1KMNA 4GI3A 3FD8A 4J75A 1YS6A 4UFNA 4NULA 3KSMA 3LZCA 3RYIA 2B4YA 2HGZA 3T3GA 2OGTA 3CLTD 3FDJA 3HH8A 2YNMD 2C0QA 4DANA 2O5RA 1T2VA 4FZ5A 4O29A 2IH2A 2L2QA 1V9CA 4A2CA 2OT3B 4BO2A 4Z9AA 1L7BA 2XNJA 4BGDA 3PYLA 4P3NA 1KL7A 4JIGA 4CF4A 2BSQA 1YTLA 4UTXA 1F7UA 4TTRA 5DCUA 2J6HA 3SZLA 1VKOA 2ISSD 2C94A 3H7AA 1RWQA 2PX8A 2Q28A 1QFSA 1EFLA 5TB5A 3RE1A 4F9TA 1FS5A 1Z45A 4F45A 5B3JC 1AUXA 4BL5A 1RPZA 3FFBA 4TL7A 5E3IA 4LDPA 4BLOA 1G0OA 3DFMA 1R0LA 4X1KA 1XROA 1YAJA 1XJWA 2YJTD 4QDKA 4WESA 3DCJA 4EO4A 4UPVA 3R6WA 1UEJA 4KO4S 3C0KA 4YJHA 4B0PA 1EAMA 4XVQA 3ZHRA 5KCZA 5HZHA 3DAHA 4FKZA 1SOAA 1ADGA 2Z5FA 1U0TA 3FMPB 4OB6A 3T54A 2PUDA 4DV2B 3C14C 2EJVA 3AI3A 5F5XA 3JVIA 1H93A 3KUUA 1MEJA 1Z2NX 3ZHXA 4HUQB 3M6AA 5CBPA 4OOFA 4OLAA 1YKGA 4IDAA 4FDLA 3K5PA 4Y1RA 4Q3OA 3BHIA 1F1BA 2OV1A 1Q77A 4AY5A 4CTNA 3HUFA 2HMVA 4IHQA 1PNOA 1CY8A 2ZPTX 4QOFA 4MPPA 4L6IA 1GNVA 2WK1A 4N0PA 1IPEA 1N6OA 1ADFA 1TOAA 2A0FA 5EHGA 1F0NA 4ZZ2A 3ADBA 2FSUA 3IPXA 3QU5A 2OK7A 2RH9B 4OSPA 1VLHA 4FE3A 1Y6ZA 2OOKA 3A2NA 5JEDA 4W7HA 3Q3VA 1D6NA 4NZZA 4F5EA 2E4WA 4C1BA 3C98A 2RGRA 3KLBA 1Z7BA 3K1YA 5LKAA 1HWYA 1ZICA 3LQKA 1NMEA 4HDOB 2WZBA 1EXNA 3EY4A 3JVEA 4LXGA 1ZYUA 3I28A 5EAIA 4AMGA 3AKYA 3HKCB 1KH1A 1NFFA 1P80A 1JJFA 3OFSA 3P9SA 1PDVA 4X8OA 5DK6A 1RQPA 2NYUA 3PKIA 5ALEA 3SQNA 4X71A 2PJRA 4HFJA 3HJGA 4Z49A 4OQEA 5AVYA 1USIA 3H2IA 1V16B 2L17A 4OXIA 5EJ6A 4X90A 3MELA 4Q7KA 2WWFA 1VJ0A 5T6BA 3DMGA 4RD3A 2K7FA 3ZE8A 3BMQA 5BPFA 2A3NA 4MS4B 2MDTA 2HT6A 3JZFA 4B3DA 3M89A 5I8ZA 4CIXA 2AK3A 4LFAB 4DB2A 1Q7EA 1KK1A 1Z12A 2ADFA 4Z4FA 1OWLA 2BFDA 1NY5A 2NVWA 3VHXB 3CW9A 1GL7A 1QC5B 3EHEA 3GJSA 4D44A 1IC6A 3JARA 1NKTA 5FV4A 1D2MA 5B58C 1FU7A 3ZNOA 2ZJ3A 3GG2A 5KIAA 3F78A 1J23A 1H5UA 2G9RA 3NCHA 2VZ8A 4GXTA 3CN7A 1YS9A 2HCRA 1C14A 3DWIA 3PXEA 3NTRA 2QG4A 4MSUA 1FX0A 5IHXA 2XNHA 2DULA 4H27A 1NRIA 4RTMA 3HWRA 2REQA 1Y5LA 4I4NA 5KYWA 2WOJA 2EXXA 3NKFA 3OU7A 2VUTA 3H04A 5FI3A 2VPQA 1SVLA 5KTOA 5M29A 3C6BA 3MQFA 1PS8A 3A9SA 1Z26A 5K4HA 3ZDCA 3QKSA 3ST7A 1UBGA 1XVLA 1FTGA 521PA 4NS4A 2A3RA 2W2TA 3DXXA 5AIAA 2A9FA 2ODEA 3I09A 4G97A 4KAXA 2XKKA 4ZC1A 1V1MA 3AUXA 4XIIA 3TBFA 3ROMA 2JJ2A 2XXBA 1R6DA 2WFLA 3LGXA 4IDNA 2FOXA 4M8SA 4WCVA 4XGQA 5DGDA 4QGSA 3VO8A 4F71A 1X42A 5F4ZA 1LA2A 4PIPA 3QE2A 2IYYA 3SQMA 1KIAA 3GXBA 4FYJA 1F5SA 1O5IA 1IJFA 5JSKA 4B5LA 3AERB 5KYNA 1SCUB 3SSAA 4HAZA 4ZAGA 1DWQA 4TS1A 1QH1B 2OZEA 2KBFA 2YNMA 3O4VA 3CLVA 4RIGA 3FKJA 5ALVA 3ZLTA 2JAPA 3O21A 4K9QA 3DR3A 2XGJA 3R24A 5LA6A 5CCEA 4TKVB 4HWTA 2GNAA 4KO2S 2YRXA 2BP7A 3LVRE 2YTZA 4PTYA 2E2WA 1THGA