1K27A

Crystal structure of 5'-deoxy-5'-methylthioadenosine phosphorylase in complex with a transition state analogue
Total Genus 92
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
92
sequence length
273
structure length
270
Chain Sequence
AVKIGIIGGTGLDDPEILEGRTEKYVDTPFGKPSDALILGKIKNVDCVLLARHGRQHTIMPSKVNYQANIWALKEEGCTHVIVTTACGSLREEIQPGDIVIIDQFIDRTTMRPQSFYDGSHSCARGVCHIPMAEPFCPKTREVLIETAKKLGLRCHSKGTMVTIEGPRFSSRAESFMFRTWGADVINMTTVPEVVLAKEAGICYASIAMATDYDCWEEAVSVDRVLKTLKENANKAKSLLLTTIPQIGSTEWSETLHNLKNMAQFSVLLP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 5'-Deoxy-5'-Methylthioadenosine Phosphorylase
publication title Picomolar transition state analogue inhibitors of human 5'-methylthioadenosine phosphorylase and X-ray structure with MT-immucillin-A
pubmed rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 92
structure length 270
sequence length 273
ec nomenclature ec 2.4.2.28: S-methyl-5'-thioadenosine phosphorylase.
pdb deposition date 2001-09-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01048 PNP_UDP_1 Phosphorylase superfamily
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1580 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1k27A00
3D1VA 1Y1QA 3DJFA 2OXFA 4JWTA 4DA0A 4YO8A 5F73A 1U1CA 3LGSA 3BSFA 1YQQA 2QTGA 4GLFA 1JDUA 1PK9A 4D8XA 1NW4A 5K1ZA 1WTAA 2HSWA 4M7WA 5DK6A 3GGSA 1JDVA 1Z38A 1U1EA 4X24A 1Q1GA 3BJEA 5FAKA 2AC7A 3FNQA 2A0YA 5CCEA 3KVRA 3OF3A 3PNSA 4G8JA 1ULAA 4TTAA 1XE3A 4OGKA 4E1VA 4F3KA 3NM5A 4WKBA 1ZOSA 4UC0A 1JDZA 4GKAA 4F2PA 3FB1A 3OOHA 3EUFA 4TXLA 3K8QA 4OGLA 5F7ZA 1A9RA 1RXSA 1SD2A 1Y6RA 4WKPA 4D98A 1K9SA 3E0QA 4P54A 3OCCA 1JYSA 2IQ5A 1M73E 4OY3A 4TS3A 3OZDA 1A9QA 4R2WA 4G41A 1Z37A 3BGSA 3F8WA 4LNAA 1TGVA 5EUBA 4LNHA 1RXUA 1TCUA 3E9ZA 4TTJA 3ENZA 3UAZA 1U1GA 2BSXA 1V2HE 1K3FA 4KN5A 1PR6A 1ECPA 5F7JA 5F7XA 1U1FA 4K6OA 4IP0A 1T8RA 1RSZA 3KVVA 4PNPA 2AI1A 4BMYA 4G89A 4DANA 4U2KA 5B7PA 3LBAA 3OZEA 4QFBA 1T0UA 3IEXA 3UAVA 3BL6A 3UT6A 5KB3A 4EB8A 4BMXA 2QDKA 2GUWA 1JE1A 1Z5PA 1YQUA 1ODJA 4NSNA 1FXUA 1G2OA 2B94A 1LV8A 5CYFA 3SCZA 1LVUA 1PR0A 1B8OA 4JOSA 4DA6A 4L0MA 4MCIA 1OU4A 3K8OE 3P0FA 4TXMA 1SJ9A 5IFKA 3FWPA 3U40A 3EUEA 1PKEA 4GMHA 3QPBA 1YBFA 3FUCA 1RFGE 1SQ6A 1A9PA 3DP9A 5F78A 4RJ2A 5I3CA 3NM6B 1TCVA 4TXNA 3MMSA 4F1WA 1RXCA 2QTTA 1PR5A 1TD1A 3PHCA 1N3IA 4OJTA 1YRYE 5F76A 3DPSA 3FAZA 4NS1A 5CXSA 1K27A 3OZBA 1I80A 1QE5A 4I2VA 3E9RA 1PW7A 5IU6A 1Y1TA 1ULBA 3OOEA 2AI3A 2HWUA 2QSUA 1V3QE 1SD1A 3GB9A 2A0WA 1PBNA 1CB0A 5C80A 4BN0A 4M3NA 3INYA 3UAWA 1Y1SA 3PNPA 4QAQA 1NC3A 3OZCA 4L6IA 4TXJA 1A9OA 2AI2A 3ONVA 4DABA 1Z36A 1T8WA 1RR6A 4H1TA 1RCTE 1V41E 1A9TA 2I4TA 4WKCA 1PR2A 5JPCA 1JP7A 2RJ3A 1OTXA 2OC4A 5F7OA 4LZWA 2OECA 3KHSA 5ETJA 1ODIA 3PHBE 4TTIA 5B7GA 1U1DA 4MARA 5B7NA 4DA8A 1OV6A 1PWYE 3UAXA 1CG6A 3P0EA 1VMKA 5CXQA 4M1EA 1Z33A 3UAYA 4LDNA 5EPUA 1NC1A 1Y6QA 1RT9A 1JDTA 4FFSA 1YR3A 1PR4A 1OVGA 4GLJA 4DARA 3NM4A 1V48A 4QATA 4D8VA 4TYMA 1TGYA 3IOMA 1VFNA 2PGAA 3LA8A 3OPVA 4R2XA 4QARA 1Y1RA 1Z34A 5EFOA 1OTYA 2ISCA 2HN9A 3NBQA 4WKNA 2A0XA 1RYZA 1ODLA 4YJKA 4MCHA 1PR1A 1C3XA 1JPVA 5B7QA 1JDSA 1A9SA 4DA7A 4DAEA 1ZL2A 1T8SA 1Z35A 5F77A 2HRDA 4EARA 2H8GA 3EMVA 3EEIA 4L5YA 1LX7A 4D9HA 3DDOA 3T94A 1JE0A 3KU4A 1PF7E 4BMZA 3KUKA 1V4NA 2P4SA 5CYGA 2XRFA 2Q7OE 1Z5OA 1B8NA 3O6VA 2ON6A 3MB8A 4L5CA 3C74A 2QPLA 1VHWA 4L5AA 1V45E 4PR3A 3KVYA 1PK7A 1OUMA 4DAOA 4R31A 4YMLA 4NY1A 4WKOA 4JP5A 4TXHA 1ODKA 3TL6A 4TS9A 5CCDA 3ODGA 2I8AA 4LKRA 1A69A 4QASA 1VHJA 1Z5NA 4ECEA 3O4VA 3FOWA 2OC9A 4F2WA 1T8YA 1Z39A 2A8YA 4QEZA 4F3CA 4OF4A 1RXYA 4OEHA 4D8YA 4YNBA 3DF9A
chains in the Genus database with same CATH superfamily
4IDAA 3LXXA 5MN5A 1V25A 2PKQO 3WDSA 1PZGA 2QSYA 5FI5A 3EFHA 3WYEA 3ZCQA 4ITUA 2XITA 3TKAA 2J9RA 4TLAA 4V2IA 1CEXA 1E2JA 1NTOA 3NKFA 1QDLB 1XTIA 2DU8A 2ABWA 1MO2A 4GBJA 4IHQA 3GRCA 1YB7A 1Z88A 1ZICA 5LC1A 4G01B 4LMAA 2P6MA 3NVKI 3JALB 1D2CA 1HKUA 1V3TA 1K0UA 1M6NA 1X1QA 2RGYA 2ZRKA 2IV3A 4TYQA 3RVBA 3UUWA 2P9YA 3RSQA 3B82A 1BEZA 1U8TA 4UM9D 3ZCTA 3DDSA 3UHAA 5IJ0B 3F5FA 4KVZA 5HMLA 5BVGA 3AEKA 5FLKA 5HKKA 2AXPA 5IPFA 2CHUA 5BWMA 1JEOA 2QY6A 4CUKA 3TM4A 4XDGA 5FBWB 3BCSA 2J85A 1Y8CA 4FJ1A 3M9WA 4MINA 2FSSA 4Z3KA 3AY6A 4PO8A 3KJNA 4LN1A 5JC8A 3MT0A 1ND6A 4NNOA 4WX2B 1CUVA 4QOFA 2VSYA 2PJZA 3GGSA 1B93A 3ZOKA 4DIMA 1ADYA 4F38A 1OWMA 1W85B 1U1EA 1AV7A 4XM1A 3ROFA 1SNYA 3QY9A 5C5IA 3LLSA 1L7NA 4PO9A 3AHDA 4GW3A 3RYTC 2PHZA 1JB9A 2RDMA 4EW6A 2A0FA 1CW2B 2GVDC 1WOYA 3C5WP 1FTYA 2C5LA 4GLOA 1IY8A 1XF1A 1B8VA 2QUJA 3OZWA 4J0DA 2J3LA 4CKYA 4DPLA 3QI7A 1ZK4A 4O3MA 2CUZA 4GOND 4CTNA 4LFAB 2W6MA 3LTNC 2CXPA 3T5PA 3OU6A 4DRZA 1P29A 4W9NA 1O8BA 4ZOLB 1OREA 5F4ZA 5AVSA 4LFBB 2GZSA 3U09A 5JVDB 1PUJA 2VJYA 1COZA 1W19A 3H5OA 1FTNA 3U0BA 1NF9A 2QG9A 4ZAGA 1NLMA 2QTCA 1LZKA 4KZKA 1EE2A 4IDHA 2QLNA 5CPFA 5B53A 2PIDA 2IU4A 4EHIA 1FYFA 1K4MA 1H2YA 1UC9A 2ZITA 4H17A 4INPA 1GQFA 4GPTA 4HGOA 4OV6B 2VQFB 2GCPA 4JCOA 5EE1A 3GYGA 1SK8A 4BO3A 2IT1A 1E6MA 2REXB 4PAMA 3WMWA 4AZSA 4JK3A 2C4MA 2YVKA 1M0TA 4BB9A 2NV6A 4JZKA 1ESZA 4YTEA 3DH0A 3C1UA 2HGSA 1E2BA 2FG6C 1L5GB 1HLPA 5FADA 2HUNA 1VKRA 4CT0A 5ANRB 5FFMA 3OI7A 1E8NA 2PSEA 3V1UA 4Q16A 2BYTA 1VJCA 1E2PA 5CVCA 3LKDA 1QG6A 1P6XA 5ITZB 2XMDA 3DCNA 3FKJA 3KFLA 1COWA 3AKZA 5J4VA 4AJ2A 2VZLA 3DTTA 3N2NA 3O9MA 2QL9A 3SOZA 1ABEA 2YBDA 5IVIA 3VYSB 4KYIB 2AN3A 2YW9A 1T8RA 1V5EA 5GZ6A 2E5FA 2G4CA 2QS9A 4BFWA 4BEVA 1HYGA 2BM1A 3KYJB 3AF5A 1L4EA 1ADFA 4S3MA 3VH3A 4ZYYA 2X5OA 2MSDB 5CGQB 4EEKA 3JQ9A 3HB7A 5A3SA 3FPHA 4Z4QA 1B15A 2A1UB 5CDYA 1DU4A 4FOLA 4I5EA 5KNLA 4M7PA 3ZEAA 1YE5A 2EKBA 4B82A 4N3AA 4PPYA 3VU8A 3PXEA 4U2KA 3P71T 3HUFA 2BMDA 2R5FA 3D7NA 1Y6GA 1CUBA 1LBHA 3GMSA 5AH0A 4ZGGA 2H54A 3F4LA 4OI0A 3RKRA 3BWYA 4I55F 2UZIR 3LUKA 4P53A 4HATA 4EX7A 4FNGA 2C78A 2J0VA 2RGAA 3F3KA 1PHRA 1YZQA 1O2DA 1LLFA 5FB3A 4MPTA 1T1EA 3WSWA 3ZY3A 1T4MA 1XD2A 3T5MA 3D1JA 1G59A 3OC0A 3VO9A 1AGNA 1GGHA 2ILTA 4GVPA 1TM1E 5IT4A 1UBMS 1V7ZA 5D6NA 1DAKA 5FUYA 1JILA 2ZRLA 3WKCA 1K88A 4TKLA 1QCDA 1NVAA 1PVVA 4O29A 3ETLA 1P6QA 2EQBA 4FDMA 2FSUA 3UNXA 3Q8KA 1T0IA 2V58A 3H99A 2IF0A 4OIMA 5A03A 3OY2A 2CFRA 3L7NA 3PVCA 4D44A 4CQMB 3MW8A 3OY7A 1VE3A 3NOXA 2QRJA 5CBPA 2YIVX 5LOVA 2OCKA 4D7AA 3JTEA 5CFOA 1DINA 3NDIA 3VOSA 3DEAA 5K45A 2QNRA 3USCS 2GARA 2O2ZA 1MQ9A 4Y0NA 4B73A 3QPWA 3DHYA 2B98A 2YOGA 3DOUA 3AR8A 3C70A 3O0TA 4MCIA 4YCJA 5DHFA 3TLJA 4HAOA 2PX8A 3C1AA 2GJ9A 4RH3A 2QN9A 4KPUA 3UY4A 2OYSA 2J41A 2RHCA 3BILA 4MPJA 1LWNA 4FYJA 4OA5A 4UEJA 4JUBA 3M1AA 4GSKA 3VRHA 3G5UA 3OJCA 1RHJA 4IZHA 4DM3A 5JH7B 1BHO1 3O8QB 3Q4GA 1HFEL 1LZLA 2ZTUA 4HDQB 3VHRA 3IPXA 4ZCRA 2G88A 2ET6A 3PC8C 4NCHA 5IKOA 1GCIA 2ZIVB 3O7MA 1YBFA 2RK6A 4KTTE 1LCIA 4PWZA 3W2HA 2YYAA 3SVZA 1ZLXA 3IRVA 3PWZA 4IUCS 4ZTUB 1Q7CA 3QSYA 3SJAA 4TMTA 1TCBA 3O9ZA 3KZMA 3P45A 1FU4A 4R1NA 3NM6B 4Z0PA 1QP8A 2K2QB 3BH7A 4YX9A 1E4EA 4BP1A 1YCFA 1RXCA 2Q5CA 3VSAA 3IKTA 4DCTA 5DW0A 5DYIA 2XUHA 2Z3ZA 5D1HA 5LMCA 5DM4A 4XZ3A 4WOPA 1AT1A 3KTFA 4KH1A 3ENVA 2F8MA 4MWEA 4YAUA 1XJ5A 3K5WA 1CQJA 2GF9A 2IZ7A 1F20A 2XSZA 2R8EA 4L02A 2ZM5A 1I80A 2Z30A 4Q9IA 3X43A 4MUHA 1M2WA 1SBYA 4D3DA 2JCYA 5C51B 3HUDA 4BJ5A 1YHNA 4NH4A 3COPA 3RS7A 2HFKA 3FZEA 1JUDA 1KY4A 3H6HA 3IESA 4MIYA 1Y9ZA 4R84A 3QIVA 2ZBGA 4UMVA 3ZV7A 4BO4A 4EG7A 2PUFA 1LVGA 3L4BC 2WJ6A 2VQ6A 3KFVA 4MVJP 4IEFB 2NTJA 1CJKC 4OHWA 1ZVVA 1DGQA 3UWPA 1NI5A 1TCAA 2X9GA 2LR0A 3HR7A 2FX3A 3KEMA 3K0FB 3ZR4B 1WETA 5TNXA 3AI2A 3AI7A 5CYPA 5JT1A 3CINA 1CJUC 3IPLA 4FDUA 1YF3A 4LSZA 1AN9A 1WDKA 3PDJA 1Z3IX 3NNNA 4RVDA 1SD1A 1XQ6A 5G1NA 4B75A 4DQVA 2H1WA 1KNQA 4MEBA 5HM6A 4MR7A 4OHUA 1KMHB 4OQ4A 4EPWA 4JUFA 2YHUA 3KYDB 3S44A 4JENA 5EI5A 1IXSB 3I12A 3UWOA 3QMWA 4GI2A 2R9VA 4HFNA 1G21A 4GPIB 4JQOA 2I87A 3V4SA 2H16A 1DAPA 4URZR 3P1JA 1NMQA 5TVGA 4AJIA 4HX2A 5F33A 2P9FA 2VK8A 3JS5A 2AI2A 2PXXA 2B78A 1T1IA 1QIGA 1RR6A 1OXVA 4MVYA 1DLJA 1GQ2A 3K32A 4M0PA 3WG9A 4UHDA 1XRQA 2OILA 1KI4A 1GPKA 3DL0A 2W11A 2ZUCA 1NLUA 1U3VA 4HNUA 5K05A 1N2CB 3GGPA 1D6NA 2P11A 4B3CA 5KNDH 4FP9A 1PHPA 4PR0A 3BQNB 1UEXC 3ZQKA 1II8A 1P1CA 2C59A 1AKMA 3H1GA 1NXXA 1PIWA 1RM4A 2PGJA 3NU1A 2FZ4A 4OFWA 4DLNA 1FVHA 3H8SA 4C4ZA 2Z83A 1Y9JA 1DKLA 1QONA 1MJ5A 3A4YA 4EYOA 2F1HA 1WB4A 2XNSA 1YMVA 2P79A 2J6IA 3UMVA 2WF6A 4HH3C 4MI9A 2GN1A 2ZI6A 3OFNA 3F7TA 1AXEA 1K2VN 3HYTA 4EYEA 3AY3A 1WLYA 1IY2A 2PSJA 4UUPA 4W9MC 1SZDA 3LF2A 4LHXA 2CVZA 2O3JA 5HBGA 1XLVA 2B4AA 4PLWA 5HIMA 5HWSA 4QGAA 2ORVA 1NPTO 2EGUA 3FSRA 2FWPA 4Q15A 1PWXA 1HZZA 3ANNA 2BHLA 3PDCA 3VOBA 3MA0A 4BQNA 4QU8A 1KBOA 1V43A 4ED9A 3TECE 1OVGA 3NHRA 1RQNA 2DFLA 3MTDA 4KNVA 4AUMA 4OKIA 4C4TA 1PJSA 1U0HC 5TRTA 3NM4A 1HTWA 1I10A 2XUPA 5FJIA 4PEVA 4X85A 2R7LA 2HPZA 3DEJA 3IVMA 2VYVA 1OASA 4XGKA 4PBTA 4G2NA 5JCOA 2BFOA 3PV0A 4N4AA 4UHEA 3IXMA 4B8ZA 1XAIA 2QX6A 1PP4A 2HYDA 4KNYA 4IDDA 4CU2A 1V4VA 3EZLA 4KV7A 5T67A 2ZETA 3OAAA 1U80A 1U0JA 5KEIA 1O94C 3M6AA 1JJFA 3JD1A 5GZ1A 1JJAA 2BUCA 1E4OA 2G76A 1X7ZA 2J0UB 1QKJA 2UYYA 2XCOA 3EGWA 5BW6B 2I71A 1JIIA 2A78A 3AEXA 3QHQA 1KAEA 4YMTA 2OBYA 4CM5A 3WKEA 4DQKA 4DL9A 2QRKA 2ZI9A 1N6PA 2FSVA 1P9OA 2AWNA 4RX1A 4Z51A 2N75A 2O05A 4K6KA 1NNSA 1X7WA 3G7UA 3KT8A 1MB2A 2AEEA 3R5SA 2VXBA 2Y6VA 1S2LA 2E6UX 2ZRQA 4AMZA 4BFSA 2Y05A 2EFJA 4YIKA 2IYXA 3B6IA 3MWYW 1RYZA 3DTYA 2E89A 4PV7A 4E70A 5BNIA 1DT5A 2H11A 3Q72A 3HKEA 3WLQA 3LP5A 1EUCB 4HJXA 4XYLA 1FP1D 2YZNA 2QX8A 1E9AA 2QMYA 3X2FA 1BS9A 4BEBA 4DA7A 5M04A 1EFTA 4Q37A 3H2JA 5E7MA 3SSAA 1NE7A 4NH0A 3TO5A 4IDGA 1X1AA 3MD9A 3SYKA 5F1YA 5CAEB 3OKPA 1LI7A 3PSHA 3CUWA 4MVJE 3ODPA 3ADKA 4NJEB 2WM3A 2XMSA 4F7WA 2J0SA 4UDOA 1QFMA 1VLVA 3DBLA 3LPNA 3EEIA 3TRFA 1CS0A 4J6FA 1X0XA 4ARVA 2BCEA 2DFNA 3U7IA 3TLXA 4E7PA 3RIEA 1GYRA 2QUAA 1ZVKA 3VSCA 1YZNA 3W4JA 3W06A 1N92A 5J4HA 1DBVO 4Y98A 3T61A 4BNXA 1XMPA 2I7DA 4H60A 4K86A 1KZ7B 2CW5A 2OLKA 4W1PA 3QEBZ 4NENB 1KIAA 4E13A 1XT6A 1M10A 2IXAA 2YZGA 4XQ9A 4OLBA 5ITWA 1BKSB 4RJKA 1S1CA 4DSNA 2XYGA 2WWGA 5JPIA 4NHOA 3CF6R 3H5LA 3QMPA 3UK2A 2J4CA 4J9VA 3T9EA 4MS1A 1ZCFA 3E6AA 4ZRNA 4C06A 5DEIA 5K2MA 1TU3A 1ZJ4A 1Q14A 1RP7A 1GGKA 5HRUA 3RG2A 4P82A 5EOVA 1NL3A 4EG8A 2DOKA 5HTKA 3FOCA 1PDVA 5BN4B 3EEFA 2D00A 4L8VA 2NXNA 1WPXA 1OJ7A 3HJRA 3C0KA 4REQB 1OUMA 4IM7A 5DEOA 4OK5A 3M4NA 3USES 4UPEA 1ZA1A 3BXOA 4NBTA 3DEFA 2WTUA 1HDOA 2J5QA 1RJ9A 2LIPA 1B8UA 4LQLA 3FTFA 2UKDA 2EFEB 2WDZA 3BQMB 3L6OO 4GX1A 1E79D 2KPOA 2W6OA 4LJ8A 3F6SA 5ECYA 5FT9A 2WI8A 1RXIA 3I64A 3N6VA 3QG1A 4KUGA 5E8RA 4ZHQF 3FR7A 3N87A 5GINE 4IRUB 5LMUB 2EWMA 3O8NA 5CM2Z 2QVYX 3I05A 4UNIA 5IWAB 4CL2A 2FSIA 3ODGA 2E4YA 1C4XA 2OV1A 1G291 3CCFA 3CVUA 4FKBA 4PTYA 3KSAC 2H08A 5HX7A 2A6PA 1FE8A 2BT4A 2GZ3A 3T1VA 2FWRA 2YFQA 3DT6A 2JLZA 3QEAZ 3EVBA 3PNBA 4QT0A 2IBTA 2WAMA 2WYHA 4BMVA 3KE8A 3ULKA 2ZR9A 4MR9A 1DUVG 3ZGZA 5B37A 1S6YA 1MEOA 5TR9A 2NO1A 3IUYA 1MCZA 1QS0A 4LXTA 3TEJA 1Z4MA 2Q6TA 1DDGA 1B0UA 4XJVA 1Q1BA 1T4GA 4M8SA 1UBFA 2VXCA 4BC0A 1EUDA 1JWAB 2GB4A 3QEKA 4IKPA 4KG7A 5AXCA 3T06B 5C4MA 2CJWB 2XBMA 1SBHA 3WBFA 1G8MA 1Z6YA 2JATA 3P9SA 3JQGA 2WVHA 4FN4A 3PKIA 4K5QA 5CIWA 1VPLA 3OOJA 4QM7A 5REQB 1SULA 3LY7A 1YAHA 2N1MA 1BFKA 3NIFB 5BR8B 2JBAB 5EIHA 1RM5A 2V7GA 1SC6A 4IG4A 4IOLA 2ZUWA 3JYQA 4RU1A 5JNUA 3FRHA 1RWVA 3NTUA 3L7MA 3U7EB 1IY9A 4GHWA 5IBCA 3WIDA 3VA7A 4DA0A 3HO6A 2WJYA 3M34A 3LSTA 3TYXA 3KD3A 3I0NA 4BGEA 4JDUA 3MF4A 4N6OA 4NDNE 2XQJA 3LGSA 5BXQC 5FOQA 3GLGE 7AT1A 1J8VA 3TRKA 3JASB 1THZA 1Q7EA 3NJ8A 4RDCA 4HX9A 4B0OA 5P21A 1X7XB 4G4SP 4TYNA 1RZRA 5HIKA 4CODB 5C0OE 4LE1A 4Y6LA 1YGPA 4F5ZA 1KEEA 4JBGA 4Y6OA 4KCGA 2DGDA 4W5OA 1XDUA 4TMXA 3PJFA 4EQ6B 1M2JA 2R1UA 4ZA2A 2CDAA 2HSWA 3V8PA 3BBLA 1QVWA 1RJWA 2Z8YA 2JW5A 2K5UA 4BNLA 7YASA 1CRPA 2HD4A 1OZ0A 3ID6C 4Y7DA 2CV2A 4BVJA 2DKOA 2YMMA 4TMKA 3MGGA 3WA7A 3K73O 2Z6UA 3T3HA 3AH8A 1OXTA 1TLTA 2VP2A 1CS4C 2CNBA 2OAEA 3DZBA 4J3FA 2LWIA 5FAKA 2AC7A 2IU0A 5CVTA 4GBED 1CDOA 4TKUB 1FQWA 5JMWA 3C3PA 4R69A 5EMHA 1SCBA 1VJ0A 4KN6A 2E49A 3DFFA 3IYLW 3P4XA 1UBKS 3G7NA 4LYAA 4EPXA 5HQ3B 2C2YA 4WCFC 4XCQA 2BM0A 1NVTA 1XTUA 4HNRA 1LS1A 2XWJI 1R00A 2HMTA 4H77A 4URXR 5EQFA 7GPBA 5GOTA 4LDQA 1HV8A 1TYBE 5AICA 1H5NA 2JFNA 2XEDA 3PSAA 3KB1A 4EY6A 4ER0A 3FPAA 1PL6A 2H07A 2Z9BA 3QELB 1D9XA 3F9CA 2RKWA 5H5JA 5LD2C 1W36D 5TQ0B 3OOHA 5BQPA 4GH5A 3CRMA 2G28A 1UR5A 4C7JA 3AZQA 3RPEA 1KI7A 5BNTA 1DEXA 4Q4CA 1VHLA 3WRXC 4DIUA 3I9OA 4DEYA 1VJ5A 4KWCA 3AZOA 4YUZA 2BLNA 1CUCA 3OZVA 2OBNA 5DWQA 3WQBA 4DMLA 2YFHA 3LY9A 3Q7IA 1H2XA 5DXFA 1E2UA 3ZCRA 4CEJA 2A9QA 5CIQA 1KXZA 3TSCA 3ZGVA 1L5KA 3S8EA 1RWQA 2CVHA 3BE5A 1TEHA 5B64A 5FQNA 2FDCA 4R2HA 2VWHA 4B32A 1H6BA 3ZGOA 3THYB 5IZ4A 1VL6A 4WK6A 1THGA 4PZYA 4QELA 1W25A 5TPZD 4IZIA 3QQPA 3NQ41 4FLFA 4X3OA 4MGHA 1AU9A 5E4YA 2ZE7A 4YXWA 2POCA 4CHTA 1GRCA 5EXXA 2OXTA 4MHTA 2XKAA 1HDYA 2GD2A 4LNHA 5B6JA 2IYAA 4DNQA 4UDYX 2Y0DA 4PLHA 5DYGA 2R6GA 3R0QA 4NNJA 1TUBA 4BVLA 1QVZA 1WHTA 2FZCA 1BCRB 1M33A 1TC1A 3EVNA 4FFLA 4AG3A 4WK2B 1X8LA 5AVYA 3WIEA 1M2VA 2ZE8A 1ARZA 3JQ7A 5ALYA 5DDIP 2PTGA 2R25B 5DHAA 2NZ2A 5AQ1A 4EJSB 4OXIA 3Q6IA 3U4GA 4CKBB 2DBRA 3TOCA 4YJHA 1W6RA 2JL1A 5CK4A 2H65A 2XCUA 1PX0A 3C7TA 1L6IA 4FDLA 3UJPA 1FRVA 1UUFA 1Y3BE 1J9GA 3OKFA 1AVTA 2B21A 3ML1A 3IERA 3KLPX 3PYLA 4NCXA 2ZCVA 3VGJA 2DTDA 1JQLB 2P4EA 3QJ5A 2R66A 1ZUNA 4LJAA 2VTBB 3GLIA 3FVWA 2YVLA 1GUBA 3P4UA 4K46A 2QM8A 2Y1XA 4KO2S 4FFPA 5LA6F 3U5ZB 1GPUA 2BHTA 1GARA 4O4LB 1VE5A 3NAMA 1N9GA 2JD1A 4DSZA 3K71B 4PSKA 4G5YA 3W2FA 5HS4A 2QR5A 3ILYA 3D4IA 4J0HA 1BDBA 1EVKA 221PA 4W5NA 2XA1A 1U0RA 2IOYA 3KOOA 3T5CA 4HRXA 2VO1A 4D8TA 1ZBDA 4GVXA 4OL0A 3UEOA 5KSYA 2HJVA 4CMJA 1UP7A 2ZJ0A 1NIPA 1URPA 3AESB 2ZWIA 4O2BF 2VH5R 5IUKC 1XMXA 2FHPA 1J1UA 3ND9A 3CA8A 3PUIA 4LJYA 4AB1A 3I32A 1WU8A 1E5LA 1U9JA 2RBGA 4X64B 1K5DA 2EP5A 2FUG1 2HREA 1IBCA 2ZBVA 3A9CA 3HXTA 3R20A 1GL7A 2YY5A 4V38A 4CNQA 2OZLB 4QZVA 3FNFA 1Z5PA 1YVRA 2ZUDA 3PKJA 4NZNA 4NYJQ 1J09A 2ZT6A 3EDQA 2CVFA 4HH4A 1D03A 3SLGA 4GP6A 4ES6A 4PCAA 2GN8A 4RXMA 1YQTA 1W5FA 4GBGA 5J23A 4JC4A 3PLRA 1L1QA 1DV1A 4O2AF 4MKGA 3IURA 3U61B 2WBLC 3UAOA 1A5TA 1PR0A 3W78A 3VU3A 4C1NA 2VNSA 3R9XA 4F6RB 4WECA 1YK0A 3OPYI 3UPUA 3DEZA 3AGQA 1H0KA 2WF7A 4CM8B 3IQDB 1H4QA 4KUHA 1G19A 4FGWA 3ZY4A 1BJRE 2BKVA 2IY9A 2Y1CA 3CRNA 2YV2A 3DBHB 4HLDA 5IFKA 4D0GA 2V5UA 4YWHA 2I65A 3QLEA 2CEAA 2FEKA 1YHZA 1EFRD 4NDAA 1QGUB 2DCUA 3KSBC 1V1JA 3MAJA 5K4AA 1MA0A 2O1SA 2PUHA 2FVXA 2TYSB 4FOPA 5B57C 3IXQA 4UBMA 1J1IA 1SQ6A 2VH2A 1OXUA 5TJ9A 4MGZR 5FWDA 4DB4A 4GP7A 1M0EA 1BN7A 4EELA 5INTA 3QU7A 1JEEA 5ED0A 3P0RA 3RAGA 4DIEA 2FEPA 1PAUA 1NF3A 4IXDA 4YPFA 4JR0A 1R7RA 1L4KA 3H7AA 3WGUA 4F1WA 5HNKA 2IZZA 4L15A 4KQ6A 3ZVKA 4FYVA 4ILEA 3SZGA 2QTHA 4ZVUA 1K6EA 4LG1A 4RORA 3SKYA 3TZKA 4GPD1 3E84A 2I29A 4IFIA 1OLSB 1AKVA 3BVPA 1QQAA 1QQBA 1AXGA 1NVXQ 3VJKA 2JLVA 2ZXFA 5FYDA 4KHPB 4GLLA 2FGKA 5D3KA 2ODPA 1I1OA 1I6KA 2CNKA 2DKFA 1UK7A 2BTOA 3JQAD 1SUDA 4GOOD 3UICA 1V71A 1Y6ZA 4RF2A 3W04A 4TKVA 3CLUD 4ZO8A 4WFJA 3Q8MA 2R7MA 3STWA 3OZXA 1UWKA 3T9DA 2P6OA 2YOFA 4WBSA 2ZDHA 4O8CA 3L0YA 3ZTTA 1L5FA 2K7ZA 3D8HA 2P27A 3UFBA 5I01A 4OUDB 2FF7A 4X7MA 3WNZA 8MHTA 3ZKWA 1RTTA 4ESHA 2HWUA 2GK4A 5T5QA 2BI7A 4Q1FA 2ZR7A 4QVKA 1SC4A 4ZZ2A 3OM0A 4E07A 2RHLA 3ZVMA 3B6JA 3GVPA 3OESA 6PFKA 1BZYA 4RVOA 5GMOA 1Y7PA 3QX9A 1VDZA 3LOQA 3SIWA 4KTVE 4PAQA 2IPMA 3BIJA 4JB2A 4YJ3B 2W8BA 3HFJA 3GBVA 3PEEA 2BDEA 4DLKA 2GHQA 2I2XB 1R6DA 3DVRX 4BUZA 2O0LA 4QPCA 3TTSA 1P7CA 1DMRA 5ALOA 4TQGA 2VTDA 3CIOA 3NXSA 4F96A 1CZOA 4HVAA 2XLBA 4KW7A 4QU9A 1I01A 3HU3A 1QF6A 4BVGA 2YN4A 4IJ5A 2ODNA 1J25A 1P81A 3ONVA 3RVKA 1NW6A 2PL9A 3GRKA 3TGLA 1FFCA 1QLWA 4QULA 3V8EA 3CX3A 2FPPB 2LKDA 2PUVA 2YWEA 3CZPA 4WBNB 3WK4A 3IDOA 3X3HA 4P83A 3ZE1B 3I1IA 3RYCA 4DV4B 3OQJA 2BWJA 5IDVA 2BR3A 1A9ZA 1U0GA 2RJ3A 2B1RA 5A9TA 2DWUA 1NU8A 1PSDA 1XR3A 4Q19A 2KBEA 3L1KA 2OQVA 1CKEA 4HTFB 4MUJA 5I8WA 2DM6A 2C54A 2JDIA 3KL4A 1I4EB 4TZ6A 5D3MB 2Z1NA 3QENA 4GR5A 3DZIA 4KWIA 4Q93A 5BOSB 2TSYB 1E6CA 1TQ8A 1CV2A 3QVGB 4G1CA 5JUWA 5LJIA 1UXGA 4TYWA 2OK7A 2QTRA 4JL8A 4KITB 1ECJA 1KMMA 3LO5A 3AF0A 4M1EA 1Q0TA 1EGVB 1Z33A 4H1VA 1GFZA 2VP6A 9ABPA 2EQ5A 4ZCQA 5JAHA 3W79A 1SXJB 2ZIAA 3KAPA 1TL7C 2AFIB 3R7BA 3I53A 5KYXA 3ZJ4A 5JFGA 3UW1A 1OFGA 4RS4A 4Y6RA 3WICA 1LU9A 2IHKA 4MV1A 4KO1S 3GEEA 1OB2A 2QMHA 4E4TA 5JJBA 4MAMA 1T35A 4UCQA 1J5XA 3QF7A 2XVMA 4E3ZA 2C20A 3G9ZA 2NZYA 4DARA 3T1NA 4EYQA 2NQ8A 3SOPA 2GXSA 2AD1A 1AQUA 3KJGA 2DBZA 5J5AA 3RODA 3JWGA 3DKKA 2Q1WA 1P60A 4LQ4A 5CR9A 3V48A 3X1XA 2XNKA 3CNQS 1KO8A 4C20A 3AO0B 5IYZB 1ADCA 3E7PA 2Q4BA 2QZPA 3THXB 1ZN9A 3OEEA 2CF5A 4IV8A 2OT3B 3O8DA 1ISSA 1DC7A 1UBSB 3VM6A 3ILXA 4CLXA 3OQIA 2HRBA 3QX8A 3AETA 3UHPA 5C5CA 4FQ7A 4KSBA 2CMGA 4QJ3A 2JJYA 4BO5A 1MXHA 1OBVA 4NNPA 4B7CA 2G9ZA 4ZXPA 5GJBA 3QLVC 5B6PA 2JD2A 4FHGA 4DOMA 2FRDA 1R4NA 2XZTA 1GCGA 4EMSA 5K6TA 2GHTA 4FYHA 2QW1A 1KPHA 2QP4A 2YQ5A 3LZ6A 1I4OA 1U99A 3M1IA 3D81A 4WZAB 2QD3A 1IVSA 2IE8A 5H0IA 4KXNA 2A0XA 4H7FA 2JJ8A 3NJ4A 1FS6A 3JATA 1AKQA 4RSHA 4GMGA 2B7LA 3PQ6A 2HQOA 2WABA 2HSEA 2WW8A 1DKNA 2A9VA 3Q5DA 4J2TA 3ZHRA 2GD6A 2H1OA 3FPGA 3P32A 2ZDQA 4D46A 5DN6A 2AOTA 2BTQA 2GN9A 5AJVB 4TWAA 2I2AA 3TLGB 4C3VA 3AVVA 1FFDA 2QN6A 4X1KB 4YLGA 5HXAA 2X9VA 2XNJA 3SSMA 2JGDA 1AF4A 1J5PA 4DVGA 4ROSA 2R6CA 2L0XA 1AKTA 1FSGA 3DYBA 2PZMA 4PTZA 2IBSA 4EARA 4CCAA 1MN6A 2ZSDA 1JMVA 2VP5A 3NBXX 1GU0A 4RVSA 4JFAA 3EIOA 1U6IA 3DE2X 3DQZA 4G85A 3BMNB 2QAJA 3DO6A 2LPMA 2C9MA 1LJ8A 4Q9DA 2VBGA 1NQVA 4RY0A 2OLJA 4OBXA 3VISA 3WGQA 3TDKA 1ZGAA 1PV1A 1R4AA 3GVCA 3OT5A 4OLFA 3AJ9A 5L40A 3GLFA 2WINI 4DT1B 4LXIA 3B7WA 4MKFA 2NU9B 3VO1A 3UKDA 2V4MA 1P7PA 1Z0JA 3MB8A 4FJ0A 5G0VA 1ZR2A 5KPJA 1M8PA 1RCUA 4N03A 3SC2A 2GCGA 1Q0QA 4PSVA 2WOOA 4FQ8A 3W6OA 4JZYA 2XRZA 1GG2A 4EO4A 1RXVA 1G3MA 4HWTA 4UQLA 1NRIA 2VC2B 1Z4OA 3E9NA 2Q6OA 4AKIA 3I01A 1MBZA 3N2KB 3HJCA 1SQSA 1IY1A 2XTZA 4QPPA 4B48A 2F8SA 5EJ5A 2RH4A 1AE1A 2B4RO 3DW3X 1CP3A 2F7SA 1YU9A 3F6RA 1T3HA 4NY1A 4A0HA 1CDEA 2O8DA 4NLLA 1IZYA 1W4CA 1XHLA 1RWWA 3Q12A 4QKQA 3AVOA 2CDNA 2H9AA 4I3GA 2DFDA 3L8DA 3T15A 2AK3A 2VTEA 4D4IA 4CZ2A 1K9VF 1NBIA 1PJTA 2OESA 3GT7A 4TLEA 1ZQ9A 1M34B 1W2HA 4I46A 5MDHA 3AR2A 3OETA 3RC8A 2Z5GA 5HSGA 1DUSA 1FFHA 4GYJA 3TQSA 1F38A 4CDNA 1MPTA 1GSAA 5E1DA 3LVQE 2P90A 4F6LA 3IAAA 3TSWA 3N6XA 5A62A 2IW1A 3K92A 2OMEA 4OQZA 4PQYA 1GA1A 3TIGA 3GDFA 2NPFA 4YFYA 1OGJA 3EZGA 3ELBA 4BBPA 4N82A 3BF7A 2CEKA 2PBLA 2UDPA 1NBHA 1IN8A 4Q1EA 5ULLA 5J4KA 3A6PC 1SVUA 3EZ2A 4RH1A 5CT9A 4BWVA 2E2WA 4F3CA 2F4VB 4U2GA 1EIZA 3AERB 5JDCA 1PT5A 5E7JA 5IJ9B 4M1SA 3ME5A 2WT9A 3H18A 2ZUBA 4UATA 5KI6A 1ZJWA 2NOAA 5DYYA 4PAWA 3JALA 3DO5A 1QUEA 2H4JA 2Q4TA 4LOAA 1QPGA 1A2OA 1F9EA 1T9BA 1JAXA 1Y4SA 1XVUA 3CLSD 3K0CC 4I55B 3LYHA 1MO6A 3R24A 1P17A 1JSLA 4CFSA 1QIDA 5IJ0A 3BAFA 1RZVA 4LRWA 4PZ9A 2DHEA 1QRRA 3S2YA 4DEXA 5K6AA 1OH5A 4OAOA 3U7FB 5IBPA 3CHYA 3BSFA 4CYMA 1HR0B 4II2A 5K0FA 1XDBA 3A11A 3A6KA 1RLMA 5JIBA 4M53A 1XXLA 3TG8A 1QPZA 1BSVA 1A27A 5EPEA 2JCBA 5AM3A 1IC6A 1W85A 2EKLA 3KOZA 3QYAA 2OMKA 3JAWB 2AC4A 1PT9A 1YZFA 4KPEC 4YJGB 3AFNA 4MOWA 3C15C 1S7GA 1V9CA 2W2VA 3AU9A 1R9GA 5BW8A 3ZHXA 3BJRA 4LOHA 3ANTA 1R16A 1T24A 4UDXX 3UHFA 4O33A 4FUTA 1HC7A 3L7IA 1A50B 1JDJA 1E62A 2KW5A 3H17A 4HY3A 3DLHA 4P7JA 2NM0A 1SU4A 4RMNA 1FNBA 3IUNA 3UK7A 1HA3A 4CBVA 2C7PA 2CJXA 1CUWA 2NZJA 3I2KA 2Y71A 3WGGA 2D7DA 3S7TA 3FNQA 1NVKA 2GVNA 4UAGA 2PGXA 3T7KA 2J67A 2JC3A 4M7RA 3A6LA 4WEQA 2G82A 4ZOLA 3TUIC 1P4RA 2AZDA 2EBWA 2GYYA 2PKRA 2XJ9A 4LDJA 1T2FA 4PSDA 5JVDA 3NHLA 4HDNA 4L8LA 1TQHA 4AVYA 1ES9A 1YKGA 2Q8PA 1W5EA 3HZHA 4OGKA 4Z7QB 1A9XB 2C2XA 3BB3A 4BGUA 4P2BA 1HQKA 2BGRA 3CPSA 4CL0A 5FXMA 4EOGA 4P3PA 4WKBA 2CGEA 1YS2X 1SIUA 3DLIA 3L18A 1NUHA 4QPJC 5G02A 3DB2A 1SKAA 3QPVA 3RFFA 2IE0A 4H2DA 3TIVA 4GL2A 5BOVA 3EPLA 4L5JA 1HH4A 5CB6A 4WJLA 5LNK1 4Q4AB 5JSFA 4Q3CA 3PFWO 4IDCA 1O95D 1VSVA 2RGDA 3NKLA 1MRNA 1Y3HA 2EJCA 2VJPA 2JLSA 3HO1A 3GPIA 1UDAA 2O9JA 2B4YA 3LCVB 1M6EX 1CRLA 4D6XA 2JZCA 4IJVA 1MRSA 2RB4A 2C1XA 4J16A 5DNEA 2OHFA 3LCJA 2E21A 4R9UC 4M0EA 3VX3A 2OBFA 1SEVA 4KRFA 4FSXA 4MWTA 4CE6A 5BR4A 4MMYB 1ZLYA 4A26A 3LH5A 5C3UA 5TF0A 1RD4A 2Y4OA 3B36A 3KRTA 4G25A 3EXEA 2X5XA 2PZAA 4YAWA 3ZZUA 2WFMA 1WIWA 1L5HB 3OPMA 3ETHA 3KOXA 4B45A 1VSBA 5HOQA 1WA5A 1A9QA 2BF7A 5ITZA 2GCNA 3KKPA 5ED4A 1NQXA 1TVEA 1QIIA 4HDCA 4BASA 3M4JA 2DWCA 1TYDE 2QGZA 1T6ZA 4AJHA 1BXRA 2FQYA 4EG4A 1H65A 3H2IA 3CRRA 1Y0BA 1JHZA 3LQQA 3QOFA 3S28A 1OY1A 2C00A 4BLWA 5BW5A 1B6SA 1A8HA 4QD3A 3TR5A 4G1MB 3BGVA 4P5DA 1XJQA 1KP3A 4OBEA 4WW0A 5AVZA 1V2HE 1I51A 1R10A 1RCFA 5EJ9A 4FW8A 1LSSA 2A1UA 5TS3A 1GSHA 3WLSA 4F3NA 3KT6A 3ZDCA 3FR8A 5EIFA 1KQOA 5H3HA 3HP7A 4BNVA 4BVFA 3N3BC 4H6XA 1Y7IA 1YDHA 1EK0A 2GPAA 3A7EA 1SD5A 1C3LA 4OQPA 1Z26A 4RIEA 4ZOAA 3G0DA 3SD7A 3ZJ5A 4BLUA 5K5EA 2NUBA 4TLDA 2XYHA 5AT1A 3GJXC 3SNKA 4KQWA 3T3IA 4B6JA 3NGLA 1GUAA 4P32A 7REQB 1XZNA 2C4HA 4ZJPA 3IUJA 3NC0C 4ALJA 3RREA 1WDMA 3WGTA 2WPDD 3L02A 3UBMA 1NW5A 3VDMA 4AQ7A 1Q77A 2J3DA 1XVAA 1KZYC 1R0RE 2VR1A 4CIXA 3RRZA 4X60A 1Z28A 5JD6A 4QJBA 3GCWA 2OWDA 1XCJA 4AXXA 1OI3A 2HB6A 2X8WA 1GRRA 1RMQA 3HJHA 5HDQA 4D92A 1SHKA 4IIDA 1E6UA 5DX0A 1GFWA 1ZVMA 2P9GA 2VDWB 1YRBA 2PS3A 2VSNA 3OQBA 4ALKA 3L41A 2P77A 3H13A 1H3FA 3ONDA 1YDEA 3R0JA 4J49A 3AF6A 4TVBA 2ZIUB 3PJGA 4XD7D 1K2WA 3MILA 2VPTA 4BUJA 3UT6A 2WTNA 3K09A 4HOYA 1ADGA 4JXKA 3ZNNA 1AQIA 1RS0A 1KRWA 1I3MA 2W6JD 3FYDA 3LHSA 1YVUA 2PUTA 1PZNA 5C7IO 3ENKA 4B9AA 5HJ7A 5AUPB 4R6WA 5KYWB 2LW7A 1HLGA 1EEHA 1GV0A 1ZJZA 2VLIA 3QLUA 2FR8C 5DNUA 5J40A 4B40A 4U9HS 3WHIA 3T3PB 3EQ9A 1ONNA 5K3FB 2ZT8A 1LSJA 2K6GA 4M9RA 5DTJA 3RR2A 1L5MA 1UQTA 3PU6A 4IO0A 4ND2A 4G0WA 3IB6A 2YZ7A 1GPLA 1VBNA 4JSTA 1GQRA 2C42A 2ZTVA 3E22A 4LE0A 5GAJA 1N4AA 3NNDA 3TVTA 2I4LA 4Z49A 1KDOA 4G8CA 5BSGA 4LAFA 3I5XA 3RC9A 3UPDA 3CR7A 1EB9A 1F7VA 3UKOA 4LF5B 1GVNB 1YB5A 4CM7A 5LU9A 1NW7A 4NBRA 1KDRA 4C0SA 1PKXA 2V4UA 5A0VA 4D5EA 1S1MA 5FORA 1WEHA 5EP3A 1PNTA 3CEPB 4LZAA 5BWCA 2GN0A 3M2PA 4MYUA 1T43A 2F90A 4FOTA 4M0UA 2QD5A 4OYYA 5D8DA 4TXMA 2PRYA 5TVKA 3T9BA 3WL7A 2PGDA 1W87A 3X1MA 4H3VA 2DLDA 3ZJUA 2FE1A 3GRFA 3LDGA 4P4GA 1Y5LA 2AMJA 4Y1FA 1ORWA 4CTJA 5AVKA 5EJ4A 3WHPA 1PJ8A 2YWRA 4Z3DA 4K2HA 1YFKA 1CK4A 2PL3A 4MWDA 2PX6A 2OPHA 3VV3A 4DLLA 4YRIA 3D5EA 4YUXA 5DI3A 4BVBA 3HGMA 1A9PA 1L1RA 3T4XA 5C7OO 1CDZA 1CY8A 4TMYA 5C1BA 3IIKA 1H42A 3H7IA 1V37A 3CLVA 1UPAA 1TCVA 3N2ZB 2B5VA 4O1HA 2HU7A 3NUQA 4KOEC 1U7XA 4AK9A 4JT9A 4UEKA 2BRUA 3O8LA 4RC9A 5FTJA 1E1LA 5LZ7A 3WMXA 3TQCA 5JDIC 2QTTA 4EWLA 1JTFA 1SIWA 3VSDA 2P3OA 4GMXA 1N7GA 3MT9A 4YEDA 3TXAA 3U5TA 3RBVA 3AI1A 4R1UA 4B74A 4OBWA 1J9ZA 1F2UB 1XP5A 5FBQB 3RASA 5KU1A 1CR6A 1VRWA 1Q1EA 3FUTA 4X6XA 4LWOA 3OOSA 3SHQA 1JJIA 4JAVC 3WXMA 4BJ6A 1NZDA 1R1DA 5GTDA 4W9NC 1TU4A 3E58A 3R0XA 4HNQA 1UPCA 1RRVA 3K0FA 4J6EA 4XJSA 1WB5A 3BUSA 5EJ2A 3B6ZA 1U2GA 3JQ8B 1PDWA 4UVDA 4R2JA 3T38A 5CTJA 4PBSA 1PS9A 3F97A 4GPAA 5K8JB 3W2EA 2UUPA 1WPRA 2XH8A 1FDRA 1WMDA 4OHRA 1EI9A 1KMHA 4KXMA 4LWZA 1ILWA 2R1ZA 1X94A 2BMFA 2ZJ1A 3UXYA 3V42A 1RTKA 3IVAA 5G4KB 3WAJA 3K70B 1UFKA 4NX2A 4L22A 3HI6A 4NG4A 2ZI3A 2RHTA 1UK8A 3OURA 4EY3A 2H3HA 3D8TA 1M2FA 4P7KA 5ALEA 2UAGA 2E55A 2QYTA 2W2OA 1XWFA 4KE9A 3SBXA 4FMCB 2ZIFA 1Z74A 3NT5A 5NLLA 1TLFA 2D4AA 3W9UA 4OU4A 2VXOA 1KA9H 2WMDA 3UW3A 5H81A 4LBZA 1VL0A 3I2GA 4HDKA 3ELYA 2GO1A 4OK3A 5A5GA 5DNCA 3OFVA 4UE6A 5IJWA 1WBBA 1H3EA 4CQNA 1N2CA 1U6JA 2H06A 3EC1A 3HA7A 521PA 3V34A 1KERA 3DFUA 1M1NB 3JYPA 4WLVA 3WYGA 3T9AA 4NCIA 4F4UA 4HNTA 1BNCA 4MQFB 4PQEA 1KBZA 4RJTA 2I6UA 4O08A 2HMYB 3CO0S 2DAPA 5ALZA 3ZU4A 1V41E 2AS0A 5IN4A 4Y2GA 3I6BA 1ZFNA 5KKNB 2JIBA 2XTAA 4KQFA 5AUOB 1N9KA 3QTLA 1R4MA 3QWHA 3WV4A 1WXEA 5PGMA 4BQQA 2ORIA 2OC4A 3A58B 2FWNA 2ZYAA 5JOQA 3TNDA 1FSZA 2FRVA 3PFGA 4BO0A 4F85A 1H1TA 4Z1MD 2HH9A 1REQB 3C6MA 4L4RA 4M8IA 5E6UB 1NUTA 2ZB4A 4K6CA 4MV9A 1C41A 4TSFD 2J4DA 4PG7A 3A6JA 4EKYA 4DY6A 3AZPA 4HAWA 3OFKA 4S12A 1E3EA 3JQ9C 3QJYA 2BUBA 2XYVA 4NOLA 2OVFA 4NYIQ 4WFQA 3SHWA 1PYDA 2PX4A 5T3UA 3TLEA 3WLEA 4FWTA 3FCUB 1DO8A 3DONA 4D97A 3TRDA 1EG2A 3C8MA 3DPIA 1HDRA 1DTSA 4CKXA 4PLZA 5JEDA 1DKOA 1MDBA 4CCYA 1NC1A 4EG1A 2VVTA 3RFVA 2AA3A 1FUEA 2VSXA 4HXFB 1DC3A 1WAMA 4U4AA 1JXMA 4YQYA 3HKCB 1ISMA 5FX2A 1SMKA 1JDTA 2O57A 4J1SA 4J0FA 4EKDA 1LWOA 5MF6A 1GA6A 4WGGA 3MRVA 2AYYA 3VPHA 5IWCA 1XPJA 1X92A 2DYKA 3GFFA 4QG7A 1OXXK 3I8XA 1D7OA 1GPJA 3TBFA 2GM5A 3M83A 4O1IA 4DIFA 3BMQA 1KO7A 5KTTA 1J6UA 2CD7A 3DTVB 1USVA 2X9LA 4JDPA 2D06A 4WL0A 5FUQA 5I9IA 4LS3A 2LNDA 3PIDA 1P44A 3IUMA 4HWPA 3S5JA 3D7KA 3FDZA 3DFIA 4ARZA 3V4RA 4LISA 3B5JA 3FXAA 3FGPA 1NYRA 1E1YA 4X97A 3DOIA 3COYA 4MW5A 2FSPA 2X7HA 1WTCA 1ADBA 3ND6A 4F4FA 2L69A 4MSUA 1AK2A 2YJ5A 1W4AA 4EY7A 1OR8A 3E82A 3IQHX 4JEUA 2FV8A 5DHUA 3RGGA 5HF5A 4BNTA 2FUEA 5BUSA 1CYDA 2AN9A 1OSNA 1KKUA 5E3JA 4R98A 1EUCA 4IGFA 4YMHA 1EQUA 3AVYA 1JYFA 4JVNA 2V98A 3FJ1A 5B1EA 5LDGA 4FWIB 3EXHC 4KMRA 2BFDB 5EMJA 3K0SA 5IRCD 1ZC3A 2XUOA 5EE9A 2YCBA 3GD5A 1R88A 2QN1A 1YR7A 3IJEB 3L7CA 3HCNA 3MGCA 4IHKA 3IT2A 4NJEA 1NMEA 2G36A 3MTGA 3O4FA 3MMPA 2E4AA 5FNVA 4PLPA 5FO1A 3FD8A 2G63A 3CX7A 3GQVA 4DMKA 1IHUA 5JYCA 5JBIA 5ADWA 1X42A 4AMBA 3G0HA 3DHVA 4I4TB 4M54A 4YA6A 5C8YB 2HLHA 3TS1A 2JVIA 1FS4A 3EFOB 3WAKA 1Z2EA 1GP2A 4UTVA 5JR3A 3ER6A 1C9EA 1JALA 1T4BA 3NUZA 3EW9A 4NENA 3WB1A 2FWMX 1IEXA 1Z4QA 2V7EA 3ABZA 2OZKA 5EFZA 2V65A 4DXAA 1DJNA 2XDQB 2FVYA 4ISCA 4RPCA 1Z5ZA 2BFNA 3H1BA 3LNTA 4PNHA 4D9HA 1LH0A 3WV5A 4LJ6A 2XJ4A 1B0AA 3SSNA 4QJIA 1C8VB 3HA2A 4Z5XA 1TI7A 1FTSA 2VS1A 1RWMA 2ODBA 2ZS8A 3ACBA 1EFHA 3TAHA 4A16A 3TAXA 4DRXA 5B4TA 1PGQA 5JASA 1NMXA 4GOJA 1E5VA 1FX1A 3T1OA 5BN4A 4DA9A 4OLJA 1DDIA 2J3QA 2FWAA 3FMPB 1V35A 4LZOA 1W93A 2Q50A 1E92A 5FWAA 1GG9A 3RT7A 4L5CA 4TLMB 2C2HA 5KOIA 2B69A 2J0EA 4FR0A 4DMRA 1KVSA 3EX7C 2QPLA 3A05A 3VUEA 2CLEB 3EA5A 2JGNA 5EKXA 3SJBA 2VK4A 4PE5B 4FX2A 1Q0UA 3PRHA 1KY3A 3P9QA 2PT9A 3TAUA 3AOEA 5LMNB 4M9CA 2G7ZA 4EJFA 3RJMA 3EVDA 2VAVA 2VRNA 4EUHA 1T0BA 5JATA 3W3AH 4BTEA 4OYRA 1CQWA 3WLTA 3GAMA 1BD3A 2IXEA 3QFFA 2TMGA 3VNRA 2PS0A 3OOYA 3TL6A 5DM2A 1PJLA 2B0CA 5E6SB 5JSQA 5F2KA 4HGRA 1EFVA 5CJ2A 3U62A 1LQTA 1Q3TA 1I94B 1Z68A 3OZSA 2J9YB 3ZTWA 1JEYA 2QD2A 4R0NA 3NRBA 5ARBA 1OH6A 3GNQA 3N8GA 2CJWA 5JXJA 1Z4NA 3MUEA 1Z0KA 4KEAA 4LZZA 1P1BA 2EIXA 3KR2A 3RG8A 4EF5A 4N5NA 3VH1A 4N49A 4Q3DA 5REQA 3RANA 2VCYA 3GRUA 1IN6A 4QICA 3SP1A 3I5YA 2IITA 4AZ0A 3W5JA 2H63A 4R4JA 4TTTS 4XGNA 3K6RA 4MVJF 2AWOA 5AKKA 3WMRA 3RVSA 4G63A 1P39A 1Y80A 3LP6A 4R5HA 5IZCA 2OBBA 3FBWA 3G0GA 1L4HA 2A8YA 2Q0XA 3A3NA 4R8KA 1HDGO 4JLPA 4XYEA 4OF4A 5ITSA 3Q11A 3U44A 1Y8ZA 4MRSA 4B3XA 4DUZB 2Z5LA 1NVMB 3GWGA 1CB7A 1D5WA 1HQCA 1XCLA 4NFLA 3I9V6 3RVPA 3C6BA 3RFXA 3ICPA 2WKWA 1W96A 2JBWA 3GJ8A 2NQTA 5JMTA 1QXSA 4WY5A 3C3EA 4S04A 1E59A 2ZRFA 3JSXA 1SA0A 4OAPA 1JEAA 4C0LA 4DHEA 1QYWA 2JGFA 5AOCA 5F73A 1H8HA 1NI4B 1A3CA 1A96A 2Q2QA 3N7AA 2WWRA 1IJEA 2VF2A 4BB0A 4B81A 2WYOA 4FMPA 5LYJF 3R6GA 2VJDA 2WOJA 4LW8A 4LGYA 2VF5X 3ED5A 4HZGA 1RACA 4IQGA 1PJBA 1C4KA 3FVVA 2PR7A 3WRVA 4OSOA 4Z8YA 2HLDD 4PC7A 3QRWA 4M6WB 3MNFA 4S1NA 2R8YA 4X6UA 2XCIA 1W44A 4HQOA 2Q45A 3MM4A 1O9BA 3AG6A 3ETGA 5DOVA 3A6DA 5JCOC 2VOEA 4FFNA 5EEHA 1G18A 2C2MA 1SOVA 1LI5A 2I6QA 4GXQA 2BLLA 4J8PA 1DQRA 2VPQA 1PJRA 1ULSA 4IF6A 1SPXA 2IYNA 4C4AA 4N6NA 5K3SA 3NFYA 1BEEA 4QRIA 4ER5A 3MSCA 9LDTA 2QENA 1VLMA 3MN1A 3BSWA 3B13B 3I1FA 3ZBQA 5JH7A 2BH2A 3PNSA 1XEFA 3IO3A 4G8JA 1Y3AA 4M9UA 4XSHA 1JLLB 1ZGJA 1ECCA 1MH1A 1YH3A 2DH6A 2PSSA 1RZ3A 4XVRA 2FN3A 1P0CA 4KIUA 3GJRA 4LGMA 2H1SA 5EP2A 4BX9A 1E5TA 5J2TA 1FP2A 3BWDD 1RI4A 3NYQA 1ZNQO 3SAJA 3U7JA 1MTOA 4BO7A 3HXLA 1DFIA 2Z56A 3F90A 3RARA 1E7QA 4XWTA 5LDHA 2ZVPX 2WAXA 5EWJA 4DUGD 3THSA 3V6LA 4UHFA 4NI5A 3E1KA 1NVEA 1RM0A 2UUOA 3AW9A 3LT1A 1S3FA 2NTEA 1K7SN 5IVPA 1GPYA 1GGMA 1W2WB 5FPSA 1KR5A 4AJNA 3J80A 3TVDA 3VQTA 3BC1A 5DBEX 3VHXA 3ZZ1A 1X15A 2J32A 3QA3E 4LGCA 4QBGB 4GKJB 1AA9A 1PX2A 1RXSA 4U7PB 3THYA 5F98A 621PA 3E0QA 2DQYA 3F6BX 3RW9A 2QU7A 2AN4A 4W1QA 3TF5A 5C7YA 4YI3A 4BJ1A 3QX3A 2HA3A 3D02A 3F4BA 1N32B 1PJCA 5AKJA 1T13A 1P1FA 1ZNYA 5KWSA 1WCXA 5HA5A 4BBZA 2A5YB 2IQ5A 3QEMA 4EFLA 1M2KA 3V1KA 1R5JA 1U5AA 1MJGA 2V54A 3WZLA 1CQIA 3BF8A 1ZD3A 1UM8A 5EWLA 1N6NA 4MW9A 3Q7TA 3D6MA 1QB7A 2Z08A 1SRRA 3I6IA 2C9CA 1H85A 2AR0A 3PT5A 3MLEA 3QYPA 2L19A 4JNCA 4PICA 3UV3A 4F93B 5EPOA 4DXHA 2A5GA 3QOYA 3GJ4A 5KOHB 3KWFA 4J0GA 1WD5A 4BLSA 4AF8A 4E31A 4EITA 3FSGD 4EJSA 1EU1A 1J42A 2EKDA 3AKDA 3E3NA 5EUBA 2JZNA 1YXMA 3EGIA 3WB0A 4A6XA 4JOCA 4E12A 4IEIA 1IK6A 1HMPA 1MB4A 3KEGA 3O0DA 2XVXA 4QNNA 4DREA 1XZEA 2HV9A 4UULA 4JYMA 5KTPA 1BX3A 1EDEA 4FU0A 3D1LA 1GM5A 1KP2A 4UFPA 4C0QC 3TXYA 4XB2A 4PRYA 3OZIA 2NSLA 3OHMA 4WV3A 3RTCA 3E9DA 3GFTA 5KU7A 4LF9B 1U1FA 1JTEA 1T5SA 2QVBA 4RYDA 4OMUA 4J90A 3C8UA 1RHQA 3PUXA 4OPMA 3U3XA 1IG3A 2RMKA 1J2RA 2PKCA 3WBKA 4E3WA 1HLDA 1RSZA 5DNAA 3DOJA 3KZKA 5HCUA 5BT9A 3L04A 4PNEA 5BNFA 4O4LA 4R8VA 4YCNA 4A15A 1D4OA 1MVOA 4RA6B 4HAZA 1K6MA 1BTOA 5KQRA 4HC4A 2BZGA 2HY7A 5JISA 4D3XA 1FLAA 4DDMA 1YIDA 4LJ5A 1RQPA 2AE2A 5ESDA 3WIVA 4BOYA 1ZGHA 3GELA 4N5HX 1T9AA 3T3DA 4KO8A 4E11A 5AD1A 3E03A 1EVYA 2ZR8A 1JQ3A 4KNWA 4R7ZA 4LBWA 2QVGA 5JXIA 3AESA 1IEVA 2I22A 3IR6A 4BQRA 1MFPA 5FTWA 5AM0A 4PG4A 5IP5A 4UFNA 2YQ4A 3HK2A 4CGYA 1TECE 2E4WA 3VU1A 3D4BA 5HYVA 2NAFA 4RCYA 2OZLA 4I1OA 4Y2JA 1EQAA 1V5IA 4KXWA 4QU5A 5LLSA 4EI2A 2D5CA 3JQCA 5ALQA 4TMZA 2FSGA 4YQFA 3W7AA 2QVCA 4KYTA 4AP9A 2HIAA 2QDKA 3OTQA 1D2MA 1GADO 2J30A 2PX5A 4HPWA 1ZCBA 2DUMA 2HLNA 1ZY2A 2P2YA 4JC8A 1T1RA 2RHMA 3PNLA 1R66A 2Z95A 5DTQA 1WSBA 2OV6A 2G08A 2AJTA 4TTRA 5AOBA 4TSRA 2WHEA 4URWR 5HCIA 4CM8A 5L3VA 1RABA 1PWHA 2DECA 2KLBA 1L5YA 1ZNXA 4KMMA 1ST2A 2GAIA 3CTPA 3EGVA 3TE7A 1GZVA 1VA4A 5AUNB 4BPBA 1U4SA 3UMMA 1NQ5A 3AFOA 1B8OA 1UJ5A 2Z8YM 4ARUA 5LUBA 1T6BY 4JA2A 5IKEA 5KVAA 3DE5X 1RC0A 3EVCA 3GJ6A 4A5SA 4B3IA 4Q7QA 1CZLA 3UF0A 3HVKA 2QN7A 3ELDA 3B1WA 1JAYA 1W5AA 4G5QA 4JP3A 1Z4JA 4DRYA 1JKJA 1NVUQ 2Y4NA 1XX6A 3RB8A 2A0KA 3W77A 4E2WA 4HLCA 3EUEA 3FCEA 2HCRA 4F4HA 1PTJC 1J1ZA 1R5OA 4PLTA 2Q7XA 4WT7A 5KJCA 3EGXB 5BMVF 1KMQA 2Z6QA 1K3TA 4G4JA 2VOJA 2M98A 2PVSA 2VH1A 4O63O 4ZODA 4II3A 5JNWA 2HHLA 1OLSA 5KS2A 3ABRB 1LA2A 1ONSA 4L28A 2HRQA 3C5CA 3KUXA 2L82A 1EP1B 4X63A 5AESA 2UVPA 3MCUA 1JFVA 3FBTA 3IBFA 3K1YA 3MMSA 3MWEA 4G5RA 2B2CA 5G1PA 5I7SA 1P73A 1I7LA 2GEDA 3PUWA 4GDMA 3QE0A 1JA0A 2OV4A 3TKYA 3CRW1 4FFVA 3I4FA 1R0XA 3NX4A 2GJSA 4RZXA 3SX0A 5LWQA 1GXSB 2DJ5A 2X9NA 3GDOA 2Q9AA 4FD3A 4H18A 5BWOA 3KKQA 3U4CA 1QGED 3DE7X 1CUSA 2WMNB 2ZUVA 1GPMA 1K27A 3TB4A 4CKEB 4KRXA 4W9RA 4PHTA 3VR1A 5IH7A 4RHTA 4E5NA 4OUDA 4FYXA 4IKEA 3S4YA 2E0IA 4ZVTA 1UT6A 4WXPA 1B41A 1U6KA 1CE8A 1T4CA 2NVOA 2JIZD 4H6VA 3ZXXA 1SUPA 5KCZA 4ZCMA 2ZB8A 4LDRA 2LRHA 1F7UA 1KS9A 2QTVA 2D2EA 4GOLD 2B20A 4XLZA 3OFSA 3CX4A 3DR5A 5IM4F 3MTJA 2VPZA 2V7VA 4DKJA 3T35A 2CLLB 2BFCB 3HACA 4LYDA 3SX4A 1E98A 2JA2A 3OH8A 2C57A 4ZV7A 5F1OA 1QOQB 4JHLA 3R7NA 1R12A 2WD9A 4MS4A 3PZRA 2F9LA 3C6YA 4HXGA 4YJ2F 4XWKA 1OH8A 1MQAA 2ZE6A 2AW5A 1Z2NX 1K68A 4W5TA 3IDZA 1Z7EA 4TUYF 1K7CA 3OX1A 4QBKA 3ICEA 4F2DA 4LJKA 2Y8EA 4EBBA 1P1IA 2Q3DA 1JBQA 3TCXB 1U0FA 1JQKA 1OFTA 1J8MF 1GO2A 2QY9A 3E3AA 2CBZA 3PDIB 3SX2A 1FYXA 3ZH2A 4WBNA 3RQSA 1Z7GA 2N42A 3SE0A 4XLLA 3EISA 1KI9A 2Y0CA 3I9KA 1POXA 2BGMA 4TXJA 4RZQA 2IYTA 1U3TA 2CBXA 2IDKA 2TMKA 3G2NA 4Z53A 3G5LA 2XMZA 3LPCA 1XHFA 1UMBB 4XVCA 3TLAA 3GJ0A 2RKOA 5BOSA 2RBEA 4XB6B 1WKCA 1KFBB 1ZA2A 1N57A 3A9VA 3DNPA 3DD1A 1W52X 3OLWA 1OBCA 1O87A 2DHQA 5HBRA 2QQEA 3W1VA 5D00A 3MIZA 2NU8A 2HBQA 1BG6A 3MJ4A 4F4CA 1RHKA 2HUPA 5BSTA 1SXJA 4NOJA 3UJCA 3O2JA 5FI1B 4MV4A 1H6DA 1IHPA 1O58A 1CG6A 5LQMA 4JSYA 3OZGA 3STUA 3EC2A 4PO1A 1QC5B 5CA1F 3HYSA 1ENZA 3HCPA 5JD5A 3IUPA 2RGNA 4CR7A 2W4QA 1VQ1A 2GD0A 5DTEA 2FQ1A 4F8JA 2QK4A 2ZSKA 3BMOA 3SKXA 3I9MA 5E7IA 3G02A 2I2BA 2FXIA 3A26A 2F17A 1NPYA 5ECWA 1D8AA 1M1YB 1OX5A 2C0PA 2H57A 1PR4A 1U81A 4DBZA 2VT7A 3PGKA 4P22A 5IYZA 2W2QA 5CGZA 1UP4A 5KJ1A 2IYLD 3THXA 4PX2A 2VT6A 2YWFA 3QXGA 3AIOA 5TLSA 2JVJA 3SMQA 1F2VA 1RLOA 4RK1A 4K6HA 2YINC 2PQ0A 2JCGA 4CXMA 2V7PA 1ZKDA 1UBNA 3PD1A 4OXKA 1TZKA 4CG3A 1NVDA 1PI3A 2P67A 3KQKA 4UOQA 1QRSA 1VFNA 2AJLI 5FQOA 2EVWX 4PGMA 4U2FA 1DRKA 1O54A 1U7UA 2BSAA 4ZVNA 4A0SA 1XXHB 4DUYB 2AYZA 4WZAA 4BL5A 1V8ZA 5JPDA 2QYSA 2EBFX 2P2GA 1B2LA 2XOKD 3IP3A 3N7TA 4KAXA 5FBKA 3OZFA 3VBCA 3W5DA 4QUBA 2Q21A 3H5VA 1QU2A 5IHPA 4IIUA 3DKIA 3IVRA 5JXHA 1W75A 3HZRA 1WZCA 1ZIOA 1ZUIA 3R8CA 3D4PA 1RYNA 1O6CA 3AB7A 3KJQA 1KDPA 5CHYA 2IU6A 3WO0A 4UVEA 5KWIA 3TLGA 3M82A 1YS4A 2IPOA 4JLAA 5JQGF 2GCIA 2B8WA 1R8XA 2HPAA 2EAUA 3II6X 1IIRA 3DAGA 6REQB 4CLRB 5K6RA 4CN8A 3JQFA 4MGEA 5B30A 2X5KO 3T4PA 4KRGA 1JIVA 1P7WA 1FDOA 3CNEA 2WD7A 4LC1A 3TLMA 3EBPA 3F8SA 1HE4A 1XNHA 3PT9A 3IAM1 4BLRA 5A3RA 4EGQA 2PNFA 4J1TC 3IQZA 1YBVA 3L7OA 1E6LA 1CNFA 4J43A 5KYVA 4B3HA 3BMNA 4DV2B 1XQVA 1Z35A 2AOUA 3BIFA 1KL7A 2OCXA 1N5DA 3WWZA 3ESAA 4ZCTA 2E1PA 2KX7A 3VTFA 1FP4B 2C2KA 4KGDA 1L4MA 1JLMA 2GPJA 3PQ8A 1KK0A 2C58A 3GIDA 5AHRA 3U4HA 4NDZA 3SBDA 2WT8A 4NULA 3EG9B 4QFMA 4Y2XA 3ZE6A 4A6DA 2BJVA 1FFYA 1VZ2A 3K94A 2BONA 3RVDA 3KU4A 4UHJA 1R3DA 4N5IX 4P4NA 4ND7A 2JI6A 2IHZA 3DBRA 3LUAA 3OIWA 4WQMA 3SDZA 3NXKA 1A1VA 1X2BA 2O8VA 1HSOA 1XZKA 1G20B 4Y2QA 3WLPA 1R9JA 1IXZA 1FU8A 2DQZA 2PJDA 3FZYA 4HK4A 4XTCS 5ERGB 2EZ9A 4LZJA 4LF7B 3LG2A 4GIBA 1DE0A 2BHRA 4GZMA 4W82A 2CXSA 4GO1A 5DGDA 1E3QA 3W6PA 1DTWB 1LQUA 4C6RA 1DAHA 3ZKAA 1PGJA 1QG4A 2WV9A 4G1EB 1A4RA 1WU7A 4ZCLA 4LYYA 2HO5A 1JWLA 3BMCA 3IQGX 2PBRA 1P3DA 1PK7A 3F5SA 3SZOA 2JGJA 3OCWA 2CL0X 1RYMA 1SPBS 2B35A 2Y1WA 1XZIA 3HBNA 4TZTA 5GP1A 2FUKA 2OXIA 1JRLA 1M34A 3CPJB 1YQXA 5GVSA 3N0VA 4ZQBA 4ZALA 4LQDA 1IU9A 3AHEA 1FLVA 3IHKA 5CD9A 2GF0A 4MWZA 5A0FA 4Z4GA 4B43A 3PWTA 2IJGX 1E94E 4B6EA 5IDWA 2IYOA 4ZAVA 3EXG2 1U94A 2QN8A 3P2MA 1IOLA 1X74A 2O20A 1UFOA 1NF2A 3K9GA 2VHCA 5JJKA 3SM3A 2QNBA 1QIMA 2HWWA 1YVEI 2PLNA 2W2LD 1PD0A 4DSOA 1R37A 1Q0SA 2GBIA 2I7XA 2R8PA 3NONA 3QKRB 3CW2A 5TQVA 4YIHA 1IJBA 4C05A 1E58A 3ITKA 5DSXA 1S2GA 4C2TA 2GN2A 4QGBA 3KS9A 1Z5NA 1YJQA 4I9GA 1XN4A 2W2MA 1I4DD 3IT1A 1K7FB 1UKYA 1FMJA 2P0EA 2VUHB 3A6ZA 3FN4A 3G6KA 3L82B 3GRYA 3OP1A 3NV9A 3JR7A 5I4CA 4F9FA 1BDHA 3QU4A 1G5RA 3JZDA 4HH0A 4IVPA 1SVNA 3BH0A 4EZIA 3L40A 4DR2B 3Q40A 3GCDA 3K05A 1BQEA 2NACA 3K6KA 3ND5A 2HBRA 4X1YB 2DWPA 5A6SB 3RAJA 3HKBA 1K8YB 4A4DA 4C4RA 3GARA 1PWEA 5ICSA 2QL7A 4Y2VA 1QQ5A 2EBUA 3SFTA 4NVRA 1KH3A 1NMYA 2FP4B 3FZQA 3DF9A 4UBIA 3RSSA 1HE2A 3F6PA 1SCJA 3IR5A 3RROA 3R74A 1Q83A 2PUDA 1DMSA 3OTIA 1F6WA 1TVKB 2GK6A 2HZ7A 1QCZA 2FJPA 1MG0A 3AUXA 3ZLVA 1GL6A 4RDHA 5ADHA 3AIKA 4G5HA 1VBKA 2W6QA 1COWD 2IKQA 5BRAA 4R8MA 4X90A 1DWQA 4GYWA 1Y9EA 4YJGA 1MIHA 4LXHA 4OXRA 3ISVA 2I7TA 3PA6A 4X94A 3SXJA 1B76A 3UFXA 2JAPA 1LBIA 5JAZA 3NO4A 3A7DA 1X80B 3GA7A 1SUIA 2XQKA 2QT9A 3Q5EA 4L72A 4NCBA 2W43A 4MB0A 1FYDA 5A0TA 2RSLA 1VPTA 1PJ3A 2D1QA 2VDKB 1WBDA 1GVHA 1NW9B 2I62A 3KPVA 5EEGA 3QXCA 2O3TA 3AFMA 1KOGA 2AXNA 2J3KA 3F2VA 3BKXA 3M3DA 3L8ZA 1IZ8A 4IX9A 1K8XB 2XADA 1G21E 1FNSA 4RK7A 1YRAA 4MW7A 3MUFA 5A7FA 2YVUA 2OBMA 2WSLA 3FBGA 1SZCA 5AJYA 5ER6A 1IM5A 3NAQA 1Z38A 2P3SA 2QSZA 5IULC 4GG1A 4PLFA 2VUSA 3WLNA 1QV6A 1ZUD1 3S1LA 4DIBA 2DKNA 3OLCX 1J0CA 3ZLBA 5CB8A 2D59A 5IMBA 3U48A 1A9XA 3E8SA 1K8QA 5EG5A 4BKRA 3BK2A 2XQGA 2G80A 4DGSA 3BGIA 1QH1B 2M1ZA 2Z43A 3CMMA 4MRMB 2HQRA 2Z2JA 1JJ7A 1SC1A 3AWDA 3K2IA 1ULAA 4J07A 2FRDC 3QF4B 5EJMA 4AG5A 1K6XA 3ROEA 3TQHA 3WISA 2HT6A 5TPZA 3L8CA 1MABB 2II6A 2MSKA 4P5EA 3SJ7A 3NPAA 5DHPA 3ZWDA 3WRYA 2DUWA 3DDWA 4ER6A 5A4IS 2ISSD 2FCRA 4FJ2A 1AF7A 1ZOSA 2ECOA 2QX4A 4L07A 3UJ9A 4F8EA 4MA5A 1ZDMA 5F2NA 4NBUA 3ZU3A 5B3KA 4JEIA 4DNOA 4XYGA 5IASA 4RSRA 3WK7A 1QGOA 1OWLA 4DLAA 4BE4A 4CMIB 4ZPJA 1SN7A 3MAGA 1Z18A 4C0AC 2AF3C 4YRJA 1EK5A 1E2HA 4AC9A 3VR4H 4AS1A 4PFKA 3EIWA 1X1CA 3K4HA 3HJFA 2N9UA 1UWLA 2X5NA 1L5HA 5K3CA 3SNHA 1KK3A 2WC1A 3VHLB 1K9SA 4D3FA 1JHVA 3UYKA 3NTLA 3KNZA 4ZI7F 2RC5A 4ADSG 1EZ4A 2FPXA 4GECA 5FTKA 2CD9A 3N76A 4JP1A 4MUBA 1AQYA 5FIUA 3RWBA 3S0JA 4YRCA 4AY3A 1IUNA 4BP3A 4LK3A 4U6NA 3GJYA 1QOPB 2O0KA 3K2BA 3HGTA 3CEMA 3TN7A 1V7QA 1M66A 2W6PA 2YWDA 3IMFA 1DPFA 4WLFA 2MYNA 4S2UA 4G0OA 3OZDA 3KPWA 3O74A 1Q0RA 1NT2A 2JGMA 3ISJA 3LX4A 2AL7A 3Q10A 3FVRA 2R4QA 2ZBRA 3ZWAA 5BSRA 3I01M 3RUPA 3K0BA 4ZAYA 2QRQA 5FP0A 1AUQA 2AHRA 3A6EA 3UB4A 1XP8A 1DJMA 2WKSA 3UT5A 1YB1A 2FWJA 3DXYA 4L50A 5E4JA 4RPLA 1H0SA 3OZTA 2QBYB 3MELA 1K5GA 4FTWA 4LGVA 2QJOA 3F1LA 1WQ4A 3IKVA 4TROA 2OFFA 4A6PA 4KR2A 3GCZA 5A1JA 2J6HA 2RI6A 2DP4E 7REQA 1EWVA 1FVXA 3ORSA 1ECPA 4COOA 2XSZD 5GIPE 4R16A 3H4IA 2B30A 5B12A 1KXJA 1N8NA 1SVWA 4FKMA 2X14A 1RQ7A 1ZHHA 1Q15A 2E18A 2RKBA 4MKRA 8GPBA 2FPOA 1EBFA 2IUSA 1S3IA 3JD2A 2C84A 5DRYA 5HPYB 1QH8B 1EMDA 1I3KA 2GF2A 1Q20A 1OPXA 4B6GA 3TNYA 5G0WA 2NMVA 1MAHA 4YCBA 4DDWA 2VDWA 4AIIA 5J63A 5JANA 1YFJA 4KPYA 4BCDA 3JRXA 2CFOA 3RTGA 2Z9DA 4J4TA 5T6BA 1D1SA 3DTNA 5C1DA 2AMYA 2J5KA 1ZN8A 5G0TA 3X1KA 1NBMA 5ALDA 4AROA 2GZHA 1PFKA 4OGWA 2GS9A 5KYWA 3HA5A 2DX7A 2RCYA 1Z7WA 2A3RA 1QORA 4AKSA 5WRFA 1Q91A 2ZBDA 3VI4B 4B6RA 3A3OA 5K3FA 1JH9A 3NEPX 4MVJH 2UV8A 3NCTA 4S24A 2ONKA 5ALUA 3BWCA 3TM5A 2P3LA 3V8RA 2O8FA 1P1HA 1YT5A 2BEUB 4UUAA 3SQXA 1XA4A 3P2JA 4I6GA 4N76A 3GPDG 4MV7A 4H6PA 5EA2A 1JHXA 1FVFA 3VNAA 4EO7A 5T4BA 1EVEA 2BHSA 1US8B 2ZB3A 3OQ6A 3TX2A 2XUJA 2JJ1A 2Y1DA 2EQAA 3PZBA 3SF8B 2P9CA 2B1JA 4LF4B 1M6WA 1O4WA 2JLQA 5CLJA 2FK8A 2WYVA 4U8GA 4NSNA 1KEPA 3EA4A 3D3WB 1EDZA 2YIJA 2C1ZA 3AB3A 2VA8A 2WHXA 4L2IB 2BKUA 4WNCA 3CEHA 3ZBTA 1BGWA 1POWA 4OOFA 1KYWA 1VCMA 4DJJA 4A2QA 3PENA 3QEJA 3GEHA 4HDRB 1E66A 2VXYA 3RU3A 2BGNA 5BQOA 5JLAA 3NRJA 3ZGNA 5IKMA 3VAYA 4DCOA 5L95A 1K6IA 4PW0A 1XPRA 3UANA 2AZXA 2GYUA 2ANCA 2D3TA 3A6GA 1K66A 3K8OE 4KK3A 2JIDA 4REMA 2O2XA 2YW2A 3EFEA 3FJYA 4UVGA 5FHRA 4HZIA 4MYTA 5CB4F 1VE9A 2NP7A 3GGGA 3AEQB 1JHMA 1D2EA 3GFBA 4N5LA 1N77A 1ZN7A 4RF4A 4GM4A 3OFND 2NQ2C 2AB0A 4P1ZA 3GJSA 1TZBA 2H9YA 1E63A 3GK3A 1UK6A 4U0JA 4UHHA 4UJ5A 4M0CA 4TLBA 2BHNA 4RFSA 5KSZA 1LRKA 3RS9A 2B1IA 4KVAA 1CUHA 1P5JA 1T9DA 5JNVA 3ZVRA 5T7BA 4XFKA 2QW8A 3D31A 3I9FA 7MHTA 1XRNA 1MENA 3BX1A 4M8LA 1PR5A 4RD6A 1WXXA 3Q2IA 1YL5A 4I4CA 4LV5B 1ACLA 4XGIA 5GONA 1IMOA 1QPBA 5A2QA 3L8MA 2P9TA 4RGBA 2JEOA 2CNNA 2DRIA 4B46A 4LHVA 4GVLA 5FA8A 4DG9A 5HZKA 2CVOA 3S1SA 3OQNA 1RM3A 3NVAA 2DBYA 3A4MA 4DLPA 1LPAB 1SB8A 3ZYCA 3OAAD 3CUSA 1L5VA 4JSRA 2C2GA 1ULZA 2EKPA 2E7ZA 1F0KA 3LIPA 3LOUA 3MJVA 2AUMA 2SKEA 3AL3A 4HRYA 4PYLA 3GP8A 2JJ2A 1BKDR 2IEYA 5BYBA 4D41A 2ZYGA 1CZUA 3RJ5A 5LLTA 2C03A 4B44A 3C98A 1PJ4A 1PT8A 2DR0A 2IEAA 4HN2A 4I1VA 5EXPA 4HDOB 3S27A 3DHWC 3LBIA 4U7GA 4MS3A 3WLKX 1JG2A 3Q15C 1N2BA 3BJZA 3ZWKA 4TV9F 2AFHE 4AAYA 2CSUA 1MIOB 1SXIA 3EIUA 2D8MA 2GCOB 2J46A 3LFTA 3RLIA 3WNCA 3E7DA 1OT5A 2BBOA 4L75A 4AJLA 2H1RA 2O3UA 2XHEA 4G67A 4IZ6A 3UWDA 1S9DA 1VMDA 3HXPA 4B17A 4CRWB 3HB4X 1X9IA 3Q87B 3GAZA 1P5RA 4GI7A 4GEGA 3PX2A 1Y1SA 1G42A 3AP3A 4FC6A 4O2RA 2C5GA 1G5QA 1DKPA 1PQ4A 3C3DA 3QVJA 4ERNA 1Z36A 2YUTA 1U3CA 4OCZA 2NU7B 1X1RA 5E6UA 1O7JA 4GYKA 1Z4PX 4IDQA 3UB3A 5A4KA 1NFQA 1OC4A 4E2XA 2X23A 1KEVA 4DMHA 5HOEA 5ALGA 2IYFA 4MXDA 3OLQA 3N2LA 3CX6A 5HIAA 3HVRA 3KDPA 2PWAA 2QN2A 2ZQ5A 3JRWA 1Z6XA 4RQAA 3KKLA 1F8GA 1ODIA 1LF0A 1T9CA 2PVPA 1N0UA 4TTIA 5EYPB 1XKQA 3MWDA 4UMFA 4IIJB 3ST7A 2JIQA 5L4NA 3DE3X 3M6UA 4DBLE 1L7DA 2FZLA 2Q8NA 2Y6UA 1WCIA 2BFFB 4DDUA 3P9IA 4JVSB 3U16A 2JKZA 3FTDA 1THMA 2C5HA 1WUJS 3UXHA 3S2SA 4KBFA 1QGDA 3B5EA 3AF4A 4GM1A 4XEUA 5KNBH 1JDNA 3PLAE 5AVUA 1PL8A 2Z2YA 4KQIA 1KYYA 4OQQA 3T7RA 2IUTA 2SCUB 3A6FA 1HNNA 4NC9A 4URFA 1VJRA 2FMXA 2ZSFA 4B47A 4AYXA 5KNCA 2CL5A 2F3SA 2GFIA 4FINA 5GIOE 3TI9A 1DC6A 5CDSA 1E5QA 3IJRA 4GLJA 4AS2A 5D5PA 2W0MA 2PD6A 2YXBA 3UAGA 3K09C 2IEIA 2B92A 1T15A 1UL1X 3MRSA 4N3GA 2PL5A 2QTMA 5CHEA 3VU0A 3IE2A 4JFRA 3V1NA 2GPSA 3JV7A 4GXTA 1GPH1 1DQZA 2WYWA 5BP7A 4PWYA 2WIBA 5JD3A 5LP6B 4P8RA 3FROA 3GNTA 4KWHA 3UJNA 3GT0A 3RIYA 5C46F 2KI5A 5KQGA 3IOMA 2EFHB 2FPGB 2ZATA 3WS7A 5KBYA 1QAOA 4MR8A 2E5WA 3VDRA 3IEPA 2PKEA 1YB4A 2PGAA 3LY8A 4L3WA 4U3JB 5AKGA 5CCBA 3LL4A 5LYJB 4R2XA 1E3LA 1YK1A 4TN1A 1NQUA 2OHVA 1INLA 4BE7B 4G0PA 1Z34A 1UKZA 1VBFA 2BFDA 1CIPA 3C39A 3FPJA 4DQUA 3C16C 1C2YA 1FFGA 2XT6A 3MUNA 3VAAA 3SJUA 3QWAA 3H2BA 1ZJJA 4W5RA 5AW0A 3IT3A 1UFQA 1K63A 2Z3VA 2NYAA 3N58A 4YHBA 1UC8A 1O6GA 4MICA 4I8XA 4DKXA 3JAKB 4G0UA 5FTMA 4WKNA 1YTUA 3ZE9A 2OQIA 4I4TA 5C8YA 4R0MA 2Z0MA 5FFNA 2YOHA 4M0FA 1JDBB 2ORYA 1VCOA 3EFOA 4EW2A 1KMNA 2J3JA 3KVOA 4MCHA 4CDRA 2O19A 1C3XA 4L4XA 2DQKA 2MDTA 3EW7A 4CIAA 1G8YA 1OZAA 2XDQA 1PSZA 5B7QA 2XT0A 4ZU1X 3WR5A 1PLLA 3M89A 1F60A 3FDJA 5E0KB 3PX7A 4A8JC 4FZRA 2Q3BA 4UM8B 2HRDA 4GMFA 5E9AA 4ND6A 2VJOA 1MX1A 3AVQA 4C9BA 4RTPA 1PVDA 2LV8A 3LYAA 2BRUC 1G3IA 1G0OA 1EG7A 5D85A 5KYNA 1DIBA 2G25A 4X65B 2C5EA 1LPPA 2Z3WA 3N8NA 4DNPA 4EMBA 1YWGO 2PSDA 1XMOB 1E2DA 4NE9A 3C6XA 1QHIA 3VR3A 4C87A 3VJRA 1V6SA 3KFXA 1CY1A 4FCVA 3H1EA 3QE4A 2PJUA 2CCJA 2OGSA 1GNVA 2DY0A 2ZIEA 4I4NA 5CLLA 3Q9UA 2GM3A 1W1UA 2XRFA 2ZRNA 3WL5A 4C78A 2AUNA 1FDVA 5J2UF 3QMMA 2WZCA 3V97A 3VO2A 4F04A 2ON6A 3CONA 4RTQA 1JFFB 2Y67A 4TTPA 4UTPA 2BGUA 1KWGA 2MU1A 2OD7A 4GC5A 3S2GA 1M6HA 3CO5A 4N7RA 4O02B 2RGEA 3FI9A 2GLTA 2BEVB 2CJFA 1OZGA 5KSPA 5BSHA 1S8AA 4KIJA 5EJAA 1GN8A 4ILKA 1UT8A 5I7HA 2P8SA 2OFWA 1WWKA 3LT0A 1GT91 5D87A 5E6SA 1VLZA 3VR6D 3AHGA 1LVHA 1WEKA 1IVYA 2FZWA 4D8UA 3PEYA 2ZEJA 1AJEA 4HAYA 4LRTB 4XRGA 2C2BA 1RQRA 2QAGB 3C85A 2I9KA 1J99A 4KDFA 4XXHA 3ZZNA 1H6AA 1JBKA 1RBYA 3OJLA 2VF4X 4OQFA 3P96A 1T5BA 4PF1A 3Q8LA 4FZ5A 4ZOEA 3DDCA 3UHOA 4YRKA 1OXKB 5EJ6A 1HE1C 1WW8A 4WE3A 4QYXA 3NZEA 3S8MA 1KMIY 3OPNA 3EPRA 4NZPA 5FOXA 5I3ZA 3G0BA 3NVMB 5JYEA 5LKAA 3M3HA 2CFIA 1QZXA 1V8PA 3AQIA 5DSTA 5IN5A 1ZRHA 3C3MA