1K27A

Crystal structure of 5'-deoxy-5'-methylthioadenosine phosphorylase in complex with a transition state analogue
Total Genus 92
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
92
sequence length
273
structure length
270
Chain Sequence
AVKIGIIGGTGLDDPEILEGRTEKYVDTPFGKPSDALILGKIKNVDCVLLARHGRQHTIMPSKVNYQANIWALKEEGCTHVIVTTACGSLREEIQPGDIVIIDQFIDRTTMRPQSFYDGSHSCARGVCHIPMAEPFCPKTREVLIETAKKLGLRCHSKGTMVTIEGPRFSSRAESFMFRTWGADVINMTTVPEVVLAKEAGICYASIAMATDYDCWEEAVSVDRVLKTLKENANKAKSLLLTTIPQIGSTEWSETLHNLKNMAQFSVLLP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Picomolar transition state analogue inhibitors of human 5'-methylthioadenosine phosphorylase and X-ray structure with MT-immucillin-A
pubmed rcsb
source organism Homo sapiens
molecule tags Transferase
molecule keywords 5'-Deoxy-5'-Methylthioadenosine Phosphorylase
total genus 92
structure length 270
sequence length 273
ec nomenclature ec 2.4.2.28: S-methyl-5'-thioadenosine phosphorylase.
pdb deposition date 2001-09-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01048 PNP_UDP_1 Phosphorylase superfamily
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1580 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1k27A00
3E9ZA 1JE1A 5IFKA 3QPBA 4YO8A 3DDOA 1PR2A 1SQ6A 1RR6A 3NBQA 4TXJA 3EUFA 2AC7A 5DK6A 1CG6A 1Q1GA 3KU4A 4PNPA 2AI2A 3ODGA 1PBNA 4K6OA 5ETJA 1Z38A 5F7ZA 1JE0A 1RXCA 4YMLA 3D1VA 4H1TA 1A9PA 3UAZA 1Y6RA 4F3CA 1FXUA 1V3QE 1G2OA 1V45E 1Y1RA 1Z5PA 3OZCA 4DA0A 1RCTE 4GKAA 2HRDA 1RT9A 1OU4A 4DA8A 3BJEA 3FOWA 2A0WA 1PK9A 3O4VA 4U2KA 3LGSA 1Y1SA 1TGYA 2A0XA 2BSXA 3BSFA 5B7PA 5EPUA 3PNPA 3O6VA 3MB8A 1U1GA 4TS3A 1LV8A 4LKRA 2HN9A 1ODKA 4LDNA 1Z39A 5C80A 1ODIA 4E1VA 2H8GA 1Z34A 1JDUA 3UAYA 4X24A 3MMSA 1JDSA 4QAQA 4DA7A 4L5YA 4G41A 4YNBA 1TD1A 1LVUA 1VHJA 4IP0A 3LA8A 3C74A 1A9TA 5F7OA 4MARA 3OZEA 4R2XA 1CB0A 3OF3A 4BMZA 4D8XA 1ULBA 4G8JA 4QASA 1VHWA 3DP9A 5B7QA 1VMKA 3KHSA 3IEXA 4BMXA 4WKPA 4BN0A 1PW7A 1JDTA 4R31A 3FNQA 1YR3A 1RXUA 1JYSA 1JDZA 2I8AA 5JPCA 4L5AA 4L0MA 2OECA 2OXFA 3UAVA 1NW4A 2QTTA 4WKBA 4TTIA 5EUBA 1V41E 1ZOSA 3FUCA 2A8YA 1B8OA 1YQUA 3UT6A 3OPVA 3DPSA 4D8YA 4F2WA 4D8VA 2HSWA 4GLJA 4NSNA 5FAKA 1PR0A 2OC4A 3NM5A 5I3CA 3SCZA 3KVVA 1OV6A 3INYA 4FFSA 4OGLA 1RXSA 4M1EA 4MCIA 3EEIA 1SD2A 3DJFA 4GMHA 4DAOA 4OY3A 3FWPA 4LNAA 5CYFA 1A9RA 1SJ9A 4TXMA 1N3IA 1T0UA 2P4SA 4YJKA 1U1FA 1A9SA 4QEZA 2HWUA 3OZDA 1V4NA 4F3KA 4TXNA 3OZBA 2QDKA 1LX7A 3DF9A 5B7NA 4MCHA 5F76A 1Z36A 1WTAA 1A69A 3T94A 1K3FA 5K1ZA 3UAXA 3P0EA 2GUWA 1U1DA 4DAEA 3IOMA 1OTYA 1Z37A 1OUMA 4GLFA 1QE5A 5F73A 5F7XA 2QSUA 2A0YA 3ONVA 1T8YA 3EUEA 5CYGA 1C3XA 4P54A 1SD1A 1V48A 1PF7E 3FB1A 1K27A 4OJTA 1JP7A 1ODJA 5F7JA 4JOSA 3K8OE 3OOEA 4TXLA 1VFNA 3KUKA 1ECPA 1JDVA 1ODLA 4NY1A 3FAZA 4DANA 4L6IA 1XE3A 1ULAA 4F1WA 1PR1A 4WKOA 4OEHA 1PR5A 1T8SA 1T8RA 4L5CA 4BMYA 4QATA 1Z5NA 4OGKA 4TTJA 4UC0A 3UAWA 1YBFA 1OVGA 4R2WA 2RJ3A 4D9HA 1Z35A 4NS1A 1Y1TA 2AI1A 4PR3A 5F77A 2B94A 4I2VA 1RYZA 3NM4A 4M3NA 4QFBA 1OTXA 1U1CA 1NC1A 3PHBE 4JP5A 1TCVA 4LNHA 3GGSA 3PNSA 1NC3A 1Z5OA 4G89A 4JWTA 4TYMA 4F2PA 2QTGA 4DABA 4ECEA 4M7WA 5F78A 3ENZA 1PKEA 2ISCA 4EB8A 3BL6A 1Y6QA 5EFOA 5CCEA 5B7GA 4DARA 1I80A 3U40A 5CXSA 4D98A 5IU6A 4RJ2A 3OOHA 2PGAA 5CCDA 2ON6A 1Y1QA 3OCCA 3E9RA 3GB9A 1RFGE 1M73E 1TGVA 4DA6A 4KN5A 1T8WA 1TCUA 3EMVA 1A9OA 3BGSA 2Q7OE 3P0FA 1JPVA 3PHCA 1RSZA 1YQQA 3TL6A 1K9SA 3K8QA 5CXQA 1RXYA 1PR4A 1Z33A 1V2HE 3F8WA 4LZWA 3KVYA 4TS9A 2AI3A 4TTAA 1ZL2A 2XRFA 2IQ5A 2OC9A 1B8NA 1A9QA 4QARA 4OF4A 1YRYE 1PK7A 3NM6B 4WKCA 1PWYE 3KVRA 4WKNA 1PR6A 2I4TA 3LBAA 2QPLA 4TXHA 1U1EA 4EARA 5KB3A 3E0QA
chains in the Genus database with same CATH superfamily
2Q3CA 3QJGA 5JSYA 5JSQA 5IRCD 3H3JA 3A9SA 4QVIA 2JLUA 3UMCA 1QNLA 3OPYB 4HYQA 1Q2UA 1R0LA 2IRWA 3B9QA 1RR6A 1QWOA 2PRSA 3M6VA 2VBCA 2H2DA 5AIBA 1I0IA 3DBOB 3ETCA 5KJEA 2BKUA 2SKEA 3MTAA 3MC1A 4EYEA 1NULA 2AC7A 2RJOA 3CEAA 4ZYYA 2ZWPA 5FOQA 3PGKA 4YRBA 2XA2A 2IL1A 3FOZA 4JFRA 4EM6A 3EBOA 3JQGA 1R18A 1SU6A 5FUMA 3GJRA 4GQIA 1IVNA 3MFQA 1HKUA 4IJ6A 2AI2A 2DYKA 2GETA 3H2GA 4RY2A 4ZCSA 1W4BA 4YROA 3QRWA 3W78A 3WISA 2QU8A 5K51A 1U7PA 2JLAA 4FONA 4LC9A 2PNFA 3UVEA 5FBRB 5FUYA 4GFDA 4ETMA 2BFFB 3AUFA 3DV0B 3PFNA 3RB8A 3OH8A 4WNAB 4UPEA 5KVSA 3DD5A 4K81B 2CL5A 2QVZX 1AH2A 1LPOA 4KJXA 4WOBA 2ZRBA 4H4DA 2Q3MA 4F6CA 4EKGA 4OHZA 5J1TB 2DJIA 3RYIA 3LX6A 2IHYA 4A6PA 5KBYA 1J8VA 1T0IA 5CG1A 4DFDA 2JAWA 2PPLA 3MTBA 3FCAA 4KACA 2X6RA 1DV2A 4QWMA 3UGKA 3HL4A 1CV2A 4R8SA 4ZVMA 2VYVD 4OHYA 1PFQA 2AJTA 4LWZA 2QW0X 1UFOA 5ILGA 1YFJA 4Q4JB 4PYNA 1RRGA 1X9HA 2HHJA 3KXLA 2CE7A 4B7AA 4BX8A 3PNYA 3FOWA 3EGVA 1XCBA 4BNLA 1DUSA 1QVZA 3EVGA 5HRAA 3PA8A 3LIPA 5EHGA 4AN0A 5IJ0B 1XKQA 1ZAKA 3A1WA 3FDFA 4X5OA 2KQUA 4YRFA 4CMGA 3EY4A 1NYRA 2BMWA 1FNDA 4UBIA 3X3HA 3OZSA 1PUIA 1PT5A 5IJXA 3P26A 3EYWA 3KSZO 4I1UA 5ICCA 4GYYA 3KQTA 2BFDA 3V3KA 3PVCA 4IS3A 3FF4A 1BE1A 1N2CA 2GI4A 3FHJA 4Q7MB 4Q1BA 1NVEA 4QHSA 5FBWB 3ETHA 4UVGA 3RIEA 3ROTA 5EPUA 3FG9A 2I1LA 4DNPA 1YOVA 4ZKDA 1HMYA 3MMXA 3A05A 4I1IA 1ZNZA 2QW1A 3CSSA 5IBQA 3HXTA 3SZLA 4HB3A 1UJ5A 1GQRA 2QN7A 4HP8A 4HQRA 4UEWA 4A92A 1KJYA 1YJCA 2C4VA 2HA0A 1U1GA 4LVUA 4KVFA 5LZ8A 5BSVA 1LV8A 4WRRA 2YJNA 5JY1A 2HWKA 2V54A 1KPGA 3DZGA 5CH3A 3CNLA 2GHRA 3TI7A 2YRFA 3FMOB 4NBKA 5E2IA 3X44A 4D42A 2AJCA 4OB8A 4BLPA 3GGJA 1DDGA 3L7IA 2DFDA 5KOHB 3UW1A 1Q44A 4I46A 1EU1A 4WZBE 5TGTA 3ANTA 3CZRA 4G63A 2BJHA 4UM7A 4LHEA 1T1IA 2XECA 3NYWA 4R81A 4BX2A 1YKGA 1JDPA 2J48A 1AHPA 4Z4IA 3ZWDA 2WJWA 3H05A 2BBTA 1G0NA 1NDHA 2GCPA 3BA6A 3CISA 1IEQA 3OECA 4HYEA 1H69A 1ZPDA 2O2SA 3C74A 4EUSA 2NSDA 4NEQA 3LBYA 3EH2A 4Q4HA 4YFVA 4BFUA 5BSWA 1CQWA 2G08A 5JXIA 4QYIB 4UQLA 4ZI2A 4RX1A 4KVAA 1XYVA 3KX2A 2RG7A 4JROA 4JUAA 3IELA 2NO1A 3WIEA 2E0IA 1LSOA 1CB0A 1XEFA 2HA2A 5DNDA 2J5BA 3KSAC 4HGRA 4KXUA 1WUYA 2AHOA 4MPRA 3EQ2A 5C4GB 3KKEA 3L6BA 2HADA 1IY2A 4B83A 4BO2A 1QRAA 2XOEA 5J1SB 5F51A 4AY6A 2VHZA 5ED0A 2A0FA 1JF8A 3QUAA 1VJCA 3TVYA 2XDQA 4YY3B 4PZPA 2BH9A 4FYKA 4C3UA 2REQB 3BZUA 2WF5A 3K6KA 1X1TA 3AV3A 1AUPA 1ZH8A 5BNFA 2P8SA 1EXVA 2WLSA 4NK5A 4UM9B 3VSEA 5TLSA 3UGJA 4X1KA 3GO4A 3NLLA 4YAOA 3SLRA 4NV0A 2JHGA 5THQA 5JSFA 3ADDA 1U3FA 3IDQA 3V4FA 4JYAB 2VDRB 1U2QA 3DWEX 4WKPA 1L5YA 1Z0DA 3E7DA 1OAOC 4RS4A 4XR4A 1GU1A 3TJZA 3RBXA 4QTXA 2WJPA 1VCIA 3ED5A 3FNQA 4X3CA 2VT7A 1RMQA 1Y6GA 1F8YA 3A1FA 1LNZA 4UM9D 3FWHA 3PKZA 4W5TA 1MAHA 3CUUA 4ZYWA 4Z2YA 5C9ZA 2I4LA 4YDRA 5AW4A 3YASA 3DOJA 3I8SA 4O02B 1UBFA 1ODTC 4KQFA 2Z6AA 2BCEA 3FZQA 3HYTA 2B2CA 2ANBA 1CF4A 1YRQA 1QOZA 1CUDA 3BHMA 2HDWA 4NJEA 2UYCA 2A2ZA 4JCCA 1ONSA 3QLVA 2O8DB 2R86A 1RQGA 5ITZA 3CT4A 4LGYA 2ZAGA 2JAXA 3FUWA 3R9WA 1G16A 3BB4A 4C76A 3Q7PA 4PCUA 5ADHA 5A1JA 3KPYA 2AC2A 2W6PA 2ETXA 3JR7A 2BKEA 5COQA 2HCFA 4V0LA 5AOVA 1T3LA 2F8TA 5CHYA 1JG1A 1AS0A 1W7AA 1C2TA 2Q29A 4WNYA 2XYHA 1J1UA 2HRCA 2ZJ6A 1MFPA 5SYNA 3A4YA 2XGMA 3RVBA 1FCJA 3GFRA 5ICGA 1CY7A 3MMPA 4J7XA 1ACLA 4P7KA 5CW2A 3INYA 1E3DA 2C54A 3GWGA 3L8HA 1F38A 3KDPA 1JH8A 1VJRA 3IXMA 1BEZA 3HNRA 1C0KA 3LXMA 4RF4A 3H1BA 2GARA 1O6CA 4DUGA 1AQNA 1KI9A 1BYUA 2HMTA 2VK2A 4G0NA 4IFEA 2RGRA 1DG1G 4FUQA 1SVLA 1Q7EA 1BJKA 1I4LD 1VPEA 2QM0A 3PFFA 3BG5A 5F21A 3RANA 4BBAA 1YDGA 4HDNB 1N8SA 3U37A 2NYAA 4BZPA 1GTL1 2K2QB 4CCWA 3OZTA 4P7GA 4DMCA 1U02A 1J21A 3MJVA 2N46A 3HB7A 3K2IA 4X45A 2FN7A 1S9DA 2NO7A 3ID6C 3ZJTA 4DZZA 1DKNA 4PR0A 3BH0A 5FLKA 3AEKA 5BQXA 3CG0A 2FFQA 5GP1A 3UO8B 3VC3A 1MDFA 2IKSA 3RREA 3S1AB 4B33A 1U0FA 3E53A 2HKIA 5AQEA 4IEFB 1X13A 3GZTB 5TQVA 3O3OB 3A04A 1BG6A 3NG1A 3GZNB 4X71A 1P7ZA 2ET6A 1GGMA 4S1TA 4ZQFA 4TMVA 4RD0A 3RIHA 5EAIA 3UJDA 4NCAA 2AX3A 1L3CA 3ZZNA 1V7PC 2LP4Y 4DL9A 4CF3A 3RBZA 3FZYA 4DMMA 2ZFUA 2GMWA 1KNXA 3WGJA 3AERB 2G28A 3DF9A 4WJLA 1RI5A 3G02A 2PWZA 3HY4A 3NKVA 1FFBA 3NHRA 4N4AA 4QXPA 3WWZA 1SGWA 1MJHA 3HJNA 4K87A 5F76A 4JI7B 4WL0A 1XTVA 4I5GA 1Z36A 4YAJA 3FLAA 3JRNA 4C7MA 4DLZA 4NH4A 4Q7LA 4KNVA 1QAMA 2CNWD 4YJGA 1U2EA 3CRVA 4ND8A 3AP2A 5CD9A 2MSWA 4Y2TA 1CT9A 1KI2A 1ENOA 1CY6A 1H8EA 2O3TA 4P35A 3T8YA 4A8JA 1ZIXA 2C4NA 3OPYI 3ZKWA 2HA6A 3GQVA 1E9RA 4ZAFA 1THMA 5HK8A 3RIGA 4DAEA 1WU7A 2FG6C 4FGSA 3NP7A 1Y34E 3MFYA 3C2QA 2AWOA 4KIJA 1CY2A 4PTZA 3REQB 1VXRA 4Q47A 1XTBA 6REQA 1G9TA 4XLTA 4XZ3A 4Y1FA 1VKRA 1WXHA 1ZIOA 1ZR2A 1TVKA 4FMCF 4CF7A 1YIDA 1PJSA 1T1JA 3GEHA 4I4NA 4G9BA 9GPBA 2X0KA 1FX0B 1RMTA 1XQ9A 4B73A 3HU5A 3W5SA 3U3OA 4A0QA 2NPOA 1MNAA 2DU8A 1L7VC 1Q74A 4Y6QA 1NVFA 2JAUA 3ENQA 1Z7WA 2FPOA 2IBTA 2HBRA 1T1RA 4XE5A 4ZRNA 4ABYA 3NBKA 4LZLA 3U3JA 2V98A 4H7DA 1WVMA 2WINI 1M34A 4MMXB 4CU5A 2JJYA 1BZYA 1DTWB 1TVMA 2WWWA 1BMDA 1RQ7A 5K0SA 2Z95A 3B3GA 3PX7A 3ETNA 3UEOA 1B6RA 5K20A 4FJ0A 4JK3A 4RFSB 1U94A 1ZI8A 1PP4A 1B0AA 1IXYA 1FXWF 1K3TA 2GX6A 1FS5A 4MHSA 1JIIA 1JKFA 4IGIA 5I3ZA 3EDOA 4KV7A 2FEXA 3V2IA 3RAFC 4PWYA 4AYWA 4TROA 4RTPA 1ZG3A 3WSTA 3AJ9A 4RJJA 1HRKA 5CVDA 1VA4A 3SFTA 3CJRA 2IP4A 3UAWA 3GDHA 1KVTA 3PXAA 2A5YB 2GTIA 1XMPA 3ZXXA 5K8CA 1SXJC 4PF1A 4CKXA 5AW5A 7AT1A 4LA4A 2WKSA 3RSQA 4Y6RA 2DPYA 2HDOA 4QPPA 1II8B 4UPDA 1JJFA 1OWNA 3L0YA 5H1YA 3AUSA 1M1YE 2MMCA 3A6HA 2QM7A 2CEAA 4NU5A 3MJHA 4P5EA 2VAPA 5LKAA 1HX7A 1QX3A 2PT7A 2Q5FA 5L3ZA 5IDVA 2OWEA 2GQ0A 4B6EA 1G8FA 4BU1A 4DQDA 4E3ZA 5BWNA 1FDRA 4FFWA 4QFBA 4QRDA 1S9HA 1TIBA 3IAM1 4KKVA 3F73A 1FZQA 1KH3A 2HU5A 1JLLA 1CQJA 3SIRA 2ZAIA 1XZIA 2IU4A 5KU7A 3KSUA 3IEKA 4R9NA 4C0JA 2OORC 2JC3A 3EH1A 4QDOA 1R12A 4JQYA 2NZ2A 5KYVA 1W2WB 2QN8A 4BO4A 4D8UA 1SY7A 4LZPA 1SR8A 5DMXA 3VBCA 5A71A 3S1LA 4IGFA 4LMRA 4MICA 3AFNA 2EX1A 1NDUA 4PV7A 4XXHA 2OAGA 2ZRPA 4QBIA 3RDPA 3UC5A 4EZBA 2EQBA 2WMNB 1AM4D 2EJWA 2O2EA 2RIRA 1E20A 1CZKA 4NPAA 4Q1EA 4DSNA 2GN1A 5A4AA 4N7JA 4ZEWA 4EG3A 1UL1X 2IS6A 3RYCB 4FFMA 4CGYA 4KYVA 3WLPA 6LDHA 3QXHA 4FEAA 4J75A 1C7QA 5ALJA 2PWAA 2JCXA 3GOQA 1VPVA 4EGAA 1ZICA 2EEZA 4YMHA 5CB6A 1P61B 4QDJA 3PS9A 5JATA 4GOXA 4N8EA 1G3MA 4JIMA 1M1NB 1QG0A 1NYTA 3CX7A 2GZHA 2HNKA 1YXMA 5HXAA 3GA0A 2GWRA 1CP3A 2R8XA 3AFIA 5HGXA 2XOKA 1QIDA 3Q7EA 5A7GA 4EB0A 2HQRA 3O74A 4DIUA 3OFSA 1G1AA 2L2QA 4L75A 3QU7A 4RD3A 3TS1A 4B6QA 1AC5A 3ESBA 5E4YA 1G7SA 1ZD5A 3VSCA 3I2KA 1BJTA 1JSXA 4NCIA 4UEJA 4X8MA 1M73E 1JDBC 4OBWA 1L1FA 3ZGLA 5JD3A 3TOSA 3DMNA 3BF8A 1DG3A 1FSGA 1VOTA 1WDKA 5LZ9A 1D03A 1IBSA 2W8BA 1FYEA 3F7OA 4LVOA 3BWBA 4MQUA 3H18A 3UJ7A 1EUQA 4U2FA 3KJNA 1FTYA 4INJA 2DQ4A 4CF4A 3QY9A 1OD6A 1PT7A 1V47A 5LYYA 1V6SA 3E7PA 3JQAA 5SZJA 2FX3A 4RHFA 5LP1A 3P9QA 4I55A 1FLDA 1WV0A 5EJGA 3GEDA 1NIPA 3WGOA 1E98A 3BHNA 3NKLA 4PINA 1ZHHA 4IWXA 2RSLA 4KQJA 5KVQA 4PNEA 3LCRA 1ZXBA 4ZV9A 3QIAA 3U4QB 1CS0A 1Z74A 2H59A 4JL8A 3W04A 2CJWA 1N33B 3AY0A 4OJMX 4XW2A 1W59A 2SKCA 2OHGA 1YR2A 5JSKA 5JJKA 1N0UA 2YWHA 3PITA 4IL5A 3NX4A 5DLYA 1YJQA 5I5GA 2BF4A 2NW6A 2YS6A 5AI9A 4KQ2A 4CF6A 1JHYA 1GNSA 4O4IA 1AZTA 1LVGA 2NSLA 3C8ZA 4RWEA 2R87A 3P5SA 4H18A 5B3AA 2AQKA 3QMMA 1MLDA 2Z3VA 3CH5A 2GXAA 1R4NB 1SCUA 2PGNA 4LRTB 5CPFA 3SC6A 1GGKA 1VJ0A 2G7ZA 4RQUA 4BQNA 2XKBA 3ZD7A 2NNLD 1OA1A 2VYND 3BWMA 4B81A 4URZR 5A9TA 3S4YA 3ZXSA 2XRFA 2DB3A 5D7BA 4CLHA 4E7PA 4Q6WA 1IXKA 1RM0A 1TZ2A 4J3JA 2C3UA 2HHCA 2RHBA 2V7GA 3O94A 4JLKA 4E5PA 3QYJA 4QBHA 5JEEA 1Q5PA 1MD9A 2I8CA 2IOHA 4YA6A 5LDGA 3TLAA 2VAXA 1W29A 4AUEA 4IIFA 1V5GA 2UZAA 3DP7A 3G8BA 2QF7A 4G4GA 1RIIA 4L3OA 4PG7A 4WKCA 3RS2A 3MJFA 2JLYA 3BL8A 3WIUA 1LWOA 4OG2A 4LJRA 4PICA 3IEMA 4YWJA 4CMIB 1KU0A 5REQA 2PBRA 1J42A 4MDHA 3AFGA 3FSEA 1YB1A 3NBXX 5CBPB 4NPHA 4AKTA 1LWNA 2PAFA 2NU8B 4RACA 4B9EA 1TCAA 4EFKA 5LQSA 4BAZA 5GTDA 3MS2A 4C0HA 5E7JA 3FSRA 5FTWA 1GDDA 3WGKA 4D0LB 1B3RA 3HZZA 4W8HA 1H2AS 3V7UA 4D0SA 3TLGA 4NNJA 4CG1A 1NBME 4DV7B 3ZTYA 4FFVA 4UXIA 4P58A 3G6WA 1XRPA 3EE6A 3NBQA 4W5WA 3AO0B 1KI8A 1P9WA 4B47A 1EH5A 2WHRA 3GX1A 5DWDA 1ATZA 1U0GA 2O06A 3TTSA 4C7VA 4JYMA 2QL5A 5TGZA 4B4WA 3NWPA 2H9IA 1H2ZA 2VH2A 2BH2A 3AW9A 2QZPA 5JANA 2P6UA 1UDAA 2PHZA 1TYBE 4MJXA 1HR0B 1E1YA 1QO7A 3HKEA 3WZLA 4LRUA 3TO5A 4MIYA 1EIWA 1Q95A 4CKWB 4ITUA 3DDUA 1N2CB 1RPJA 2EFYA 2QY9A 3JWJA 2C8KA 2XI4A 4PLVA 3PXEA 2PYIA 2I3AA 3C7CB 3NANA 2ZM5A 3V6MA 1D6JA 3H8SA 3AUXA 3WKDA 4DY4A 3NTOA 1E7MA 1LLCA 2BBWA 3GMSA 3PWTA 4QRHA 1DO2A 4A2WA 1L7MA 4YMIA 2EBWA 4H1TA 1J8DA 1QGZA 4G1UC 1Q22A 2MWMA 4OM8A 3C5HA 1ZI9A 5LCXA 2PGDA 4CQMA 3KBOA 1EE9A 4O2BA 4PONA 3TD9A 5K0TA 5KSZA 4HFMA 5TF4A 4U2EA 3B1ZA 1I5EA 1V45E 1Z5PA 2VWGA 4J6EA 1WPRA 4R0VA 1FJHA 4E6EA 2UUAB 4KPYA 2HM7A 4ETIA 1XD9A 3BWCA 1WB5A 3HUFA 2G4CA 1VBFA 1NVVR 5KPDA 2WUDA 2J0EA 3UFXB 3G2KA 4X6XA 3PXDA 1KY4A 2YC2C 1KERA 4EY5A 2O19A 3U7RA 4ZIRB 3NVDA 4H7KA 2GAIA 8ATCA 5CBKA 4I1RA 2JATA 4WH0A 2JFNA 3IMEA 3LQYA 2Z5GA 2RONA 3OM1A 4KQ9A 4YT5A 4C4OA 3KQKA 4DF3A 2IOFA 2HA4A 4CFYA 3RVRA 1KO1A 4ZU3A 4DS3A 4EHNA 2PRKA 3NNSA 4CF5A 5KHAA 1IHPA 2A30A 3LT2A 1W5SA 4KQCA 4MK4A 1C1DA 1RABA 3C14C 2HLDD 3IKVA 4Y9RA 4CKBB 5B7PA 4RZSA 1AMUA 1R5OA 2RGGA 3NBFA 4C7XA 1P5ZB 5DXAA 1YQDA 4J76A 1UMCA 1C1XA 1LDBA 4O5AA 1IG3A 1L5HA 3BJMA 3H75A 1NJ5A 1ZGGA 3GR6A 3IOYA 2FSUA 3OPXA 1VJ1A 3O6VA 1P9LA 2WJ4A 3NETA 4TL8A 4JEIA 2DH6A 4HWRA 5AJYA 4LECA 4RYLA 1U98A 4Q48A 4N5HX 3PZRA 4F97A 1ZU4A 2NUAB 3T12A 3B9PA 4UM5A 1PCXA 3BCRA 4J4BA 1EDBA 3U4AA 2OLEA 4QYTA 1HYQA 5KYXB 1PG5A 4KW7A 4KWEA 1CY4A 2FMXA 5K0JA 3ZK8A 4C87A 1HH4A 1EM6A 3QK7A 1CIVA 3LUBA 4AMUA 4G3XA 1DC3A 1ZY2A 4NBUA 1OAAA 4EGQA 1IQUA 4ISBA 2BCJQ 4E2WA 4ZYUA 5JQGA 3IUJA 5GGXA 4JN6B 4GM4A 5JT1A 3T5PA 1QM5A 2GN6A 2GRJA 1C4WA 2BM1A 2C8LA 2XIQA 3E5RA 3MCUA 2ZR0A 3RUDA 3TR6A 1IHDA 3RVSA 3CM0A 2MT9A 1TDJA 1SN7A 3BRSA 3ZTTA 3NJRA 1E60A 3VDQA 5CFZA 4MUKA 4NARA 1E94E 1WLSA 3FPCA 3VR5A 3KV3O 2F64A 4LNUB 2ZZKA 2A1TR 3U0VA 1OX4B 2NLOA 3THXB 2JL1A 1Y9JA 4TYWA 1D5WA 2HAEA 3Q0TA 3AIKA 4IVPA 3AJRA 4LWOA 1QUFA 4QUIA 1KY5A 4BO3A 2CFRA 5FR1A 1ZN7A 4C3ZA 1G55A 1KJQA 3KSMA 3UMJA 5L3SA 5BR4A 5ALOA 1HDOA 2GAOA 2QRVA 3NHZA 3OE4A 1QCYA 2OHOA 2OR3A 4G0YA 4D8TA 4EJ2A 4U7DA 2ZTSA 4LFAB 3M89A 2JLRA 1AQUA 1KYIA 3L6DA 4NOJA 1XMIA 4BAGA 4QUAA 2H1OA 2AHRA 2O8BB 1DJPA 1QVWA 2EAUA 2W6ID 2WNSA 3O8QB 4UNSA 1E1NA 4RVSA 3WO0A 5FTLA 2XUZA 4XIJA 4GU5A 4OQMA 4XTCS 3FYUA 1F6DA 2G36A 3R0JA 5LB4A 1OXVA 1IY0A 1T36B 3QVJA 1UPBA 4OYHA 4XYMA 4OX9B 1EZ1A 2B3TA 2VDUE 2VWQA 3JQ8A 3AFMA 1YK0A 1DC8A 3VZPA 1AU9A 3HZHA 1ZXLA 1OV4A 3I5XA 3MCZA 4B3IA 4CTKA 5HKKA 4HDMA 1FTSA 5JBNA 2O5CA 3CRRA 1JDTA 3IBFA 4NNPA 2XOKD 2WSMA 3K53A 1IUOA 4R31A 4EUKA 4HTFA 2P9YA 2H2FA 1RJ9A 4FHFA 2VSFA 4XX1A 5DLDA 5IC6A 3W05A 3ZPXA 1KDZA 1ISHA 2Q9UA 2IV7A 2AJ8A 2IYRA 4IWNA 5A6SA 1A2KC 2F48A 2HBZA 1PLKA 4BCBA 2WE8A 3SEFA 4FCWA 5JPCA 2F9LA 1XRSB 3PIDA 4JLVA 4D3XA 4O29A 5HEKA 1SG6A 1NSFA 4XSGA 2OECA 3FETA 4IQ4A 4WN3A 1BMFD 2JLVA 2OPBA 4WKBA 2IS4A 3DXZA 5HM8A 2VK8A 5HZKA 3VOBA 2ZBRA 1A5SB 3AV0B 2ZYSA 3PEEA 4MR7B 5AVJA 2R7LA 1IPEA 4F2WA 1I2BA 4HS9A 2UZ3A 3R0IA 5P21A 2ILTA 3MRTA 2ONJA 4NSNA 1UKVY 2WNIA 4O33A 4Z3DA 4L9AA 1Q1ZA 4O5OA 1JZTA 3A70A 5CVUA 1D2HA 3Q98A 2CBGA 3VYRB 3PXBA 2EQAA 4MXDA 1QBGA 4O4JA 1NUAA 1XZCA 5E8JA 1OV6A 4IKEA 2Z2ZA 3FSGA 1E61A 2K5UA 4QSHA 3PDCA 1LRLA 2C82A 4NZYA 5LM3A 1LCIA 5JJCA 1P31A 2V6BA 1NJFA 4WW0A 1KKMA 4FFSA 3GEPA 3U5ZB 2MSEB 4C04A 1QFXA 3OZGA 1NKSA 4PZEA 1ICIA 3WHLA 2X14A 4JV5B 3FDXA 1FNCA 1X19A 4XGQA 4E12A 2V7BA 1P2BA 3MGCA 1VBKA 3PDWA 4WVLA 3GJ3A 2XCIA 3E48A 4D5EA 3WSVA 4F38A 1Z25A 1EUYA 4BMVA 4J4HA 5DGCA 4AYXA 2JBWA 2FPXA 4B44A 4LF4B 1LGYA 3MOGA 1KAQA 2QX6A 3AVWA 3ROPA 4MRPA 4OLBA 4TXMA 2B8JA 2JANA 2PFKA 2V8BA 3B2EA 2EATA 3G5UA 1ZA2A 4L9SA 5ALMA 2C84A 2XVZA 4YRLA 2D0OB 2W4MA 1A88A 4XGIA 1ID8A 2ZJBA 1T2NA 4Q9DA 3SBXA 3BSSA 3RC1A 3IYLW 4NEHB 4MROA 5KX5A 4LTNA 5BYKA 5K01A 4HFJA 3Q8KA 5C5DA 5CDSA 1L1QA 2OCYC 1ZEJA 1OZAA 1J25A 2YV2A 1H3FA 4IIGA 1HQDA 1POXA 1TL7C 1AMNA 1N6IA 3PFHA 2HWWA 1OLUA 1DFIA 1Y63A 2ZE8A 3PZBA 4JP2A 2HL6A 1X1CA 2BP7A 4U02A 4NS4A 5HF8A 1VGVA 2O7VA 3B51X 1HFJA 4RJKA 2PR7A 2QVLA 1ORRA 1BS9A 2A4KA 2Z2JA 1GCUA 5AMXA 1RZRA 1P0IA 1ZN8A 1KMHB 3QELB 3MXOA 3S2SA 5AJHA 1HFWA 2KPOA 2V4UA 2NXCA 4ARZA 4DE5A 4D0NA 1IL0A 5G1OA 3KXIA 5BVHA 2PKEA 4FGJA 4FR2A 2VPQA 3T5GA 1ZJWA 3JASB 2O7SA 2COUA 3BZWA 2BGRA 3WQQA 4KSCA 1EHIA 3GPCA 3IUQA 4DC1A 2DBRA 4QYXA 5BW8A 3DZDA 1P9OA 1M8FA 4NR0A 2QYOA 2XQKA 4PLZA 1D4OA 4WXYB 1LS1A 5GJCA 2CLCX 3CNEA 5MFZA 2MTBA 5B12A 1W75A 8OHMA 2DHDA 4RUKA 2YWJA 2OK8A 2ZW9A 3DTVB 3FTCA 4ILEA 5TRTA 4O4LB 4M7OA 2O7RA 3UMFA 1XTPA 2O8EB 2C5BA 2PL3A 2QNRA 5JTUA 1V5EA 2V45A 5AM2A 1J0EA 1NBWB 1JBKA 2FPGA 2D4AA 2YIDA 3I6YA 4YV1A 5BSHA 2CDAA 2R8RA 1RPZA 2DBYA 3G5TA 4QGSA 1U2DA 1UJ2A 4AJPA 1UCFA 1UP6A 4HGYA 4MKIA 4OB6A 1I30A 421PA 5LJLA 4OAOA 2Q4EA 3QF4B 1AGYA 1IM5A 1D2AA 2G8NA 4TWAA 4AKIA 3LK6A 1VSQA 1A2BA 2H2GA 1PR5A 3E9QA 1E1DA 1TUBB 2GBCA 1QTNA 1X7DA 1C7FA 4CM4A 4IH4A 5BW4A 1FLAA 1US8A 3GMIA 2OCDA 3HB5X 3FTFA 4RGBA 3AUYA 3RLFA 5T7BA 3PC8C 1JG2A 4YLYA 4FOLA 2O3UA 4AMBA 1QG4A 3RJ5A 1T26A 5JD4A 4ALKA 3WLRA 2LWIA 3DTVD 5C7LO 5KYYB 1KS9A 3WL7A 2IXTA 2OGSA 1DCFA 2ZUVA 3D5TA 2E5LB 1CLUA 1F2TA 1JVSA 1V5WA 3CVYA 3RBAA 4OXQA 2G83A 3OUUA 3ESZA 4I2VA 3U56A 1XEXB 3MBIA 2D2FA 2HWYA 2QP4A 2HJVA 4IDNA 3V2GA 2R1VB 2D1YA 2ODBA 5AKYA 4TV9B 1LBSA 3E22A 3PHLA 1Q92A 2P62A 3D4PA 4MHOA 2DWQA 4YR9A 3EHDA 3B6ZA 3HA5A 4LRSB 2BMJA 4MS4B 3B6EA 1IUKA 1YMVA 1H93A 4NIMA 2IEYA 2L19A 5GY7A 4FUTA 5DCLA 4TZ0A 4MRRA 5JCJA 1GZ5A 4IIVA 3VKFA 4EG0A 3ZDDA 2EWVA 4BYGA 3SF0A 4TKVB 2WKPA 2MHCA 2NWQA 3JALA 2JIZA 3CCFA 3REGA 2H1FA 2JASA 2QTVA 2EX4A 2KSQA 2ZJZA 2ZITA 3ELYA 3B3QA 2D5BA 3P9CA 4LXTA 4URWR 5DTRA 3GEBA 3RPEA 5ITVA 1O97C 5T41A 4CCYB 4BC0A 1CZOA 3PXUA 1E2JA 2NU6B 3QMVA 2P9BA 2IYAA 1VRCA 3I28A 4J0IA 2WICA 5D51S 5J5CA 4ZZ3A 5JS7A 1K7CA 1KFBB 1KU6A 4DV1B 4CIDA 4G5HA 1P62B 2O7QA 4X62B 3Q87B 1E6UA 3IQEA 4IZHA 4BNZA 1T91A 5DGHA 2ENUA 3H1FA 4ZI7A 1DXQA 3VO1A 3Q5EA 2KS6A 1B1CA 1D2RA 2BI8A 4UQPA 1FVHA 3BBLA 2C29D 3LWDA 4OQPA 5LB2A 4BVJA 4EEXA 2J0VA 4HUTA 3HJCA 1GPDG 3DW1X 1Y3HA 4A1FA 1QOQB 3VO2A 4ZARA 3WRWA 4YPVA 2JH3A 4PGGA 4URHA 3VHXB 3CF0A 2CLDX 4XA8A 4JI5B 4HQKA 3V4PB 5JDCA 2ON6A 4WOPA 3LCVB 1DJNA 3ZX5A 4XFKA 1F14A 4FHCA 4KOAA 2X86A 4DA6A 4YGXB 3ZUGA 3K0SA 2LV8A 4QPCA 2AN4A 5EHQA 1U0HC 1KMQA 2EX0A 3G79A 3GFGA 1X9GA 2OHHA 2PQMA 4FVTA 1EESA 2WM9B 2AN5A 1U0JA 2WJVA 4GYJA 2QQFA 1KZ6A 4B3DA 2Q2WA 5C51B 3WMXA 1KPIA 3BRCA 3HDVA 1HSZA 3ORFA 2Q7OE 5GM2A 1WB9A 3AL3A 3T7AA 1MBZA 5DK4A 3AL0C 1SCJA 3SKYA 3ZCRA 3Q1KA 1Z5VA 1XMJA 4PE5B 3TL6A 4MUGA 3L4BC 4V0ME 3WLTA 4KNWA 5EY5B 3TZKA 3VKUA 3OG9A 4LJ8A 3CEHA 1KYXA 2YWXA 3IE0A 3KE8A 2G1AA 3NVAA 3PRKE 5F23A 1G8KA 5DF1A 4IS2A 4DLKA 1YU9A 2ODAA 2H7YA 1Y8RB 2PSJA 4M4SA 1U7UA 3DEFA 4ATNA 4KXYA 1WDTA 1XMXA 4ZHSA 1X9IA 3ER6A 1CZNA 1QYVA 2ZU0C 3DMYA 1S7GA 4HH0A 4Q16A 1Z16A 5EMJA 1M2KA 1R27A 3FE2A 3OCZA 2WWXA 4TS9A 2EJVA 2Q6OA 4ZXFA 1VI5A 3LX5A 1OGYA 4GXTA 2BGWA 2NYRA 3E61A 4LBVA 1N2BA 2C95A 4TKZA 2V6GA 5CNMA 2GEJA 2L42A 2Z1DA 3QG1A 2YV1A 5LLTA 1G6Q1 1OF1A 2V59A 4O0MA 1BWRA 5NLLA 1ZL0A 2XT9A 1KYTA 1W93A 1YGPA 1WPGA 4NYMQ 2RGEA 1NLUA 1TUGA 1Q1NA 1ODSA 1SIWA 5M7EA 1NXSA 3MOSA 2YIJA 5A4IS 1H0HA 2R84A 1XTRA 3P9SA 2XMSA 5GZ1A 4M7RA 3EGXB 3RI3A 3ZQ4A 2GPYA 2QD3A 1C0LA 2I76A 3IA7A 3EDRA 4OA8A 5EE3A 1NWHA 1CQIB 1SMKA 4R5MA 1V8ZA 4QQRA 5CGQB 1P2GA 1O4WA 2PMWB 3PYMA 4JJ7A 5CM9C 1I14A 4BNIA 3EF0A 3O31A 1CUJA 2GK3A 4B09A 1OKKA 1QNFA 1NF2A 4JBHA 2JLWA 4Q3CA 3BB3A 3CZQA 1EWQA 2DX7A 5KMGA 3COYA 1GA1A 1CZHA 1IUPA 1CPYA 1R0BA 1O9BA 3DVSX 1MAVA 3DKIA 3HB0A 4G24A 4L2IB 3RASA 5E2BA 1XROA 4BNTA 1XPOA 3G7UA 4YRNA 4AMGA 2XCLA 1ZI6A 2JGKA 3SC4A 2X1HA 3LC2O 3PG5A 3OCWA 2CLKB 1FOEB 3KU4A 4HLUC 3ZBPA 4PNPA 3AVPA 3BKXA 2EYQA 1S89A 2PUVA 2VPTA 1UINA 1HBJA 2I4OA 3CUEF 4Y9TA 3SMQA 3SJBA 4F5WA 5JVDA 3W34A 2DXIA 1HGXA 1I6MA 3GUVA 4G0MA 13PKA 5CFMA 1MENA 5KI6A 4BAUA 1T1EA 1YONA 4P33A 1M3SA 3OZFA 3T35A 5FFFA 2V8OA 1P29A 4GNKA 1A95A 4PFSA 4C6TA 1RJGA 3T41A 1YASA 4EQ6A 5A0VA 3O3NB 1BHJA 2GBFA 2P6RA 1KQNA 3O9MA 2J67A 5GZ3A 4OAPA 3D0KA 2AOXA 1T8PA 1IBRA 1NUTA 1WR8A 2EF1A 4OB7A 2D62A 4KWIA 4RKYA 4R98A 3W1WA 5EESA 3K0FA 4JT2A 3ZZ0A 1C29B 2HSGA 1KEEB 4D9KA 4DADA 5A62A 4OVKA 2I6TA 2B0CA 2W6JD 2ASEA 4HUQB 3KKOA 3MWDA 2HRDA 2V0NA 1WW2A 3HO8A 4TLBA 4F9GA 5B6IA 3SQWA 4NZZA 3R5TA 1IATA 1V16A 2JHPA 5DI9A 2YFHA 3NDBB 4PX5A 3E27A 4DLNA 4IRXA 2XWQA 1NA5A 2EG5A 1XNGA 1SPXA 4D56A 5K7SA 2UVQA 1HYGA 2XUPA 1VMIA 4TLCA 4XQ9A 1NNEA 5CVTA 1E1QA 1ZD9A 4L6CA 1ULUA 3OESA 1IN5A 1OJ7A 3VPSA 3IV6A 4OK3A 1E18A 5EC8A 4YPFA 4LDJA 5FF9A 5PNTA 2FPRA 1QU3A 1FDTA 1YO6A 2HIGA 5CYOA 3RFUA 4ACBA 1OXTA 2JBAB 4X00A 4OLAA 1UR5A 3V4ZA 2B20A 3L4KA 1W76A 1N9GA 4MV7A 2QD4A 1E66A 5D8DA 3U62A 1EINA 1DUIA 4N6NA 1SCNE 2JAHA 1GJRA 3NGLA 1MGOA 4NYJR 4LDQA 1BX3A 4CQMD 1JAZA 1QJCA 2YJ6A 4JLUA 4NEGA 1VL0A 3M4YA 4LKRA 5HNKA 4CL0A 3F1KA 4M89A 1GLVA 4ZVLA 3UWOA 1HDYA 2OV8A 3BCSA 3LOUA 4R16A 5D01A 3T4UA 3SNKA 1W6RA 2IYXA 1GQFA 2EP8A 3C6XA 2H8GA 3PJRA 4N0EA 4DMGA 3PGXA 3OA2A 2B5OA 3EBPA 1XZ8A 4RPCA 2NZJA 3F7NA 3L7BA 3K6JA 4Z49A 5L53A 1FW6A 3SHQA 3MWKA 2CJYA 1JHQA 3W7AA 4Z4GA 2FETA 1VKNA 4EVRA 4ITRC 1RJ9B 1KYWA 4RM2A 1TAHA 4ME6A 5JV5A 2J09A 2WUVA 3LA8A 2V7QD 2WJ6A 1GYQA 1E3TA 1BCSB 2YWCA 1KFEB 4M54A 4XD7D 2WPDA 2ODWA 4UD6A 1FNSA 1DE0A 3D6JA 3WV4A 2ZBEA 1ZNYA 4LHYA 3QVWA 4QZVA 4EW2A 1WL8A 1AQYA 1NV9A 3KR2A 1U3UA 4DV6B 2ZETA 3DTNA 3JYOA 1JQAA 3LXXA 1W49A 2FJUA 2V97A 3OT4A 2AFHB 1SK9A 1SD5A 2A57A 2QB5A 1I4EB 3I9NA 4II7A 1OH6A 4C5BA 4BNKA 1IIRA 2DTEA 4MR7A 5KTPA 1QGUA 3Q10A 3UWDA 1G7CA 2ZOSA 3U44A 1Z07A 1G20B 3AKEA 2G0NA 3DF7A 3B48A 2E4AA 2NQ2C 4MGIR 3NXSA 1QIGA 3OJXA 4CG3A 4BNUA 4RS3A 2JI9A 1RI1A 2GHIA 3JVDA 1EEXB 4OQYA 4OHRA 5BYAA 4X44A 1SOAA 1XF9A 4G5XA 2P75A 2VHEA 5F98A 1W4ZA 3K9BA 4OU4A 2P67A 3UA3A 2AMYA 4YAKA 4FIDA 4CM8A 4FDVA 4UDXX 2BEWA 4L85A 2XNKA 3SXUA 3DLTA 1JBQA 4OJKA 1EGHA 1Q0UA 2IVFA 1R74A 3IRUA 4KC0A 4LY3A 3I9JA 4HG2A 2O4CA 2PR2A 4X41A 5AK4A 4YUXA 1U0EA 1RLJA 1CUGA 3C5EA 1PJ8A 4WFJA 3FNFA 3JVVA 1XNHA 2IHUA 4JI0B 2CB9A 2V65A 5DGXA 4E5DA 2H1LA 5A3VA 3ESAA 3O91A 1R5BA 4N39A 1NW4A 2QTTA 1SQSA 1L8OA 1EFRA 1UIMA 2FWRA 5E4TA 4CEIB 1ZMXA 2XUHA 5D1NA 2V1XA 4TTPA 1RHMA 1Q0ZA 1B8OA 3HLTA 4IWYA 3EZNA 3UT6A 5ADWA 2G1UA 1Z2PX 1KJZA 4HGNA 1KJ9A 2H4YA 2RAFA 4GGOA 1JHXA 3A1EA 3FVQA 4WCDA 4HNAA 3JARB 3JWPA 2YWFA 3AEXA 4TUYA 4C4YA 3U7FB 1P9RA 1PWXA 3IB3A 4OXKA 4Q4JA 2KW5A 5IDXA 3NUQA 2XHZA 2IYSA 2OC4A 2E21A 5BR7A 2HD4A 4LHXA 2QAGC 1VMEA 4CMIA 2FWBA 4PQRA 4LSWA 5T4HA 4CR8A 5K3SA 4G0ZA 3BFPA 2F3TA 4ZYVA 1XTZA 2J8ZA 1Y5MA 3DAFA 2G5PA 1OFGA 3FTDA 3NHBA 3PEVA 3UCFA 3H6HA 3DOOA 3H1PA 5CA0F 4GPAA 4AP5A 2EZTA 3BEDA 3PQCA 1N4AA 1AE1A 2ZRIA 4OGLA 4XWAA 4U00A 3SLGA 1XPUA 1M83A 2I8LA 4RGYA 4CIWA 5KTSA 2W4IA 1AKMA 1E1MA 3DBRA 3QE0A 4GH5A 5L4NA 2QLLA 3DV2A 4EZIA 1K4YA 1ADYA 2E9SA 2WSIA 3EBLA 4RDCA 5BNTA 2DM6A 4CWAA 2IH2A 3U1VA 4WDQA 1LDMA 3VV2A 4QOIA 1NWCA 3FWPA 4LNAA 4X9XA 5KYTA 1E6EA 2FUG1 1T0JB 5F2EA 4QLAA 2Y1OA 1ZJYA 3MD0A 2OV1A 1OIXA 4FR0A 1A9RA 3W2GA 2PH3A 5JAOA 1EI9A 3WLFA 2C3OA 1G6HA 2Y1XA 4RIIA 4DSAA 3K20A 1I1OA 3UGQA 2JFWA 2PZGA 3DFKA 3NV7A 2H06A 2IEAA 4HGOA 4HDSB 4RVGA 5FB3A 2BMAA 3DZFA 3N9IA 2NU9A 5BMVA 4EHFA 5JCZA 2P4SA 3WYGA 1RXWA 1A8UA 3QTLA 4J1SA 3OKCA 4MQEB 2C0PA 3TZCA 3PKIA 4C4XA 2HOQA 3IL2A 3TXXA 5CB4B 4BNDA 4LY6A 3OZDA 4TXNA 4ACAA 2CNLA 2CLHB 1ZNXA 3LUJA 1V95A 2BLLA 5LP6C 3TKAA 5HZHA 4LXUA 4ZALA 3ZLBA 3O8DA 1MOQA 1Q1BA 4TYQA 5B7NA 2DCMA 1GPLA 4S0XA 1N2JA 4J29A 2IYOA 1TM3E 5EIWA 4DDKA 3OEYA 1KBZA 2I9KA 1H1LB 1HQYE 4WGFA 5D86A 3ROMA 2WM8A 2W58A 1VDMA 2RHTA 1XVUA 5C8YB 3TQSA 2WWYA 3A1CA 1CR4A 2I2WA 1BH2A 2HREA 4GOJA 4QYMA 2RI1A 4AB1A 1YUNA 4A1OA 3I32A 2UUOA 3I4FA 4INAA 2HF2A 4ZV7A 5THXA 3RIXA 1IVSA 3BT7A 3DQPA 3KSRA 3MOIA 4Q34A 4ZT3A 3TZHA 3Q7TA 3EGIA 3W2TA 1G5RA 1HORA 4R1SA 3EFOA 3ELDA 5E1MA 2CF5A 3WBJA 5FOUA 4A8JC 1MN6A 4TQ9A 5KX5F 4CEHA 2HQOA 3JD1A 3UA4A 1UBOS 4ETNA 1QCCA 2WQ7A 5T8KA 1JZQA 2B6NA 1SZDA 4MQ6A 3TLEA 3IQHX 4FS8A 4JU9A 4OQXA 3MIIA 4YQZA 1LSSA 821PA 5HWSA 2Q5EA 3AI7A 1MXHA 3HVUA 4ZEOA 3VYWA 4WLFA 2FMIA 4RTKA 1GGHA 4X8HA 2FW8A 1K27A 4HKTA 2GJAA 4JC0A 3S2FA 1J7JA 3S2GA 2IZ6A 1WE2A 1RWBA 2GT1A 5JWRA 2W6NA 5A9SA 3DMDA 4WY5A 3GFVA 4Q4CA 2Q49A 2XT0A 5IT9A 4HDQB 4HYYA 2OYCA 1NVUQ 2DY0A 4MVJH 1WZCA 1KH2A 4RPKA 4R41A 2Y6UA 4U6QA 4BNMA 1QZZA 2A92A 3C1TA 4BEJA 3ZW8A 4U7TB 1EFPB 1M5TA 2OKGA 3PCTA 4JGGA 3ORSA 2I6SA 4Q4HB 2EJUA 4WKOA 1SHKA 1P5HA 3AETA 3H7IA 4LJSA 4Q9IA 2XB4A 1QZTA 5DBGA 4XWYA 5KNBA 1CDEA 2AMJA 2JJ2D 2QTZA 1NQAO 3AU8A 3RTCA 2F3RA 3BN3A 5BWBA 1JHDA 1XJ5A 3IDZA 4OKNA 1YBFA 1G2QA 3B7GA 2BP7B 3NT2A 1EP1B 2F4VB 1WUJS 1YZGA 4KO3S 1JDNA 2CDRA 1DX4A 1K5DA 2GBLC 2NU7B 4HNGA 5L3SB 4HFRA 2I55A 2BN4A 3M9LA 3EXAA 4ZT2A 1N36B 4IVRA 4NJEB 5AOAA 2RAVA 4AKSA 1ZUD1 1Z47A 3L2OB 2X0EA 3OWOA 3IEIA 1EGMB 1R8SA 1SVIA 3BWDD 3KE9A 1B6GA 2TYSB 3HNPA 4PYQA 1M1YB 1QIHA 3JQRA 2YNMA 3T5BA 3AR3A 4ABTA 1PNOA 1ML3A 2YWBA 1V25A 5B30A 4PIVA 3NBMA 3ESDA 1TIPA 4N1AA 1PZHA 2Z6VA 4HNTA 1U3CA 3W6PA 3KZCA 3RJMA 1GZ6A 3KTAA 1KORA 1ZHFA 3I0NA 2V7QA 2Q6TA 1TADA 3COPA 2QD2A 5KINB 3LQRA 3CV3A 4Z3OA 5L95A 3IUSA 4RIGA 2AR0A 4PWZA 2WTAA 2H11A 4UHCA 4M8LA 2V7UA 1QC5B 3CLSC 4R8RA 4TM7A 3UJ9A 4EQZA 4LF7B 2O8FB 1F4VA 3E5MA 4B6SA 1FSPA 3LO8A 4NYIQ 3D54D 1IJEA 4JC8A 2UZ1B 3TOVA 4ENWA 3V8BA 4HXEB 4EBBA 4WSOA 2CZGA 1YJ5A 4RIFA 5JCOA 3SBEA 4ENVA 1UM8A 2AFHE 4J43A 4OK5A 4FFBA 2HXSA 4WXEA 4B35A 4B4DA 4RKQA 3USZA 2BOVA 2R5NA 3GVPA 5JAMA 1SOVA 1WCXA 1T9GS 2NTVA 4DUZB 3U3XA 3PQFA 3RSFA 4GBJA 4F71A 2FMTA 4D9NA 1I3NA 4DCCA 3BE8A 2NSYA 1BE8A 3EFOB 4KNYA 1P91A 3GG9A 4FI3F 4DJ5X 2XDYA 3NTQA 3E5HA 2MSCB 2ACWA 3OLVA 3S55A 1E7RA 1Z4OA 1YRHA 4Q9HA 5B2ZA 1JEYB 4CQNA 1ULZA 4KO8A 4OHFA 3RVOA 1M75A 1Z0AA 4BVLA 1S8OA 4XWTA 4B2IA 2COEA 2NO6A 4PN3A 3KZKA 2QRNA 1G4HA 3PUJA 3AHHA 2O2IA 5CCDA 4OYRA 5F5XA 1X0VA 3K4PA 4YCSA 5HG0A 3ZI4A 4YCMA 4FBLA 2VCEA 4C21A 3MA0A 2XQFA 4UTZA 2H9AA 1DBIA 5BYBA 3C43A 4DV2B 1QHEA 1F1JA 4Y3UA 4EG6A 1DUVG 4D25A 3R3XA 4G4SO 2DC1A 4LTMA 1ATIA 1UPXA 1A7KA 1XRQA 4GX5A 2IYWA 4BLQA 5CFNA 1JHVA 4XARA 2FSFA 1NNUA 2E55A 3DOIA 3IR7A 1GLNA 4EG8A 1XALA 3T3NA 3KAPA 1K7XB 1P4HA 3QKSA 4RHXA 3X1WA 3ZV4A 1C7EA 2W7TA 2EW2A 4HAVA 4GL2A 2XNJA 1EFRD 3VGJA 5U4XA 2FXIA 4TWIA 4HRYA 4XCVA 4RDXA 3GRKA 4EB6B 2ADOA 5HQ3B 4WV3A 4C2TA 1FRFS 1W73A 1YQQA 1ZSYA 3L8ZA 4XSHA 3NBYC 5F35A 1ZITA 2X0FA 4C89A 4LJ7A 2XMBA 4J0CA 4CFZA 1GP2A 2C88A 2PGXA 2JAPA 3L0BA 2BFEA 4ZAGA 4TLDA 4W6ZA 3DBVO 5K4GA 3D5QA 3OMXA 1DG9A 3DWIA 3CNQS 4NI5A 2GO1A 4N47A 1Q7RA 2JFUA 2O20A 3KKLA 3ZDBA 2HYDA 1N8KA 2VYFA 1ZRMA 1BE6A 1Z33A 4G4JA 4REQA 1WABA 3RH0A 1NM5C 2VQFB 3DFIA 5BN3A 1Z4QA 3GDWA 4R4JA 4EG5A 4DN6A 5JDIA 3PQ2A 1BCRB 4ASUA 1M72A 1AHHA 2WSBA 1IQ0A 3HXPA 2PSHA 3ZGNA 1IHOA 5FTKA 5CLJA 3NAQA 3ZEAA 3ZWVA 2A9RA 3BFKA 1MCZA 2EZ9A 3DEHA 4CHGA 4CN9A 1VLMA 2QV0A 1ID1A 4GVLA 4QUKA 4BY9E 2WZBA 5D87A 1C9MA 2ATVA 3R6LA 2J9FA 4TZ6A 2D0DA 3IB6A 4DG8A 1IMJA 1EVIA 3GEMA 5IF9A 1W5TA 1ZGZA 3MPOA 3CF6R 3HXMA 1K9VF 1ZCFA 4F4IA 4O2BB 4Z7NB 1VMDA 3RIYA 4I19A 1U5AA 4IDCA 4E08A 5F33A 2FPPB 3LBAA 4HADA 1D0SA 4Y6SA 5DOVA 3UG7A 4QFDA 4KRGA 2A5LA 1TJYA 3U09A 4BVHA 4ENSA 1SBHA 2P27A 2QVCA 3EUWA 4GR5A 1D9ZA 3O75A 1HTBA 1OASA 3EA5A 1MO5A 3JRXA 2PA3A 3L4BA 4TMYA 5CB4F 4ND7A 3CUWA 3WRVA 2OKCA 5FA6A 1V3TA 3QYPA 3RARA 2NZWA 4BFYA 5KQMA 3TLBA 4QGHA 3OIDA 1IY1A 3PUVA 4G6ZA 2IWHA 1EUCA 3WNBA 4IZOA 1W0CA 3LF2A 1RADA 1K1EA 3HFGA 4DB2A 4IXMA 1I7NA 1KAHA 3JCZA 4OFBA 5FR2A 4I4CA 1L4FA 2B69A 2ZUWA 1CG6A 2GTPA 4O4HF 4PS0A 1NVXQ 5IM5A 2IS2A 5D7NA 1DO0A 3NHFA 1QO9A 2O2DA 2J9RA 4C30A 3PUIA 5A9SB 3OUZA 4YXWA 1SA0A 5KCMA 3VVMA 3ESCA 1ZGAA 5K5EA 2VJKA 4US1R 5C31A 2NO9A 3WMFA 2P11A 2FG7C 1WUKS 2CZQA 4CIXA 2DLNA 4FKMA 5HRUA 2X42A 3AVUA 1O95D 2R751 4QBTA 3MILA 1UOEA 2QLNA 2Z8YM 1TZMA 1GTG1 3EDQA 4XFDA 4CV3A 3TF5A 5LMUB 2DHQA 1FUIA 1MHPA 2H54A 5CU7A 2CLEB 2WD9A 2VOJA 3COZA 2FSGA 3KEGA 5CX1B 2NUPB 2ZI6A 1Y48E 1HZZC 4N9WA 3P27A 2M32A 5DTMA 4P7BA 2MR6A 4AI6A 1XJ0A 3U9LA 3CT6A 2E1PA 4LG1A 4M83A 4RK1A 3UNXA 2OGTA 3AM5A 3DA8A 5BSKA 4GKAA 5C46F 1J97A 4MA4A 2J0UB 2RHMA 4A7PA 1PFGA 1QIFA 1RHKA 4G5YA 2ZBQA 3VJRA 2LTAA 3SYMA 3VZRA 3ST7A 1V6AA 4ZFNA 1PFUA 1P7YA 3FOFC 1OA0A 4AFNA 3H2BA 4FMDB 3RC7A 3L01A 4FOPA 3LGSA 1U11A 2C4UA 3N5KA 2CEKA 4FE7A 4IH9A 1QPGA 4RVCA 4X6YA 3W5VA 3WBBA 4Y2XA 1GAQA 1ZJ5A 1XPJA 4AJ1A 1UXGA 1KRHA 3QZUA 4B17A 3GBSA 3NAGA 3OKAA 3KALA 3TX2A 2H4ZA 2O0JA 4NC9A 5EN4A 4AJEA 4WINA 1BIFA 1RQXA 1TZJA 4J0FA 4YDHB 5DBEX 3W8RA 1PT8A 2CFTA 4B7UA 3PD1A 4OHVA 3SVZA 1K5GA 1U9YA 4PLWA 3EZFA 1N2ZA 1D4FA 1GRVA 3DXFA 2IUEA 2JJ1D 1P7VA 3ML1A 1TT5A 4Q02A 5ALDA 3WMWA 3P9NA 2PUGA 3KELA 1JILA 3Q0IA 5E6RA 5JFGA 5IHPA 1IBCA 1Y6FA 4JI8B 1AUOA 4NWIA 1EZZA 2EFJA 1NYQA 3F0TA 5C1OA 3K71B 4OYLA 3H83A 3K1AB 4BX0A 3SHTA 4EYKA 1XQWA 2JEYA 3RADC 2QGZA 2WU4A 3CCCA 5HF5A 4I3HA 1E2PA 5MGBA 1TCBA 5DBOA 3NWEA 4JQOA 4B76A 3HZRA 3U4QA 4YRCA 5CPBA 5TMDA 1SRRA 4G0UA 4YCBA 3VR3D 4IHQA 3B20A 3KQVA 4RVOA 5DTJA 4BBPA 3D3NA 4GPBA 5FUQA 3OE1A 2CUZA 1RXVA 2C61A 4FCTA 3SF8B 5BR8B 2Q0XA 5KNBH 4W5OA 1UT8A 1Z0IA 3OC0A 3MQ2A 4C4PA 2QJOA 4OHCA 1DP4A 5SZIA 4Q1CA 1IBLB 5G02A 3RVNA 2PPVA 3NW9A 3M1LA 5D85A 1BKSB 2CNKA 2YZMA 3A9WA 4U2DA 1VBMA 4E2YA 2R48A 1HYEA 2FF5A 2PT9A 4JYBA 1OZFA 5DYNA 4HL6A 4LJ5A 1MT0A 4R2JA 2HCBA 1RCUA 1Q0RA 4Q3KA 3RKUA 4CR7A 4R1LA 3UMVA 3Q1LA 3G5MA 1CFZA 1H6AA 3BXFA 2VKTA 1PFYA 4H3KB 2NIPA 4BO9A 3RTBA 4L4SA 5HF6A 4H3VA 3RRBA 3INNA 1JR3D 2VQDA 2CWDA 3E0XA 3LC1O 4ZT5A 2MYTA 5AHOA 4EMTA 4R2MA 2BFWA 2ZIXB 4BKQA 2H1HA 2ZJ5A 4DM4A 1GAEO 1WHTA 1ZVMA 5HRCA 1SZJG 2QVXX 4AG3A 2WT4A 1G98A 3MUNA 3T4PA 1J70A 2IFTA 2GEKA 1SIOA 2WTEA 1EQAA 5IMBA 3TGLA 4PNHA 2RGNA 2H4FA 1NW3A 1T2DA 4M86A 3L7MA 3TWOA 4R1UA 3PR2B 3G2OA 1HKHA 4AQYB 1F4LA 1NW7A 2TS1A 5D84A 3WK8A 3ZK7A 4F1JA 1CU1A 3A6ZA 5E7QA 3HRKA 3STWA 2B1IA 1YR6A 4LYJA 1RD4A 2EP7A 1L1EA 1QHNA 3DCYA 2ZTVA 3SG0A 2G70A 4QQNA 1JR4A 2PCLA 4LDPA 3E15A 4WEQA 5JBQA 5KMGB 1Z17A 2QL9A 1HRDA 4LYYA 3VMFA 4AAYA 3WKBA 2CZCA 1UADA 4FN4A 5IZCA 5JG7A 1TRKA 4NONA 5FDFA 3I37X 4D8WA 3CH6A 1H4VB 2FRXA 4F1KA 3OICA 1J00A 3ND9A 4GO1A 3JD2A 3OPVA 2GCOB 4Q4LA 4LIPD 3ZD6A 1Y82A 4KPEC 1OR8A 2H0QA 2QR3A 5EJ8A 3SYTA 3PENA 2C58A 5EJ5A 3AVXA 1XVIA 2FOIA 4KGDA 2VJMA 2VL7A 3H4VA 3VR6H 3C6QA 1OGJA 1NRXA 1T4CB 2QNBA 2V74B 1D2EA 1TVCA 2AUNA 3U31A 1XPRA 1TXGA 1E0AA 2PY6A 3KJGA 1BOOA 4LMBA 4M98A 4W82A 1KBOA 2EWWA 4RMGA 3W9BA 3KVVA 3HCAA 4XJSA 3GY0A 3PUKA 2AKYA 1DMRA 1A50B 2Y71A 3BHIA 4RJIA 5AHWA 3LYLA 2ESRA 3LYAA 5D2CA 1IY9A 4KGXA 4CNBA 1U1IA 2K4MA 3ZZUA 4E1BA 4UNNA 5KTKA 4HLQB 3UHPA 4JMPA 3AUAA 4Y2HA 4NMLA 4BO7A 2IXDA 4M60A 2GCNA 1M6VB 5EZYF 1U0OC 1OLUB 1SVNA 2BBSA 3B9RA 4H7HA 4MAMA 2VJBA 4OY3A 3VVCA 2C98A 2NV0A 1U90A 3D7MA 4WVFA 5EL0A 5IVHA 3GLHA 2YOGA 1Z75A 3JQDA 1E1RD 3AQ4A 1HNWB 3KXPA 1ORIA 4UAVA 3DYBA 4Q9LA 4J0GA 4E5KA 4DSTA 4XCQA 4NBSA 3ACDA 3ONWA 1TM4E 4MS4A 1ZM7A 4QPJC 4W8GA 3X0DA 2VRBA 2BGKA 2ORWA 4QEKA 3PFGA 4IO1A 3Q15C 3BTUA 3KQUA 2H1VA 3V1MA 2LKCA 3QKTA 1R4MA 1T2VA 2Y1CA 4GS5A 2OQVA 2JLBA 2HWUA 2FVYA 2QLMA 3IT3A 5BXYA 2E4YA 2IEDA 1NAIA 2XSZD 3LH5A 5EP1A 5TGDA 4NU6A 4C78A 4GW3A 4PAQA 3KQSA 5EI5A 2PKWA 2QSZA 4PC1A 4QX6A 2YKGA 1SUBA 3PR1A 4HEHA 4B3CA 2NVBA 1QP4A 3DULA 2ZATA 4H6VA 3FUVA 1U2TA 4TWBA 4BVEA 2PUFA 2JBHA 1OC4A 1Z3CA 3DFFA 3I72A 3IVAA 4LV5B 2WTUA 2GHQA 1JJVA 4MKXA 1XLVA 1VL1A 1YHZA 1VLVA 2QXUA 1DELA 1GM5A 3SS8A 2WJ3A 4ND6A 2FPSA 1ZW1A 4GP7A 2BGTA 2P2DA 4TOIA 3INGA 5DM0A 5CDFE 5A05A 2PTGA 3R44A 3AIMA 2GPJA 5C8VA 5LYJF 3NO4A 2BKAA 3BCUA 3HJFA 1YAJA 2FR8C 4K03A 4K6MA 4YXWD 3PE6A 1G7RA 5AVTA 3L40A 1YQ9A 1F8FA 4KUEA 3S29A 1WCYA 1RBMA 2ZSKA 4F8YA 4GMDA 3O83A 3WWYA 3OLZA 3RKSA 3K16A 1KJNA 2GAJA 4XTRA 4DUYB 1QE5A 1W6UA 3U17A 1ND5A 5AVSA 3MMZA 5IVDA 2XTMA 3JTEA 3OLQA 1Y3DE 1D7AA 1I1QB 3KL2A 5B6JA 4X0EA 1YBAA 1Z83A 1CJTC 1H42A 1TW3A 3FGPA 4HVAA 4Q12A 5KQLA 4AROA 4PFKA 2C97A 1US8B 5K0ZA 4BVAA 2ALJA 3AL2A 2YFYA 1C3OB 1EKXA 3CA8A 2E5WA 2J87A 2WVHA 4RVFA 3S5UA 2NGRA 3Q8WA 3TN7A 5DBHX 3U9TA 3E82A 3ANYB 3HC7A 3NIBA 1O3YA 1SOUA 3EB9A 1RQ2A 2GEBA 3BJIC 4HDRA 4OK6A 1ZC3A 5JI3E 5LP6A 2G3YA 2PVSA 1E32A 3O82A 3F5QA 1KQ3A 1JYFA 3HP4A 1FJXA 5ER6A 4REOA 5A5EA 3LL7A 3G5AA 3GH1A 3VHRA 4ZT6A 1JFTA 2IU0A 1JHUA 1SURA 4RH1A 4YRZA 2QS9A 1X74A 1K7YA 1LD3A 4XX0A 1XHFA 3TEMA 4EITA 3IAM6 4P34A 4X1YB 4JS0A 3PQ8A 3LTNC 2GAAA 4R8LA 5T67A 1R8JA 3O7WA 1JG4A 5T3YA 1AXRA 4PLYA 5IN4A 3G9ZA 2GA8A 1N2GA 3CC8A 3V7NA 1TMKA 3DXXA 3L8DA 2O8FA 2VT2A 4DZRA 3SF8A 3GZ4A 3R41A 1M6HA 3HKDB 1WNFA 5KQRA 5BSRA 5CJ2A 1E8DA 1AGRA 3IEUA 2GYYA 3CUTA 3TBHA 1Y4ZA 2QLJA 2J5KA 4UEOA 4D9HA 4UHFA 5TQ2B 3P97A 5T8KC 2A3NA 3NC1C 4DQLA 1ADGA 4F6RA 3LBNA 2R65A 5IVKA 2F1IA 3G1UA 4KAXA 3IJRA 2G04A 5AVKA 3ZEIA 3I9V6 4ZU6X 1TYEB 3BORA 4JVSB 4BTLA 1G291 1J2JA 2VVTA 3J7TA 2G63A 4MS1B 4IV5A 4MVJI 1EWTA 3NM4A 5KX5B 4DR4B 2Q5LA 3TLYA 2C5EA 1F6BA 3LPCA 3P0JA 3VYSB 2IIBA 2HWXA 3CF4G 3KYCB 2RK3A 2OILA 2B2XA 1CJVC 2RKBA 4IGAA 1NJSA 2ZT8A 4UHDA 3ZS9A 4LBZA 4MWDA 3UB3A 2V4ZA 1RBQA 1E0JA 3GCZA 3SJ7A 2HZBA 3AZQA 1XZBA 2OHIA 1MPTA 2H5IA 1E5TA 3E9CA 1N1GA 1WVIA 3H42B 4HQLA 1D5CA 1I2ZA 5E7MA 4JL5A 5CRIA 1EVEA 5EJ6A 4U2CA 4II2A 5CM8B 3IVGA 8ADHA 2HLHA 4JI6B 2HBYA 4F2PA 2AOTA 3I6IA 3LQFA 4P0PB 3FPLA 4AJLA 4Z4FA 1TU3A 2RGAA 1K0FA 3FMIA 4FHGA 3LX4A 5BVHB 2CDCA 3P2MA 4G01B 3N0VA 2QTRA 1EK2A 3U4CA 1P1JA 1OZHA 3RU2A 1UFVA 4M9XA 2WT8A 4MYTA 3RYHB 1N7IA 1AKVA 4IV8A 3H86A 3LD9A 4CL3A 2PUEA 1F7UA 2JCGA 4ARSA 5CCEA 2GILA 5GADl 1JFLA 4IF4A 3NHWA 4KMSA 1UDXA 1ACMA 2JGNA 5AIAA 4YREA 3ZGZA 2PL9A 2PZJA 1IBMB 2BZ0A 1OFIA 3WNQA 4B32A 2ZTLA 4RJ2A 3FCSB 4DDUA 1OFVA 4X20A 3Q6NA 1P75A 3I9FA 4Y67A 5HJ2A 3TSAA 2JVKA 5LBTA 1ETUA 2PQ0A 3QEJA 4EP1A 4GGPA 1X2EA 4MGYR 3SGLA 1JG6A 2WAMA 1QHYA 3SZRA 3WRYA 4YX9A 1RE1A 1TQ4A 5CH5A 4CMCA 2PK3A 2J9YB 1RM5A 4EFMA 4YCCA 3RUPA 3G85A 3UANA 2EZ8A 1QRSA 3W2FA 2R9VA 3ZWQA 4D6YA 4PU0A 3EDYA 4IV0A 5A3SA 4YFYA 5EERA 1N5DA 3UMSA 2VRCD 1HYHA 3UCEA 5TEVA 2O50A 3AHJA 1L7AA 4XH9B 4EYSA 4G5SA 3UFBA 2R1TA 3WMRA 3CLUC 1J2YA 1N7HA 1XZAA 3EAFA 2WYWA 4YRSA 5K05A 3B1WA 3VKHA 2QUZA 1Q15A 3NHSA 2DPHA 3KJXA 4YAGA 2GM5A 3W9YA 3HRIA 2PMKA 2PS1A 2X9QA 3R3ZA 4RZXA 4TVKA 4C20A 1H05A 1Y0BA 2I87A 1X42A 4FFPA 1TAGA 2VNJA 3GYGA 3VR2A 1GNRA 2EEPA 4D6PA 1R6XA 1I10A 1RXYA 4M9QA 2ZIAA 5AJTA 5K3FB 3W6ZA 2D13A 1DFGA 2CYBA 2G0TA 4EA6A 5JJ5A 1CQIA 2FN8A 3DKPA 4JKYA 3KQYA 1UDCA 5JLAA 3K9FC 1WPQA 1OXMA 2Q1TA 2YINC 4KRYA 5AICA 1NQTA 1FVXA 3TIGA 3IURA 1ANKA 5FPQA 1CJSA 4NOKA 3KVYA 3AZPA 2OO5A 1N2EA 3AFOA 3G17A 1G8MA 1VP9A 3EIOA 4IIXA 3PFWO 3GLGE 1TUEA 1JTEA 3FUXA 4GEKA 2DUMA 2Q99A 4H3SA 5ALNA 4IDGA 4JI1B 3S70A 1U0RA 2P5SA 4J3NA 2F1HA 1MAUA 1A9ZA 4JVNA 2QQEA 1A9QA 2PV0A 2I62A 3FMFA 3VQTA 1SVKA 1CEYA 2DFLA 2C3YA 3W4KA 4EJMA 1T4BA 4TSRA 2JGDA 4CKCA 1PWZA 3RW9A 3RYCA 1BFDA 4DT1A 4X93A 5LUAA 4OBXA 3PQ7A 3E35A 5L3QA 2QIPA 1CZUA 4P0TA 3PRHA 5IJ0A 1T5DX 3EA0A 2FG5A 5LMCA 4KVZA 1L8QA 3FVWA 4UKDA 3ZHOA 2WU3A 2H7CA 2CDBA 3HWSA 3ESXA 3GFPA 1DKPA 4FYJA 5CR9A 4ZDIA 2VNSA 3E9ZA 3CB4A 2IDZA 2H4XA 3QITA 4Q00A 2I7DA 3PT9A 1QS0B 1ZD3A 4I5EA 2PT6A 4WLOA 5FFMA 3B70A 3BRWD 2WDPA 3GOHA 3K2QA 3QPAA 2WTXA 4HAOA 4ND4A 1VC2A 4LX0A 1KAEA 4GM0A 2F7SA 4V24A 1PGPA 2GPBA 4QOHA 3UTCA 1RKXA 2IHZA 5JISA 3UJ8A 2V0CA 2IV2X 3EARA 3N05A 3SBOA 5B3LA 2C7RA 5CVJA 2Q1YA 3KHUA 2F8LA 4BRUA 1L4GA 2GBIA 4KLAA 3UKDA 4FI3C 1NOIA 4O08A 3E84A 3LY9A 1ZXXA 3HI4A 4QO7A 1JAXA 3WRYC 4ZYXA 2VTBB 1PBNA 4F4FA 4MP6A 3AK4A 3K5HA 3VPBA 5LYJB 2B9VA 2YBEA 5IZCC 1CKEA 4UREA 1GPAA 2XQJA 3IA2A 3D1VA 2R6AA 4LYHA 1GL6A 2XBLA 2YC4C 3HSSA 4AN4A 3UJAA 5IH7A 3LTEA 4OATA 4YT2A 2J33A 5JH7B 1GSOA 4P4NA 4PO8A 3SJZA 1EB9A 5IS2A 3CKYA 3QOWA 3O9VA 4N0DA 4FW8A 3T7DA 1A7UA 1QP8A 1SEVA 5AXCA 4FLMA 4PSAA 3ZW9A 3RROA 2Q5CA 3JAKA 2V6MA 3LHFA 4KSYA 1TKRA 4WLUA 4YJ2F 5CDGA 1IZYA 1ESCA 3R7DA 3VPHA 1CNFA 4E0BA 4BB6A 1XCPA 3H11A 3M33A 5F9MA 1WPXA 1N5RA 4P36A 3REOA 1N2IA 2C8VA 1GOTA 1PGQA 3OFND 3NOOA 4M9SA 5FBLB 3I05A 1SQ0A 1SUDA 2P6MA 3N0RA 4J49A 1KRXA 2AFIA 2DPLA 4GOOD 4TMFA 4ZVQA 1R6VA 1XA4A 3S81A 5CCXA 1E3MA 2OA0A 5GQSA 2XWSA 4B4OA 1U7ZA 4DR2B 1DAOA 3HWRA 3F9RA 3QOFA 5B1HA 4QBKA 4RZIA 2B4AA 2ZJFA 4R9RA 1ESDA 1HE4A 5FBKA 1VA5A 3OLYA 5A7FA 3L6OO 5IT4A 1NPDA 5LQCA 3MS4A 4ALIA 2PLNA 4NVRA 1UEJA 3CY6A 3HKCB 1AZWA 3VVLA 2GCGA 4JENA 1SAYA 3RIMA 4D9BA 1L7PA 3LLMA 5DDIP 2H1RA 3AJEA 3K8YA 1NXXA 1F2VA 2P9HA 4R3WA 4D96A 1MC1A 3ZVNA 4CUZA 3HG7A 3CVUA 5EA2A 1HSOA 2AMVA 2FFAA 4Y0NA 1IXZA 3HKBA 3N87A 4B74A 1I01A 2QI9C 3B36A 4H7EA 2G88A 1T9AA 5C53B 4F3TA 2VPIA 3O84A 4Q7KA 3TM4A 1XNQB 4DEYA 3V97A 3R9IA 2JA2A 4DVGA 2J32A 4M38A 4Z3KA 5ELLA 1SUAA 1ZRSA 3ZI7A 5ICFA 4L73A 2XMGA 2R6JA 4BZZA 4DWWA 4LXHA 1GRNA 1G21E 2BD0A 3FMPB 4JDUA 4E1VA 1T9HA 3UAYA 5B36A 3K3PA 4RCYA 4V3CA 2HW8A 1XAGA 1UBCA 3TRDA 1KEVA 2CUKA 3OFNA 2ZB2A 2QXYA 1IZ8A 3NS7A 2F3UA 2JRCA 1E2DA 3ICVA 4OFZA 4YI5A 3I2JA 5FNVF 1TMGE 1UAGA 2YICA 4TMXA 4BB5A 4ERNA 4YNBA 1JIUA 5GIOE 4MQ4A 1U8TA 4P83A 3IDFA 2OZLA 1K7SN 1N2CE 2O23A 3C39A 5B58T 1NATA 1TNDA 4R40A 1DXHA 1VIDA 1A2OA 3CZ4A 4I8IA 3U7GA 4J9VA 4Z1MA 2I5PO 2CHFA 3C7KA 2D1SA 3RTEA 4WHMA 3GJQA 3RS5A 1YZTA 2QL6A 4KXVA 4PAMA 3W0LB 3AT1A 1EHCA 1MHTA 3IIKA 3Q3JB 2C57A 2OD7A 4IKOA 4LYGA 4UPVA 5DM60 2ZJOA 2CSUA 3E18A 3DKRA 3WBKA 5B3KA 1GCAA 1EE2A 2PG3A 3DZHA 4BECA 4URUR 1W1WA 4JEMA 1HL3A 2VZ9A 3LPNA 1GU0A 5D1HA 2ID4A 1UXIA 4KPUA 4BNYA 1N6NA 2ZT7A 5B7QA 2FRVA 3OJFA 4PIPA 1HNNA 5JS6A 2X19A 4LXIA 4P82A 3FGOA 4BDTA 2F3PA 3D1LA 4OUDA 3UH0A 4YH1A 3H9QA 4XASA 4DPKA 3BPSA 4GMKA 4PBTA 2ONZA 1R4MB 1VCMA 5M3BA 4V39A 1P7WA 5HZMA 1ULSA 4DV5B 3FWKA 2ZQZA 1PW7A 3UZUA 3KJQA 4JJZA 1NOJA 4HGQA 1N32B 2WWGA 4GRAA 2JCSA 3ET4A 3KJEA 3ZCXA 5EQDA 1GADO 1M34B 4Z54A 1JYSA 1E4EA 3GLFB 3WB2A 2QIOA 1JT2A 4P2BA 4E51A 1Q50A 4UULA 4C6TB 2V58A 4BS9A 2Q1XA 2XMPA 3MTDA 3Q9UA 4JT8A 4WNCA 5TMBA 3DE1X 5KDDA 4AKHA 2W90A 2YVQA 1MJGA 1HQCA 2QMYA 4PLHA 4ENTA 4MW6A 4KLNA 1RP7A 3FKJA 5DNWA 3QE3A 3ZGOA 2IC5A 1L9KA 1G63A 2BAGA 2ZXUA 5I9BA 3QA9A 5B64A 1KI1A 2ENWA 3LPMA 5CP8A 1H65A 5A7HA 2MU1A 3OZRA 2Y6VA 5KSYA 1F60A 1VSVA 5TDHA 4H3HB 4XDHA 2E5FA 1UEXC 1C9KA 4ZO8A 4BNVA 3DM9B 1JLHA 2CLSA 4NBWA 4EW3A 4W5QA 1J9EA 3ENWA 5CLGA 4DZTA 4MV8A 1KDVA 4JBWA 5TS3A 4ESHA 2Z9CA 4JI2B 1GT6A 4HN4B 3RUCA 2OCGA 4NQRA 3R76A 2VK1A 4MQEA 1DBPA 2Y1EA 4PIMA 2O0KA 4G85A 4CHTA 1ODFA 2Q2NA 3N2YA 1F9AA 3LW8A 3GAMA 5LQMA 3K94A 4BGVA 1PJZA 3FD8A 2HF8A 4HS4A 2C83A 2QY6A 2WKWA 3MJEA 1VIAA 3DNFA 3FNGA 4QU8A 4NE7A 4MCIA 4QUGA 3QUQA 2JF0A 1MT3A 2QQ5A 1AO0A 3VNQA 4HATA 1GRCA 2D74A 1XDZA 1FRVA 5KDLA 2K87A 3DDHA 1JWBB 2GJKA 3LXUX 4MGKR 2RH8A 3L0SA 5B2FA 2NTYC 2H18A 3OLXA 2BW0A 5EP3A 5AQ1A 1TJNA 4PM4A 1SG9A 3RM3A 5BN5B 1AB5A 1HE3A 3G23A 4Z4QA 3GJ6A 2DHCA 2IYTA 4TM8A 1YE3A 1SBQA 2QTNA 1Z0SA 1UOQA 2ZYDA 4AUKA 4JYZA 1SJ9A 4MQFA 2NVUB 1R0YA 3COVA 1KR2A 1DAFA 2HPVA 2QK4A 1YTUA 2PM8A 2W00A 2HJRA 2PTHA 1VIVA 3DDZX 4CYMA 5DEIA 3N3AC 1DTWA 3CFYA 4IGKA 1U1FA 5DGDA 2WA2A 4J03A 4X84A 2QN3A 1X8LA 3AF2A 4F3KA 2VYVA 1L7NA 3KOWA 3AY3A 1E2LA 2RGYA 1R9GA 2N75A 3S3TA 5KVCA 1WMEA 2FY8A 3JVUA 1FW8A 2BFFA 3Q11A 2BI7A 1YBMA 3QWHA 1OBFO 3ZLJA 4BNXA 5BWOA 4P1ZA 1JIJA 4G1MB 4BIIA 3IULA 1LA2A 1GU7A 2W6ZA 2GKOA 4TTQA 3G9UA 2BZ1A 2HNAA 4OHMA 1T5IA 1YS1X 4E15A 3ORYA 1MABB 2ZWOA 2JIBA 1FS6A 4OPMA 5GPBA 5JZOA 1P6UA 2J3HA 3T1VA 3RUFA 3AHGA 4V2UA 3IQZA 2KLBA 5JSZB 1GL3A 4K9RA 3OE7D 3PC7A 3BK1A 3HL0A 1NP6A 2WZQA 1QIMA 5K1ZA 3ZC3A 1IM2A 2A78A 1PUJA 2B7CA 4QOFA 3QUSA 4HLUA 1X15A 4N03A 3KRTA 3S28A 4QUJA 2IZ5A 1ZMBA 3EA4A 2RH5A 1SXGA 2OESA 3S40A 4NBVA 3KUCA 4ZPXA 3LSYA 1M54A 4JJ6A 4KX5A 5HCUA 3FYDA 3PLAE 3HB9A 5ERYA 3P0RA 4C08A 1NUHA 2R3SA 2D0IA 1P2SA 1EMDA 1WQ1R 2WNHA 1FDIA 4P92A 5FO1A 2XRMA 3ABOB 3CCBA 5TR9A 2D4HA 1QHIA 1B0UA 1MX5A 5EE1A 1PF7E 5EHNA 4MV3A 3GLHB 5NULA 3D8UA 2XTZA 2BYTA 2PX5A 2WIKA 3PQDA 3ZOZA 3U7IA 2OHXA 2A88A 2UUPA 3VDNB 1EB8A 1V39A 3I1FA 2Z43A 2XCTB 1IJFA 1NF8A 4GKKB 1E2UA 2XMQA 2QTMA 3NPAA 3OTIA 3SR4A 2ZRHA 4UOEA 5FBVB 1NJGA 4Z0TA 5I8ZA 2QPOA 4HZUA 2ONKA 5JUWA 2O5RA 3WQBA 2X4GA 5DI3B 1V26A 4IDEA 1UMDB 1SHZA 4NY1A 1UPCA 2FW6A 1BCRA 1RU3A 4JY7A 2CNWA 4ZTBA 3D2BA 3ZWKA 2UXDB 3FCCA 1COWD 1PJCA 1TM7E 5JASA 4CKEB 4B3RB 1AKEA 2HV8A 4F1WA 2GNAA 3LM8A 3COWA 3CUYA 3DDWA 4XDGA 1GZSA 3HB1A 2W98A 4LZAA 4MI1A 3GQBA 4P6VF 4TMZA 1T8RA 4P4UA 1V7CA 1BEEA 3VTKA 1ECLA 2DUNA 3LCJA 5DLQC 1XZFA 1IOZA 4OGKA 5A3RA 1JN0A 4MUBA 1VB3A 2I6UA 4MWZA 4WBSA 4E13A 2UVPA 3VZDA 3H9UA 4RESA 2RI6A 1EX1A 4J07A 4PPQA 1IIBA 2XE4A 2BLNA 4HOYA 4BV9A 4NULA 1A98A 1WTCA 5SICE 1R0WA 1RRCA 5K4AA 1Q0SA 4MYUA 2RHWA 4QE3A 1IULA 4GKVA 4NS1A 1MUUA 1YF3A 1PNTA 4LYAA 3ZVMA 3WQSB 4M87A 5AUQA 1JH9A 3ZKAA 5LZ4A 3SP1A 2A9OA 1DEOA 2BPOA 1ZNWA 3ZHXA 5BURA 2BR3A 2DF8A 1KF0A 1PDOA 1JWAB 1GZUA 3BGVA 4JBLA 1T5HX 2P9CA 2RH4A 4WECA 3SVLA 1A8HA 2WV9A 1PL8A 4DKXA 3PFCA 1B4DA 5E9AA 3S2YA 4M8KA 2VN8A 5I4CA 5J2UA 5CJJA 3F2IA 1T8TA 3G13A 1J33A 3NT4A 5FNVB 1XOIA 3V7WA 4TL9A 1HDRA 3LA6A 3OQIA 2PSFA 3WGZA 3X1MA 2JFZA 1NRIA 2ZRNA 4U5QA 4ZO9A 2HFKA 4RGQA 4BL5A 3IR6A 4M49A 4RWZA 3HM9A 3HTXA 2UXCB 4B6GA 3OAAA 1MO2A 2CJWB 4V0MA 2SNIE 2WR8A 1NJ8A 1E92A 2XVAA 4ZOLA 5HSGA 4MI6A 5REQB 1IYZA 3WMGA 5JZSA 2VFAA 3OQOA 1M6NA 2OD9A 1ND6A 5F52A 1DRWA 1RWWA 3D7RA 2RGUA 4NE2A 4GC9A 4PZCA 4Q9JA 5BRJA 2X41A 1X1BA 1SWVA 3ENZA 4RABA 3RAPR 3UOAB 5EXDA 4AG6A 1QV7A 2P9TA 1FE8A 3QE4A 4KQIA 1L5LA 5JS8A 3MXTA 2QE6A 3PEFA 4DJFC 1X7XA 2NSHA 4BNHA 3FPHA 4TS1A 2DUUA 2ROQA 5LQUA 1JAIA 2B5WA 1VGRA 3KAJA 4PLFA 3OU2A 5B7GA 4DARA 4ENUA 1V35A 2EGHA 2YUIA 4DM3A 1K2WA 4OLFA 4PC3A 1QQ5A 2VUSA 5I5EA 5EMMA 2CGEA 2R47A 3DCNA 3OF2A 1XQ1A 2BBOA 2C4MA 2AW3A 5HKKD 1CETA 4QNRA 3WGMA 3DLBA 4L8WB 1QPBA 3S2EA 1SUIA 2CHUA 2P9ZA 3D6TB 4I55F 5A4DA 1NKTA 2GEDA 3HPQA 4FNGA 2IITA 1HT0A 2J4CA 1QQTA 3FZEA 4Q3OA 1M1NA 2D6FA 2FK7A 1Q3TA 1XIVA 4AJIA 4EHJA 2C7VA 2V9CA 1Z0JA 3C98A 1T8WA 1JKJA 3BD8A 3GA5A 4K9QA 5KTNA 4NOLA 1QVVA 4UE2A 3FI0A 1G1MA 5C1DA 2F8SA 1PD1A 3H0CA 4F3RA