1K27A

Crystal structure of 5'-deoxy-5'-methylthioadenosine phosphorylase in complex with a transition state analogue
Total Genus 92
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
92
sequence length
273
structure length
270
Chain Sequence
b'AVKIGIIGGTGLDDPEILEGRTEKYVDTPFGKPSDALILGKIKNVDCVLLARHGRQHTIMPSKVNYQANIWALKEEGCTHVIVTTACGSLREEIQPGDIVIIDQFIDRTTMRPQSFYDGSHSCARGVCHIPMAEPFCPKTREVLIETAKKLGLRCHSKGTMVTIEGPRFSSRAESFMFRTWGADVINMTTVPEVVLAKEAGICYASIAMATDYDCWEEAVSVDRVLKTLKENANKAKSLLLTTIPQIGSTEWSETLHNLKNMAQFSVLLP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 5'-Deoxy-5'-Methylthioadenosine Phosphorylase
publication title Picomolar transition state analogue inhibitors of human 5'-methylthioadenosine phosphorylase and X-ray structure with MT-immucillin-A
pubmed rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 92
structure length 270
sequence length 273
ec nomenclature ec 2.4.2.28: S-methyl-5'-thioadenosine phosphorylase.
pdb deposition date 2001-09-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01048 PNP_UDP_1 Phosphorylase superfamily
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1580 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1k27A00
3NM6B 3BGSA 4EB8A 3OZEA 2I4TA 1V4NA 4JWTA 1OU4A 3K8OE 4QEZA 4OGKA 1A9TA 4G8JA 5K1ZA 1Y1TA 4BMZA 1PBNA 3OZBA 3OF3A 5B7GA 1ZL2A 4TS3A 3FNQA 4YMLA 4F3KA 4QARA 1PKEA 1LV8A 4GKAA 5ETJA 1T8WA 3E9ZA 1QE5A 1PW7A 1WTAA 2I8AA 3DP9A 5DK6A 1RXYA 2ISCA 4DA7A 4U2KA 5F73A 4WKOA 3PHCA 3QPBA 4OJTA 4PNPA 2B94A 1A9OA 1RR6A 1T0UA 1U1DA 1TCVA 4OGLA 5CXSA 1OTYA 4D9HA 3FB1A 4KN5A 1VHJA 1PR0A 1YRYE 3INYA 4D98A 3D1VA 5KB3A 4G89A 4L5AA 4BMYA 5CCDA 1PR4A 1M73E 5CXQA 1G2OA 4TTIA 1Z37A 5CYGA 4TXLA 4K6OA 5EFOA 2QTGA 4D8YA 1T8SA 1SD1A 4ECEA 1OUMA 3LBAA 3UAWA 5B7QA 4OF4A 2QSUA 1VFNA 5IFKA 1Y6RA 4DAEA 4QAQA 4D8XA 1YR3A 3DJFA 4BN0A 1LVUA 1Y6QA 1V2HE 1JDSA 4F1WA 3MMSA 5EUBA 1YBFA 4F2WA 1K9SA 1Z5OA 4M7WA 2HRDA 3OOEA 4WKPA 1RT9A 5F78A 4JOSA 1T8RA 1ULBA 1Z5PA 2H8GA 2HWUA 4I2VA 4NS1A 4DABA 1U1GA 3OCCA 1PK7A 5F7XA 1JDVA 4LDNA 5B7NA 1Q1GA 1FXUA 4DARA 1A9PA 3P0FA 1RYZA 2XRFA 4GLFA 1NW4A 2A0YA 4R2XA 3EUEA 1ULAA 1VHWA 5F7ZA 4E1VA 3NM4A 1V3QE 3NBQA 1B8NA 3FUCA 5CCEA 2A0WA 5IU6A 4F2PA 4L6IA 3BSFA 3ONVA 3PNSA 3F8WA 4WKBA 3T94A 1TD1A 1Z36A 3GB9A 5F7JA 3NM5A 3OZDA 1K27A 4TXJA 2OECA 1RXSA 1RCTE 4L5YA 3OZCA 3UAYA 1V48A 1YQQA 4WKNA 4GLJA 2HSWA 3FWPA 1ZOSA 2OC9A 2P4SA 4YO8A 2AI1A 3OOHA 4YJKA 2Q7OE 4TTJA 3E9RA 1N3IA 3GGSA 1JP7A 4NY1A 1U1FA 2HN9A 1U1CA 4GMHA 3K8QA 3EUFA 1ODJA 3O6VA 1ODKA 1RFGE 3KUKA 1Z35A 4DA0A 4PR3A 4DA8A 4X24A 5JPCA 1A9SA 2QPLA 4R31A 1V45E 2QDKA 2PGAA 4RJ2A 4QATA 1Y1RA 4JP5A 4DA6A 1JYSA 3EMVA 3O4VA 1YQUA 1RSZA 4D8VA 4TXMA 2QTTA 3DDOA 4R2WA 4G41A 2AI3A 1Z5NA 1PR1A 1PR2A 1PF7E 3PNPA 3MB8A 3UAVA 1A9RA 1OVGA 4WKCA 1ODLA 4DANA 1T8YA 1PWYE 4DAOA 4MCIA 4P54A 1C3XA 3U40A 1PR6A 4LZWA 3IEXA 1A69A 2OC4A 3SCZA 1JE0A 1Y1SA 1Z34A 4L5CA 1Z39A 5F7OA 4TXNA 4QFBA 1TGVA 1OTXA 3KVVA 1B8OA 4EARA 5F76A 5F77A 1JDZA 4H1TA 4UC0A 3PHBE 1U1EA 1JDUA 3KHSA 5I3CA 4OEHA 1SJ9A 3UAZA 3KVRA 2AC7A 3OPVA 4BMXA 4MARA 1JPVA 3ODGA 4TYMA 4M1EA 2IQ5A 4TXHA 1Z38A 4M3NA 4NSNA 1I80A 2GUWA 1SQ6A 4LNAA 1RXUA 5FAKA 5EPUA 1SD2A 1ECPA 3TL6A 4LKRA 1V41E 4YNBA 4F3CA 2AI2A 1OV6A 1TCUA 3DF9A 5C80A 3FAZA 1TGYA 2ON6A 4OY3A 1CG6A 3P0EA 4LNHA 1XE3A 1Y1QA 1NC3A 1ODIA 4IP0A 2BSXA 1VMKA 2A8YA 1JE1A 2A0XA 3DPSA 1RXCA 1Z33A 3UAXA 4MCHA 3E0QA 4FFSA 4TS9A 3IOMA 1NC1A 1PR5A 3C74A 3KVYA 3BL6A 1A9QA 2RJ3A 3KU4A 1CB0A 1K3FA 1JDTA 1LX7A 3LA8A 3ENZA 3BJEA 3LGSA 2OXFA 3EEIA 5CYFA 3UT6A 4TTAA 1PK9A 4L0MA 3FOWA 4QASA 5B7PA
chains in the Genus database with same CATH superfamily
4P3NA 1L4GA 3B13B 1V4NA 2QVZX 1EINA 3A10A 4QYIB 4C07A 4IZHA 2QAJA 3LZDA 2DBRA 1E6CA 2MYNA 2R8BA 3ZZ1A 1GKYA 3DOIA 3RUAA 1WWKA 3AY6A 4LGVA 4MVJA 2ZCJA 4JP8A 1EG2A 2J3IA 4U6SA 5D84A 2ORWA 3RUPA 1FQJA 2IVFA 3A6HA 1FZQA 3AI3A 3F98A 3KQMA 4FMDB 1U2QA 1M5UA 1UZMA 2YJ3A 2VL7A 1NE7A 4B6PA 5AOVA 3HXTA 2CXPA 2VRCA 3UATA 2OGWA 4TQGA 4D8WA 2WTXA 2UUPA 5AHOA 4MRAA 4PBSA 4M0CA 2XF2A 1DQNA 2YWXA 1SG9A 1YS9A 2PSFA 3DMNA 3M2PA 4FJ2A 4GRAA 1B6RA 4HFJA 1EWKA 1ST2A 4JDPA 1WHSA 4JLWA 4PX5A 4LDZA 1UPCA 3OKAA 2EWWA 3AIOA 4R9NA 1S1CA 3IOYA 3EPKA 1IJBA 4XPIB 4QU5A 5DX1A 3B20A 3QE0A 4NLLA 2GBLA 4TKMA 3RR2A 3R1IA 1XTRA 1I14A 5KHAA 1VMIA 2AOXA 4ZT2A 4DQVA 5L3QB 3DMYA 4IG9A 2YZNA 2HJVA 3CLHA 1M6HA 1OAOC 4BUZA 1N2XA 4QGFA 5EEHA 4ZU6X 3OQPA 1XVLA 2RG1A 3NTUA 4MUIA 2EDAA 3HA3A 3ETLA 4NZNA 4JASB 3DQQA 4YJDA 1TLLA 4F2DA 1HT1E 1UJBA 3OZSA 3JD2A 4DNFA 3E3LA 5IAGA 1CB7A 1YQWA 2VK4A 5ALMA 3WDMA 1SCKA 2W8BB 1Y3CE 4FXOA 3O1JC 2AOUB 3MTQA 1QANA 2D2IA 3PJGA 4KIGA 4Y7DA 2PZBA 4K88A 1QB7A 3TIFA 1U7TA 3WK4A 3CVOA 3CO0S 1BH2A 3DBIA 4QLBA 4BLQA 1TUBA 2Y1CA 4QEKA 1H4TA 4JBGA 3VZDA 4CDGA 1GGMA 4A3SA 1K2VN 1NOJA 3QMVA 4TVKA 1E3SA 3G59A 2X6QA 3AOEC 4P31A 2B7BA 4UM9D 3WKBA 2FOIA 2ZUEA 3ITDA 4FC6A 3QLUC 4BIIA 2P5YA 3WMRA 5LP6A 3KSMA 5G2OA 2C4WA 3X1MA 2IBSA 3P19A 4H18A 1SKAA 3FW1A 2XLCA 4N03A 1HFWA 4DS3A 2L19A 2X41A 1H2EA 3NIBA 3ZWBA 1WEHA 2EARA 1W9MA 1UXGA 1AKYA 1N3BA 1N7HA 2G04A 1NQAO 4R7GA 3ZE9A 1U8AA 1R00A 3KTOA 3CGGA 5JSUA 3A9WA 2FK7A 3ND8A 4DSAA 3DTTA 2P62A 5HZMA 4F92B 4I7EA 4XVQA 3T7KA 3N7UA 1X1SA 1B2LA 1C8VB 4BJHB 5JY6A 4B47A 2D4HA 2ZJ0A 4H6WA 4RPKA 4EENA 5DN9A 1OGJA 3BDIA 1YSCA 1P9OA 3PC4A 4W1PA 5F9HA 3WWDA 1ECLA 2Z57A 1IJEA 5JD4A 1F8UA 4IO0A 1LS6A 4MA4A 3ZXIA 3UWDA 4AP5A 3DMTA 2GK4A 4HGNA 1PG0A 1KH3A 4L57A 3I9JA 4FR2A 3LRTA 5LFAA 3A4YA 1W1WA 4G1VA 1BU5A 2CLKB 2HPZA 4RK6A 1E79D 1RP7A 1Q7RA 2QVBA 4NBSA 3PPIA 2HV9A 3GEEA 4ETWA 1YZ3A 2D0PB 4ARBA 5JYDA 5IG2A 1YB7A 1I24A 5B7QA 2CHGA 1M1YA 1BRMA 1PJ8A 4D9JA 2PPLA 1BKSB 2HA6A 3TDMA 1VLQA 3W3ZB 4C4XA 1UOOA 3PHHA 2GXAA 4TMKA 2FFRA 2OQ2A 2H1WA 3H9BA 1GRQA 4KWEA 3TUJC 4YREA 4PIVA 1SPBS 3VR3D 2X0KA 1PYDA 4KWHA 3GMTA 2XZOA 2XXAA 2WABA 3OIWA 4RH0A 1EEHA 2II6A 4XYBA 5TDHA 3UAGA 1XZKA 3F8SA 4UBJA 4XD2A 3UJ8A 4C7VA 5BYKA 4RBNA 1KEKA 4AN4A 3D0OA 3WL4A 2NYVA 5G0VA 3RVSA 3K0BA 3PFCA 3KQHA 3QBJA 5F2KA 3AF4A 3V1NA 4Z4QA 2PUAA 3ANTA 2DFDA 4MQUA 1QV9A 2OXCA 2AZTA 4Z9XA 1O97C 4I50F 5FDFA 5CD9A 3GD7A 1E3JA 3D43A 3GRKA 4M7WA 3TWOA 2QM7A 2HT6A 4AURA 1LJUA 5M5BA 4R98A 3HJFA 4N3NA 3EH1A 1EQAA 1C3OB 3IJRA 3B2NA 5HX7A 3QOXA 1K1EA 3AF2A 1PTJA 4EF6A 4FE4A 3I04A 3O90A 2XIQA 1BMFD 3FCSB 5EIEA 1EHIA 3IMCA 3O21A 3IP8A 3LL7A 3R6WA 4OH7A 2ZAYA 4QU8A 1L5KA 4MZXA 4D0LB 4DEVA 4RTPA 2XCLA 1P4HA 5CNKA 5F4BA 3VYTB 4I55A 1T13A 3V2UA 4BFXA 2AVDA 2BRUC 4IZOA 5AO9A 4IMPA 2NZVG 4D56A 1RU3A 2P40A 1OLSB 4ZOEA 5MHTA 3K8ZA 5AVOA 3QJ5A 3ZDQA 5HWSA 2I9KA 4H77A 5D6OA 1AQNA 5CFQA 4Q9KA 1Z5UA 2E6UX 2BCEA 2RHTA 1GP2A 3K92A 2NU6B 3QYAA 4JZYA 5FWAA 3RHTA 2XCTB 3HXOA 3R20A 3KDAA 4ZICA 5DEIA 5TSDA 1TJYA 3A6FA 2H07A 2H06A 3L8FA 4DB2A 2NV6A 1DAKA 3V1MA 3V1YA 5C7LO 3B7WA 3R6DA 5I7UA 3WWPA 3T5BA 1QQTA 5JSKA 3WZLA 3OKPA 2C8JA 2H5EA 2RSLA 4HTAA 4QA9A 4LDRA 1DJOA 1LSSA 2BPOA 1A82A 1PSWA 3DMTC 1YQGA 3WHPA 4B6SA 1JR3D 2PM8A 3EA0A 1Q11A 4I08A 3MHTA 2VIIA 2X5NA 3QVGB 5KX5B 3HP1A 2Q4EA 4JBNA 3DWEX 3G5MA 5HKKD 3IPRA 1B26A 4ZVUA 5DTMA 2Y2UA 3JWPA 2WHPA 1U2EA 1W2HA 1UM9B 3ZDFA 4B6JA 1I7QB 1YDGA 1LQUA 3DH0A 4OU5A 4S1VA 5KJ1A 1R8XA 1V8OA 1L7EA 4RACA 5LBUA 3JWJA 1DHTA 3WFZA 5IYZA 4KTTE 3HC7A 3T94A 1ZH2A 4LK3A 1Y48E 4Q3NA 3ZXXA 4L74A 3RC9A 2B4QA 2ZIZA 4J76A 4KPEC 3R7NA 1G59A 4ETIA 3VKFA 2W2LD 2ODWA 5KI6A 1K27A 2DULA 4TL7A 1JI0A 2VDOB 5AKXA 3EHDA 1IONA 3NHMA 3T12A 1VZ2A 1GPWB 1VLLA 1HL7A 1GUBA 1OJ7A 1SUCA 3M4NA 4EPXA 4E13A 4Z2YA 3QY9A 1DEXA 1E2JA 1RPNA 2VNKA 3CY6A 4UBMA 4JGGA 4Z3DA 4FP9A 3CUWA 1HDYA 4TS4A 2W6NA 1TRKA 1U3GA 2YY5A 3DZBA 4UTVA 2XGJA 1LPPA 1H1LA 1D6JA 4EHFA 2C95A 2PUJA 3C15C 1PTJC 1GILA 1DC3A 4Q9AA 4PFJA 4WRRA 3RTBA 4HXFB 4HXEB 4RANA 1V5WA 2CXQA 1W29A 1VECA 1YC2A 2GK3A 2P0EA 1M0TA 1LK0A 1X92A 1G8YA 3NPMA 2V1XA 2IL1A 2FSVC 3CU5A 3O3CA 4NPAA 4CCAA 2A0KA 4RENA 1J0AA 2Y1EA 4Y0AA 5EPOA 5ALDA 1A4UA 2AI1A 1I6LA 2ZP1A 1O4VA 4MZDA 1H2YA 3CT4A 3RTGA 1NBMD 3K16A 4C5AA 4NULA 3HUEA 3REQB 2V4UA 3JQ8B 3RU3A 3E9RA 2ZYWX 2ZM6B 1X13A 4V0NA 2A5LA 3VUFA 1GZ3A 3ONEA 4CLXA 1CEYA 5BXYA 2ZIXA 3ADOA 4YRLA 2RARA 5E9JA 2VYND 4YYEA 3EXFB 2XQKA 2ZJBA 4JEIA 4JX8A 2BUBA 1KQGA 4EY3A 2QRGA 3ZD9A 3IMGA 3P9SA 4DBLC 4EZBA 4ZGWA 4BX3A 1PJTA 3MPOA 4LSWA 3OZRA 4JN6B 2QWXA 1N5RA 2R6AA 3JQQA 2HA7A 2AG1A 3JQAB 3I2YX 5EQFA 1JBQA 1ODKA 5TJ9A 2C5LA 4LXGA 1A2KC 1JQ5A 2DFVA 4UHJA 1KK3A 2QN1A 1ZLXA 4HDSA 3RU7A 3EDRA 1QHYA 4U2FA 4R8MA 3H5OA 4I8XA 5HG0A 2OORC 4LDJA 2BONA 4GR4A 3UV6A 3OP1A 4NV0A 4RF3A 3UF0A 3RAEC 1JFTA 1YJAA 2WTEA 2QQEA 4BC0A 5HYVA 4F06A 4PR3A 1NI5A 3FDFA 5J5AA 2ZJAA 5IVIA 2VYFA 5CK5A 1Q0TA 4YRCA 1TTTA 1MA3A 4P2GA 1EBUA 1QYVA 3GUCA 1HDCA 4YJ3B 4A73A 2GEDA 2Z9BA 5E8JA 4IF6A 3AVTA 1ABFA 2QMUA 1I5EA 1KVSA 3GJ8A 1T6BY 3I04M 3GLUA 3P2IA 5EQJB 3AUKA 3L46A 2XLBA 5FTMA 1MAWA 1IIRA 1W94A 2AS0A 2WV7A 4TSKA 2ZRDA 5EQTA 3RUIA 4AZWA 2AHOA 1NR1A 1XFDA 4YDHB 4RLFA 1KDOA 1UDBA 1JIIA 2CUTA 5ALOA 4ENWA 3JQ7B 1RWVA 2FSSA 3UQYS 3HS3A 4MDFA 4WAUA 1VI5A 1RADA 4INJA 3U3MA 1QOPB 1LBIA 2QQ5A 2AR9A 3PV0A 1Z5NA 2FW7A 5F2OA 1HM5A 1JSLA 2JIPA 1FRZA 5FUVA 3UYLA 2NYAA 4EY7A 1NRIA 1LDNA 5FOTA 3AVVA 1NX9A 4B3XA 4C4YA 1MJFA 1T9GR 1A9RA 5BSHA 1K5DA 2YVAA 1OVGA 4FYPA 4WKCA 1TMKA 1T3SA 2ZDGA 3N0RA 2X14A 1U8YA 2PLAA 1I3OA 2GBFA 2PO7A 1MQSA 1II8A 2OV1A 3IBCA 4Y8VA 4A82A 3K0CC 1UXHA 3AY0A 5KVSA 3E9DA 4O1MA 4LZZA 2DUWA 2EBHX 2WT9A 3ASZA 3JD4A 3PXCX 5EYPA 3GC6A 3B5JA 3OCWA 5FV7A 1T5DX 4HYEA 1GG2A 1YJBA 3OQIA 4JYBA 1RC0A 1Z34A 3L02A 1KJJA 1M1XB 2GBPA 2WYHA 4P92A 1D0VA 4CU5A 2O8FB 3V1KA 1FNMA 2QTNA 1XEXB 3QNWA 1KAMA 5CHYA 1T2UA 1YMUA 1WE2A 2I1LA 1KVRA 4BCDA 4LY6A 3ZJYA 4M22A 4UHFA 16PKA 2O8VA 2YWHA 4F12A 4QT4A 3QBDA 4OQQA 4L28A 3IV6A 5BN3A 1J25A 3LAWA 2C5BA 1FP7A 4U00A 1T2DA 1AF4A 1WNFA 1NQXA 3JD1A 4EELA 2B7LA 2GWRA 2ZRAA 4E32A 1Q6ZA 2N47A 1UKVY 1GTRA 1FUYB 1GYPA 2XEDA 1B0ZA 2R1UA 2X1VA 3RWBA 4CEJA 3B36A 1M6VA 3P9IA 2HWKA 1YHNA 5HKBA 2FPIB 1TT5A 4FWIB 1KZYC 3KHSA 4MWCA 3PNBA 5EY5B 3TNLA 5HA5A 3UN1A 2ZBPA 4Q66C 2NVOA 1RAAA 4B4OA 4COOA 4LWZA 1JL3A 4HFRA 2PJDA 1SBNE 5CAEA 1DBWA 3ZHVA 3C7TA 4YN3A 4DIOA 4RTOA 5FTWA 5K3OA 4LXQA 3MERA 3Q7SA 3FROA 1EAMA 2Y67A 4TWZA 3ROXA 4F04A 2PSSA 4AMBA 4YXFA 1LI7A 2CCJA 4RPJA 2GZAA 3QPVA 4HX2A 1O95C 1T0HB 4Y1EA 5JAIA 4WESA 1I30A 3W5UA 2WSLA 4BMNA 1PJZA 3ONNA 5JMWA 4URVR 2A94A 4GLLA 1DZIA 4CL8A 4JZKA 4PAMA 3F4BA 2GX6A 3HH8A 4EY8A 3LUGA 3O2JA 2QNRA 2YBEA 2D4AA 1E1CA 1H2HA 1LPOA 2INGX 3K0AA 2PXXA 3OMXA 3NETA 4UQOA 4YR7A 4O4JF 3U6KA 1IVNA 1XK7A 2ARKA 5JC1A 1L7RA 2IPNA 4OGWA 4K6FA 3H3FA 3DCJA 4LGYA 4Q1BA 3L7MA 3TZBA 4BCBA 2CHVA 2FPXA 4JBYA 5K0SA 4REQB 2O8BA 4EJFA 1D09A 4FMCF 1XTUA 2ZUVA 3ZHTA 1ZWKA 1TGYA 5BSFA 3HCFA 3TXAA 3WGVA 1YRWA 5KQPA 1TZJA 3H87A 4M1ZA 2OCGA 4PRLA 1V1RA 2R8OA 3GRAA 3RODA 1PNOA 1S5PA 3HEAA 1K08A 2BSXA 2ZSIA 1UBUS 2XYHA 3DMRA 2A5GA 2Z1MA 3KTDA 2EU8A 1FB5A 1E6EA 1Z29A 5B1SA 1JE1A 1YONA 4IDGA 1U4OA 2C61A 2JFXA 5KSWB 3CE6A 1GGJA 4KQJA 3UGJA 2HJGA 1ISHA 1E4VA 1MOZA 1WULS 3AVYA 1XWFA 1K6IA 3ILHA 2DXIA 1W2GA 1Z4QA 3KLPX 3DL0A 3ISVA 2FLWA 3JALA 5DO9A 5IAKA 3RV4A 1T0JB 2E3JA 4M7RA 3CSUA 4L07A 5K4AA 5JS2A 1ZVQA 1ESMA 4R41A 3BWBA 3V7UA 2NU9B 4RA6B 4DDHA 4ERNA 1DQZA 4YC7A 1BWPA 4IOMA 4DUGA 3D1LA 4N3AA 1IY1A 3NX4A 4NH4A 2QL6A 4NK5A 4XFKA 5FAXA 4JQYA 4OJMX 5T4FA 5TMPA 3O74A 1N8TA 1FFSA 5TQVA 2CBZA 4Z9YA 3MWJA 2HGSA 3L6CA 4H3SA 3W9UA 1Y6ZA 3PZRA 1WIWA 4KUHA 2H7CA 4BZWA 3GAZA 2FOLA 4AS3A 3IKVA 3QENA 2AUTA 4M7PA 1FCJA 4KXQA 2ZI4A 1RZRA 4O2LA 5JJLA 3I9KA 2OCXA 2PAFA 4TX1A 1R9GA 4YT2A 4PGMA 4CKZA 2XQIA 3E81A 1L5HB 1YCDA 1P3DA 2WR8A 4O25A 1EM8B 3FFTA 3OO0A 5EWLA 2WVHA 4L5BA 4D6YA 1SMKA 1KO7A 1GPJA 2KQUA 2WUDA 1KJWA 5KWIA 2I4TA 2V7WA 3PIIA 2Z30A 1ZJ5A 3PCXA 4BRUA 4ER0A 1A04A 4MR7A 1S2IA 1Z8HA 3LQQA 5HTKA 3S40A 4QKQA 1JLLB 5I9MA 3U3ZA 3NOOA 3PR3A 4NK4A 2I2CA 1J42A 2BMVA 3EVBA 1ZUD1 5EWMA 2ONZA 2QPAA 4R2JA 5CU7A 4F84A 3ZD6A 4A8TA 3DAHA 4GEKA 2FTKE 5TB5A 1B76A 4KYIB 4RVGA 2F7SA 1IWPB 2AYZA 2ADMA 5IBRA 1ZH6A 2FG5A 3EZ7A 5F5LA 3CLRC 4ACAA 1PLLA 1PGOA 1X8XA 2JVJA 3QWAA 2V6GA 3NBUA 4EMTA 4DYHA 5BWOA 3L4BA 1KDYA 3H99A 1QWOA 3SHVA 5AM2A 3VR5D 2OV4A 3NXSA 1Z45A 4MEBA 1HQCA 2VNIA 5CURA 2VSXA 3KIPA 5CA0B 1YQDA 1CULC 1P7YA 4DV1B 1EGQA 1VGQA 1Y7IA 3FB4A 3Q87B 4XWGA 3DZIA 3BBLA 2BT4A 5MN5A 3VZQA 1SIUA 3FCXA 2CFSA 4GKAA 3P27A 5ETJA 3GA0A 1XDDA 1GNSA 4YCAA 4DA9A 4UTPA 2NO4A 1ZOIA 4INPA 2GNOA 1EB9A 1C8KA 4DR7B 2I8AA 4DJDC 5KWJA 5JR3A 3RBZA 4IGKA 2GF0A 2LCQA 2DR2A 1TMOA 1YCHA 4Z1MD 2MYTA 4GVLA 3GRRA 4Y2VA 3T7JA 1ZY2A 2H8KA 3ZWMA 3DKVA 3MNFA 3MT7A 3JQRA 1CZRA 1MVNA 1O87A 5A6SA 1MDFA 1OI2A 3BHJA 4FHDA 2P9CA 1QHEA 3RI3A 2OB2A 1QGED 5L3ZA 3FDIA 2HXSA 1JTEA 1TEXA 3TQIA 2WWGA 2FH5B 1L7XA 2TMYA 4C01A 1AK1A 4UTRA 4FB4A 4IIUA 3KLNA 4AICA 4UZFA 2IWHA 3GL9A 4RTQA 2IS6A 5IXJA 2CNWA 2ZYTX 3F49S 3F74A 3AKYA 4MWOA 2GO1A 3LSTA 1V1JA 4KQ9A 1QTRA 3UWMA 5EUCA 4I3GA 1VPTA 2D2XA 4AZ3A 5EJFA 5DHPA 1NBOA 4E11A 1PV2A 2DLCX 1E2DA 2HKIA 2PZKA 4JA0A 3TBKA 1L4EA 1DRWA 1JMYA 4RD1A 5JOQA 2ZJ5A 5HQ3A 5LZ9A 3LGXA 4C0KA 5CXQA 4XB1A 2VJKA 3MCTA 5B6JA 4H2DA 4QXOA 5L95A 3T9CA 3KKPA 1BGWA 5C4MA 1CRPA 3OQ1A 3K71B 1QYCA 5FOUA 1Z6TA 1K8RA 4WXYB 2M32A 4RQTA 2VVTA 3ZWPA 3EC7A 3T7RA 2OXEA 2UZ4A 2AZMA 4QBHA 2JS7A 4DMLA 2BMAA 4KBYA 2H11A 3EMDA 1IHDA 2V4ZA 1UPXA 4CFYA 1KYVA 1RZ3A 2G06A 4PWYA 5REQA 3V8PA 2FWMX 3VSAA 3W5BA 2QQ0A 1CUCA 2I4MA 2VNAA 4LY0A 5DHTA 2R4QA 1QH0A 4KAJA 2GYVA 3EXG2 1PL8A 4Q4DA 3KQNA 1ZOLA 1BHSA 2OD2A 4O4HA 5DBOA 2A1UA 4ISBA 4IDEA 4EGQA 1CZLA 1E5XA 2ZU6A 2ZW9A 3GPDG 4KIFA 5BNIA 3D4NA 3H6HA 2OENG 1H85A 1KO8A 3N7TA 2GHQA 4KAXA 4FDTA 3CUKA 4J8PA 4NH0A 1U94A 2G08A 1GKLA 4KN8A 1K68A 1BYUA 4P36A 1TKCA 1MNQA 1BW9B 2J3LA 4D6PA 1I7SB 2AXQA 4KNVA 2R97A 3V7NA 4UPEA 4Y1RB 3FI9A 5JCPA 4L3WA 1NUAA 3SY8A 1KOGA 3K4HA 1K9SA 2VFAA 2V97A 1Z5OA 2VR1A 3GJSA 3JQCA 4GDMA 4QUBA 2OT3B 1G63A 3I9LA 3NTLA 4XTRA 4ZO7A 4ZA2A 4DCCA 4J16A 1N2ZA 2WU4A 2YRXA 5DH9A 2Q5CA 3VPHA 2QTVB 2QTRA 3JAKB 3TIXB 3C6KA 2WJPA 2JZOA 4D9CA 4LNUB 3WMWA 1T8RA 4C03A 4NG5A 1V43A 3TCKA 1P4SA 3AX6A 3IUEA 1U0BB 3ANNA 3HYNA 4QXPA 3TAHA 5K8LA 4TV8B 1B16A 1OZFA 2DECA 5ADWA 2ZAMA 1QIJA 3ZE8A 1LPMA 5L6LB 2ATIA 3FNHA 4MHTA 5HK9A 1B43A 4NYIQ 3PL1A 4D6XA 4RD4A 4YMIA 4F4DA 4NCBA 3FPJA 4ODIA 3RU2A 4CTJA 4NNPA 4BGUA 1PK7A 4CDRA 1Y81A 2WPDA 3M3PA 4TTRA 2AMYA 3I73A 4YAUA 4G0UA 1FXUA 2PTHA 2IPAB 4EPRA 3WADA 3HR8A 3AONB 1FJGB 4ZANA 1F2TB 2H52A 4KRFA 2JGFA 5KAMA 3TLEA 3AEKA 2CCGA 1U0HC 4K28A 3LOPA 4O08A 4XFJA 1BFKA 1GV1A 2V0GA 1QK4A 2PANA 4YASA 3QUAA 4GWGA 3JWHA 1RXIA 3GD5A 1I51A 4DPKA 3R5KA 4QX6A 5BSRA 4DY6A 4MR8A 4MKGA 1OI3A 3ZY2A 4BFTA 4F3NA 4F45A 4AB1A 4N6GA 1ICIA 1XL0A 4KFUA 4BQPA 1UBKS 2G83A 2BFBA 4ZYTA 4MP6A 5AW1A 3EGWA 2OGTA 2I80A 4AF8A 4CF3A 4KREA 3H9EO 3DP7A 3AUJB 4E4RA 4NCKA 5FWDA 4L85A 1R1DA 2Q29A 3K5WA 4UE2A 3L2OB 5DGXA 3S44A 2E4AA 2BC9A 4MUBA 5H3CA 1QP8A 4WD3A 5A5EA 1NIPA 4DPMA 2EDCA 5SV2A 3ZHCA 3FTCA 5CR9A 4W5RA 4OQZA 4P3XA 4UQPA 5SZHB 3T7EA 2J5BA 3WYFA 4I1RA 1KY5A 2WIKA 1FL9A 2Z5VA 4HJRA 5KOIA 1M6EX 1H0KA 2GPTA 4NATA 3SEQA 3DB1A 4R0VA 5KTNA 4TLAA 1C8LA 1P0CA 4C0HA 4CL0A 1GNRA 4QODA 2CWDA 5GONF 2GM4A 1BCSA 3GB9A 2V1UA 4D9EA 3FUXA 3CRZA 4R5HA 4NC9A 4A16A 1SUWA 1SY7A 4CMEC 1A71A 5IT4A 2FY8A 3GFFA 1KPHA 5A0FA 2BR4A 3ZKWA 4WBNF 1U99A 4R71A 1DFIA 4J0DA 2OECA 1HT3A 4CR6A 2PR2A 1RCTE 1C9KA 4D3DA 2IE0A 2GN2A 1U28A 3MILA 3BICA 5IBPA 3GLFE 2WC1A 2XGSA 5JSZB 1YUMA 3RVRA 1RLMA 2ZBVA 3TTYA 2WE8A 2XEXA 2YV5A 4IG4A 2CYAA 4KUEA 3COYA 4FGUA 3OPMA 3GRYA 5FBZA 3W6NA 4BO2A 2HIAA 2WJ4A 1X7ZA 1K7FB 2W42A 3I01A 1S01A 3RO7A 4LE0A 3UAOA 2VZLA 1RQXA 2I3DA 4INOA 4R9RA 3DCYA 2I6SA 1IXZA 3O3OB 4J9UE 3S5UA 2Q1TA 2Y66A 2ERYA 3NHBA 1G5FA 3S1AA 4EHKA 4LHZA 4RJTA 2P4SA 2PLWA 4MI3A 4YO8A 3DG9A 3HKEB 5BRAA 3F5MA 1UBLS 3KXIA 4IIJA 2C4HA 5IMBA 3ZTWA 1WZ2A 4Q7QA 1KO5A 1Q6YA 1VKZA 5CT6A 1PEAA 4KXMA 1TC1A 1M34A 3RDPA 4QICA 4LCEA 3M0EA 1T9GS 1OBFO 5GQSA 3GLKA 5D8DA 1DADA 5LLTA 3ZWXA 4E4TA 4OXRA 2K7FA 1VPWA 3RT1A 2XWQA 4C06A 3NHRA 1NPYA 5T6MA 1E96A 3EUFA 3HZOA 3JYPA 3N8KA 4W8OA 5CM8B 3BTSA 4AJPA 5AVZA 1QP7A 4J4BA 2EG9A 3QVWA 4ZJUA 4FYVA 4PN3A 1BFUA 2BFCA 3LRPA 3GPLA 1OBCA 3A6LA 3EG9B 3R3VA 2R66A 3RIYA 4DSZA 4CKYA 3LKZA 4HNSA 3UOAB 1NXTA 3HJRA 3BGDA 3B6MA 1VMDA 2QL9A 5EKUA 4DA0A 2HD4A 4CM5A 1Z8FA 1U3CA 3IHWA 2HOQA 3F1KA 5J2UB 2J6IA 3CLTC 1IRIA 3LJKA 4WXMA 4M38A 2QY6A 3K9QO 3EGXA 1SD5A 2AOWA 1M6NA 3G23A 4FSXA 5AFSA 2B83A 4QNRA 4RZSA 2CVFA 4CL3A 3UGKA 1FMLA 1N6RA 1W5AA 5B57C 2H2AA 3TNDA 2OHXA 5IMSA 2D0DA 2VRBA 5KB3A 1R18A 4FPXA 4KXUA 3HHEA 1MEJA 2M9MA 4X60A 3RQIA 5EJ6A 3AW9A 3W1WA 2WWFA 2ZJZA 3TW8B 2GAIA 4Z3KA 4Z53A 2FEWB 2RKWA 2FZVA 3ZD7A 1Z5WA 3ZJTA 4OK6A 2F8SA 1H5NA 2IU6A 4GE0A 5HF5A 1KI6A 1PGQA 1Q1QA 3WKDA 1L9XA 3KV3O 3ISJA 3SYKA 2PFSA 2QXUA 4BKUA 1X39A 2ZBRA 4PBTA 5I5GA 1L5SA 1ZR4A 3PHIA 5EZSA 5K3AA 4IH9A 2NLOA 4N18A 1P1FA 5TJHA 2V98A 3SHWA 3SHOA 4DVGA 4EUKA 3UANA 4IRUB 4WBXC 1T5HX 2EJVA 4FI3F 2GB4A 1WETA 1LPSA 2RHRA 3B3FA 3AQIA 3HR7A 2QN2A 1GOTA 1ZOOA 3IEXA 3Q5DA 1JG4A 4UXIA 3FYUB 4KJZA 5AW2A 3NHJA 4ANFA 1HKHA 1Y42X 5DDIP 1ICEA 3LA6A 1D2MA 1Y0BA 2QLLA 3NBAA 4RKYA 5GM1A 1JHPA 4A2QA 4DQXA 3KYCB 4GOND 4R8SA 1U7UA 5LYJA 5KSYA 1ML4A 4PGGA 5EHXA 2AEMA 2QJOA 5FKJA 3DOUA 3KETA 1RHMA 1FS4A 1FQOA 3DO8A 1JBEA 3LBNA 4YWHA 3IIEA 1TLFA 5DLQC 1C7IA 2UUCB 3THOA 2BTOA 3EIUA 1PT9A 2PYIA 3FRJA 3WLNA 1PEKE 4UREA 1NXPA 3G8CA 1QR6A 4RXUA 5P8WA 3AIIA 2R00A 2PRYA 3QVVA 1X7XA 2JFYA 3ZZ0A 2WJYA 5FOVA 2D59A 1U1EA 4A0GA 3L5KA 3VPBA 3ANLA 1M7BA 2HI0A 1KJZA 1CNEA 4W4TA 4BRWA 1BH6A 3H42B 1Q0UA 4ZO9A 3Q0EA 2H3EA 5K9ZA 3LPAA 3O4JA 2OFPA 4O33A 1YBMA 4HG2A 3TN7A 3T3OA 3BS4A 1UPFA 4FGZA 1W59A 5TF4A 2XB9A 3OTWA 3V34A 4FKMA 4YV1A 2D8MA 1T6XA 3CONA 2X1MA 4WCFC 5DYIA 5BMVF 5I9IA 3OPVA 2R6JA 3DLPX 1DU4A 4KR3A 1IEWA 1NNSA 2X4GA 2FRXA 1NXXA 2JGRA 3EXIA 4JFRA 3NEPX 1D9XA 2PWBA 3ADKA 4BRSA 3Q3GE 3QPWA 4AZTA 4U39A 1ZQ1A 2X5KO 3OFNA 4F5WA 1WXFA 2IQ5A 5FWXA 5ICSA 1T29A 2OE2A 3IDSA 5K0ZA 2JI9A 4NBUA 3DXXA 1EHCA 4U2BA 1EVQA 4RL6A 1RM3A 1R6VA 5ENDA 4BOYA 2F3QA 1G38A 1SQ6A 1K4KA 1N5JA 4PM4A 4PAOA 2V0NA 2CXSA 1IPEA 2Y1FA 4ZCPA 1M67A 1SZCA 1YKGA 2DG2A 3ZW8A 3F5SA 3IP3A 3JQFA 2WYOA 2YY6A 2WFZA 2ZJOA 3M6VA 4GI2A 2FEOA 3NANA 1RYFA 5EEGA 4OG2A 2J1LA 2P6NA 5JVDB 4KO8A 3C4QA 3OAAA 1BWQA 2OFWA 3BL5A 4A6EA 1YS2X 3U4DA 1Z6QA 3RSLA 1E1RD 4UUNA 5CLLA 1A88A 2QGNA 1RM0A 3RVLA 1X9GA 3KHKA 3ADCA 1HFJA 3EIQA 3MBIA 5JISA 2Z2XA 1XTJA 1YRAA 4UCQA 3SP1A 1X15A 1DV1A 4PTLA 5CVUA 3U48A 3AVOA 3WB1A 4L78A 1EFDN 2DR3A 4CMAA 3A31A 1NKTA 1AQUA 3C16C 1PS9A 2DQKA 3G9XA 5CDFA 1EUDB 1P1HA 1PWHA 5LVAA 5GV7A 3QFFA 1Z7EA 3IR7A 3O2QB 3EVNA 3D59A 4N8SA 1WV1A 2AD1A 3LXRA 1N2CE 2ZUWA 1L7VC 4RY0A 3BAFA 4KIJA 3EQ9A 3UAXA 2OLEA 4GPIB 3LCJA 5AHKA 3SQXA 3ME5A 4DCJA 3PNLA 1C0KA 4PNEA 5LP1A 2AF4C 3R74A 4RK4A 4YXWD 5I47A 1D2HA 3DM5A 4U7DA 2YYZA 4WZAE 1Q0QA 1SB8A 4TM8A 1NVVR 4LJ6A 1SU7A 4HNAA 5F3DA 1N7IA 4B0OA 4PZ9A 4OGFA 6Q21A 1I1NA 1FW8A 3BGWA 3LLSA 3MWDB 4EW3A 2JJYA 5KNBA 1RBMA 2I6TA 4OL9A 1JB1A 2G1AA 2IYZA 2DTXA 5ILOA 1XNGA 1QNLA 2QN9A 3M82A 3K70B 4OAOA 2E48A 3PX3A 4X61A 1ZCBA 2RIPA 2YN4A 3JVUA 4AMUA 2O1WA 3KAKA 1AHPA 3B6KA 3BJEA 4G4SO 3K9NA 4ZN6A 4HDMB 2R8ZA 3EEIA 1F17A 3VNVA 2BM8A 2FPSA 1H3NA 1ORHA 3R5HA 2J33A 5DTJA 4FGKA 4I4CA 4RHTA 4F38A 1IEVA 4C7BA 2ZBDA 2Z1NA 4TYYA 1GXSA 4I9UA 3ZJUA 1G21A 2MSKA 3OCXA 1J21A 3SJZA 3R4VA 3QPAA 3WO1A 1E4EA 1EFVB 1UJMA 4M8SA 4MXDA 1NUUA 4ZAVA 2POCA 2C8KA 3G9QA 4U7WA 2CKMA 4BCCA 3LM8A 5AVUA 3LWDA 4BFVA 1W5TA 4RDHA 1A5SB 3VJKA 5LJLA 3UOGA 1PJRA 3X1WA 2Y0CA 3IBGA 2XF8A 3L0OA 2EYUA 3MPUA 5B58C 1Z22A 1ZUIA 2W6ID 3V4VB 2BZ0A 4DXDA 2JGLA 2JHAA 1G55A 2XA2A 3LPDA 4QOIA 5AUPB 2OAP1 3G3EA 3VO2A 4YBZA 1JR3A 3CTPA 4B32A 4KIWA 1KZ7B 4MUYA 4D3XA 4L50A 2A2ZA 4OU4A 4H27A 1YKFA 2J9GA 1NSYA 3OLZA 1LJLA 3N9IA 1NVXQ 1K66A 5A3QA 5K01A 4YHHB 2Q07A 3GXOA 3SPXA 4JBXA 3HCEA 1R66A 3UTCA 1CJUC 1DBVO 1T8WA 2C59A 3C24A 4XGNA 3UIEA 4AYTA 3GRFA 4ZMSA 3G1TA 4HQ0A 1UMCB 1V5GA 3GP3A 5M29A 4BKOA 1T5OA 3GI1A 5DK6A 5HMMA 4YK7A 2BGWA 2AW3A 4WQMA 5CVVA 4I1PA 3ZWDA 3G2LA 2JFOA 2C77A 3TAUA 3FNEA 3HWSA 5K2MA 1X0XA 2I6XA 1NZJA 3OZ7A 2HJRA 2CNLA 3DHEA 1KF0A 2HB6A 1PQYA 4BLSA 1ZW1A 3ZW9A 2JIBA 2Q1SA 3B8HA 3QBVA 2I3ZA 4JJIA 4YFYA 2M1ZA 2B94A 4BFZA 3F5DA 1RRGA 1PZMA 4C08A 3HADA 1WMEA 1GT6A 5TARA 1XQXA 2FV8A 3IO3A 1FFDA 4R8LA 1ZGAA 5DNAA 2MDTA 5DYNA 2VDUE 3H8SA 2DWOA 3KKZA 4PZEA 4TKVA 2IX3A 1NYLA 2WF5A 4KX3A 3T5MA 4LF6B 2P27A 2QRMA 2DM6A 3G2QA 5GM2A 3K6SA 3OP4A 2JLAA 1HBJA 2AQKA 3VU9A 3PPYA 1TJNA 2HZBA 1F1BA 1CJTC 2NNWB 3K0FA 4HDRA 4I5IA 4QWMA 4A1FA 4ER7A 3PCTA 3SFVA 4TLCA 1NBMA 4B17A 2QX6A 1DMSA 1QV7A 1YULA 2F1IA 4DRZA 3JYQA 4MRSA 3AJEA 2SECE 4RZUA 5K05A 1JEQA 1O3YA 2VYNA 1CUEA 3WIDA 4ALKA 4WNYA 3D2LA 1Q12A 4J1TC 5JZMA 3K2QA 4GH5A 4LQCA 5CLGA 1DCMA 2DTDA 3PDCA 3UK1A 1KFCB 1DPFA 2BHSA 3B1KA 3L0SA 5HZHA 4OI0A 4BN4A 4QWWA 4J4HA 5HS4A 1WD7A 1T15A 1TE2A 2EFEB 4PYOA 3HVKA 4GBGA 1R0RE 4WFQA 4YQYA 2OV6A 4E14A 1FFCA 1DRJA 4ECEA 1L8OA 3R24A 1JF8A 3E7FA 4M53A 3MC1A 3CCCA 1N6IA 3RS3A 1N33B 3I53A 3FHLA 5FI0B 4HATA 4Q3CA 1YL6A 3BMQB 3PNVA 1Y6RA 4Q18A 5AJWA 5CB0A 4R69A 5JSHA 621PA 3GUZA 1PX2A 4MROA 1CR0A 2XCOA 3CRNA 3DMDA 1RABA 3G5LA 4ML3A 4QDXA 1R6XA 4TPKA 5AK5A 3FM9A 2XUKA 3JSAA 4BMVA 1Y6QA 1FMJA 1GRRA 2BN4A 4IJQA 4PLWA 1EUZA 1LDMA 1AC5A 2QX7A 3TM5A 3HVUA 4EFLA 4CQLA 4DR4B 2ZFUA 1ENPA 2Q3DA 3MK31 1EK5A 2I7TA 4BAGA 4DWWA 2DHEA 4W5OA 3MOIA 3H0EA 4RY8A 3A37A 1XJ0A 2JVIA 3NRCA 4N0PA 3V6LA 1U7PA 2WV9A 2XE4A 4LHVA 4O2BB 4TMYA 7ADHA 5CIYA 3CVUA 3THRA 3D4BA 2AJ8A 1AXGA 1RT9A 3WGHA 3WLQA 4OXQA 4XSVA 3DVLA 4NIMA 3T61A 2IYXA 4P38A 4BWVA 3A14A 1ULBA 1G16A 2H8GA 3IPYA 3E3MA 3TLAA 4BO1A 4E5UA 2HWUA 1RI4A 1I33A 5EJ2A 1R50A 3CUEF 1GHTA 1K7XB 2DBVO 2ACEA 1F6WA 2YRFA 4O2RA 3RRNA 2OD9A 3LBIA 4KO2S 1NXSA 2C3UA 5EA2A 4EB6B 2PL3A 5JPDA 2Q1YA 4J7XA 4LDNA 3QSYA 4HVTA 4BYMA 1E60A 1Q77A 1YOBA 3IBYA 3UB2A 1ACLA 3AF0A 1H9CA 5CM2Z 2CFIA 2DH5A 2AQHA 2R65A 4ND6A 4X63A 4AWBA 1XTKA 2PD4A 3DGFC 3H4TA 4DYDA 2DT8A 4QGSA 2PKXA 2OCLA 2I0FA 3F96A 3MTGA 4YUWA 2XUJA 1OKKD 2BZGA 2WUGA 2I2FA 1I2ZA 2EHDA 4KKVA 1F6DA 1XR3A 4ZYYA 2IH2A 2CLEB 1FYVA 2PYZA 4ZZ2A 1N9GA 1JDBB 1XD2B 4TTPA 1SVLA 1ZGGA 4WFIA 1VG0B 3A11A 1FFYA 1R9JA 2BTQA 1G5PA 2WDZA 1RWBA 1FDIA 1WMFA 4HS9A 4IWNA 4U7PB 3RU9A 1QHHB 3KSZO 3RYIB 4BNLA 3GLHA 5B58T 2V65A 5BSKA 2MU1A 4Q7LA 2FR1A 3JATA 4X3CA 3A1NA 3M49A 3O47A 1EP2B 4RNDB 4EI2A 1TC2A 3PWZA 4OFXA 1EXMA 3RRJA 4ZYWA 3DEAA 2HF8A 5KYVA 3E18A 5CDGA 3DMGA 5DYGA 5INTA 1KAOA 2TMKA 4Q6BA 4Q47A 3A1DA 3EAFA 3VVLA 3ONVA 2GM5A 1A5BB 1TQ8A 3BFKA 4KQXA 5UKDA 4Z9AA 4LOLA 1LLDA 3G8DA 1UDWA 1ANKA 3FCOA 3L4SO 2EJWA 2E21A 3VPFA 3LBYA 2GCOB 5F7JA 1O94D 4BZPA 2JATA 2PUBA 4QULA 1HMYA 1KR2A 1Q1NA 1ZJYA 3C3AA 4XDHA 3DW1X 3OE7A 5EQDA 2ZOSA 4KGZA 5IJAA 3RG8A 3HDJA 3HRHA 3L8ZA 4YJFB 5FA8A 3RS0A 5LXTB 3BQMB 3G5UA 2XYVA 3B48A 3CRVA 5IWCA 3CRW1 2FW1A 5GY7A 1E9DA 4ZYLA 1EVYA 4F71A 9LDTA 1AXEA 1JI3A 1SC6A 3HABA 2EJTA 1P73A 1WXHA 3ZXSA 2P65A 2ZUBA 3JW8A 4BXOA 3CX6A 4JLJA 3U6BA 3BXFA 4RQAA 2NU8B 1IB0A 4A8JA 1EE9A 2O8NA 3ZQ6A 4CEIA 3ESXA 2ODAA 1CZKA 5K3CA 1DOZA 2P9GA 3GBVA 2Q46A 2IYVA 4M4SA 2J85A 2HLHA 1KIFA 2IEYA 4CF4A 3P9KA 3DNMA 1T4CA 3C6YA 2BL4A 1G8GA 1M54A 1W1UA 1T0PA 1ZOPA 4XDZA 2OC9A 4B7UA 3AVQA 4RTNA 1X42A 4KR0A 2B99A 1U02A 4XYLA 1HR0B 2Q27A 1LGYA 3WVNA 3FPBA 3ZOKA 5BOSB 2Q6VA 4AXBA 3RS4A 4ENVA 1B73A 4IEFB 4AXXA 1Z7BA 4GF5A 1IQUA 3DC2A 4YMTA 4M9CA 4IGIA 4JC5A 5IK2D 1SK9A 3C3PA 3H83A 4Y7CA 4N47A 3W2IA 5L45A 3VVMA 3UWKA 4E15A 4IQGA 5H8WA 3EXEB 3AESA 1SC9A 2JDIA 3A2LA 5LOVA 2EATA 4GMHA 5K09A 2QIPA 3VHXA 1BNCA 4KUGA 3B7GA 4E31A 5A9SB 5JTUA 3I30X 4RVCA 4ZREA 3NP7A 2ZRPA 4HNHA 2ZKLA 4M9UA 4GPZA 1JEYA 2P78A 2F8MA 4FR0A 1XU9A 4RMGA 2YQ5A 5JAMA 4LC9A 4AIIA 3DWGA 2V74B 1KO1A 3UHAA 2X2EA 3QV2A 4FN4A 4MQFB 5FT9A 3RLFA 3RV3A 4RLSA 2DTEA 4RZ3A 1XZQA 3WGKA 1GYQA 2VF4X 1H93A 3ZCXA 1JKMA 3VR1A 2X8BA 2AZXA 3FGPA 4NYJR 4FYHA 2BKVA 5BV7A 3PXXA 2A9QA 3CPHA 3RSHA 1TIBA 1VPEA 2ILVA 1TIPA 4HEHA 4MMXB 1W87A 2AE2A 5KCZA 3SMVA 3HGTA 1G5RA 5CFMA 4CG0A 5CB4F 3AVUA 3L6EA 4BZQA 3PWSA 5CNIA 3HVRA 4NZZA 2RGNA 5LMCA 1KH2A 4BC1A 4QXQA 1OZGA 4JI3B 1G41A 1JYSA 1P2GA 5TQ2A 3BEOA 5HZGA 4HDOB 4TMXA 4YPFA 3SSOA 3GEHA 3I52A 5AHWA 4R8KA 2VJAA 2O20A 1ZRSA 5I7SA 2YHAA 1QIEA 4NBVA 5D3KA 2P4EA 3OTQA 4JI1B 2DFNA 1CIPA 1IDOA 1DG1G 1I32A 2BUCA 2UZ0A 2VP4A 5CVEA 1Z26A 2TS1A 3UHFA 5IH7A 2ID8A 2GVDC 5TC4A 5GGXA 4GZMA 4I81A 3WISA 4AO8A 3MB8A 4ZVPA 3QIVA 3FBTA 6AT1A 1RWMA 3AINA 3OD1A 4KAFA 1KMHA 4RVNA 4MRRA 4MI9A 1WCV1 1XCGB 4UE6A 4DL9A 1AD2A 2AJDA 3GBPA 4L3VA 3QXCA 4LBWA 3AJ9A 3WS7A 3D7MA 3RC8A 2MYUA 5EP1A 1KYXA 1OI7A 2PJRA 1Z4LA 1GITA 1J0BA 1T2FA 2V03A 3IDOA 5LLSA 4E6EA 1E66A 4CG3A 2OWDA 1YT5A 2GJAA 1UMKA 2YOFA 2G71A 3AETA 4ZI3A 1JE0A 1KJQA 4V0KA 2ZYRA 3EGCA 3UT5B 1XHEA 4QQRA 4CMIA 5B2ZA 2O2XA 3F47A 1Z39A 5EFZA 4OMUA 1CS4C 5GWXA 1R6TA 2F1OA 3BSYA 3IXQA 2XE6A 1HF3A 1XB2A 3CO5A 4YA6A 4M36A 2EKPA 4X8HA 1VE9A 1MB0A 5CMLA 4JJ8A 3J81k 3EOZA 4JH0A 4H7KA 5ILGA 1F38A 2O2ZA 1O1YA 4LF9B 1D0IA 5DM0A 1Y4DE 1K92A 4BP9A 1KI4A 4G97A 3LP8A 4X6XA 3K30A 1W85B 2C4KA 4M9RA 1HTBA 2VTVA 3OQ6A 4NBRA 1K86A 2JFBA 3FHOA 2J9FA 4JL5A 4MS3A 4JVNA 3VHLB 2OGSA 1AQYA 4AMGA 1VI6A 3LX5A 3ND9A 3W9SA 5I3CA 1GTG1 2XE7A 2AK3A 3ZY3A 3ZCTA 2ODPA 4CTMA 1KY3A 1Q14A 3G0CA 4PFQA 4TVBA 2HWWA 3SHFA 3HFGA 1VE3A 3NH9A 5JPIA 5ELXA 3VSBA 5A4MS 4BJ5A 1GVNB 3LBFA 2JLZA 3AUUA 1O9GA 3N07A 3OT1B 5BN5A 4N65A 5AH0A 4L8FA 4ZTUB 4MKRA 2BGNA 2F3UA 1U0RA 2AC4A 2O5EA 4QREA 1SVWA 4NBWA 4ZYZA 3KPUA 3GZTB 4K7JA 1J8VA 1EXNA 2XA9A 3NASA 4HWPA 3P20A 1HXHA 1UBMS 4JYCA 3T15A 1OY1A 5L7WA 5K8JB 5JAZA 5AESA 3IAM6 4J4TA 2QJRA 1U0JA 4KKXB 2IV3A 1JZQA 4XWWA 2RGNC 4RTLA 2IYLD 1VGRA 3I45A 3TLJA 2DQZA 3L8CA 1C30A 3FTQA 2LGJA 2WD7B 3O03A 3TJMA 3O83A 4EHIA 1HTWA 4A0RA 4RPLA 2R8XA 2Q5EA 5L3SB 2PLNA 5HK8A 2DP4E 3HKCB 1XN1A 3TLXA 3UHOA 2JFPA 1TUIA 3GFTA 2XECA 4LKRA 1CBUA 3TOXA 5D1NA 1SCUA 1O58A 1ZM7A 2CFCA 4DCGA 3TQCA 1JGTA 4ENRA 1MQ9A 5CPFA 3CUSA 1XZFA 3CG0A 4PCAA 3LH5A 1BN6A 4LY9A 5T3YA 3HWX1 4CF7A 1XPUA 4OB6A 1ODFA 2JGAA 3GFBA 1NRWA 3HZRA 4DKXA 3GZNB 3EZLA 5JAHA 1X2EA 4N0EA 1OYOA 1Q1EA 3NGMA 3ZY4A 3CVWA 1YJ5A 4WLFA 1UK6A 1WOYA 4GSYA 1W4RA 5IJ0B 3TLGB 5JAPA 4YJGB 5E7IA 4OY3A 4PLPA 1Z2AA 2OZVA 5DOVA 4N9WA 2OFXA 5KYNA 4W5QA 1WPGA 4N7RA 1VMKA 3R41A 4CUZA 2E1PA 1QCCA 2YXNA 1F14A 1UT5A 1HDEA 3K2BA 4F56A 1YNOA 4DV3B 4UASA 1R8QA 2FW8A 2J48A 3H04A 3DTVB 1HH4A 2A0XA 3IIKA 2WPNA 3GCZA 3D2BA 1JV2B 1OR8A 3KXPA 1RHUA 3IKJA 1B8VA 3BF8A 4OYRA 3KFLA 3SSAA 5BW4A 1W36B 1UKZA 2WMYA 1SUAA 4KO3S 1BFDA 1E3QA 1MO4A 4MYRA 3GT7A 1KZHA 3U0BA 1RM4A 4UHDA 3IOMA 2KM1A 3U7QA 4BWFB 1PR5A 3BPSA 1T5LA 2XUQA 3ABQB 3KJFA 2B8EA 4YONB 3P0RA 4KTVE 2CDNA 4PX3A 2EGHA 1AUQA 1JG3A 1T3ZA 4MVJE 4OQPA 5KYXB 4IO1A 4KLAA 1JPJA 3EC1A 4MYCA 4UARA 1O9HA 2H85A 5DFAA 1JDTA 3CR3C 3ZC3A 4DTIA 4Z4CA 4WE3A 1P17A 3IPCA 1S2MA 3GELA 3IX7A 3QX7A 4L9WA 5YASA 3OPQA 3Q0IA 4K1XA 3ZNNA 3X1KA 2VQ6A 3V8VA 1HLPA 1YOVA 2AOTB 2GETA 2WKQA 3ET5A 5JASA 2PA3A 3VYWA 2CJFA 1NDUA 2ZE7A 4UU0A 3X2SA 4B3SB 3IP1A 3G88A 4WSOA 5JY1A 2B4AA 3QVTA 3B9BA 3HBNA 3A3KA 3OY2A 1XAGA 2PSDA 4XW2A 5FBWB 1RAHA 4O2AA 5FL7D 1GZ6A 4S1TA 1XDGA 1HPLA 3BGVA 1LDBA 2NO6A 4R9UC 3BGIA 3OZEA 5E7MA 3G8BA 4ROSA 3TQTA 3N6XA 1R5NA 1KEEB 2ZSEA 2ZSHA 4X1OA 6ABPA 3ELDA 5G1OA 3AEQB 3PIRA 1ILWA 3RFFA 5CEFA 2AV6A 1NNEA 1ZJJA 2R2AA 4RK1A 4AWAA 2N46A 4QTUB 3DOFA 1OZAA 4ISCA 4NCJA 2XZLA 5F35A 1CF4A 1NN3A 1BS2A 4MGYR 4KPUB 4EHAA 2ZTHA 3WIUA 1ZUNA 4JLVA 1W0KD 5ED4A 2ZYVX 2GNPA 2ZI9A 1NFQA 3ETGA 3FMIA 3O8LA 3RLIA 2HBYA 4QOGA 1AQ6A 1IBSA 1RIFA 2PFGA 2P11A 4L8YA 1N3YA 1UF9A 4XX0B 4YTEA 4BMZA 2X7XA 3K1YA 4X3OA 1AGRA 3UW1A 5EHIA 2NZ8A 2PH7A 3LKVA 3FNFA 4YRQA 1ADFA 1E9EA 1PEYA 2ZKIA 2VAVA 1NBHA 2R9VA 3H5NA 2WYUA 1AY0A 2SNIE 1KHHA 3FJYA 4MJ7A 1T6ZA 5K51A 1PUJA 4YCJA 1JWLA 1ARZA 1M2WA 4RQBA 4F3KA 2ZJFA 1PKEA 5IVHA 4ALJA 2VTBA 2Q7XA 2RI6A 3TRJA 1IY0A 2R5WA 3KV1A 1RP1A 4HZUA 4JJKA 3CEHA 4PS1A 4QRIA 4RGYA 4AP6A 4EQZA 1UKAA 5FB3A 3THWB 1T1SA 3QEOA 1J0CA 4UBOA 5I7FA 5JH7A 3HCDA 2PZGA 1RPZA 1WEKA 1OFHA 3FPAA 3MF4A 5BYBA 5LU9A 1SXJC 3B3JA 1A2BA 5FJIA 4UATA 1LK7A 3OCVA 4PZ0A 2YXDA 5D1HA 3UUGA 3H7AA 2H2WA 1J49A 2QG9A 1FYFA 5TVGA 1YVPA 1ZM4A 4H0FA 2RK6A 1CJBA 2ZVDA 3GEPA 4KDEA 2VJNA 5DCLA 1XPOA 1R0YA 4JLPA 1MVLA 4AJLA 1U5BB 2OVBA 3U16A 4JOBA 4AW9A 1KJNA 1WMBA 3NRBA 4LJRA 1BMQA 1E63A 2P5TB 2C20A 1QF9A 1TCVA 2B7CA 2OHIA 3N2YA 2WZBA 3R40A 4UNRA 3HXQA 4ND5A 2OV8A 3NU1A 1JXMA 2Q4RA 2ZLBA 5KYUA 4A8HA 3GBSA 3CNOA 2ZJYA 4D9HA 1HOTA 1RRMA 2IW3A 4IJWA 5BN4A 1FQWA 5C9ZA 2QSZA 2V8BA 3QVLA 4WZBA 1KMNA 4TMVA 1RYEA 3AHHA 2P3QA 4G6ZA 4WIAA 4X1IB 4FKZA 1HDOA 3EGEA 1WMDA 4KQFA 4ZU1X 3WGIA 1XTIA 3ZCRA 4OX9Y 1GZ5A 4CQJA 1VL1A 3SLRA 5TS2A 4NEHB 1TM7E 2ZBFA 3HRKA 3GX1A 5HZKA 1MZPA 3U3XA 3DFMA 4ZOLB 2JK1A 3BXOA 3EVFA 1M2GA 2JIMA 5KYGA 1SQGA 1F0NA 4Y1FA 3V4PB 5T3UA 2W2MA 4LY3A 3N8IA 4ZQIA 2EIHA 5KTMA 1ZQ9A 3KR1A 5A62A 1R4AA 1NQUA 1BU8A 4UEOA 3RK0A 3RVJA 2MCFA 5BR7A 1Z7GA 2QRUA 3LY8A 2Q8QA 2JI7A 3TF5A 1RRFA 1ILEA 4CM4B 2C7BA 5EFOA 2DEUA 4MICA 4D8YA 2W4QA 1H6BA 3RH0A 2JCVA 3I2HA 4QYTA 5DLYA 4C0LA 2F1KA 4P3PA 5D01A 4MMZB 1XJCA 3CZRA 3GCWA 4PBRA 4FFBA 3MS2A 1II9A 3R3UA 5LMNB 3I9FA 2P4HX 4FIZA 2HCFA 4FGSA 3GLTA 1D2GA 3GFVA 3Q5GA 1ZN9A 5LC1A 1RWKA 3EF3A 1YJXA 2BLLA 1KZ4A 3WLFA 1FNBA 2JCYA 4I36A 1MDBA 5LQRA 4J29A 1HI9A 1A9ZA 1ESNA 5TS3A 3FZEA 4G5OA 2ID7A 2X76A 5C81A 1FPMA 3G85A 3OA2A 4HSGA 2QM0A 4WBNA 1GUYA 2DAPA 4NJMA 4V0ME 1CEQA 1R3UA 3QU5A 4QDTA 4FWTA 3A9CA 3T7CA 2QLTA 4EHJA 4BO7A 3PC2A 3LZCA 1SIBE 2CNBA 3FFBA 3HXLA 4XFDA 1DG9A 2VHWA 1C3LA 4F2WA 5A06A 3QEKA 4JOCA 1W19A 4DLSA 1MV5A 4QPCA 1OILA 2HO5A 1CRLA 1ZI9A 3AI1A 4X3PA 4TWJA 1OJLA 3ZV7A 5LSAA 2AQIA 4OJKA 1PZGA 4Q1FA 3E4CA 2YUTA 5D51S 1WU8A 5IRCD 3A1SA 1CPYA 3RS8A 3AI7A 2AW5A 2SKEA 2YJ5A 3U9TA 1OFVA 2RGDA 4NE9A 4BLUA 5ILQA 1MB4A 2FPUA 2FUCA 4XYGA 4DMHA 2BMFA 5FP0A 2E87A 2O3QA 4FCCA 1N0HA 2CD9A 3HCRA 3CRQA 3VZCA 4EUSA 4CIAA 3C6XA 3WXBA 3K7EA 4EKIA 4PPNA 2QEQA 2A9JA 2IOFK 3SC3A 3R6LA 4QFCA 1DAFA 2VNHA 1XA3A 4HQOA 1KMQA 3O0DA 1HDGO 4NZYA 2H2HA 1E7SA 1F3LA 1P5FA 2BBTA 3ENWA 3WK7A 3PLAE 1WZUA 4B74A 1QB8A 3SN6A 1NP3A 1ZN8A 4U2CA 1QIFA 1ULAA 1VL2A 2GJ9A 2NZUG 4MPRA 1Y8ZA 2G25A 4ZVQA 1QKJA 2HR1A 3E03A 5HUQA 3PX7A 4H1HA 4FD3A 4MIEA 1QKKA 3P71T 1EAYA 1NQ5A 1VBFA 3EBLA 4ZJZA 3EWIA 2EEPA 3MTAA 5KJEA 2MMGA 2OESA 2HDNB 3HUUA 4ZV4A 4PFSA 3V4FA 3KOMA 1U0LA 3RYHB 1VYTA 4B2YA 1EX1A 1WUYA 1U7HA 3DL7A 1MAHA 2ZG6A 1L7PA 4JB0A 4LV5B 5TT0A 5CCXA 3MCVA 3TW0A 5IU6A 4KV7A 1NN1A 1R4ZA 2QP9X 5AW0A 3SC2B 1P7VA 1XZCA 1FX0A 2Q3BA 3IUBA 2GQ0A 3CWCA 4UM7A 5JMPA 3BSFA 3KYDA 4FDLA 2A88A 1CUBA 2VH5R 1FFGA 1NV8A 3TH5A 4LZJA 3PI7A 3L8DA 4ZK2A 4UZEA 1SA0A 4ESHA 2WINI 1NP6A 1SKYB 2XYPA 3TW4A 1A2OA 2GBIA 2YL2A 3LT1A 4EFDA 4RPGA 4BV9A 1OB5A 1CEXA 4L3OA 3SDBA 1HOXA 4JI7B 3TOCA 4NCIA 3UY4A 3VTKA 5ERGB 4IHJB 2IT1A 3GMIA 4LBZA 1CUFA 3LX8A 4GQIA 2P9TA 3VPSA 3AH8A 1Y5RA 5JDIA 4LZNA 2YOHA 3OZCA 2ZIGA 1P72A 4CL2A 1YKSA 1OXUA 2GM3A 4JVOA 4E1AA 3EXAA 2HHJA 1N2GA 2YZGA 3BDVA 3QU4A 1ZAKA 4HUQA 4OHRA 4QXMA 1CUYA 3TTTA 4CIYA 4B83A 1FZTA 2F1RA 1XCBA 4UEQA 2HSWA 4M49A 4PZUA 5EIAA 5EXDA 1MUUA 2VSYA 3OQHA 1V5FA 4RVUA 5I8PA 1XZNA 1ODTC 4LRTB 1QFMA 5AXDA 3N2KB 4NMWA 1C1DA 1QH1A 1KO4A 1ZC3A 1RLTA 3P2OA 3WK5A 4FZJA 5HRUA 2RI0A 4I4LA 1ECCA 2E55A 2VXOA 1B1AA 1JH9A 1XV5A 2DSNA 1TU4A 3QKUA 1G8HA 3Q72A 3NDPA 3WHLA 4B3MB 4MJ3A 3WE7A 1JP7A 5ELLA 2OXTA 3SX2A 1E2MA 3HB0A 2QGFA 4J1NA 1TRHA 4DLVA 4IIBA 3REFA 4ZT7A 4D7AA 5JCJD 5K0LA 2FW0A 4CM8A 5HXAA 3Q8LA 2P6OA 2VDJA 4DYVA 3TIGA 3CM0A 1E7QA 4HH0A 1QE3A 5IBQA 3TSYA 2JIRA 3QU2A 4OD0A 4EJSA 3HM9A 2IXTA 3IVGA 4NWIA 4WJZA 3FPKA 3R2JA 1X1BA 1DXQA 1E94E 1KC3A 1NSFA 1UUFA 2J9XB 3AB3A 1E2FA 3N5KA 2IYRA 4G23A 4QQKA 2Q7DA 4PNHA 1N5KA 1J9GA 1XNQB 5G1NA 4MWGA 1DMRA 4IQ4A 4NU0A 3SFZA 1FA9A 4FHEA 1OIWA 4K2AA 4PVCA 1Z0ZA 4LC0A 1KEUA 5DISB 1PYGA 3IEIA 1YV9A 4HLCA 4MV5A 5BMVA 2ZCVA 5ERYA 1XSEA 1J8MF 4NYMQ 3R3HA 1G4UR 2JKYA 1A9SA 2QPLA 2XX3A 3GARA 4FUTA 5HFNA 3K9FC 1SULA 1KK2A 1UBEA 4RKWA 1UM8A 3U56A 3QKRA 1MU0A 1C3VA 2QTHA 2R1TA 2X4DA 4QGGA 4L8LA 3WOVA 1XUOA 1R0WA 1R6AA 3MB5A 4FOTA 4TN1A 1WKBA 3MJHA 4IOLA 3PB3A 4FE3A 4I6EA 1KU0A 4KLCA 4UCXA 2MSDB 3NEAA 4LOAA 1CDZA 3VXKA 4XEUA 5ELMA 5G0WA 2X40A 3LHIA 2QTTA 4DJFC 4KXVA 4X65B 1U2DA 2IXEA 3INGA 4GPD1 3U3OA 1RKBA 4MA0A 4BS9A 5CW2A 1UBOS 1XYVA 3V8NA 3B3GA 1Q44A 1WR8A 4EO9A 3HDYA 4EDHA 2KE5A 4WGGA 2BGMA 1D2RA 1VL8A 3B1VA 4KXYA 4MRMA 3DBLB 4EW2A 3RKSA 3K5PA 3FFAA 3BH0A 3V2HA 1FDRA 1ODLA 2AJTA 4ZAYA 2ZDHA 1ADBA 3GLSA 4FI3C 4Y9RA 5COQA 4NCAA 3RUEA 1N78A 3LL4A 2C9MA 4ZEXA 5BOVA 1BXRB 2QSJA 2VUHB 3R3JA 4KGXA 5E7JA 2VF8A 1U6IA 3RFXA 2VBGA 3RVKA 1SXQA 1N9ZA 3HK2A 4P7BA 4IUCS 4LXYA 5E1MA 2Z04A 2RH5A 2YW2A 4QUAA 4MYHA 4G0VA 1YS7A 1G8KA 2ORYA 4CDMA 2LKCA 4L5CA 2FPLA 1VHLA 3MCWA 4OQNA 1VC2A 4U0JA 1B6TA 4J7AA 5IZCA 3QE4A 3ZU5A 4N41A 5AVVA 5BUQA 2B9VA 1Z7WA 1W5SA 5BRJA 2Q9CA 1OTXA 3AEUA 4WNAA 1Z3CA 1A7KA 4G1UC 3REOA 3RRBA 4LYFA 4EARA 3FNRA 3T3IA 1W76A 4FKBA 1WSAA 4YB8A 3ORFA 3PC8A 5F77A 3THSA 1NF3A 3RM3A 3PC7A 4Q4HA 4MR9A 5CDTA 5FOQA 1KC1A 1KERA 4AWXA 3FMGA 5AKZA 3IAS6 4HDCA 3E7PA 1Q0LA 3L41A 3OPYB 4GC5A 4OMCA 3SLGA 3U4HA 3UH0A 3X44A 5KO2A 5HJ7A 2AFIB 3LZ6A 3KTAB 1WDTA 3CXRA 1MTOA 3OICA 4P7GA 3B38A 4QHTA 4NJEB 3CV3A 2DFKB 3D3WB 2VJMA 3IKLA 2C2XA 3K15A 4DWOA 5T8KA 3CZQA 3M4XA 4DMKA 2EW1A 3NHSA 1IUPA 3MWGA 3FFXA 4ZHQB 1GQOA 1OXBB 1PL7A 3C85A 1RAFA 3NTOA 3OPYI 4X1KB 4EVSA 3U0VA 5E95A 3OHMA 3VX4A 4W7HA 4X9XA 3JRWA 4BL5A 2YMMA 1YD7A 2NZYA 3E1GA 4C0QC 3FZNA 2G1UA 3WK9A 1B2RA 5DT2A 1KIMA 1F3OA 5E2AA 2QVGA 4O0MA 4UNSA 4AL4A 5KJ6A 1TTHA 1JDJA 1TVKB 4N7BA 1JTVA 4OYHA 1DJLA 1QZZA 4LNAA 4PWZA 4GZ5A 5LDGA 5KC9A 2JGDB 3RBXA 3OM9A 1CXZA 3T3PB 1Z2OX 2NXWA 3C4VA 1ECPA 4U8GA 1SQSA 1I3LA 3HB5X 4ONEA 2H4YA 2OP1A 5F52A 4TN5A 1J2RA 4F3CA 2AI2A 4ED9A 2HCJB 1XRSB 3R7SA 1E2PA 2B2XA 2J9RA 1E3IA 4KMSA 1GKIA 4LQ4A 1FTQA 2GS9A 3O7MA 4H4DA 3N74A 5AXBA 3LLUA 3I62A 2XT0A 3DGEC 5DGDA 3TQFA 4CU2A 4FILA 2I1WA 4AJEA 4KN9S 3HFRA 3NHYA 2PVCA 2ATEA 4V0RA 2J5QA 5GOZA 1C2TA 2WWTA 2W2OA 3H84A 4LISA 3ZQ4A 1WBDA 2CLDX 3VDNB 3KT3A 2AZ4A 2EW8A 2FN7A 2Q8NA 4LBYA 2CL5A 4CEHA 1YMVA 3W8DA 3F6CA 3G9UA 5IZCC 4BVHA 3TMAA 2BEWA 1DE0A 1PNQA 3WYNA 3JQPA 3BB3A 4JOQA 3FCUB 3N8NA 3ZTYA 4B3DA 4OSPA 4B35A 4EYOA 5EJ5A 1A8UA 3WLHA 4AAYA 3PDWA 1QIIA 2PXCA 1A8PA 1FNSA 4QU9A 1M2OB 2C3OA 5C5EA 3HA5A 3FLMA 5JXIA 3S2FA 2BHRA 4G4GA 4DVJA 1Q7TA 1H69A 5CW1A 4YCLA 1WP9A 3AB7A 5JS7A 4IUDS 5MGBA 5ESDA 4QGAA 4EDFA 1ZVJA 1NJ5A 3B6EA 4K9PA 4ZDKA 1QCZA 3IALA 5JDCC 1ZJWA 4GKJB 1ORDA 2AGVA 4B3JA 3NW9A 1BYIA 3VZBA 5LQCA 3LA8A 1Z0KA 3ZG6A 5THKA 2FPPB 5E4JA 5I01A 1YK1A 4DNOA 4GOKA 3PRKE 4KAAA 3LXUX 3TJZA 3EPHA 1H05A 1BE8A 1GCIA 3EULA 3O1LA 4GS5A 2RC6A 4BTEA 1J24A 4V1CA 4DZRA 3IEKA 1P7PA 3TLBA 2ZYUX 3WHKA 2Z6UA 2P67A 3TINA 3L0DA 1DS6A 3IAUA 5A3JA 4FFDA 2YS6A 2NUAB 4RA9A 4CQMB 1T24A 1D8AA 2G5GX 1E0JA 2J07A 3O1HB 3ORQA 4JUDX 4MV7A 3VV3A 1VM6A 1AZTA 1BX0A 2CF6A 1NJ6A 2DQSA 2XR1A 1UKYA 2O0MA 3GJQA 4MK4A 1N8NA 1Z4NA 3JZAA 1KYWA 5DEOA 1OKKA 3KSUA 4U1RA 5JXGA 5AVRA 4DR5B 4HPWA 2EQAA 4AX4A 1HK7A 1T1IA 2ZXUA 1C1YA 3P1JA 3BCSA 4HMQA 1REQA 2XW6A 1NXQA 4KW7A 5FLYA 2WOOA 3TZEA 3DZCA 4YJ2A 4JI8B 4KK4A 4F91B 1SXPA 1IBCA 4HLDA 4DNPA 3K5HA 4L8WB 5DIZA 1ZL2A 3TZCA 1P2DA 3A3NA 2B1JA 2Y1LA 1LSOA 1JS1X 2Y93A 3EJ6A 3KUDA 3STYA 2YNMD 2GEJA 4YMLA 4F9TA 4IDNA 4RKEA 3DV9A 1KKMA 1XP5A 1DAPA 2VHZA 3DKIA 3OCUA 5E9AA 3JAMA 3WX0A 4DCNA 3ADBA 3P2MA 3AR3A 2P79A 2NTYC 2FMFA 2WZCA 4EG3A 5FD8A 1WCWA 3GHYA 1Q22A 3VAZA 4U02A 7MDHA 1NA5A 4GM4A 4NZMA 4YAJA 2GEVA 3PVSA 3EXHA 4Y0NA 5I6DA 4HR7A 2HTFA 1VJDA 2CLOB 1NQVA 1Y4ZA 3LXXA 4X1YA 1O94A 2HEIA 4J2OA 4E7PA 1ZK1A 2VWQA 5C8YF 4DDTA 1DQPA 4K9SA 3GLIB 3FMFA 3QJYA 3G2NA 4QDOA 2WUEA 1UP7A 2HLDD 3UV7A 1IBRA 1IMJA 4NICA 4RZQA 3VUEA 5D7BA 2LE0A 3P9RA 4KFTA 1VDMA 1AE1A 2Z1DA 3CLSD 4WK6A 4BFCA 1UBTS 1YE8A 1RYBA 1Z06A 4B40A 3GRUA 2PWZA 4G0OA 4GR5A 4PG7A 3DDSA 3MXOA 3DE5X 3OHSX 4PYQA 2ZPAA 4RFSB 1NQTA 4TLBA 5IAEA 3VR0A 3C3YA 4AYXA 2C58A 2UZAA 3AUFA 5CXSA 3LWNA 3UK2A 5FI5A 1L4NA 1XVIA 2FZEA 3QKSB 2GASA 1VRVA 2WSYB 3EGDA 3H16A 5GP1A 4NENB 2VP3A 2YOGA 3FB1A 5THQA 4OFBA 2B6NA 2ZRLA 4R8VA 1WY7A 3CX4A 2G9NA 3EQZA 3L7NA 4I3HA 2NG1A 2RAPA 3BRWA 4UHHA 1YRYE 3Q2KA 1N6HA 4G4JA 2BE7A 4R1OA 1J56A 1K6XA 2FXIA 1QZUA 2BF7A 3SBEA 2IHNA 4KITB 1KRWA 4NQRA 4UNIA 4G89A 2H1VA 4NABA 1YB5A 4OHYA 3U3RA 1VGVA 3TDKA 1XQ9A 3Q7EA 2VA9A 2E49A 2Y1XA 3GRVA 3L0IB 1IQRA 4YAWA 5B3JC 2EFCB 1F4LA 4AFNA 2DF8A 2PZFA 3LYAA 5IK2A 4MAFA 3WKAA 4EF4A 1LRKA 1OIXA 1U8XX 1AMOA 2O7SA 3UB4A 1EA5A 2JRLA 4Q21A 1SB9A 4TTIA 5JXWA 2D7DA 4NL4H 1KSFX 3BXXA 1KVUA 3JXEA 4WNIA 3ST7A 1MB2A 4N5IX 2IZOA 2GN9A 4XCXA 1Z68A 2BGGA 5BQ5A 2BFAA 1IXKA 1U04A 3SVTA 4H1VA 2REXB 3QP9A 1FDWA 2ISQA 1R74A 1MJHA 4BB0A 2RJNA 4UNPA 1N0IA 4ABYA 3EC2A 3AP1A 1IN5A 1P2TA 2FOXA 3CKYA 1CIVA 3NNDA 4K40A 4RK5A 3AVPA 3P9NA 3TL2A 4MIKA 3OBBA 1Z47A 3D6MA 4BNGA 1N6OA 1B74A 1OX4A 1QIMA 4MV0A 1WQ4A 3QEMB 1IUKA 4X7MA 1F2DA 2P9EA 1X80A 3PQ4A 4WN9B 2CLHB 1KP2A 3ZQJA 3FYSA 5HGJA 2GF2A 4Q3EA 2IYYA 4JJAA 3BTVA 2RKBA 4P4TA 4U3JA 4WFJA 3WGYA 1N2HA 4ABTA 3W7VA 4X71A 2HCRA 3VBEA 3TNJA 2FLKA 3E5NA 4V03A 4ZEVA 3HLYA 1ZICA 2D0OB 1O94C 3EVAA 4HL6A 5SZIA 3H9GA 1YBFA 1W30A 3ZXUB 2L0XA 4IIHA 4RE5A 3GT3A 2HCBA 2BDEA 3LMKA 2BZ1A 2NV2B 3BK1A 4HGOA 3L6BA 3EVEA 2X3YA 4O4IA 1L5MA 1RM5A 1SU6A 3HVIA 1YFLA 2EOAA 1KDZA 4GNKA 3R9IA 4DADA 3F7MA 4BRZA 1H22A 3VYVA 3EIWA 1SVIA 4MSUA 1V6SA 1E9SA 3TRKA 5GMOA 3KOUA 4UTXA 1Z2DA 2X58A 1IEXA 3A27A 3KLMX 1NV9A 3FDXA 3EPRA 1YDEA 5DWVA 3Q9LA 5CIWA 4FT4A 2WQ6A 3CVVA 5F7XA 1JDVA 2QD4A 2YCBA 1EUCA 2BE9A 1JKJB 1D2NA 1Q1GA 2AZDA 2I4LA 3B85A 4L2IB 2JLUA 5AK0A 3PICA 4EGSA 3C6ZA 2YJ6A 1T2CA 1HZZA 2QORA 3LFUA 3EY9A 1Z18A 3BQNB 3SBOA 5LQAA 4AMYA 7MHTA 1WXXA 3TCXB 5TQ0A 2ZQYA 2D1FA 1CF2O 1P62B 5HF8A 5J58A 2IRWA 3UFXA 1OH8A 2OCBA 3ZK8A 1ZSVA 1EHYA 2OBXA 1U11A 2XJ9A 4NYJQ 3WP0A 3X43A 4J2HA 1GSIA 3E8SA 4K6MA 3HACA 1HYEA 3O9MA 4ZRMA 1SUBA 3D6AA 2V9PA 2Q49A 4BQRA 1YF3A 1IFXA 1BVUA 1TF2A 1Y98A 2EFDB 2P8SA 3QM1A 4ROTA 3W9YA 4BQNA 3K1AB 4XASA 3TVYA 3WGMA 2ZUDA 5GZ1A 1GZ7A 1CU1A 3WDLA 1YB4A 1M8PA 2SHKA 4R1PA 4ZT3A 4GZ3A 1D2EA 1XZIA 2V6BA 3NLLA 1YB6A 4OIMA 4PHTA 3FR8A 3QHQA 4CKBA 4HV4A 3FOFC 5F1YA 1LPAB 1YBVA 4JT4A 3SG0A 4YRIA 4WCVA 1Q7EA 3ZCVA 1JH8A 2WZDA 5DCUA 4LA4A 3NI2A 3RNOA 4ARUA 5CPBA 4F2PA 5LQUA 2HSJA 2RCNA 3A1TA 3DEJA 3UJ9A 1KXZA 1MH1A 2JA2A 3LUFA 2WJAA 3DE2X 3Q3HA 4Y3UA 3VDMA 3CX3A 2JBWA 3KQPA 1NBEA 3D7LA 1XDZA 4UJ5A 4AI6A 3IKMB 1TYEB 1OAAA 3GVPA 4OHOA 4PQFA 4DEYA 3G9TA 3RGGA 4TXJA 1R8YA 4GR9A 3MUEA 1MP0A 2ZIVB 3SF8A 2QE7A 4LQLA 1QVZA 1V3TA 2VDLB 5A5FA 4HFNA 1JEAA 1CD5A 3D6UA 3USZA 2CF5A 2GK7A 3RTDA 2YINC 4ZRDA 2PGOA 2CDAA 2X9LA 3RVBA 1FNNA 1XRJA 3FX2A 1N0VC 3RJMA 2IPLA 1S8OA 1W1IA 2BFDA 2A92A 2C3MA 4TKUA 2L42A 2SCUA 3WQQA 1WXQA 4J0JA 5DHQA 3GNLA 4G5HA 5ITZA 1GG5A 1FFXB 2IFTA 1KORA 2OUIA 1L8LA 1VCNA 1JJIA 2XCIA 4WBNB 3JASB 5EHGA 3PD7A 3LYUA 5JAOA 1YQTA 1GL6A 3A4MA 4JVMA 4R83A 3PTLA 4OQXA 3MJDA 1L4HA 3DBHA 4N82A 2EKLA 3QZUA 4PC2A 1HNXB 2APJA 4ALMA 3T7TA 2F6RA 3CG4A 2JJ1A 3FLAA 3WNBA 2CD7A 3EWAA 1Z82A 2X0DA 1OA0A 5FORA 4REOA 4Q34A 5KNDD 4N1AA 5DHSA 4CCWA 2EKZA 3IMEA 4DJJA 4C0AC 3BJIC 4ESVA 1SCBA 1Z4KA 1EMDA 1GSAA 1NWHA 1Q1ZA 2P3SA 1ZM9A 2JEYA 2ZIFA 4RYLA 3E9QA 4UFNA 2J32A 3H2BA 1ZX1A 4QTYA 5M04A 4G5GA 2P2LA 1FNCA 2FDXA 1GADO 5G4KB 3KOOA 4XGKA 4YJ3F 4BVFA 1IZZA 4D44A 5ECYA 4ES6A 5F2NA 1NUPA 4BVKA 4QOFA 3PSAA 2QTWB 1ORTA 4PLTA 4DF3A 1AUVA 3VPGA 1VLMA 4YP9A 2H0QA 3RJ5A 2PUWA 4D9BA 4MI6A 1I0IA 2LUOA 3DVQX 5DNCA 3MBKA 1E3EA 2XMCA 1P0MA 1P44A 4Y2UA 4FU0A 4BLRA 3IMKA 5DHFA 3TSZA 3VSDA 4UDOA 3MA0A 4REMA 3LP5A 3PITA 4Z6KA 5JPCA 1OFTA 3AJRA 1KQNA 3PLRA 3H9CA 1WHTA 3U4AA 3VR4D 4HDQB 4DXAA 1COWD 1KYIA 2CMDA 2OOKA 2PAAA 4DM4A 4X7PA 3RIMA 2QBYA 1JNYA 5IPFA 2F48A 3QW4B 3PDIB 4GU5A 2WU3A 3UWSA 2A58A 2ZTMA 3BWDD 3L05A 2HDOA 2AX4A 4B34A 5B37A 3EPJA 5JJIA 1P0QA 2GFQA 5FWNA 4TT3D 3H13A 4B4WA 2ATCA 1P1KA 3LW7A 3QLEA 2TYSB 1L1RA 4PZCA 4U7GA 2X0FA 2NVUB 3OESA 4B87A 3AM1A 1NBAA 3RFUA 2ICAA 1VKRA 5K0BA 2J3MA 4J9VA 3PNPA 3MIIA 5J9FA 2ZE8A 4IIGA 5FWYA 1A8QA 3FUVA 1DNPA 3FCEA 3GAAA 1ZO8A 4FEYA 1W0KA 4DANA 1F7VA 1PWYE 4XR9A 2IHTA 1E2LA 1THTA 4IFTA 3C3BA 5K0EA 1HMPA 3JQAD 1HE5A 4KZPA 1RBQA 1N6PA 1HE2A 5JE8A 1SHTX 2B69A 1TB4A 2OEPA 5JSYA 1UXOA 2ONYA 3NDIA 3ZHBA 4EHBA 3WLKX 1V9CA 1EEXB 1ZIDA 3PQ6A 1NFRA 1XQVA 3R3ZA 1XVUA 1MT3A 3OFKA 2NMVA 1LD3A 3ROEA 1HRKA 3ETJA 5EJIA 3RYFA 3IL2A 1ONNA 1O08A 4HXYA 3I72A 7GPBA 1A7AA 2IXGA 3JWGA 4GI5A 3VZSA 3BMOA 2IS1A 1UDCA 1VYUA 3PT9A 4WXHA 3TQHA 1PV4A 2JIOA 3OURA 3NDBB 1VBMA 4ARAA 5DHAA 1TJ3A 3MQFA 5E6UB 4DIMA 2O8CA 4M0MA 4MO2A 6REQA 5K4HA 1WABA 1ORRA 1BA2A 2OFOA 1AA9A 1CR6A 1CY1A 1Y33E 3GWZA 4DBVO 3RS5A 4J6EA 5ICFA 3T3DA 2ZR7A 3RIGA 1X7WA 1P31A 2XTMA 1YB2A 1VRCA 5FUWA 1K3TA 1RLIA 4L75A 4ZMBA 3A6GA 4K5QA 2D1YA 2Y1WA 2RHBA 3DOEA 4JUFA 4PSDA 2XT9A 4EYKA 4GGMX 5TR9A 2Y0BA 3CGWA 3H8JA 3A1FA 4HEQA 5SY9A 1R4NA 5H7XA 3N2ZB 3TIVA 3WNQA 3UWPA 2YN0A 4F96A 2JH8A 5I9SA 2ZAGA 2AC7A 5D85A 3PBKA 1QX4A 4M6WA 3IDFA 3TZQA 1E9AA 2RE8A 3PE3A 2PX2A 3AOGA 4U4AA 1XKQA 1JG2A 3IMFA 1CY0A 2QT0A 5C3UA 2H7YA 3LF1A 3OQJA 4A0FA 1Z38A 4D8UA 1ULSA 1TAQA 1C1XA 1GY8A 3NQ41 2GUWA 3LWZA 5AVYA 3IOEA 2PUTA 2DETA 4X90A 1THGA 4D5GA 3UO8B 1RXUA 5C1PA 1IYZA 1MRSA 4IRMA 3G68A 3L6DA 3CZ9A 3CNBA 2CUZA 3PKIA 2FPGB 2CSXA 1V41E 1EB8A 1DEHA 4BNKA 3LO8A 4DEXA 3U49A 2PKQO 4H0CA 2R96A 4JUIA 3TB4A 4JXZA 4HQ6A 4RTRA 3PTZA 5I9TA 4H1WA 3KYBA 1M10A 4TLDA 1E4OA 1BEUB 1IEQA 5C80A 4LHEA 4D3SA 3UK7A 4AYWA 2FGKA 5J2TB 1NPDA 2W98A