1K27A

Crystal structure of 5'-deoxy-5'-methylthioadenosine phosphorylase in complex with a transition state analogue
Total Genus 92
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
92
sequence length
273
structure length
270
Chain Sequence
b'AVKIGIIGGTGLDDPEILEGRTEKYVDTPFGKPSDALILGKIKNVDCVLLARHGRQHTIMPSKVNYQANIWALKEEGCTHVIVTTACGSLREEIQPGDIVIIDQFIDRTTMRPQSFYDGSHSCARGVCHIPMAEPFCPKTREVLIETAKKLGLRCHSKGTMVTIEGPRFSSRAESFMFRTWGADVINMTTVPEVVLAKEAGICYASIAMATDYDCWEEAVSVDRVLKTLKENANKAKSLLLTTIPQIGSTEWSETLHNLKNMAQFSVLLP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 5'-Deoxy-5'-Methylthioadenosine Phosphorylase
publication title Picomolar transition state analogue inhibitors of human 5'-methylthioadenosine phosphorylase and X-ray structure with MT-immucillin-A
pubmed rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 92
structure length 270
sequence length 273
ec nomenclature ec 2.4.2.28: S-methyl-5'-thioadenosine phosphorylase.
pdb deposition date 2001-09-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01048 PNP_UDP_1 Phosphorylase superfamily
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1580 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1k27A00
1PKEA 4QARA 3FB1A 1TGVA 4EB8A 1U1FA 1Z5PA 4DA6A 5I3CA 5F7OA 4E1VA 1LVUA 1RXUA 4GMHA 4BN0A 4BMZA 2ISCA 4DA8A 3UT6A 1PR5A 1TCUA 1M73E 4OY3A 3OZCA 3FNQA 4F1WA 1JP7A 5F7JA 4WKNA 3DJFA 4DA7A 3NM5A 4LDNA 1RXSA 3OOEA 1V2HE 3OZEA 4D8YA 4DANA 5EUBA 1Y1SA 4JWTA 4L6IA 4FFSA 4LNHA 4TTAA 1ODKA 4NY1A 3EMVA 3FOWA 1SD1A 2A0YA 1ODJA 1T8SA 4X24A 1N3IA 2I4TA 1PK7A 1Z34A 3EUEA 1Z35A 3GB9A 4JOSA 4G89A 5K1ZA 4TYMA 3NM4A 2RJ3A 1K9SA 3BJEA 1PWYE 1NW4A 3UAZA 4ECEA 1YRYE 1V48A 2A0WA 1OUMA 1Z37A 4L5YA 3KVVA 4GKAA 1U1CA 1NC3A 1A9OA 3SCZA 1PR2A 2OECA 4DAEA 1LX7A 5ETJA 1LV8A 4R2XA 4P54A 1T0UA 3OOHA 1OTXA 4MARA 3PNSA 1TGYA 4TXJA 4F2PA 1Y1RA 3UAYA 3DDOA 4M3NA 1A9PA 4DA0A 3IEXA 4QASA 4PR3A 1V45E 1Z38A 4WKPA 4L0MA 4IP0A 1SQ6A 3PHCA 4F3CA 1NC1A 1RSZA 1PF7E 1QE5A 4OGKA 2PGAA 3ENZA 3PHBE 3KUKA 4JP5A 4QAQA 1A9TA 1JDVA 4UC0A 1VHJA 3BL6A 1T8RA 4BMXA 1U1DA 3OCCA 1JE1A 3ONVA 1T8WA 3TL6A 2OC4A 4WKOA 1I80A 3K8OE 4G41A 5FAKA 1ULAA 1ODIA 4DAOA 3DF9A 1YBFA 3T94A 1Z39A 2B94A 5C80A 4YO8A 1PR0A 4TXNA 4D8XA 1PK9A 2AI1A 2QPLA 2Q7OE 3K8QA 1RR6A 1JDZA 1PR6A 4H1TA 4GLFA 2I8AA 2QSUA 4LZWA 2QTTA 3KU4A 3LA8A 4R2WA 3IOMA 1Z36A 3F8WA 3PNPA 3E9RA 3E0QA 1B8NA 3NBQA 4R31A 1CG6A 5JPCA 4K6OA 1ECPA 1CB0A 1A9SA 3D1VA 4WKCA 3NM6B 5F78A 3KHSA 4GLJA 3LGSA 1TCVA 4YMLA 1JDTA 1OV6A 1PR1A 5F7XA 1VHWA 1TD1A 3GGSA 4NS1A 4EARA 5DK6A 4D98A 5B7QA 3E9ZA 1VFNA 1JDUA 4F2WA 3P0FA 1YQQA 1V4NA 1SJ9A 5F7ZA 4TXHA 1RFGE 3C74A 5CCEA 5CXSA 5F77A 2AI3A 1PBNA 4LNAA 4OEHA 1JDSA 1A9RA 1V3QE 5B7NA 4F3KA 2OXFA 4U2KA 3OPVA 5EFOA 4MCIA 3BSFA 4LKRA 4D9HA 2A0XA 4TS3A 4M1EA 4TXMA 4TS9A 1Y6QA 1K27A 1PR4A 2BSXA 2H8GA 1Q1GA 1A69A 1RXCA 2AI2A 2AC7A 4OJTA 1Z33A 2HSWA 3O6VA 4DARA 3O4VA 5CXQA 1ZL2A 1VMKA 5IU6A 5CYFA 1Y1TA 4PNPA 4YJKA 3EEIA 1Y1QA 2HRDA 1RT9A 2HWUA 3UAWA 4DABA 2XRFA 4D8VA 5B7GA 1A9QA 1ULBA 5F73A 1G2OA 4TTIA 1Z5NA 1XE3A 5KB3A 4YNBA 3INYA 4MCHA 1WTAA 1OU4A 2HN9A 3FAZA 1U1EA 3FWPA 4OF4A 3OF3A 1C3XA 1T8YA 1U1GA 2QDKA 4KN5A 1SD2A 4L5CA 3UAVA 3LBAA 1JPVA 3KVYA 1JE0A 4L5AA 4TTJA 5IFKA 3UAXA 4WKBA 1OTYA 3U40A 3DP9A 5CYGA 4M7WA 1Z5OA 3QPBA 1K3FA 1ODLA 1B8OA 3MB8A 3KVRA 4G8JA 2P4SA 1RCTE 1PW7A 1OVGA 1YR3A 2OC9A 4QFBA 1YQUA 3FUCA 4NSNA 4QATA 2QTGA 2IQ5A 3BGSA 1Y6RA 1RXYA 1ZOSA 4RJ2A 4QEZA 1RYZA 1FXUA 4OGLA 4TXLA 4I2VA 1JYSA 3EUFA 3DPSA 3OZBA 2ON6A 4BMYA 5F76A 5CCDA 2A8YA 3OZDA 5B7PA 3MMSA 3ODGA 1V41E 5EPUA 3P0EA 2GUWA
chains in the Genus database with same CATH superfamily
3LDHA 2HLDA 5FUVA 1USWA 1XOIA 2C1XA 1JQJC 4LISA 1DBIA 1JLLA 1OU0A 2ATXA 1CNFA 2HJGA 1JVNA 3DTNA 3HV2A 4HEHA 4LCEA 3KKMA 3UV3A 4ER5A 2WTUA 3PWZA 3NVKI 1E9DA 3FVQA 3WK4A 4EUFA 3PJRA 1XHEA 3CIFA 2NPOA 4KO4S 1KI8A 3FKSD 5EP1A 2FKNA 2DTDA 3WDKA 5LMCA 4FD2A 4KDEA 2QQFA 4WNIA 3TOCA 4EB0A 4M1KA 4OHOA 3LXRA 3FVVA 4G26A 2O06A 1RXUA 1E60A 4K7JA 2MR6A 1MJ5A 4R7TA 2NO0A 1ZVKA 4CHGA 3GMIA 3ZV3A 5IHPA 4MR8A 2KX7A 4BGEA 2I1LA 3DPUA 3GMDA 4UUAA 1U5BB 3PENA 1BHSA 4B32A 4QECA 1YVEI 1QOQB 4BBZA 4PXYA 1RWOA 4H3SA 3DZHA 4ZEXA 2Y4OA 3OLYA 3PNMA 1GG2A 1B2LA 2NXCA 2H57A 2O5VA 5CAEA 2D54A 4L3VA 4QPPA 4M0CA 3L8DA 3D2AA 2LBPA 2IX9A 1IOLA 2PQMA 4P83A 3VMMA 2HTFA 4Q3LA 3AUXA 4QXQA 4E11A 5GIPE 1GRNA 4WASA 4EP1A 1D8AA 2H29A 3QUTA 1EM6A 4IWXA 1TKAA 3PE6A 2VUSA 1DTWA 2OHXA 3S99A 4PGGA 3V1UA 5DGTA 4L6IA 3FNBA 1T3SA 1D9ZA 3QNUA 4P4SA 3PQ8A 4IDNA 5LDHA 1S2OA 2PS9A 1KEZA 3II6X 5JAUA 2PANA 5JISA 1GFZA 4RJJA 2OXIA 2RAVA 5K6AA 4H3HB 5DP2A 4AY5A 4G0OA 4E3ZA 4ZQHA 3A1EA 1OXXK 3KZOA 1VKZA 2GN6A 3IURA 2VHWA 3QYAA 1NRWA 3URKA 2JJ2D 1G1MA 3GARA 3OICA 2AX4A 1DDGA 4PS0A 4OSEA 2FZLA 4WIAA 3KHKA 5THKA 1KMIY 2PBRA 3DNMA 3VH1A 1ETUA 1M1ZA 2REQA 1ZP6A 2XD4A 3EZ2A 3HYNA 4HNAB 3I05A 2O7RA 4RLHA 3W8DA 1G6Q1 3U6KA 1OLXB 5EPOA 1AQ6A 2OESA 1G7CA 2YIDA 4YS6A 2CJPA 1VRCA 2W71A 3A9TA 4CCWA 1TF2A 3PQ6A 2XNHA 4B8ZA 1E1MA 5ALUA 2IXGA 2IDKA 1Z06A 2BW0A 1ZW1A 4MKGA 4OHUA 4FHEA 5FA5A 4IIFA 4TVBA 4V3CA 5AUQA 2ZWOA 1RKQA 1RKXA 4C03A 1PGPA 1XTBA 3K16A 4REQA 1KJJA 3EK2A 1Y3HA 5BYAA 3H1GA 4HQKA 5EY5B 5B3KA 3BXEA 2CJYA 1BWRA 2ZJYA 2GSWA 3M4YA 3GMTA 3LOUA 1XRRA 2VTVA 1TJ5A 1DJPA 2QV0A 2UYOA 1QWSA 4G4GA 5ULLA 3BPSA 4IR7A 4MV7A 5EWLB 3GIWA 2O2JA 4S1VA 2WMYA 3AFNA 1SZDA 1RS0A 1T5TA 5HGXA 2RHOA 3ENQA 1LSOA 1XNHA 5DIFA 2OFPA 4FOLA 4MUGA 4GG1A 1W30A 4TKMA 4ZOLB 2IYQA 5HCUA 5T4FA 4H1VA 5G02A 4GKAA 1TYBE 1E98A 2DETA 4ZXPA 2GBCA 5CDTA 3DXZA 1UC4B 4G97A 1DUSA 1SA0B 2AUNA 2AYXA 1L7RA 3PC2A 4WCVA 2OWEA 4BEBA 5FBKA 3EUWA 5JBNA 1YUMA 2EQAA 1RCUA 4K03A 5CYPA 3LBNA 3REGA 1IN8A 2MINB 3X43A 3ANNA 1OASA 3K72B 4FK8A 4GP7A 5MF6A 1V8PA 2QRZA 3E5NA 1AM4D 2XXJA 1LNSA 3T7KA 3VI4B 2IZ1A 4MYCA 4BO5A 4M0KA 4D9MA 4OI0A 4P3YA 1T5BA 2QL7A 2I54A 3NYQA 1UDCA 2OHIA 1OXBB 3W7VA 4EABA 1YZQA 1U7DA 4MPDA 3EA4A 4GXQA 2K2WA 2H92A 1U81A 2QL5A 2X5NA 3DW3X 4NATA 1GPJA 2NU9B 1KYWA 1ZJZA 5TGDA 4ENRA 2R7MA 1ZN8A 1JFFB 4TXJA 1G6OA 5BUCA 5DLDA 4BPRA 2IH2A 2FOLA 4NU0A 4PX5A 1E2FA 1KFCB 2H2FA 4HH4A 4QQKA 4L5IA 1PNOA 4EJSA 4QO8A 3OEYA 1U99A 2PXXA 2W6IA 3F5DA 5DCLA 3UB4A 4DJ5X 4KNYA 1KYXA 4JY7A 4J3NA 1BOFA 3PEFA 4QASA 3W6PA 1X7DA 2AOWA 1K0FA 1DIRA 1UBGA 1VIAA 3BVPA 5JZVA 4PX9A 3RF6A 4A03A 2YC2C 1FMFA 3H65A 3AIMA 3A3KA 1H2ZA 1R0LA 1Y9DA 3JWGA 1D2HA 3PXEA 3ZHTA 4U39A 4AJKA 4AULA 1DKLA 1GPNA 2YJ3A 3MF4A 3LM8A 4HY3A 3BRQA 4AS3A 4KITB 4L5JA 4HWPA 2E1RA 1KO4A 3VR6A 3CISA 4GMDA 2BFCA 4PC2A 1HG1A 4O4HA 4N7MA 4PS1A 2BDTA 1KBZA 4MKZA 3CH4B 4N40A 4FXOA 4Q9KA 4EFKA 1E6UA 3D3WB 3D3JA 4NYJQ 2D3WA 4NBNA 4YRAA 5AUOB 4R1OA 1OI3A 2J8ZA 3E82A 2BOVA 1P2SA 4YT4A 4ROSA 2Y67A 1EVZA 3AU9A 2LUOA 2Q45A 4LMAA 3VXKA 4WESB 4I99A 2OV6A 1QH1B 4V0OA 2JFQA 3IBCA 4A4DA 4Q6BA 2ZCVA 4P7GA 1PX2A 3N5CA 3E35A 4E5YA 3TAUA 5CCXA 2QMQA 3MYYA 3FOFC 1YGYA 3WMFA 5KREA 4GEKA 4CT5A 1IAQA 3BDVA 1R66A 4I5GA 3DMTA 2KPOA 3PKIA 4HF7A 4A2WA 3N2GA 2BIFA 1YU6A 3IMEA 3TL3A 1N1DA 3ZDQA 1NDUA 1QHNA 1QAOA 3I09A 4DAOA 3RSCA 2IE8A 4DKXA 2P68A 1PS8A 2WAXA 2QG6A 2X40A 4Q03A 1NRIA 2FWRA 3COWA 5ESXA 3ZTWA 1GTVA 3AEKB 1NBAA 2B82A 1ISIA 3K6RA 1OILA 2I2AA 2KHZA 1Y1KE 2MT9A 1ZH4A 2R4TA 2WTMA 4FWBA 4TPKA 5KTTA 1RVV1 1W1UA 1OIWA 2QPLA 2OXTA 1G2IA 2IBSA 4JFRA 4KLNA 4WOJA 1J8YF 4E5VA 4CE6A 1MDBA 1FNCA 5JVDA 2VSXA 3KR9A 3BILA 4BXOA 1YVRA 3D9QX 5FPPA 1PIWA 2F8LA 4RHEA 1EWTA 1N1MA 1SXHA 1V1JA 2D1RA 3ZI7A 5I8PA 5I9IA 1B8VA 1VB3A 1V3VA 3BMNA 5F2KA 3C39A 1IE3A 4OQEA 4KNVA 3DOEA 3TQQA 4P4GA 4LZWA 1KKMA 1VKRA 3IMGA 3GFGA 3DZKA 4OYRA 5IDVA 1OWLA 4AO7A 3RG8A 3AY7A 5EFZA 5DLYA 1XZGA 2GQ0A 3E8XA 521PA 1ZOIA 3RW9A 1G63A 4DMGA 1XROA 2P27A 2X2PA 3CKMA 4RIGA 5BT8A 3H2JA 5I4KA 2BM1A 1M6YA 4BX3A 4I5IA 1TM2A 4HWSA 2WVHA 3DOFA 4IEFB 2Y99A 2QROA 5EJ8A 1CG6A 5BR8B 3KAQA 4M98A 2N47A 1Q1EA 2I3DA 1RXEA 3TRJA 2EFCB 5JBQA 4G4SO 4YAKA 1U9IA 2I76A 4ZOBA 3VDNB 4E1AA 5L3VA 3RWBA 3LHSA 1FA9A 4ZQCB 3HB9A 1Y6FA 4Z3KA 1NMSA 1LBHA 1U7WA 3DKKA 2B35A 5JNRA 1TQ6A 3TAHA 4ESEA 1ATIA 4NV1A 3KV1A 4FZRA 4R98A 5CBKA 4Z49A 1QH8A 1UJNA 4UNIA 5H3CA 3IIMA 3M81A 3IJRA 2AZ4A 2QORA 2QJFA 3L46A 3X2EA 1ESCA 5FV4A 1B42A 1I5RA 3EEBA 4Q15A 3RS0A 4R2LA 1W85B 3ZDDA 1XLUA 4IKOA 5KHAA 1LJ8A 1CEEA 3IPCA 2G72A 3FOCA 5L7YA 1YHZA 1TKBA 2MSEB 3D2CA 2C4TA 2PX2A 4J7UA 4UBMA 2VJOA 1OAOC 2JASA 1RLUA 2QR3A 2WG0A 4K5QA 5CMLA 4DR1B 2J0SA 2VZ9A 3RIYA 5F52A 2W4IA 5CA1F 5JADA 3M6AA 4J0FA 1C4WA 3GEIA 4JLMA 1YRWA 4C4TA 4CMJA 5KTPA 4CT4B 2FZVA 1AKWA 1OGYA 1WDTA 2IYOA 1M2KA 3K8YA 4QUIA 1KQPA 5B1SA 4B1FA 4F3NA 1KNXA 4D4GA 4CGYA 1XPUA 1N9GB 4F2HA 1SQFA 1CF4A 4QPZA 3CPJB 3ZLJA 1YL6A 3DTVA 2JLAA 3H86A 2YW9A 2ZDGA 3A70A 3JQ6A 1UWKA 1Q22A 3C7KA 1YZYA 4O2RA 4OI2A 4P2GA 3RUPA 5LLDA 3BE8A 1BH6A 2B7LA 2J48A 4FT2A 4OXKA 4MZXA 1E6MA 3OP4A 3D5QA 3TD9A 4NEGA 3S44A 2UYCA 3DWEX 5HX7A 3VJKA 1JR3A 2BM0A 3UVEA 2VNSA 1Y34E 5KEIA 4C21A 4LY9A 2FFJA 4JYBA 4P58A 4YYEA 8MHTA 4B6FA 1SZCA 1IY8A 1XHLA 4L9RA 4L7VA 4E15A 2G9QA 4ZRNA 4C2UA 2GYYA 2AC7A 3C5EA 5AHOA 3HB0A 2Q2QA 1AX9A 1R0WA 3QA3E 5JWRA 4YP0A 2NSYA 1I9GA 3I1YA 3D8HA 1EBUA 5F4BA 5C8YB 2XXAA 2ZRDA 4UXHA 1OYVA 4ZVVA 4PO3X 3AEQA 1XVAA 4HAUA 5L40A 5DCUA 3NAGA 1NNUA 3O90A 1U0FA 4LXYA 4IMRA 5ESDA 2HTEA 2NV6A 2CXXA 3EEIA 3AO0B 3V4LA 3RJ9A 1RT9A 3ST7A 2FGKA 2KJQA 3IHLA 4ZYTA 5J23A 1VKNA 1JDJA 2GB4A 2XRFA 4FFLA 2JCYA 1A5AB 4TT3A 2YCBA 4KWEA 4YRJA 1DO2A 4WLNA 3EG9A 1E1CA 1SULA 3I9V6 3Q9NA 1SRQA 4O6VA 4RY9A 5LP6C 3WHPA 5CLFA 5KB3A 2HHCA 4RF2A 1GUZA 3RFXA 1U9ZA 2JI8A 4MW4A 1PJCA 4HGYA 1T6YA 2JFOA 4MCHA 1GAXA 2OAP1 1EK2A 3MC1A 5JD3A 5KVSA 3G17A 2LD4A 3GUVA 3IAXA 3TFWA 2ZB8A 2BFDA 2COKA 4JLJA 4MUFA 5CLJA 1Z4LA 1YAHA 2F2TA 1WUKS 2CNWA 2YH2A 2GCPA 2J0UA 3B48A 3PNYA 5FQNA 1EXDA 3PDCA 4KKXB 3IEKA 4EITA 1IWPB 2BF4A 4DT1A 4DV2B 1W5FA 4MAAA 2PUDA 3RC2A 4NPCA 1PK8A 1Z75A 3QVXA 3RV3A 3Q7TA 3RRBA 1K5PA 1Y8QA 3G7UA 2P1DA 3IDSA 4KFUA 5FTNA 4HV4A 4X8HA 2IY8A 1JV2B 1ENOA 3SS8A 4BNDA 2JI6A 2O0HA 2OHHA 1PJ4A 5AW5A 5FB3A 2IKSA 3N0VA 4NEHB 3GUZA 5B1IA 2H17A 1KZYC 4OH7A 3UAVA 4N5MA 1XA0A 1YKFA 3BWEA 5AI4A 2FZKA 2A78A 5DN9A 3FA2A 4L4RA 1Q15A 3S8MA 3BD6A 1KVSA 3BN3A 1NTOA 1GDDA 1HQKA 3BMQA 4MKHA 3EULA 1EJ0A 4L5AA 1GYQA 4HTFB 5KVCA 5CFRA 3O8OA 1OVMA 2N42A 1VG9B 1YQ9A 3AR7A 1QFSA 2VQ3A 4PF1A 4ZANA 2WE7A 3OLXA 3HL0A 2FG5A 3OT4A 2A5DA 3PF8A 3TLZA 4C3ZA 3F9IA 2PS1A 3WK8A 5C5CA 2ZPAA 3S81A 2HREA 3BBLA 4U8HA 1BDMA 5AXCA 4ALNA 2WNSA 5BQPA 1OH6A 2IHUA 1Q0UA 2UUBB 5JDIA 1FSGA 1O2DA 4M8NE 3A9VA 2CDRA 3OOJA 3WBKA 5KJ1A 3Q8LA 2QNBA 1AXRA 4XDHA 2YRXA 2X2FA 4PPNA 1RFLA 2XUDA 5IVIA 3NAZA 5KNCH 2QZZA 1P2TA 4S0XA 4ARZA 2BHNA 5F64A 4D2IA 2GEVA 3AILA 4UCFA 4PHHA 5ALGA 2BH2A 4KV7A 5AJVB 3OZAA 1YQUA 4G37A 3OECA 5LN1A 1Y3CE 4AAYA 3AHHA 4IEEA 2QF7A 2O7QA 3DP7A 5JC1A 2Z2JA 4AZ3B 4BS9A 5A5EA 2GD2A 1YCHA 1Y6RA 2IYWA 4J3JA 3DXYA 1U0BB 2W6CX 3TX2A 4E2YA 4YMHA 3Q3CA 4TMTA 1ECGA 1YFZA 1IY2A 2HF8A 5FT9A 5SZIA 1YVDA 5BW5A 4QX6A 4A8JA 4O4JA 1GSHA 2WIKA 3L8EA 3SZGA 5DBIA 4B8WA 2NIPA 1Z82A 5EMJA 4AWAA 2I8LA 3LXUX 1ZL0A 1RYNA 1TIKA 4FFRA 3OJXA 1YNSA 4YAFA 5TR9A 4YP9A 4MB0A 1TMKA 5I5EA 1LPNA 1P7PA 4FHZA 4KO1S 1NA5A 1H1DA 2XCUA 2C0CA 5IJXA 1DHRA 4TLCA 4O59O 3ZGYA 1ITZA 5A7HA 2H4HA 4UJ5A 2FR8A 2XNDA 3K9NA 2H51A 4V0LA 4QPNA 3NBUA 5KKNB 3P1JA 3HXMA 3X1DA 5D5PA 3BCHA 1E2UA 1NXSA 3LA6A 1EFRD 2I2FA 4ILEA 4PPFA 3DZDA 3SHTA 5LU8A 5SYMA 1R64A 2QT9A 2FX5A 2ORIA 4NE7A 4Y1GA 4ZXFA 3HU5A 2DAPA 5TNXA 3U3DA 3UQYS 4K6CA 4P08A 3UHJA 3T5GA 5JCOA 1AQLA 4Y6RA 2GK6A 5IC6A 1UP7A 1BCSB 5D86A 3UJNA 3RUEA 4F1KA 1PZEA 5EE9A 1HQCA 3RHFA 3GLKA 2Z95A 1P2GA 4I4CA 1P19A 1KDYA 1Z6GA 1ISRA 3H1EA 3H8WA 4MW6A 3F2IA 2H4XA 2IHYA 3CH6A 3KYBA 2CC2A 3NASA 3QKUA 3SBOA 1JG7A 3PDJA 4EB8A 1ZAYA 4US0R 1TU4A 1O95C 1ORHA 4CUJA 4DA6A 3NKLA 4BQNA 1P81A 5F7OA 3VTFA 4OGWA 1NVGA 3AF5A 3OEHA 4CG2A 4X1KA 5CDSA 2WT9A 4AYWA 1MC4A 2BMAA 1IBLB 2NADA 2XMQA 2GJ9A 3A8TA 3A6HA 5A9SB 2G25A 3P2EA 1E9FA 1W581 5TF0A 3QY9A 4A6DA 3IEIA 5JT1A 2PX3A 1EFPA 2Z4SA 4IYJA 3RUCA 3CW2A 3NP9A 4K28A 4DFDA 2QRPA 3A37A 4OQ4A 1GNRA 4CFZA 4DA7A 1KJQA 1VBKA 1ICEA 1U3FA 3C1OA 3G0CA 4ZIRB 5LKRA 5F1OA 3ZWVA 4H3KB 4YRPA 3UF0A 5DM2A 1RXSA 4JITA 1T3HA 2OV1A 2JPDA 5AOCA 1CS0B 1V2HE 1SO8A 4N48A 4D8YA 2VUIB 4FW9A 2QE7A 3FDXA 4NONA 5CHYA 1DARA 4HLNA 4YALA 1XTKA 1J8MF 5CGQB 3K96A 1BGVA 3LY9A 4PSCA 5KSOA 1QYCA 4NK4A 2CXOA 3HS3A 1GFSA 3WHKA 4REMA 3NJ4A 1Z6TA 3GCZA 3PQ4A 3EARA 4NCXA 4FHGA 4EUHA 1W6UA 1HETA 3I62A 1HXHA 2I4MA 1LEHA 4L85A 2G7MC 2WQ6A 3C4JA 1CE8B 3TF5A 1O96B 1K7YA 3VA7A 1CQXA 1T29A 2QTHA 4RD2A 4PCAA 5BYBA 4WOCA 2D13A 1YS9A 2COEA 3O2QB 4PONA 5TF4A 2ALJA 3PWKA 2GLXA 3OLVA 3WISA 3FUTA 1P4JA 3T7RA 2R87A 4BV2A 2WIGA 3MJTA 3GLGE 1IM5A 1E6CA 4N0MA 4WZZA 4OB7A 4QQNA 3TD2A 4QTYA 1GLGA 2PMKA 4CIAA 1KVUA 1VCHA 1TIPA 1Z35A 1LBIA 2AJDA 2JGNA 2ZYWX 4Y1RB 4RVFA 4JZYA 4M49A 1SHZA 3TCXB 3W4JA 1S2DA 4YLYA 1FYEA 2I3AA 4ZZ2A 4HQNA 2PA0A 1ZJ4A 1WTCA 3FBWA 4I4TB 5DWQA 5C8YF 3RYCB 3OM9A 2FF5A 3BJEA 3TFQA 2IZOA 5COQA 1N78A 2UYHA 1PNRA 4IOJA 4MLPA 2W8BA 4RD6A 1NW9B 1T1EA 1H05A 1XTQA 3IP5A 3N7TA 4GI7A 3KDSE 1QGYA 2H2WA 4C7OA 5JJLA 1P4AA 4S35A 1GPBA 3NWBA 3VHRA 2QAGA 4OFWA 3KYDB 3O4GA 3HKBA 3HDJA 2H2GA 4UAJA 3QFRA 1LI5A 4AG3A 2XSZA 4PNZA 5T5QA 1LK5A 1U0SY 3HV0A 1VSTA 2WTEA 4PAWA 2NOAA 1VGQA 621PA 3MEQA 2HPAA 3T94A 5LZ2A 3QX7A 3CH5A 4AKSA 3QI2A 3G79A 3E7WA 2B8NA 4XCQA 4AIRA 1E0SA 4LJ4A 1DKUA 3ZE0B 2V4UA 3PXBA 3THXB 1N34B 4TN5A 3IVRA 3BGDA 1P0FA 1C9DB 2R1TA 3SHVA 4CMEC 1L5ZA 2GCEA 3Q7IA 3D6JA 3C24A 1XF9A 2BUBA 3DMRA 4LECA 3JZFA 4R2XA 4JP1A 4YJ2B 4L4UA 3U3ZA 4DDUA 2I3GA 1AD2A 4LMBA 1J0XO 1QCYA 4M89A 3ZGOA 1X9HA 4XYMA 4EJ6A 1I30A 2W2KB 3D0QA 2GF0A 3P4XA 2HRZA 2RAUA 1HT1E 4KX5A 3CF6R 1BZYA 2LIPA 1BEZA 2D7JA 3OMWA 4P4TA 2PT6A 3RIXA 1KDPA 1R15A 2EX4A 9LDBA 3RU7A 1ZUD1 3PNSA 4XIGS 3U7IA 5A2GA 3ETJA 1UXHA 3RJZA 4ANFA 1WABA 1HOTA 1SKYE 3LIIA 4HDRA 2A9RA 2EKQA 3N0RA 3YASA 3PZRA 1ONBA 3DC2A 4TLEA 5AW3A 4DYDA 4UMVA 5CXXA 5EKTA 4ZJYA 4R7ZA 5H0IA 1C9YA 2YJTD 4FGWA 2AOXA 3UKOA 1GUAA 1QV7A 1RDFA 2CBXA 9LDTA 2WKRA 4IGFA 4A8TA 4DEYA 3P45A 1X77A 3W0LB 1JW9B 2WHYA 1UKVY 3BQNB 3I52A 1NXQA 2JJ1D 3GQVA 4P7JA 4JQZA 5HZKA 5DH9A 2BSAA 4AX8A 5ALOA 2GT1A 2H6EA 4D9KA 5BR4A 2P1ZA 2VH1A 4LYHA 3CZPA 4XRGA 2G1KA 4PAMA 4X1IA 1EFAA 5DYIA 1KGSA 2XUOA 4Q37A 2UYYA 2YWEA 1EE9A 3ESXA 4XDZA 3H97A 2FPSA 3EIOA 4NAUA 3BIOA 3EODA 4BNMA 4G4SP 5CFLA 2C5HA 3K2IA 1SHKA 3DFFA 4CKWA 2AG6A 4EJ0A 3BTUA 2G1JA 4CLOB 2O8CB 1E18A 2UZ1A 4KSYA 2B61A 3PIIA 3L0IB 2C4UA 1KFBB 2RH4A 1Q16A 3Q6NA 2ZBUA 1WQ3A 4WFQA 2FPXA 4Q3KA 4EJ2A 2AMVA 1PE0A 5REQB 2IYYA 1CDZA 5CG2A 5FUXA 2LKCA 3F71A 4URUR 2NYAA 3AM4A 4RSMA 5BR7A 2GPJA 1HE5A 1OX4A 2I62A 2VF4X 1XELA 3NOXA 2HC9A 4PLHA 4ND7A 4R40A 4UVIA 4Y6OA 4A73A 4BJ1A 3ADDA 1CY0A 2FN8A 3R5TA 4PVDA 4XUCA 1RQPA 3CKYA 1COWD 2PZJA 3FCCA 5FCDA 2R6AA 3I2IA 5FFFA 3T12A 2YWRA 1L5OA 2GD1O 3LKBA 1DINA 3ANYB 2FUCA 4R1LA 5D5QA 5I9SA 3U1VA 3DE6X 3IQDB 2FQYA 2YOFA 3BIWA 4OHZA 3BA6A 1ZR4A 1A4IA 2C4VA 5ESRA 3MPUA 3OE7D 1YRQA 3NOVA 1M2VA 4MITA 2DE0X 1WBDA 3DKIA 3BB4A 4L50A 1VPTA 1SBNE 3MHTA 2CUZA 1GDHA 1SKBA 1E4YA 1V26A 3IIEA 4U7WA 1Y7IA 2C2XA 1ECJA 2GBPA 5C34B 3GDWA 3GNQA 1CHNA 2VTKA 1MNAA 2H3HA 2YVAA 2ZVJA 3QKTA 4B7AA 4FGUA 3N9IA 3RU9A 3W77A 1PFWA 4WUVA 5IVHA 4H3VA 2ODPA 1UJBA 5JW6A 3FSJX 4C14A 2HDOA 2VNAA 3IAUA 1QGOA 2P9ZA 2IRWA 3N7UA 5B36A 3HK2A 1C3VA 3GJ7A 5B2FA 5LYJF 5BYKA 1N2XA 1P4HA 4YTEA 3IUNA 1Z68A 1BGXT 3KFXA 2R8PA 4TVSA 4P80A 4MA4A 5T6MA 4Q4LA 4J7AA 4RNCA 3IOMA 4G6ZA 1WHTA 1ODFA 2NO6A 2FW6A 2SKDA 4NI5A 4NDAA 3HY3A 1DHTA 2YHUA 1NIJA 1DIAA 3F8WA 1CUWA 3PNPA 2O0JA 2ZK7A 4ZCSA 4ER7A 3B7PA 3E0QA 1OT3A 1U7OA 1T4BA 3ED5A 3I1FA 2PUJA 1H69A 1IVSA 1CB0A 3L02A 4X20B 2LDBA 3JSAA 1W5EA 1ZGZA 4WCDA 4HMOA 3V5NA 5B4UA 5KOHA 4GL2A 3ZVLA 4PO9A 1S01A 1SOAA 1Y6JA 5MN5A 1HH4A 2CLCX 2ZZNA 3O93A 1ZGAA 5IYZB 1JG3A 1NGSA 1OV6A 1MENA 1SIOA 1ZMOA 2JBWA 5F7XA 3QLUA 4NS1A 4I1VA 2QUHA 1UZUA 4J29A 2CMKA 4ALIA 4DHWA 3NNSA 2RH9B 2QZJA 4E6PA 4YRSA 5GJWC 5I5GA 5JQGB 1D0SA 4Y6PA 2BTQB 1FMCA 1F0PA 3N0WA 4RKRA 2HYIC 1ZJ6A 2HWWA 1PT7A 3RO7A 4B6OA 4OYHA 4C0HA 4HAXA 2G9UA 3K8ZA 4BMDA 1CY1A 4R9NA 5EINA 4GR9A 4HDQB 4QGBA 1SB8A 2OLKA 2PGNA 4QPCA 5F77A 1RP7A 1QF6A 4OEHA 1JDSA 2Q07A 3BZWA 3FYUB 3QF4A 3ZDEA 3W1EA 5B6JA 2IYUA 2CZGA 3C41J 4Z1MA 4BP8A 2H18A 4YK7A 4COKA 1NMEA 4QA9A 2ZXUA 3N70A 2YJGA 3CLRD 3ECAA 3EW7A 5J1TB 1QS0B 4YI5A 3BSFA 1GJRA 1GNQA 2J33A 2PVPA 3MOIA 4ZQGA 3OD1A 4EOGA 2RHHA 3H2HA 1IXKA 1GPWB 2WABA 4U3JB 1NJ5A 3ZNNA 4RTLA 1JIUA 1FDTA 3PGA1 4ASUA 4GSKA 1PQUA 3TW8A 3ZCPA 1E9RA 4GKJB 1VJRA 3QE0A 1V5IA 2DBZA 1DAFA 3F6SA 3WK5A 1ZUWA 4E5NA 5KJ6A 2JI9A 3RTEA 4LSWA 5EOVA 1O97D 5B37A 1GDTA 2I6SA 4UBKA 4UZFA 1DWUA 1FW8A 3G9XA 4OFXA 5DNVA 2RHDA 3NJRA 1QB7A 2QJOA 3UOWA 5ENDA 1K0UA 5JFOA 5K8UA 2QRNA 1AF4A 4CR8A 4PG8A 5KSZA 4UVDA 4AZVA 4BNFA 1CRPA 2FPRA 4EF5A 2O2HA 2VDMB 4UBOA 1KRWA 1H0RA 3E3OA 1VMKA 1EFLA 2YUTA 4XGQA 5LQRA 2CNKA 3KPJA 2RH8A 2UAGA 3D6AA 5IAOA 3O1HB 5IKOA 1Z74A 4OP1A 3V00A 2VTBB 2YOHA 2HRDA 2HZ7A 4Y2QA 4JJGA 4NH4A 1U4NA 3VDQA 3ADOA 1BW9A 1E3IA 2CD7A 2CLLB 2VUUA 3CRVA 2VJYA 1X7XB 5K0NA 3SLKA 5E6SA 4TWBA 4W5OA 1X9IA 3QJGA 1EFKA 4WBNA 3WKEA 4H17A 4N47A 1DKPA 3HFSA 3O3OB 2JH9A 3U31A 3I8XA 1U2GC 1SU6A 1G55A 2KQUA 4OSPA 1DMRA 1QO0A 2Q4EA 3QMPA 1ACMA 4PBTA 4YUVA 2OHJA 4A1OA 4C6HA 4DM4A 4DV7B 1KJIA 4H18A 1LFAA 1YE8A 4EZIA 3AW8A 1UBLS 1TYAE 1WMFA 2LW7A 3CUSA 2HCFA 4IFIA 4RHCA 1CZHA 1VGVA 4YJ2F 1FLNA 1BXRA 4TTVA 3UJDA 3WYDA 3QPAA 4QNNA 4TMWA 1G5FA 3OF3A 1MAWA 1V7PC 2GTIA 5EUQB 3IUBA 5PGMA 4TV8A 4BFSA 2XDQA 5EXPA 4AECA 5A0VA 3AU8A 4RM2A 4Y7CA 3WO1A 1QFJA 2QDKA 5ER6A 2VYND 2QDXA 2BWJA 3U6BA 3R0ZA 2N3ZA 2L17A 1HSOA 4LC9A 5CT9A 5E9WA 5LQAA 2XB2A 2B99A 1POWA 1JPVA 4OXNA 3KPVA 1WUJS 1Y3BE 5K4HA 4D9EA 2ZRBA 1I6MA 2FF7A 3W8FA 2Q4BA 6GPBA 2FMUA 1QQBA 3PNLA 1MB3A 4DLZA 2WD8A 2OO5A 1A9ZA 3Q9UA 2YN0A 3B5JA 3OOWA 3QEMB 4M22A 4TTJA 1W25A 3W7AA 2WVGA 4LZPA 4RHTA 3IIIA 3SX0A 4FONA 3T0FA 2RK3A 4H7DA 3D4OA 1DCTA 1J2YA 2HCBA 4FX2A 4IWYA 2Y6VA 1UBTS 1Q77A 3TTSA 4WFIA 4LQDA 4X8OA 3PZBA 4EW3A 5LIRA 4AJNA 1JQKA 4JXZA 1UM9B 1UXKA 2CB0A 3TSOA 2Z2YA 1RYEA 1JMKC 4KODA 5AVTA 1UPAA 4KXMA 4W5QA 4HNHA 3TPZA 1GUYA 2J41A 1IHPA 1XWWA 3Q2OA 1BMFD 2FJPA 4YY3B 2GGSA 3QV2A 3QPBA 4EBFA 1EDBA 1EGVB 4FB4A 4C6TB 4XUDA 3EX7C 4KACA 3PTLA 4YHHB 5T8KC 3BL5A 3L6UA 4RQBA 1QB8A 1JIJA 1MOPA 4U2DA 5F9FA 2I99A 1PR3A 1VKOA 1ZS9A 1UBHS 1WXEA 2GJSA 4YYZA 2VYVD 3UOAB 3WNZA 5HJ7A 3EVTA 1NU8A 2WIBA 3KSZO 3H3XA 3VI3B 5H5JA 1W75A 3U13A 3AEUB 3VC2A 3ZXSA 1C0PA 4B83A 2ZI6A 1Z0IA 4L8GA 2MSNA 1DKOA 1N7IA 3PQ3A 3BRCA 3T34A 4BFUA 4CV2A 3TPCA 4D3YA 1IVYA 2B21A 2XNSA 1J90A 3L8YA 4QL3A 4Z7NB 3TCNA 2R86A 3B1JA 2Q49A 1RXYA 2R8RA 1Z07A 3SEFA 2HSEA 3U44A 3AVVA 1UAAA 2ENWA 3SMQA 5KNBH 1CR4A 1PYDA 3CB4A 3HLKA 1PO7A 1U3WA 2EKPA 2REBA 2AZTA 2BKLA 2AXNA 1N3YA 4IJUA 4KOEC 4I2VA 1W6RA 3U37A 3USCS 5IJ0A 4DDKA 1HE1C 2FSPA 2MOKA 2VAPA 1TTTA 3WY9A 2Y1OA 1UK7A 4B81A 2Y2VA 1NVDA 2PNJA 2A5LA 1MC5A 3QW4B 1X1AA 4M60A 2WHPA 3TKYA 1H4QA 1TDJA 3A4MA 4F84A 1DV1A 4F9TA 4BYGA 3IS3A 3MW8A 3TW0A 1SVLA 2XYPA 2ZU0C 4TTQA 5ALQA 3IC5A 3O31A 4R51A 1B00A 4L3OA 3MINA 3IUYA 3KVNA 3DS8A 3RK4A 2AD5A 3K9QO 4MQFB 3T38A 1GAJA 1LBQA 2W22A 2XDAA 4N8SA 4MHTA 1QF9A 8ATCA 2O0MA 2QVYX 3ABIA 1N2IA 4KIUA 3DUWA 2RGWA 1IQUA 4LBYA 5L4LA 2HPHA 2WUFA 3MIIA 4NNPA 3VR5D 4ZI3A 2VPIA 4MW1A 1F7UA 2F43A 4N0QA 4QG3A 3H1BA 2Q1XA 4PO1A 3PC3A 4ZRDA 4X65B 1VC2A 4MOWA 1RI5A 3MAJA 1BU8A 3WICA 1J8DA 2GO7A 4KWHA 3C8HA 4XVQA 3QY0A 3ESDA 4ZREA 1ZHOA 4JROA 4K9SA 5I7AA 1KE1A 3UANA 3RC8A 1TKRA 2R7NA 4BN0A 1X0VA 1UPXA 3HXKA 5B1YA 4IDBA 1GPH1 1L4LA 1NVEA 1IH8A 1ZY2A 1M8PA 3L79A 1QZZA 5ALYA 3W2FA 4EHDA 4R9RA 4TL8A 2FFQA 4O4LA 5D84A 3KWFA 4INOA 3TRIA 3H04A 3OCYA 1CVRA 3EFHA 4HZIA 3V97A 1COZA 1P73A 1YRBA 4BE9A 1FVFA 4JUAA 3ZCVA 4DV5B 5EC8A 3TTUA 4ZC1A 5GQSA 1NBMD 1R5NA 3U7GA 3C87A 4ACAA 2OG2A 3BXHA 3I8SA 3NDJA 2FN3A 1AGNA 1C30A 2HKIA 2V59A 2Y0DA 4JL8A 3IODA 5AJWA 1ISGA 4DCNA 5BO5A 3WGYA 3IKTA 1OBCA 3LW8A 3TZQA 4H59A 4LBWA 4LYFA 4E70A 1VIVA 4PX3A 2I03A 3BORA 4RLFA 3UJPA 1YWGO 5SY4A 1Z5UA 3VYVA 4G1FA 4FM9A 1XEXA 2DLNA 2HSZA 2B4TO 4C7BA 4F8EA 1OI2A 2F6RA 4Y98A 3O74A 2IDMA 3C8ZA 4I55A 3R7WB 1Z6XA 3CRRA 5I7UA 1WDMA 2E7ZA 2VN8A 4JEIA 3SYTA 2X1MA 2QRHA 3IJPA 3N58A 4K1LA 4HS9A 4WD3A 3FPSA 4UOQA 1W4ZA 1MH9A 2QWXA 3NWJA 1G3IA 3AJAA 3PC8C 2ROQA 5ITVA 2UUOA 2HQBA 2GM5A 3LI2A 1HDEA 5UKDA 5IVDA 1X13A 1AK2A 1BROA 1FF9A 2I3ZA 3A9WA 5TS3A 4AIIA 1VJ1A 1F17A 1IHDA 2WILA 4FGKA 2ZCJA 3F9RA 5KNDD 1KMHA 1UFVA 2OQVA 3OC6A 4N3CA 1SG6A 4IG9A 1BVUA 1X6VA 5AQ1A 1J2EA 1XKTA 4Y9SA 4YRGA 3KD3A 5FOTA 2FWAA 4TX1A 1Y5IA 1LH0A 4XXHA 5BWBA 5LCXA 1NSFA 2PWYA 2QPTA 1HBJA 2Z58A 1RJ9B 2ATEA 1GL6A 4AKGA 1TQDA 1QPZA 1J2RA 2VOEA 4YJGA 5DHFA 5E7QA 2J87A 5TQ0A 4RVGA 2AA3A 2NNWB 4R1QA 3ZW8A 4B3DA 1KVQA 1A0OA 1A9XB 1GAWA 2H7XA 2FJ0A 5LP1A 1N77A 1Y6ZA 2JGLA 2JEZA 4YROA 1E3LA 1CQWA 1NLFA 2H9YA 2HLHA 4RCZA 4DJTA 5BP7A 4P3PA 3D7NA 3OF5A 4GEGA 4OV6B 2WM8A 3QFSA 4F56A 1DQYA 5DEIA 4CLRB 2Z1NA 1L8LA 4N49A 4Q9LA 4JC5A 16PKA 4K6KA 1O87A 1U0GA 5AW9A 1TF5A 2WF5A 2Z43A 4LV5B 3RJTA 1JN0A 1JJAA 2FLKA 3AQIA 3QG5A 4L5YA 4ALLA 2YBDA 2ZJ5A 3HCWA 3OP1A 2UVPB 4MGYR 4P92A 4QG7A 1UIMA 5FYQA 5KTMA 3EVNA 4LMRA 4PZYA 4UZSA 2GR9A 2MR5A 3L05A 4W9MC 1RLTA 1G291 5CEJA 5ICMA 4D8WA 1NI3A 1TJ4A 2P2CA 4LJ6A 5HZGA 1JDNA 4D41A 1WW2A 2H06A 4BMPB 1FDOA 2PD6A 3VR6H 3TRDA 2EF0A 1ZIDA 3CINA 4MWCA 3U3JA 1JXOA 1ODSA 3AWDA 4MTLA 4MS1A 4QYTA 5DM4A 5LA6A 3JW8A 4URVR 2ZYRA 3B3JA 2ZUVA 4EELA 2QRQA 4JCCA 4NOKA 5K03A 3FRHA 4R0MA 3LKDA 3L7CA 1L5MA 4U9UA 3SGLA 1Z0JA 3ZZMA 1GPMA 2C4MA 3HNOA 1NG1A 1JIKA 2YMMA 3GEMA 3PUIA 4B3BA 3GXBA 3MOGA 1IPFA 2XI4A 2HHHB 3TQIA 5FDFA 5KX5B 1E5LA 3G0HA 4WZBE 4UZEA 4QUGA 1IQ0A 3I8OA 5AK4A 5JH7A 5JAHA 4A0FA 2VDWB 1H8ED 4N6GA 1LWNA 4BZXA 4TV9F 2YWBA 1EE2A 5A5FA 1C8VB 3GFBA 4A5SA 3ABRB 1XRNA 3CMMA 4OLFA 4JJ8A 4WOKA 2AF3C 3SSAA 3HXOA 4J0HA 1SXJB 3HYLA 1PJRA 2B4YA 5AKEA 4Z9YA 3ZVRA 1KOFA 1GCAA 1H9BA 4CNBA 4EUKA 2IIQA 2VNJA 1LF5A 3OG9A 3N5KA 3F6YA 4LI0A 3U3XA 1QGUA 4YV1A 1U7HA 4HLUC 5L6MB 3EVAA 2VIIA 1TEHA 2C95A 4CW7A 1BSVA 1B14A 1G4AE 3KZKA 1WY5A 3UT5A 1GCGA 4OHPA 2QUJA 2PMEA 1FY2A 1K3UB 4BGUA 4D8TA 4EF6A 4QXRA 4YPVA 3GA5A 2CXQA 1A88A 1N5DA 1R9MA 4JI7B 2HLNA 1QG6A 4OGKA 3ILXA 4E33A 1E9AA 2VDUE 3KUKA 3LX8A 2QBYB 1UT8A 2QRKA 2BRUC 4DDMA 4MCJA 1QAQA 4Y2HA 3REOA 5HW0A 4FMCB 4UVHA 4PQYA 2CE2X 2C9DA 2IY7A 4WN9A 1EZ4A 4BO6A 1USUA 2FJUA 1GPKA 3QLTA 3TR6A 1JHPA 1P4RA 3WLRA 1VCNA 5KMGA 3THWB 1SUPA 1I01A 1I14A 3C7CB 4XQGA 4JLBA 2QU7A 3HJAA 1I3KA 5LIPA 4X6YA 2FSFA 1T8WA 2FPLA 3KB6A 4GX0A 4XB2A 3QJYA 5FD8A 2HO5A 2OC4A 4WKOA 1Q6YA 2OEPA 3K8OE 4Z2AA 1X8LA 1HO3A 2NXNA 2CEKA 1NURA 4E0BA 1DI0A 2E1PA 4JU8A 4DMHA 1P9OA 4R16A 4TYPA 4O2LA 3RIEA 3KO8A 3HBNA 1XCBA 3SF0A 2M6KA 1ULAA 6PFKA 5BMVB 2CNLA 1FNMA 2IP1A 2ZI3A 4MKFA 4WQMA 3U4CA 3P9NA 4A82A 5B58C 4TZKA 2XIQA 1K7EB 2JNWA 4MV8A 3U4GA 4XWAA 3L40A 5H9VA 3ECCA 5DM70 3U5ZB 5FOUA 4FGLA 4IF6A 3A6FA 1F1BA 4DC1A 3QSGA 2WPDA 2AEEA 2XWBF 4Z4EA 2XBMA 3UAOA 1TM3E 3JQFA 3EYWA 5CHEA 4G25A 4O1IA 1QIMA 1XMOB 5FIUA 3TW4A 4ICIA 3MTEA 2AC4A 2BFBA 1V3TA 2FPIA 4MLZA 4WNYA 2C97A 4GQIA 1OSNA 1T0HB 1TMGE 1Z56C 3M0EA 4MPTA 4QOHA 2I8AA 5I47A 5T7BA 2XTNA 3B36A 3MPOA 3QIAA 1SHUX 1XBTA 3ZCQA 3GHYA 3BULA 2VBCA 1PTJC 2BGNA 1AS3A 1H2RS 4DZZA 1F8XA 4I1PA 1T2AA 2O8EA 1AN9A 3R74A 4Q05A 2ENUA 1HDXA 1TM4E 4Q4JB 3WDSA 3I5XA 4CN9A 3H5NA 5B3JA 2CCJA 5A0TA 2PTHA 2ETXA 3OIGA 5LWQA 5LWHA 3MS4A 3W5AA 3RKUA 4BMOB 3EEOA 1B8NA 4GRAA 5HK8A 4E46A 2P0AA 4NBUA 2JGEA 3PRKE 5DTIA 2R84A 3CW9A 4MRNA 1M34B 4X8LA 4P3KA 3SQLA 1SU8A 3KT8A 5TE9A 3V80A 1N5JA 4K0RA 2NNLD 3QYPA 2H1RA 1LPAB 3FN4A 1KHTA 4UHBA 4EUSA 4TYYA 4LJAA 1MR3F 2IPNA 2GI4A 3VNRA 4MRPA 1J20A 3PC7A 5GY7A 2R7AA 3UJ9A 1HUQA 1SCUA 4I3GA 1SUFA 3CCBA 4OQPA 4PQEA 5CFZA 4PV7A 1BO6A 1KYZA 1NVWQ 3E9ZA 3KTAA 3RS3A 3RROA 3AERA 4KDRA 4HEA1 1HMPA 2W2PA 1RJWA 1FX1A 4H35A 5F3DA 5J5VA 2VRCD 3RVJA 3X3HA 3L07A 1SXJD 4G1EB 5F1PA 4I81A 4B3IA 3RBZA 3DFMA 4EJFA 3HM2A 1L4UA 1LRJA 1WBBA 4DBLE 4FR0A 2UZIR 1UZNA 4B09A 4XSGA 3UY4A 4AO6A 1F2UA 3EXG2 4FMPA 4YJHB 3I2FA 5LQCA 3VGJA 1GV1A 2V7WA 2XLCA 3HACA 3EEQA 3MLEA 2G07A 5C1IA 5HA5A 1J39A 1P6UA 2R65A 3IUPA 3SC4A 1ECFA 3MWDA 2OXFA 4CLRA 1DLJA 3HR4A 4BHTA 3QVUA 1E61A 2F1JA 5GZ1A 5B30A 1ZNYA 1N6RA 5FWXB 3T1HB 2P77A 1V7ZA 1U0LA 4BLSA 1M54A 2H16A 1A2KC 3O4HA 4V2UA 5J2TA 4MUXA 4KN8A 3IHTA 1QRSA 4KU4A 3PGMA 5E95A 5J58A 4E14A 2NSHA 3D3NA 4GBJA 5DO9A 3GGGA 1CV2A 3B6MA 4QFMA 2X0FA 2XRMA 4V0MA 1PVVA 1N4AA 3I6BA 4MWEA 3H4IA 3ESCA 3C3CA 3GLIB 2F8TA 3L8HA 1JA0A 4D0LB 3I6MA 2FSIA 5EIHA 3VH3A 1J00A 1E3JA 4JKOA 4MQBA 3DV0B 3ZLUA 4Q4HA 4XIIA 4G5QA 3KEMA 3WAJA 5ALRA 1PRYA 4DZTA 5KYUA 3SQWA 3JPYA 1PZFA 3LDFA 4ER6A 4ZO6A 2ZVPX 1R6DA 1QC5A 2DSTA 5C4GB 2AMJA 1T2DA 4B79A 2R751 4RMGA 1REQA 4Q5IA 5L53A 2VKTA 4PNPA 1TQ2A 1GTSA 2AKAB 2ID4A 1JJ7A 1TI7A 2XE6A 2X9VA 2Q5JA 4GH5A 4U2BA 4YCAA 2PEZA 1SXPA 2GJAA 3HRHA 3UJ8A 4KHPB 2R7LA 1QKJA 3RS2A 5CVEA 1SB9A 3TFOA 4IJKA 2YYAA 3FX2A 4DLKA 3AH8A 4O1HA 2GRAA 3AB8A 4H7FA 2XV1A 2JAWA 1MFZA 3I37X 3RC7A 1TUBB 2FWNA 2C2YA 3F5MA 3FPGA 3ZZ0A 5AIBA 4XD7D 3TJMA 4DCUA 4Y1EA 4I1SA 1J0DA 5GJVC 3GVPA 4P6VF 2B8WA 5HIJA 1E0KA 2RBEA 3SC3A 3H1PA 3TR0A 3SAJA 2V7QA 4UNSA 4J1QA 3LKZA 1Q6ZA 3MT9A 5FWAA 4LDPA 3MFYA 3LHKA 3ZGZA 3X1JA 4X1YB 1X2BA 1AXEA 3I9NA 1X8KA 3LNCA 4RH0A 4RYLA 5GINE 2H1IA 2ZJFA 3LGXA 1VMDA 3CT6A 3HLTA 4NG5A 1QJCA 3JQPA 1JZSA 2QD5A 1P7VA 1LC3A 2C9ZA 1F2TB 4UARA 3SZMA 4PPYA 4KO3S 5JIBA 1ZEMA 2VT6A 5KX5F 3RUHA 1E1LA 1OLSB 4KRGA 3BZBA 3CUWA 3E0XA 4WKGA 4G0XA 4NXNB 3VR1A 3V33A 2VDLB 4F92B 3I5MA 1NR7A 1WZCA 3OJLA 1T1RA 2C5LA 3TLCA 1IDOA 2CLOB 3BXGA 2NYVA 2NXWA 1R9GA 3CVJA 1JE0A 2WPNA 3FBTA 1D4ZA 2F3UA 4BRSA 4HGNA 2A4MA 1UKZA 4HEQA 2XCRB 1SK9A 4WEOA 3QVMA 3S1AA 3AONB 1EP1B 1GO2A 4TKVA 1RRPA 3CCCA 1I2DA 1MVNA 1Z5WA 2XVXA 1C1DB 1JPNA 3K2BA 1XNQB 2QUZA 1SUCA 4HBGA 4ZT6A 3TL2A 3H9JA 4C01A 4Z51A 1YFKA 4J0CA 5K0FA 3GD7A 3KEFA 5ARCA 3EXAA 1TU0A 2BEUB 2CF6A 1TU3A 1T9GS 1PEDA 1XG5A 1LUAA 2BISA 2ZULA 1EUCA 3QXXA 4KCGA 2IUSA 2UV8A 1LY1A 1XA4A 3N1UA 1KI2A 1A5TA 3R3UA 1ZA2A 4GMXA 4AO8A 3NW9A 4BNTA 5KSWB 2RHLA 1V1MB 1IWBB 1H94A 1RWXA 5K3BA 4MYTA 1Q0TA 3TSZA 2GA9A 2PU7A 3KKKA 3GAAA 2GD6A 3V4OA 3HVKA 4N5HX 4PLPA 1U0OC 5JCJD 1QH0A 1ZEJA 2XGGA 2YV2A 3ICOA 4HFRA 1YL7A 4CU2A 3IRVA 1YFJA 2UU9B 3G5AA 3H4MA 4KEAA 3GYBA 4OHVA 1LPBB 1PWHA 1Q44A 4B2LA 1KIAA 5JQGF 4Z3OA 1OROA 4QATA 1ISJA 1ZC4A 1ZNXA 4B47A 1GG5A 1Y7LA 3NHYA 1UDRA 1J25A 2UUPA 3UHFA 4MQEA 2DFVA 1EX6A 4I8XA 5M34A 4LTMA 1Y89A 4BLPA 1DEAA 1E1RA 1C3JA 3V9PA 4BOYA 1ESNA 4OI1A 3WOHA 2XOXA 2GHQA 1T9BA 4HNRA 2WLSA 3AG5A 3F98A 4QBIA 3ZPXA 2GJ8A 1P7CA 1PQYA 1X9GA 4JODA 3HJFA 1VJ5A 2A86A 1JYSA 4OHBA 2XA1A 3MWYW 4G86A 3TE7A 1H3FA 1QYVA 4P1ZA 4L16A 4Z4CA 3UV6A 5KZMB 4AKTA 3U19A 2CL7X 4L6CA 3UWPA 1M2JA 3OZBA 2FDCA 4DRXB 1L7NA 2GHTA 2G06A 4JWKA 5H81A 2HF9A 4Y6SA 4AZ0B 4WK0B 2CJFA 5EMLA 5G1NA 3UN1A 3OQ6A 3NRBA 5B58T 3SQXA 2BF7A 5HKLA 2XB6A 1KYTA 4JUFA 3OZDA 1AN0A 2JLZA 2MDTA 2PH5A 5JAZA 4CNQA 2M9MA 3DZCA 5ELLA 3K31A 3QWHA 4AFNA 4Q12A 1OZAA 3PFCA 2RG1A 5G1OA 2IH5A 3R4VA 5SICE 3JD4A 4OHRA 3FNGA 3R3SA 5CGZA 1X1RA 1L5HB 1LNQA 3H18A 1UBJS 4W8OA 4B9AA 3DBHB 4RD0A 5CB4A 1D1PA 1U3DA 2GCOA 3GRAA 4QTZA 2JBHA 2Q99A 1UBSB 4GNKA 3ZY4A 1UKEA 4DNXA 3NT2A 1EVEA 3BEOA 1JHQA 2XVZA 3ZE7A 3DLCA 1TJYA 3K6SA 2BEVA 3SBDA 3BFPA 1LVUA 2FG6C 1X70A 4R69A 3WR5A 2R0QC 4JELA 3Q6MA 5I4CA 2W6JD 4MMXB 5CBPA 1Z4KA 2HQOA 2YR0A 3ISVA 3PKZA 3QKSB 4TUYF 4BKMA 1PR5A 4IUYA 5ALXA 3PVCA 1G17A 1TCUA 4LSGA 2CFRA 5CX1B 3FSGD 3HXLA 1JWBB 1XRJA 2YZNA 3I2GA 4N8EA 4WDQA 1J2UA 3FNQA 4EWLA 4UU0A 3BM5A 1XTZA 4IDGA 1ZVJA 2OR3A 1WXDA 2OZVA 1I0LA 3H5IA 1V7CA 2A1TS 3FWNA 3M83A 4KPUB 3OPXA 5JYDA 2ZVQX 1TYDE 1NVVR 3O84A 1UQTA 2ZS9A 3ZJTA 4X8MA 2XCTB 1NMXA 2R1VB 3A6PC 4C43A 1DQZA 3ZLTA 1IY1A 4EYEA 4DANA 3E22B 4DSZA 5SZJA 4MTCA 3AZQA 5EUBA 2PUFA 1C3EA 3WDLA 3ZXIA 1WB4A 1F9AA 1CUEA 1E63A 2VSQA 1QIGA 2WFZA 2GFQA 5AKYA 4MRVA 3CLRC 2HIGA 4NY1A 3EMVA 4EFDA 1YE3A 1HTWA 4OHCA 2HCRA 1TJ3A 4TROA 5K3AA 3HB4X 3H6HA 1L5VA 3HC7A 1TT5A 4BGDA 3SZRA 2XUPA 3X1YA 1J8FA 1IEXA 5AW0A 4PZAA 1I0ZA 3F6CA 4RD3A 2DPHA 3W7BA 1T2EA 3KQLA 1IMJA 3AVXA 3UXEA 1DQNA 4HWKA 1DG1G 5JXWA 1F6BA 2IU3A 3WGLA 1E7RA 2F9FA 2WC1A 5CLQA 4XOUA 5DTEA 5TMEA 2BH9A 1Y8RA 1RXVA 2A3RA 2APJA 1T4MA 3QM1A 2FPGB 3L7DA 1AHPA 2Q6OA 1XLTC 5LL6P 3IAS1 1QHHA 2WIAA 4AMVA 5AVZA 2PGOA 1U0NA 1AK9A 1MXFA 1XJ0A 3K53A 1FFDA 1R4NA 4KH1A 1W46A 4DLLA 4G0NA 1Q7RA 3MGKA 1GCOA 1DRKA 5AK0A 6YASA 1DC6A 2H5LA 3GB9A 1LDBA 4NWIA 3K9FC 4EDHA 4OLJA 4J76A 2GHRA 4GPEA 5J2UA 4C76A 1OW3B 1PLLA 3ZHXA 2I87A 2GSDA 1QNLA 1SRRA 1IM8A 4X97A 5MGBA 1QANA 3NT4A 1AQUA 5AOVA 2BHRA 4MKXA 1CY2A 1RPZA 1XT6A 4FGSA 5EERA 3H5LA 3VR3A 1GL3A 1FX0B 2IEZA 3VDRA 1UMCA 2JFFA 2XE7A 4NU6A 3DT6A 3GJ5A 4D42A 4B44A 4CKCB 5KTSA 2OHGA 5DV9A 1AKNA 2W93A 1CEYA 3TOSA 4ZCRA 4G1BA 2VQSA 2PZLA 1L5NA 1DOZA 1XHFA 5D3MA 1G8FA 2KLHA 3GELA 4DBZA 4EW2A 1HFWA 3RS9A 1AUQA 3WIDA 5IUNC 2EKDA 3WBJA 1U3VA 2UYGA 1CIPA 2X5KO 2WE8A 2RHTA 4BEWA 4ZYLA 5IMSA 3FYHA 3V34A 1SU7A 2FUEA 3AGPA 3L43A 4PICA 1OF1A 4EFMA 4M54A 2A92A 1K98A 1T2UA 1K7XB 1XD2A 2SCUB 1GNTA 4AN4A 1I4EB 2ZPTX 3MCZA 4JI8B 1FSPA 2CHGA 2QSJA 1EDEA 1EKXA 3ZK7A 1Z0FA 3P4UA 1C1XA 5CR9A 2PLNA 4N3AA 3JQEA 2OK8A 1LS6A 1NBWB 2I2WA 2VL7A 1YZNA 3W34A 1ZGGA 3T15A 5I7FA 4YI3A 2QLBA 1KQOA 4IOKA 4DCMA 2VBGA 4ABYA 3I42A 2GYUA 3R0QA 5U4XA 1V43A 1C7RA 3NWPA 4RIHA 3KR1A 4P4LA 4ZI7A 4NVRA 3IQEA 4FQ7A 5BUQA 3RTGA 4C4SA 4EYQA 1P3DA 1M8GA 1M0SA 1Y1RA 1YQEA 4GLBA 4JLDA 3PC4A 2ID7A 3EAGA 1BX1A 1KYYA 2FI1A 4CKEA 1G5TA 3OO0A 1A72A 3P9IA 3WLPA 3DBOB 4KQ2A 3GT3A 4I50A 1JAYA 4W99A 5EMMA 5C1BA 3LX4A 1IWOA 2AOUA 1JAHA 1B1CA 2VK8A 2X7JA 2Y3IA 3JS5A 5KWIA 4C0XA 4UDNA 4FT4A 3V7FA 4HDNA 1QGED 1NYQA 1Z38A 2JVJA 3A6GA 2JAUA 4EK9A 1ORWA 3FYUC 3RUAA 2EDAA 4F04A 3PGXA 5AJXA 3Q8XB 1RI1A 2RJOA 4L0MA 1BAPA 1G42A 3WZ2A 4YMUA 5G1PA 4ZEMA 1WPXA 2VJKA 2AW5A 1II9A 3GI1A 2H7CA 4L8FA 3NTUA 5K0BA 1ZHHA 3RRMA 1V8BA 1G20A 1NOJA 1RSZA 2Q3EA 1CZOA 3IVGA 3LWNA 3LVQE 4PXSA 2YY6A 4XUGB 2Q0SA 1L3CA 3WLQA 2CLEB 2GAJA 3LSYA 3HJCA 1NF2A 2CNOA 3PGJA 1U28C 1Z29A 3NIBA 3X1ZA 4YT5A 3U9TA 1FTGA 5TB5A 4NOJA 3VO9A 5HIAA 2YCLA 2QTNA 4LK2A 2ADMA 1PW5A 1UOEA 5KAPA 4YAGA 2Z09A 4URXR 3E8SA 2VR1A 6AT1A 1U1DA 4BV8A 4RANA 1K7CA 3G8CA 3R5XA 1KI6A 5FI5A 1I3OA 3CE9A 3JCZA 1JJBA 1NFRA 3W2GA 2ZI4A 4OOFA 5DWDA 3T5TA 1QCZA 5FH9A 5ITZA 2CUNA 1VRVA 2GYVA 2PQ0A 5EJGA 3V46A 5IUJC 1ZOOA 3VNVA 4S0ZA 1YS1X 5TQ2A 1YASA 1QBGA 2ZRQA 1V8FA 1CUDA 3HPRA 4RWEA 4P53A 5EIXA 3C4QA 1P44A 3GFFA 4G1UC 4J3FA 4NFLA 5IAEA 3JZDA 1JH9A 1A96A 4IJMA 3STUA 3G2JA 3QI7A 5I01A 2FP4A 2BBOA 2DQSA 3R9XB 1GQOA 4JA2A 3F67A 4YUYA 1I7SB 2DJ5A 4L76A 4OUDA 5TPWB 5CA0A 2EQ5A 2Z8ZA 1E7YA 1NDHA 1JI0A 2ZRGA 4N7JA 2JLVA 3DEAA 1FYVA 3NUZA 2IX3A 3GDOA 4I7EA 4AQYB 5JS1A 1BVYF 3W3AD 1R6TA 2Q7OE 2YWHA 3GJ4A 4RETA 1DJLA 1P0CA 1JLLB 2FMFA 1OY1A 2P2GA 3SU8A 4U63A 1O5OA 2LWIA 2LE0A 2XW6A 2HZBA 3OEED 2VHCA 3KBBA 1D7OA 4ZAWA 1VE1A 2OV2A 5GV7A 3G3EA 4CQMA 2B83A 3OSZA 4AC9A 2E49A 4IDQA 4IIBA 3C3PA 3AYZB 3E7FA 5H4HA 3OHPA 4ETWA 2X9QA 4INJA 2PKQO 4HK4A 4NPHA 3LS2A 1JHXA 3P9CA 5BXYA 2B1JA 3GZ4A 2WD9A 5CVUA 1A97A 1WCYA 2ZT8A 2CK3D 1DKQA 1YDWA 1Z36A 3I9FA 4HXYA 4EAQA 4EQZA 3CR3C 4IGEA 2H1CA 4UFOA 2RHGB 4ZT3A 1PGQA 3VZQA 4F3YA 4MP3A 4LSMA 3T54A 3V8NA 1YB1A 3N75A 1EUDA 1IHXA 1QUEA 2CDNA 1ZGJA 4YWJA 2H4FA 2IUYA 2VJMA 4FTWA 4P2BA 1ECPA 1DPGA 2AGVA 2HYDA 5CAEB 4EUEA 4PLFA 5HQTA 5KOYA 3GVCA 5M2QA 2FVXA 1NV9A 5A4IS 5TPZD 9MHTA 2C9BA 5LNK6 2WEKA 3NM6B 2HT1A 1NNI1 2E89A 5DSZA 4IWNA 1C4OA 1O0CA 2HRQA 4GLJA 3OTGA 1AOXA 3U2QA 2HMSA 3KVOA 1E4VA 4FYJA 4GWKA 4RE6A 1DTWB 1UBFA 3ICQB 4IKEA 2B20A 5SY6A 4HVLA 2YQ5A 2VJAA 3DD1A 4GC5A 2XUQA 1VFNA 1XUOA 3PS9A 2P30A 3ORSA 5LC1A 1QJ4A 4CETA 2VATA 1XRPA 3R3HA 2FMIA 1JFRA 1LBSA 3H1FA 3R0VA 1KMMA 1JEQA 3LMKA 4QUAA 3NVAA 1MD9A 2AXQA 2Q8PA 5ALTA 1SQ5A 2J30A 1J5PA 1RFGE 5CFMA 2WDZA 4MUIA 2FPUA 3MQ4A 4C0AC 1X80A 3ZQKA 5BNIA 3ESAA 2REQB 4IXDA 1F1JA 5K3EA 3C8MA 1FXSA 4L2IA 3UW3A 3WMEA 3FF1A 4BTVA 1A8UA 4DG8A 2CVQA 4BFZA 2QMYA 4TWRA 4F3KA 4CHTA 1LRKA 3CNQS 2CHFA 1MEEA 2PH7A 4W1SA 4CLEA 1WP9A 5A06A 4WZAA 5KYXA 1DC3A 1Z5VA 5KQGA 1RPAA 3KZCA 4IRXA 4JSRA 4Z9XA 4KKVA 1PGJA 1Q20A 1RHQA 1YAJA 2ZT6A 3VU3A 3IUEA 3LFTA 3CW8X 5DT9A 4E31A 5CDUA 5E4JA 1B1AA 1J9GA 3C45A 4REQB 4XX0A 4FIZA 3L7OA 4X41A 3D0RA 5IULC 3N7AA 1A69A 3DMFA 2P3LA 1OXMA 1TA4A 1HE2A 2JFXA 2QX9A 3AWIA 2WJHA 3PDWA 3AF3A 4UEJA 4JOBA 4URFA 4X7PA 2HIMA 4HNTA 4WT7A 3NNNA 1W49A 3GRVA 4ZAGA 1G59A 3M6WA 3PHHA 2B3DA 1GG9A 1D04A 1CQZA 1E99A 1Z8FA 1HZZA 1PFYA 1WMDA 3DCJA 4IHJB 4QUEA 4BLOA 5T57A 5ALVA 4UBLA 4II3A 4CCSA 2WHQA 4EI8A 4MAMA 821PA 3EIFA 4PCVA 1Y1TA 3JAWA 4BX9A 2G4LA 1UEXC 1E5DA 2GM9A 8ABPA 5AW7A 2HJWA 3BIJA 2Z2IA 5ELMA 4YAJA 1SAYA 3AHEA 3ND9A 5HQ3A 2CCKA 2HLDD 1G2OA 1SZJG 4IO1A 5CEFA 2YWCA 4KRYA 4XLTA 3NYIA 3PRHA 4X95A 1H3EA 3EA5A 5ILQA 1Z16A 4PLWA 4HTAA 4ZN6A 2EP5A 4H0FA 4EYGA 1FFHA 2IW3A 2RC6A 3K0CC 3EPRA 3G1TA 4OQXA 3FCAA 1A50B 3PCXA 5EG5A 1Z4QA 2Y0PA 1I6LA 1JR4A 2G9NA 1HA3A 1MAVA 3EY4A 1KH3A 2PX0A 2YJ5A 4GX1A 4LDZA 4RPLA 4C4YA 1E2GA 3K4HA 1E2NA 5IVPA 5JPDA 5H70A 3PXGA 2WG1A 1DL5A 2FKAA 1HL3A 1D5WA 1P0MA 2VI5A 3CKLA 4DG5A 1C3XA 4AX4A 1RZRA 1ZQ9A 4I36A 3ZJYA 6REQA 3G2KA 4YDRA 4O1MA 3PUXA 4B84A 4LDJA 4ZVMA 1Q7BA 2HHAA 4C4XA 3E3AA 4EJSB 3QIVA 1K6EA 2D1FA 4W4TA 3BF7A 3CEHA 1PQ4A 2WYIA 3L6CA 1LPPA 2F3QA 5DHQA 5K3FA 1XZAA 4DVJA 1AGXA 1VHTA 5CTAA 5DYNA 5THXA 5CDGA 1XQXA 1XYVA 4V1CB 1T24A 3KRTA 5HFAA 5H9WA 3GRCA 3PEYA 3BB1A 1U2EA 2AMFA 4C7KA 4OI4A 2IF0A 3MMXA 2VPPA 4GPBA 3MZ0A 1GILA 3CEJA 2DWPA 4BUJA 1OLUA 4KGZA 3GLHB 3U40A 4KHZA 3VGPA 2BFCB 3HUEA 3W79A 3CVOA 4DGQA 1TNDA 2ONCA 1HC7A 4PTZA 2E85A 4JLUA 2I4NA 4KH0A 4W6QA 3M89A 3O75A 3SNHA 1J9EA 1A4XA 1M1YA 4FIDA 3KQHA 3PXAA 1QZTA 3BH6A 4HB2A 3NETA 2ESRA 2G9ZA 3IVAA 1HYGA 4A16A 4QGAA 5IWCA 2C88A 5JARA 1OXUA 3K0KA 3UMJA 4DCGA 1O1YA 2D62A 2B9EA 3L2OB 4WXPA 5ISMA 1IFXA 3C5CA 2GBIA 1L7DA 1ZLXA 1PW7A 1YQGA 1WNFA 1Z88A 2PEYA 4NBRA 3GP8A 1MOZA 1FP7A 3IUQA 4HO1X 4J16A 4NMWA 3U4DA 2YXNA 3DGFC 4EVSA 3ZWWA 5LZ7A 1PV1A 1V96A 4MUBA 3NVMB 5EE5B 1CQPA 3BWDD 4ZAYA 1ZQ1A 2RGCA 5LOVB 1UEJA 3DAOA 4QYWA 4RS3A 5E0OA 1BH2A 1WZEA 5F2EA 4HI0E 1ZOSA 1WAMA 4RCVA 1JAIA 3WRYC 5C3UA 1XCLA 2GZSA 4N76A 2WAOA 5HGJA 4PLCA 1RYZA 1VIDA 5EQFA 3VVLA 1AQNA 3OURA 4Y1FA 3AXSA 2CXSA 3LHFA 4FCCA 3A05A 3WGZA 3QKWA 2ODEA 1ISSA 1T5SA 3RFVA 4IVQA 3I28A 3O8CA 5KC8A 3SFTA 3KEOA 3ADCA 4AYXA 2GCNA 1T91A 5JVDB 4BXOB 1LWOA 2EFEB 3N28A 4RABA 3TQHA 3PNKA 1TFRA 3EGOA 2CLMB 4JCOA 3TWOA 3H8JA 1U7PA 4BN4A 1VA4A 4AMZA 1ONSA 3BS4A 2B69A 3BMNB 3DA8A 1PG2A 3L92A 2J6IA 4Q48A 2PYZA 2VT3A 1LKZA 1M76A 1VLJA 1WD5A 4ZVNA 3MMSA 4YV0A 3RAGA 3ENWA 3OTIA 3LPDA 3PQ5A 1O5TA 4PVCA 2DRIA 5LDGA 1GGVA 3G9TA 4KR3A 2AG8A 2OB2A 3VX4A 5HS4A 3ORFA 2F62A 4EAAA 3WP0A 2B8EA 2O59A 1FXWA 4K9QA 1TM7E 3LP6A 2FTKE 3P2KA 4IIUA 3SJ7A 1A2OA 5BWNA 4UD6A 3UCXA 1WSWA 3WAKA 4LJYA 1U1FA 3OX4A 3C97A 1JUDA 3EIEA 1WB5A 3K2QA 2HDHA 1NONA 1P1IA 1AQYA 3N86A 1WKBA 5HIIA 2R1ZA 2Z08A 5IKXA 1QH8B 2AWNA 3ZG6A 1BDIA 5IANA 2O6LA 3N8NA 2ISCA 4P86A 4RF4A 3KOMA 2ZGVA 3GEPA 3CLSD 2ZB4A 2O9JA 3FIUA 3I2JA 2FRXA 2YJ4A 1QR2A 2PZGA 1XA3A 4ZT2A 1Q0RA 3FPJA 1P91A 4UHKA 4WKNA 4ALMA 3B89A 1SXJC 2PNFA 3JASA 2W6ID 1XF1A 3SZUA 3DVAA 3UM9A 7REQB 1KOGA 3IXMA 5DLQC 1I10A 1MA3A 2HH9A 1MRNA 1OH5A 4IQ0A 4RC9A 2FSVC 1O94A 2D3TA 2QIOA 3CTPA 5I48A 3DXXA 3AKZA 5ELXA 1AV6A 3WK7A 4K3UA 4LOJA 4MA5A 4HWGA 1USIA 4BVAA 5IKPA 1UQRA 1Y5MA 2QW8A 1V4BA 3KR2A 4JI5B 2GLUA 2ZB2A 4IOLA 4H7KA 2GO1A 4TTAA 3AEXA 1UJ2A 3SF8A 3WGMA 2O05A 4IV0A 4QGHA 1ZN9A 3UA4A 5G2OA 5DTQA 4DIKA 4BFXA 3V4FA 4ZA2A 2YNMA 1M2GA 2FN4A 5JZOA 2ZATA 4EGAA 2Q27A 2DY0A 1R74A 3Q0EA 4J0KA 3O9MA 2H5JA 3TXYA 1U5AA 2QGNA 5JWHA 4K6MA 5IC5A 4LXUA 3G5UA 2GKGA 5K0SA 1T8SA 1DFIA 2C3OA 2YN2A 3E3LA 3PVZA 4LUCA 1WZNA 3WV4A 1G3QA 1IBCA 1H8HA 1UXGA 5J5AA 4AMGA 4RTKA 3EIHA 5H8WA 3QVWA 1ANKA 3N2KA 2ZU6A 5B3AA 3EGVA 5IN5A 5A1JA 2HA5A 5KDLA 4OO3A 1Z34A 2Y93A 3AHCA 3TTWA 1DXYA 1FDSA 2ILVA 3ACBA 4QOGA 5ALJA 3W1VA 1CJMA 4KFSA 1WSBA 2YYYA 3VHLB 2P9FA 2XXAB 1SQSA 2NUBA 2AHOA 3E9NA 4KQGA 2GPTA 4CVNA 4RLQA 4UNRA 3U7JA 4CUZA 1MOSA 4JXKA 2BCJQ 4DC0A 2Q4OA 4TMVA 3EAQA 3D7MA 2R00A 2YJ6A 2XRYA 3F1KA 3GZTB 4IHJF 3UPDA 4ECAA 5HNKA 1RKUA 3ZV5A 2HRBA 1U0RA 2P5SA 1NN5A 1TKCA 2DJIA 3KYCB 2VFAA 3SQMA 2C07A 4UXIA 5KKAA 4U1RA 1Y4ZA 5FLYA 3FNIA 1WOYA 3MT8A 3C98A 3VYUB 3EG9B 1E1CB 1YRYE 3JQAD 2OCLA 4L8VA 3UATA 2CBZA 3Q7SA 3ZKWB 4EGJA 1F8FA 1OUMA 4L27A 3FDIA 2BFEA 1DRUA 2ZE5A 3ANMA 3HGMA 4PSDA 3T7EA 4PQRA 3R9IA 4MQ6A 1SUBA 3WQQA 2X4LA 4ETMA 1IB6A 4IDPA 2BFDB 1E2DA 1YBVA 1QHEA 3IKLA 3QFCA 1IXSB 1QQ6A 2J0UB 3NC1C 3N05A 4DT1B 2I3BA 2NZXA 2Q1SA 4PIMA 3ANLA 4P3XA 4G1CA 2EBFX 3CPEA 3HCEA 4GYWA 1FQKA 1NFQA 3OTQA 4WTOA 3DZJA 2XTAA 2C5AA 3L8ZA 4P5DA 4IX1A 3QK7A 5DCWA 3IXQA 1PT8A 2DBRA 3N74A 2QG4A 2A2ZA 4KZKA 1BWQA 3DPIA 5AK3A 1PZNA 4P54A 4F0JA 3BXPA 4P5PA 1ZXXA 2X3FA 2L82A 4W5JA 1WV1A 2D7DA 2Z6UA 1PHRA 3ZHYA 1LI7A 4II2A 2EWMA 4UULA 1YB2A 1XP8A 4HAIA 1RM3A 3BMQB 3L5OA 3N07A 3C85A 3WZMA 2HNKA 1QCDA 3O8OB 5HIKA 3OCWA 1JF8A 4G5YA 1LK7A 5KWVA 1RAFA 3K7EA 1GTL1 3SIWA 3Q1KA 3F2VA 3OKPA 2H48A 3RVOA 1QDUA 5EE0A 5AVXA 4MJ7A 1NVUQ 1G5IA 3WFIA 2WK1A 1J23A 1QP4A 2ZIXA 4WV3A 2EKZA 5MHTA 4IVPA 2DHQA 3N2EA 1G0NA 4DIFA 2HBQA 1I9CA 3L01A 1VJDA 2X2OA 1G38A 4CDNA 2IZ0A 2I4RA 1DRWA 2QLNA 3IV7A 3HEAA 1WSDA 2PKQP 3WXBA 2J9FA 1UINA 3GBVA 4G5SA 4Q9NA 4F4FA 5FUBA 2GS9A 5EIFA 2EF1A 2YASA 2C0PA 2EQBA 4PN3A 1R0RE 4OXQA 2XYRA 4JBIA 3GA7A 3NWOA 2FZGA 1RWNA 2C8JA 2R44A 4Q0MA 3M1IA 4ARZB 3ZLBA 5IBCA 5G0VA 1B3BA 3KM0A 4AZWA 3KYJB 3WLFA 1M2WA 2W70A 2RFLA 4X93A 2C4NA 4P4UA 1FP4A 3IDOA 3L7YA 4PU0A 3AI7A 2D1SA 4WGGA 1C41A 4IIEA 4N0PA 4UTPA 3R7NA 2Q46A 1JDVA 4ZKDA 1JR3D 1TMOA 3KHUA 3QFTA 4Y3UA 3AVYA 4D3SA 4BKRA 1YQDA 4BMXA 4R3UC 1RRKA 4WK2B 1Y9AA 4O4JB 5G0SA 4A8JB 1I4TD 2FEWB 4FDMA 4DA4A 4J8PA 2BE7A 5LOVF 4WXYB 1E5TA 3FTQA 3T4UA 4X0EA 3OU7A 2PT9A 1IULA 1LSSA 2WA1A 1BEEA 4G85A 4RNDB 5CFOA 5K3OA 3NIWA 4WLOA 2DR0A 4FFWA 5BSFA 5KSYA 1QIJA 4LZJA 4FYWA 4BU0A 1ZBQA 1NM5A 2VXYA 2X7XA 3ESYA 5B64A 7MHTA 1TLTA 2AWOA 3SYNA 3CTMA 1WUIS 3AOEC 3VO8A 2OAGA 3JR3A 1WNTA 3TDNA 1RQLA 4ZHQF 3VISA 1GL9B 4YT8A 1B8UA 4BVHA 1YBFA 1Z39A 2E5FA 4HLDA 5FTKA 1JRLA 4WNCA 5BOSA 3F7TA 5JBIA 4TT3D 5C80A 3AY0A 3D7LA 1B76A 4ZIRA 1A8QA 2DU8A 3Q3GE 2WI8A 3JQGA 2WP0A 4JSTA 2Z5LA 4RVUA 1SBCA 4RK7A 1XP5A 5A4KA 3AM1A 1JDZA 2HBYA 2Q3CA 3BWVA 3LP8A 1XMPA 3SLRA 2A6PA 1MIHA 3JX9A 5CJJA 2C77A 2Y6UA 5C51B 3Q87B 1TPZA 2CY0A 2FMKA 5DN6A 3LT1A 4FZVA 2M98A 2CNWD 1SY7A 2VRWA 3LTEA 4CMCA 4CUKA 4EMSA 2C5SA 1OYWA 3E27A 1HDYA 2QHXA 3IAM6 2G28A 2IHVA 1E66A 3NXSA 1JTFA 2QN9A 2PMBA 4WL0A 2MIIA 1PT9A 2XKJE 5GMOA 3VQTA 4RFSA 3H9QA 3UFXB 2W43A 1K4YA 4CF5A 3ETNA 4GM1A 4RZXA 1MGOA 4QFDA 1DG3A 3NUGA 4X6LA 2GN1A 2X1LA 1U0HC 2ZW9A 2DKOA 2C96A 2JH3A 4CBVA 4XM2A 4AF8A 1NZFA 2H4WA 3AR2A 3TE6A 1FDRA 1GPUA 3MJVA 1E6KA 5FYDA 1WXQA 3KHSA 1LLQA 2RKBA 2QD3A 1SKQA 4Q1BA 1ZW6A 1JDTA 1CB7A 4G65A 4B17A 2HRCA 1ONPA 4PYKA 3LQ2A 2DUMA 3DAFA 3DB2A 4HHEA 4NE9A 1KQNA 4A92A 3T5AA 2PA3A 3UJ6A 3L4SO 4ITVA 5PNTA 3TLXA 4M0DA 2DX7A 4EY3A 1FSZA 1P77A 4MIKA 2GK7A 1SIUA 3NHUA 3UGJA 1SJ9A 2WWFA 4LDRA 1BCRA 5CW1A 5HF6A 4B7CA 4ZVKA 2MMCA 2Q9BA 2HF2A 4BLTA 1XWFA 5EIEA 1DAEA 1W35A 3MGBA 3MOSA 5CCEA 1TRHA 3PFFA 1PBTA 1ZH2A 2CNNA 1MJGA 3LZ6A 5FPTA 5K0JA 1G4HA 2IXBA 4L02A 4LGVA 1AKMA 4AKEA 1DMSA 1P18A 1SOMA 1U4OA 2MYTA 3CA8A 1JVSA 1QQ7A 3U60B 3HYTA 4ZOEA 1N9KA 2FQWA 4UE6A 2CLFB 2BMEA 2I9PA 3NHBA 2CFIA 4YMWA 3LT0A 2BFFA 2Q6TA 2X41A 3FFBA 3OPVA 3R3XA 4RZQA 4TKZA 4UE2A 2HU2A 3DQQA 1E3EA 3F47A 3KSBC 2F48A 4D97A 4IIHA 4RH3A 1MFPA 4J0IA 2YHIA 4INZA 1WU8A 1V71A 3KQSA 4PFQA 3VO2A 1PR4A 4ZPJA 1Z13A 2PKWA 1U2DC 2BJWA 3QJ5A 4FYXA 4B7XA 2YWFA 5EPEA 4PYOA 5F4ZA 3CG4A 5K7SA 1YQTA 4FMDF 3I6QA 1PJBA 2XTMA 2W8BB 4AWBA 1KJYA 4PSVA 2Q62A 3DMGA 1W0KA 2B5WA 5LB4A 5L9AA 3AF2A 2BDUA 1UJ4A 3RRFA 4C7OB 3O4VA 3CVYA 5LQJA 4N5DA 5DNWA 5EIBC 4WLEA 4A23A 2QAGB 1PX0A 2XNDD 1M8KA 2PJDA 1W29A 2D2EA 3GT0A 3HKBB 2PL1A 3O73A 2NU8A 3ZWKA 1QRTA 2I4LA 5M04A 3U7HB 2RHCA 4P32A 2NTEA 4CT0A 3AUFA 2CKDA 3NU1A 4DJEC 2ZUEA 3A4IA 3C15C 3Q7EA 5U1PA 2C3MA 2QLFA 3P26A 4RVCA 3HRKA 5AHXA 4DCSA 2V8OA 4DABA 3B9BA 4JD5A 5IN4A 4HXFB 2IP4A 1OWNA 4XJTA 4KPGA 4NZ9A 5DI9A 4CLDA 2I1VB 2I2CA 3G0DA 2GF9A 4JC8A 2GAIA 2GN9A 3O3NB 4N39A 3W5IA 2KW5A 2R1TB 3KOXA 4TMYA 2JJQA 1SELA 4F96A 3INYA 2C7QA 4W5HA 2JBAA 2JGAA 4EMUA 4TS1A 2G88A 3PR2B 4JGIA 4UM9B 1GD1O 2GBFA 1KU0A 3QWIA 1R12A 4CM8A 3OEHD 3D8TA 4RA6A 2VAWA 1T25A 3EDRA 1U1EA 3S4YA 1OWMA 3FH0A 1ZX1A 3ASZA 4HZUA 1ZH0A 2WSSA 3HSSA 4X90A 3WLJA 3JALA 4YIHA 5GZ3A 1CERA 5CG1A 3K9LA 3P9YA 3D8UA 3E3NA 3IT2A 4CIYA 2AJBA 4HDRB 4LZAA 4PG5A 5A7GA 3CVXA 1ENZA 3JQ8B 2XLBA 2RKOA 5ARDA 2TMGA 4PYIA 1F14A 5HRAA 4NCAA 2XWSA 2OCDA 4IV5A 2C5GA 4L5CA 1S2GA 4CTJA 2C1EA 8LDHA 3GLHE 5GAJA 3BA1A 4C4OA 4EY6A 3M49A 1W5BA 2EARA 4C7JA 1X14A 1UWCA 4MVJF 3VR4D 2D2XA 3SVTA 2W2MA 4DMLA 4AUNA 2QE7D 4UTOA 3G49A 3WYFA 1X86B 4TLAA 2BM8A 1HK7A 2P9EA 3H8SA 3EDQA 3EG5A 3G2LA 4DL9A 2QRVA 3ZJUA 3I12A 2JFYA 4BP3A 1KXZA 4F4UA 1LNZA 2AJ8A 4AZTA 5A4MS 5LKAA 5GIOE 1MJNA 1QE0A 1XEFA 2L18A 2D2FA 2UZ1B 3RYHA 3BGOS 3WLEA 3H42B 3T1YB 1OXTA 2QIPA 2J85A 1GKLA 3TRHA 1WUHS 3MRXA 4RZSA 3A6KA 4W7HA 4ZC8A 3RVQA 1HTBA 4PGHA 1OX4B 1IN7A 1CBUA 5JZMA 2VA8A 2XQKA 1IUPA 4KX3A 3WJAA 3RODA 3C5WP 5FNVF 3OUTA 4DTIA 3X44A 2RCYA 1Y4AE 5SV2A 4TVKA 2J31A 1OC4A 2ABWA 1YC5A 3B3GA 3G2MA 4N6OA 3ZHRA 1SCQA 4RPCA 2YVUA 4R8LA 3EIXA 5EKUA 2RK6A 3FZQA 4N6NA 4II7A