1K2MA

Solution structure of the fha2 domain of rad53 complexed with a phosphotyrosyl peptide derived from rad9
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
158
structure length
158
Chain Sequence
GNGRFLTLKPLPDSIIQESLEIQQGVNPFFIGRSEDCNCKIEDNRLSRVHCFIFKKRHAVGKSMYESPAQGLDDIWYCHTGTNVSYLNNNRMIQGTKFLLQDGDEIKIIWDKNNKFVIGFKVEINDTTGLFNEGLGMLQEQRVVLKQTAEEKDLVKKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Solution structure of the yeast Rad53 FHA2 complexed with a phosphothreonine peptide pTXXL: comparison with the structures of FHA2-pYXL and FHA1-pTXXD complexes.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Transferase
molecule keywords Protein Kinase SPK1
total genus 24
structure length 158
sequence length 158
ec nomenclature ec 2.7.12.1: Dual-specificity kinase.
pdb deposition date 2001-09-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00498 FHA FHA domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.200.20 Mainly Beta Sandwich Tumour Suppressor Smad4 Tumour Suppressor Smad4 1k2mA00
2A0TA 1LGQA 2BRFA 1GXCA 3VA1A 1J4KA 1UJXA 1R21A 4A0EA 1J4LA 2JPEA 2KFUA 3HUEA 1G3GA 2EH0A 1J4QA 3GQSA 2G1LA 3ELVA 3I6WA 3I6UA 1K3JA 3MDBA 5A8IA 1YJMA 2LC1A 2KB4A 3I0MA 3PO8A 3KT9A 4JONA 5E50A 1QU5A 3OUNA 4D9VA 3POAA 1J4PA 2FF4A 3HX1A 1G6GA 3I0NA 3ELSA 2JQLA 1K2NA 4G2SA 4EJQA 3UV0A 2XT9B 3UOTA 1K3NA 3VA4A 1K3QA 2W3OA 1DMZA 2JQIA 2PIEA 2KKLA 3UN0A 4H87A 5DJOA 3UMZA 3UNNA 4EGXA 2AFFA 3VPYA 1MZKA 1UHTA 1YJ5C 1LGPA 1J4OA 2JQJA 1K2MA 2KB3A 4QCJA 2CSWA 3UNMA 1FHQA 3FM8A 1WLNA 1WV3A 2FEZA 3HUFA 2JKDA 1FHRA
chains in the Genus database with same CATH superfamily
3V80A 3V8NA 3VA1A 1J4KA 5EJHA 3V8PA 5JELA 5JEKA 2JPEA 5DHUA 1G3GA 5JEJA 2QVLA 3AFOA 4V24A 5DHPA 1K3JA 1J2FA 1KHXA 4WERA 2BONA 3PO8A 2I2FA 2XXSA 5A8IA 4JONA 3OUNA 4D9VA 1DEVA 4DY6A 3POAA 2JGRA 1Z0ZA 5DHQA 3HX1A 4JIWD 3ELSA 5DHTA 1K2NA 4G2SA 3UOTA 5JEMA 3VA4A 3DSHA 1DMZA 2Q5FA 2KKLA 4R9PA 4H87A 3UMZA 5EJFA 4JIVD 1MZKA 1LGPA 1J4OA 1UHTA 1YGSA 1U7VB 1WV3A 4HAOA 1SUWA 3V7WA 1GXCA 2QV7A 4A0EA 2I1WA 2EH0A 3S40A 1J4QA 3GQSA 2I29A 3I6UA 3GMJA 1YJMA 2KB4A 1U0TA 3I0MA 2I2AA 1J4PA 1G6GA 4WRRA 3V7UA 3UV0A 1K3QA 1K3NA 2JQIA 3UN0A 5DJOA 1KHUA 1K2MA 1FHQA 5C4VA 1WLNA 3VZDA 3DITA 2A0TA 5DHSA 1DD1A 5BVIA 1R21A 3T5PA 1MK2A 1J4LA 3HUEA 5JERA 1YT5A 2G1LA 3ELVA 3I6WA 3V7YA 3MDBA 5EJIA 5E50A 3A77A 5JEOA 1U7FB 2JQLA 5DHRA 3V8QA 4EJQA 2W3OA 2PIEA 1MR1A 1Y3HA 3UNNA 2AFFA 3VPYA 1U7FA 2JQJA 1YJ5C 1Y3IA 3FM8A 2FEZA 1MJSA 4L02A 2JKDA 4A4YA 3PFNA 1LGQA 2BRFA 1UJXA 2KFUA 3V8RA 1Z0SA 2I2DA 3UNMA 2LC1A 3VZBA 3KT9A 1QU5A 2I2BA 4KU0D 1U7VA 2I2CA 2FF4A 3I0NA 2P1RA 2XT9B 1Z0UA 3VZCA 1ZOQA 2AN1A 1U0RA 4EGXA 3V8MA 5EJGA 2KB3A 4QCJA 2CSWA 1QWTA 1G88A 3HUFA 1FHRA
chains in the Genus database with same CATH topology
3VA1A 1J4KA 5JELA 5JEKA 2JPEA 1G3GA 5JEJA 2QVLA 4V24A 1K3JA 1J2FA 1KHXA 4WERA 2BONA 3PO8A 5A8IA 2XXSA 4JONA 3OUNA 4D9VA 1DEVA 3POAA 2JGRA 3HX1A 4JIWD 3ELSA 1K2NA 4G2SA 3UOTA 5JEMA 3VA4A 3DSHA 1DMZA 2KKLA 4R9PA 4H87A 3UMZA 4JIVD 1MZKA 1LGPA 1J4OA 1UHTA 1YGSA 1U7VB 1WV3A 1GXCA 2QV7A 4A0EA 2EH0A 3S40A 1J4QA 3GQSA 3I6UA 3GMJA 1YJMA 2KB4A 3I0MA 1J4PA 1G6GA 4WRRA 3UV0A 1K3QA 1K3NA 2JQIA 3UN0A 5DJOA 1KHUA 1K2MA 1FHQA 5C4VA 1WLNA 3VZDA 3DITA 2A0TA 1DD1A 5BVIA 1R21A 3T5PA 1MK2A 1J4LA 3HUEA 5JERA 2G1LA 3ELVA 3I6WA 3MDBA 5E50A 3A77A 5JEOA 1U7FB 2JQLA 4EJQA 2W3OA 2PIEA 1MR1A 3UNNA 2AFFA 3VPYA 1U7FA 2JQJA 1YJ5C 3FM8A 2FEZA 1MJSA 4L02A 2JKDA 4A4YA 1LGQA 2BRFA 1UJXA 2KFUA 3UNMA 2LC1A 3VZBA 3KT9A 1QU5A 4KU0D 1U7VA 2FF4A 3I0NA 2P1RA 2XT9B 3VZCA 1ZOQA 4EGXA 2KB3A 4QCJA 2CSWA 1QWTA 1G88A 3HUFA 1FHRA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2A0T A;  1LGQ A;  2BRF A;  1GXC A;  3VA1 A;  1J4K A;  1UJX A;  1R21 A;  4A0E A;  1J4L A;  2JPE A;  2KFU A;  3HUE A;  1G3G A;  2EH0 A;  1J4Q A;  3GQS A;  2G1L A;  3ELV A;  3I6W A;  3I6U A;  1K3J A;  3MDB A;  5A8I A;  1YJM A;  2LC1 A;  2KB4 A;  3I0M A;  3PO8 A;  3KT9 A;  4JON A;  5E50 A;  1QU5 A;  3OUN A;  4D9V A;  3POA A;  1J4P A;  2FF4 A;  3HX1 A;  1G6G A;  3I0N A;  3ELS A;  2JQL A;  1K2N A;  4G2S A;  4EJQ A;  3UV0 A;  2XT9 B;  3UOT A;  1K3N A;  3VA4 A;  1K3Q A;  2W3O A;  1DMZ A;  2JQI A;  2PIE A;  2KKL A;  3UN0 A;  4H87 A;  5DJO A;  3UMZ A;  3UNN A;  4EGX A;  2AFF A;  3VPY A;  1MZK A;  1UHT A;  1YJ5 C;  1LGP A;  1J4O A;  2JQJ A;  1K2M A;  2KB3 A;  4QCJ A;  2CSW A;  3UNM A;  1FHQ A;  3FM8 A;  1WLN A;  1WV3 A;  2FEZ A;  3HUF A;  2JKD A;  1FHR A; 
#chains in the Genus database with same CATH topology
 3V80 A;  3V8N A;  3VA1 A;  1J4K A;  5EJH A;  3V8P A;  5JEL A;  5JEK A;  2JPE A;  5DHU A;  1G3G A;  5JEJ A;  2QVL A;  3AFO A;  4V24 A;  5DHP A;  1K3J A;  1J2F A;  1KHX A;  4WER A;  2BON A;  3PO8 A;  2I2F A;  2XXS A;  5A8I A;  4JON A;  3OUN A;  4D9V A;  1DEV A;  4DY6 A;  3POA A;  2JGR A;  1Z0Z A;  5DHQ A;  3HX1 A;  4JIW D;  3ELS A;  5DHT A;  1K2N A;  4G2S A;  3UOT A;  5JEM A;  3VA4 A;  3DSH A;  1DMZ A;  2Q5F A;  2KKL A;  4R9P A;  4H87 A;  3UMZ A;  5EJF A;  4JIV D;  1MZK A;  1LGP A;  1J4O A;  1UHT A;  1YGS A;  1U7V B;  1WV3 A;  4HAO A;  1SUW A;  3V7W A;  1GXC A;  2QV7 A;  4A0E A;  2I1W A;  2EH0 A;  3S40 A;  1J4Q A;  3GQS A;  2I29 A;  3I6U A;  3GMJ A;  1YJM A;  2KB4 A;  1U0T A;  3I0M A;  2I2A A;  1J4P A;  1G6G A;  4WRR A;  3V7U A;  3UV0 A;  1K3Q A;  1K3N A;  2JQI A;  3UN0 A;  5DJO A;  1KHU A;  1K2M A;  1FHQ A;  5C4V A;  1WLN A;  3VZD A;  3DIT A;  2A0T A;  5DHS A;  1DD1 A;  5BVI A;  1R21 A;  3T5P A;  1MK2 A;  1J4L A;  3HUE A;  5JER A;  1YT5 A;  2G1L A;  3ELV A;  3I6W A;  3V7Y A;  3MDB A;  5EJI A;  5E50 A;  3A77 A;  5JEO A;  1U7F B;  2JQL A;  5DHR A;  3V8Q A;  4EJQ A;  2W3O A;  2PIE A;  1MR1 A;  1Y3H A;  3UNN A;  2AFF A;  3VPY A;  1U7F A;  2JQJ A;  1YJ5 C;  1Y3I A;  3FM8 A;  2FEZ A;  1MJS A;  4L02 A;  2JKD A;  4A4Y A;  3PFN A;  1LGQ A;  2BRF A;  1UJX A;  2KFU A;  3V8R A;  1Z0S A;  2I2D A;  3UNM A;  2LC1 A;  3VZB A;  3KT9 A;  1QU5 A;  2I2B A;  4KU0 D;  1U7V A;  2I2C A;  2FF4 A;  3I0N A;  2P1R A;  2XT9 B;  1Z0U A;  3VZC A;  1ZOQ A;  2AN1 A;  1U0R A;  4EGX A;  3V8M A;  5EJG A;  2KB3 A;  4QCJ A;  2CSW A;  1QWT A;  1G88 A;  3HUF A;  1FHR A; 
#chains in the Genus database with same CATH homology
 3VA1 A;  1J4K A;  5JEL A;  5JEK A;  2JPE A;  1G3G A;  5JEJ A;  2QVL A;  4V24 A;  1K3J A;  1J2F A;  1KHX A;  4WER A;  2BON A;  3PO8 A;  5A8I A;  2XXS A;  4JON A;  3OUN A;  4D9V A;  1DEV A;  3POA A;  2JGR A;  3HX1 A;  4JIW D;  3ELS A;  1K2N A;  4G2S A;  3UOT A;  5JEM A;  3VA4 A;  3DSH A;  1DMZ A;  2KKL A;  4R9P A;  4H87 A;  3UMZ A;  4JIV D;  1MZK A;  1LGP A;  1J4O A;  1UHT A;  1YGS A;  1U7V B;  1WV3 A;  1GXC A;  2QV7 A;  4A0E A;  2EH0 A;  3S40 A;  1J4Q A;  3GQS A;  3I6U A;  3GMJ A;  1YJM A;  2KB4 A;  3I0M A;  1J4P A;  1G6G A;  4WRR A;  3UV0 A;  1K3Q A;  1K3N A;  2JQI A;  3UN0 A;  5DJO A;  1KHU A;  1K2M A;  1FHQ A;  5C4V A;  1WLN A;  3VZD A;  3DIT A;  2A0T A;  1DD1 A;  5BVI A;  1R21 A;  3T5P A;  1MK2 A;  1J4L A;  3HUE A;  5JER A;  2G1L A;  3ELV A;  3I6W A;  3MDB A;  5E50 A;  3A77 A;  5JEO A;  1U7F B;  2JQL A;  4EJQ A;  2W3O A;  2PIE A;  1MR1 A;  3UNN A;  2AFF A;  3VPY A;  1U7F A;  2JQJ A;  1YJ5 C;  3FM8 A;  2FEZ A;  1MJS A;  4L02 A;  2JKD A;  4A4Y A;  1LGQ A;  2BRF A;  1UJX A;  2KFU A;  3UNM A;  2LC1 A;  3VZB A;  3KT9 A;  1QU5 A;  4KU0 D;  1U7V A;  2FF4 A;  3I0N A;  2P1R A;  2XT9 B;  3VZC A;  1ZOQ A;  4EGX A;  2KB3 A;  4QCJ A;  2CSW A;  1QWT A;  1G88 A;  3HUF A;  1FHR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...