1K2NA

Solution structure of the fha2 domain of rad53 complexed with a phosphothreonyl peptide derived from rad9
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
158
structure length
158
Chain Sequence
GNGRFLTLKPLPDSIIQESLEIQQGVNPFFIGRSEDCNCKIEDNRLSRVHCFIFKKRHAVGKSMYESPAQGLDDIWYCHTGTNVSYLNNNRMIQGTKFLLQDGDEIKIIWDKNNKFVIGFKVEINDTTGLFNEGLGMLQEQRVVLKQTAEEKDLVKKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Solution structure of the yeast Rad53 FHA2 complexed with a phosphothreonine peptide pTXXL: comparison with the structures of FHA2-pYXL and FHA1-pTXXD complexes.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Transferase
molecule keywords Protein Kinase SPK1
total genus 22
structure length 158
sequence length 158
ec nomenclature ec 2.7.12.1: Dual-specificity kinase.
pdb deposition date 2001-09-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00498 FHA FHA domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.200.20 Mainly Beta Sandwich Tumour Suppressor Smad4 Tumour Suppressor Smad4 1k2nA00
2G1LA 2KB4A 2FF4A 3I0NA 1LGPA 3KT9A 1R21A 1GXCA 5DJOA 1UHTA 5E50A 1FHRA 1QU5A 2A0TA 1K3QA 2FEZA 3OUNA 1K3JA 2W3OA 2KB3A 1WLNA 3FM8A 2JQIA 2PIEA 3I0MA 4G2SA 3UNMA 3VA1A 2KFUA 1MZKA 2BRFA 3UNNA 1J4PA 2AFFA 2LC1A 1J4OA 3ELSA 3ELVA 1YJMA 2XT9B 2KKLA 3UV0A 1FHQA 4A0EA 3POAA 4EGXA 2JQLA 4EJQA 1J4QA 1LGQA 3HX1A 4H87A 3UOTA 1K2NA 3HUFA 3I6WA 4JONA 1WV3A 4QCJA 3UMZA 2CSWA 3GQSA 3VPYA 4D9VA 1K3NA 1K2MA 2JKDA 5A8IA 1G3GA 2EH0A 3HUEA 2JPEA 2JQJA 1YJ5C 1G6GA 3UN0A 3I6UA 1J4LA 1J4KA 1DMZA 1UJXA 3PO8A 3VA4A 3MDBA
chains in the Genus database with same CATH superfamily
1ZOQA 3I0NA 2FF4A 3VZBA 1LGPA 3A77A 1UHTA 4WERA 2Q5FA 5EJFA 2I2DA 2AN1A 3FM8A 5DHPA 3PFNA 3VA1A 5JERA 2KFUA 5JEJA 1MZKA 1J4PA 3ELSA 1KHUA 2JGRA 2I2FA 3ELVA 1YJMA 2KKLA 1MK2A 5DHQA 1QWTA 4EGXA 3V8MA 3UOTA 3V8RA 4R9PA 2QV7A 4JONA 3V8PA 3V7YA 1K3NA 1U7VB 3T5PA 2JKDA 1G3GA 3VZCA 5E50A 1QU5A 2A0TA 5BVIA 2FEZA 3OUNA 3V7UA 1K3JA 2KB3A 1WLNA 5DHTA 1KHXA 1Z0ZA 2BONA 2P1RA 3UNNA 4V24A 3VZDA 1J4OA 2I29A 5C4VA 2XT9B 5JELA 5EJIA 2I2BA 4A0EA 1Y3IA 3V8NA 1U7FA 4H87A 1LGQA 4A4YA 3V7WA 1WV3A 4D9VA 1K2MA 1Z0SA 2CSWA 5JEOA 5A8IA 2EH0A 2JQJA 1YJ5C 2QVLA 1U7FB 2I2AA 1J4KA 5EJHA 3PO8A 3KT9A 1R21A 2XXSA 5DJOA 1G88A 3DITA 1K3QA 4DY6A 3GMJA 5DHUA 2W3OA 3UNMA 1YT5A 1DD1A 2JQIA 4G2SA 3AFOA 1Z0UA 2LC1A 3V8QA 1J2FA 2I1WA 3POAA 4EJQA 1J4QA 3HX1A 1U0RA 1Y3HA 1K2NA 3I6WA 4WRRA 4QCJA 4JIWD 3V80A 4KU0D 4JIVD 3HUEA 2JPEA 1MR1A 5DHRA 1MJSA 3VA4A 5EJGA 3MDBA 2G1LA 2KB4A 1FHRA 1GXCA 1U0TA 5JEMA 3I0MA 2PIEA 1DEVA 2BRFA 2AFFA 3UV0A 1FHQA 1SUWA 1YGSA 4HAOA 3S40A 1DMZA 3DSHA 2JQLA 5JEKA 1U7VA 3HUFA 3UMZA 3VPYA 3GQSA 4L02A 1G6GA 3UN0A 3I6UA 1J4LA 5DHSA 1UJXA 2I2CA
chains in the Genus database with same CATH topology
1ZOQA 3I0NA 2FF4A 3VZBA 1LGPA 3A77A 1UHTA 4WERA 3FM8A 3VA1A 5JEJA 5JERA 2KFUA 1MZKA 1J4PA 3ELSA 1KHUA 2JGRA 3ELVA 1YJMA 2KKLA 1MK2A 1QWTA 4EGXA 3UOTA 4R9PA 2QV7A 4JONA 1K3NA 1U7VB 3T5PA 2JKDA 1G3GA 3VZCA 5E50A 1QU5A 2A0TA 5BVIA 2FEZA 3OUNA 1K3JA 2KB3A 1WLNA 1KHXA 2BONA 2P1RA 3UNNA 4V24A 3VZDA 1J4OA 5C4VA 2XT9B 5JELA 4A0EA 1U7FA 4H87A 1LGQA 4A4YA 1WV3A 4D9VA 1K2MA 2CSWA 5JEOA 5A8IA 2EH0A 2JQJA 1YJ5C 2QVLA 1U7FB 1J4KA 3PO8A 3KT9A 1R21A 2XXSA 5DJOA 1G88A 3DITA 1K3QA 3GMJA 2W3OA 3UNMA 2JQIA 1DD1A 4G2SA 2LC1A 1J2FA 3POAA 4EJQA 1J4QA 3HX1A 1K2NA 3I6WA 4WRRA 4QCJA 4JIWD 4KU0D 4JIVD 3HUEA 2JPEA 1MR1A 1MJSA 3VA4A 3MDBA 2G1LA 2KB4A 1FHRA 1GXCA 5JEMA 3I0MA 2PIEA 1DEVA 2BRFA 2AFFA 3UV0A 1FHQA 1YGSA 3S40A 1DMZA 3DSHA 2JQLA 5JEKA 1U7VA 3HUFA 3UMZA 3VPYA 3GQSA 4L02A 1G6GA 3UN0A 3I6UA 1J4LA 1UJXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2G1L A;  2KB4 A;  2FF4 A;  3I0N A;  1LGP A;  3KT9 A;  1R21 A;  1GXC A;  5DJO A;  1UHT A;  5E50 A;  1FHR A;  1QU5 A;  2A0T A;  1K3Q A;  2FEZ A;  3OUN A;  1K3J A;  2W3O A;  2KB3 A;  1WLN A;  3FM8 A;  2JQI A;  2PIE A;  3I0M A;  4G2S A;  3UNM A;  3VA1 A;  2KFU A;  1MZK A;  2BRF A;  3UNN A;  1J4P A;  2AFF A;  2LC1 A;  1J4O A;  3ELS A;  3ELV A;  1YJM A;  2XT9 B;  2KKL A;  3UV0 A;  1FHQ A;  4A0E A;  3POA A;  4EGX A;  2JQL A;  4EJQ A;  1J4Q A;  1LGQ A;  3HX1 A;  4H87 A;  3UOT A;  1K2N A;  3HUF A;  3I6W A;  4JON A;  1WV3 A;  4QCJ A;  3UMZ A;  2CSW A;  3GQS A;  3VPY A;  4D9V A;  1K3N A;  1K2M A;  2JKD A;  5A8I A;  1G3G A;  2EH0 A;  3HUE A;  2JPE A;  2JQJ A;  1YJ5 C;  1G6G A;  3UN0 A;  3I6U A;  1J4L A;  1J4K A;  1DMZ A;  1UJX A;  3PO8 A;  3VA4 A;  3MDB A; 
#chains in the Genus database with same CATH topology
 1ZOQ A;  3I0N A;  2FF4 A;  3VZB A;  1LGP A;  3A77 A;  1UHT A;  4WER A;  2Q5F A;  5EJF A;  2I2D A;  2AN1 A;  3FM8 A;  5DHP A;  3PFN A;  3VA1 A;  5JER A;  2KFU A;  5JEJ A;  1MZK A;  1J4P A;  3ELS A;  1KHU A;  2JGR A;  2I2F A;  3ELV A;  1YJM A;  2KKL A;  1MK2 A;  5DHQ A;  1QWT A;  4EGX A;  3V8M A;  3UOT A;  3V8R A;  4R9P A;  2QV7 A;  4JON A;  3V8P A;  3V7Y A;  1K3N A;  1U7V B;  3T5P A;  2JKD A;  1G3G A;  3VZC A;  5E50 A;  1QU5 A;  2A0T A;  5BVI A;  2FEZ A;  3OUN A;  3V7U A;  1K3J A;  2KB3 A;  1WLN A;  5DHT A;  1KHX A;  1Z0Z A;  2BON A;  2P1R A;  3UNN A;  4V24 A;  3VZD A;  1J4O A;  2I29 A;  5C4V A;  2XT9 B;  5JEL A;  5EJI A;  2I2B A;  4A0E A;  1Y3I A;  3V8N A;  1U7F A;  4H87 A;  1LGQ A;  4A4Y A;  3V7W A;  1WV3 A;  4D9V A;  1K2M A;  1Z0S A;  2CSW A;  5JEO A;  5A8I A;  2EH0 A;  2JQJ A;  1YJ5 C;  2QVL A;  1U7F B;  2I2A A;  1J4K A;  5EJH A;  3PO8 A;  3KT9 A;  1R21 A;  2XXS A;  5DJO A;  1G88 A;  3DIT A;  1K3Q A;  4DY6 A;  3GMJ A;  5DHU A;  2W3O A;  3UNM A;  1YT5 A;  1DD1 A;  2JQI A;  4G2S A;  3AFO A;  1Z0U A;  2LC1 A;  3V8Q A;  1J2F A;  2I1W A;  3POA A;  4EJQ A;  1J4Q A;  3HX1 A;  1U0R A;  1Y3H A;  1K2N A;  3I6W A;  4WRR A;  4QCJ A;  4JIW D;  3V80 A;  4KU0 D;  4JIV D;  3HUE A;  2JPE A;  1MR1 A;  5DHR A;  1MJS A;  3VA4 A;  5EJG A;  3MDB A;  2G1L A;  2KB4 A;  1FHR A;  1GXC A;  1U0T A;  5JEM A;  3I0M A;  2PIE A;  1DEV A;  2BRF A;  2AFF A;  3UV0 A;  1FHQ A;  1SUW A;  1YGS A;  4HAO A;  3S40 A;  1DMZ A;  3DSH A;  2JQL A;  5JEK A;  1U7V A;  3HUF A;  3UMZ A;  3VPY A;  3GQS A;  4L02 A;  1G6G A;  3UN0 A;  3I6U A;  1J4L A;  5DHS A;  1UJX A;  2I2C A; 
#chains in the Genus database with same CATH homology
 1ZOQ A;  3I0N A;  2FF4 A;  3VZB A;  1LGP A;  3A77 A;  1UHT A;  4WER A;  3FM8 A;  3VA1 A;  5JEJ A;  5JER A;  2KFU A;  1MZK A;  1J4P A;  3ELS A;  1KHU A;  2JGR A;  3ELV A;  1YJM A;  2KKL A;  1MK2 A;  1QWT A;  4EGX A;  3UOT A;  4R9P A;  2QV7 A;  4JON A;  1K3N A;  1U7V B;  3T5P A;  2JKD A;  1G3G A;  3VZC A;  5E50 A;  1QU5 A;  2A0T A;  5BVI A;  2FEZ A;  3OUN A;  1K3J A;  2KB3 A;  1WLN A;  1KHX A;  2BON A;  2P1R A;  3UNN A;  4V24 A;  3VZD A;  1J4O A;  5C4V A;  2XT9 B;  5JEL A;  4A0E A;  1U7F A;  4H87 A;  1LGQ A;  4A4Y A;  1WV3 A;  4D9V A;  1K2M A;  2CSW A;  5JEO A;  5A8I A;  2EH0 A;  2JQJ A;  1YJ5 C;  2QVL A;  1U7F B;  1J4K A;  3PO8 A;  3KT9 A;  1R21 A;  2XXS A;  5DJO A;  1G88 A;  3DIT A;  1K3Q A;  3GMJ A;  2W3O A;  3UNM A;  2JQI A;  1DD1 A;  4G2S A;  2LC1 A;  1J2F A;  3POA A;  4EJQ A;  1J4Q A;  3HX1 A;  1K2N A;  3I6W A;  4WRR A;  4QCJ A;  4JIW D;  4KU0 D;  4JIV D;  3HUE A;  2JPE A;  1MR1 A;  1MJS A;  3VA4 A;  3MDB A;  2G1L A;  2KB4 A;  1FHR A;  1GXC A;  5JEM A;  3I0M A;  2PIE A;  1DEV A;  2BRF A;  2AFF A;  3UV0 A;  1FHQ A;  1YGS A;  3S40 A;  1DMZ A;  3DSH A;  2JQL A;  5JEK A;  1U7V A;  3HUF A;  3UMZ A;  3VPY A;  3GQS A;  4L02 A;  1G6G A;  3UN0 A;  3I6U A;  1J4L A;  1UJX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...