1K34A

Crystal structure analysis of gp41 core mutant
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
65
structure length
60
Chain Sequence
GIVQQQNNLLRAIEAQQHLLQLTVWGIKQLQAGGWMEWDREINNYTSLAHSLIEESQNQQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Transmembrane glycoprotein GP41
publication title Interhelical interactions in the gp41 core: implications for activation of HIV-1 membrane fusion.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Viral protein
total genus 25
structure length 60
sequence length 65
ec nomenclature
pdb deposition date 2001-10-01
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.210 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 1k34A00
4N23A 1Y66A 5CMUA 3K9AA 3M99B 3H01A 1K33A 5HFMA 4FK5C 5H9CA 2P6JA 5KA6A 1Y4MA 1ENVA 2EZOA 4G2KA 1QR8A 1SZTA 2EBOA 4FJCC 1K34A 1QBZA 1MG1A 3B8NA 1MOFA 2MK3A 5HFLA 3CYOA 5KA5A 1I5XA 1DF5A 1EBOA 1I5YA 1QR9A 2X7RB 4JPRA 3MHHC 2LP7A 3MHSC 2M7WA 4JGSA 3GWOA 4FIPC 1DF4A 3CP1A 4JF3A 5CN0A 1JQ0A 2OT5A 4E2LA 4N21A 3B77A 3WFVA 1JPXA 2EZPA 3P30A 3B8MA 1DLBA 1QCEA 1F23A
chains in the Genus database with same CATH superfamily
1FFXA 1LNQA 2RDCA 3OEEG 1XMQO 2B9ZA 4L8JA 1YZBA 3SJCC 2Y69B 2ZDIA 4FFKA 1VP7A 3OM3B 4TSFG 2DYSC 1VMGA 5GONA 2OWOA 4LWSB 4WFFA 3A0HZ 4JI8B 2CTPA 1WLEA 3G6BA 3ZHSA 2PUSA 2JS5A 4X20A 3BA9A 4DV4B 3AG1B 4JI4B 3RVYA 3W7SA 1NH2D 2UXDO 2DN9A 3LUTB 2Z3YA 1OCCB 1NZ6A 4J9YB 3SJQC 2ATKC 1QR8A 4JTCB 4P2ZA 3B40A 3SJBC 3OTOB 1FPOA 3FKSG 5ITZB 2CTRA 1KP2A 1Q81W 3UCSC 3JCUZ 2DOSA 5BR8B 5FNVB 3D3IA 3AG7A 5DM6V 4MW8A 1THZA 4DV3O 1M1KW 5DEDA 3MD0A 4B7EA 3B4SA 3FAVB 5KLVH 4ZIBA 4JI2O 2BSKA 1FXKA 1V9PA 3QO5A 1GK9A 4DR2B 1LUWA 2NNUA 3T4ZA 4IIJB 1MNGA 4OGQB 2P7TC 5KA6A 3E83A 2ZIMA 3F7VC 1IURA 3CC2V 4WFAV 3FX7A 2ZCEA 4FM2A 1FJGB 1AI4A 1VQNV 3N2GA 1AI6A 4DO2A 4CH4A 2HKOA 4FMTA 3KCXA 3A0RA 3SDLA 4WCEV 5D5QA 3WFVA 3DSQA 2EINC 4WBNA 3M7MX 2Q69A 5EBLC 3I5DA 3H1IH 5LHHA 2BTQA 3ABLC 4XDLA 3CYOA 4CS4A 3BEHA 1ZTEA 1FD9A 5KX5A 5LHIA 1PD3A 2A7WA 2X6BA 4EEQA 1Y6XA 2CGOA 1IXMA 2GV9A 2Q67A 4E4EA 4JI5O 4J10A 5FPRA 1AJPA 1J5EO 4LH7A 1AP5A 1JCHA 3K5OA 2CUGA 2X6CA 1TVKA 4I50A 4I5SA 4LFAB 1BQZA 1K73W 4UXNA 1JQ0A 3R66A 1OCOC 3H1LH 3ABKC 4PA3A 3IAYA 4KP4A 1Q5OA 3H1KH 1MSWD 2EIMB 3ICXA 1VQ8V 4YIOA 1YF2A 1IXBA 2W0FC 1D2DA 2JIZG 3L73H 4NVPA 3CC4V 3CMAV 2DMXA 1HNZB 4RWUA 3ZMUA 4FZ1A 1M5IA 4AILC 2ITDC 5HFMA 1G1XB 1Q7YW 1GH6A 5H9CA 3AG4C 4B7KA 1N32B 1HW7A 3I56V 1AVMA 3OE7G 3CCUV 4P9OA 3G80A 3E35A 5BMVB 3JD4A 3SJAC 2Q0OC 3ASOB 2GSMB 1R1BA 1OCZC 1R6KA 3STZC 4ZHQB 4MVZA 4Z1VA 1L8DA 1YCIA 1B3QA 2CH7A 2WLHA 1S77D 5LOVA 2ZM6O 2ZXWB 3ZHQA 2BCCH 1D5AA 3LNNA 4H44B 4BAYA 5LHGA 1X59A 4UCOA 4KXRA 4DV0B 1ZWIC 1N0JA 2E76B 4U7OA 1UFIA 3E8HA 4QJFB 5CBGA 4PDVA 2EULA 5LP6C 3CHXA 4KHPO 1YSCA 4ICGA 4JYYA 4I0XA 4CBCA 5BXZA 3OR6C 5B1BB 3AG2B 1WP8A 1HNWO 4O4HA 5LP6A 5A9GA 4RO2A 5A2QN 1NTMH 2IJKA 1PNKA 3OEHG 4UCRA 3CB2A 3E2EA 1A32A 2ADQB 1XNRO 5CA1A 3OMNB 3ZJZA 4DK1A 5CA0A 1G6UA 1EN4A 3JD3A 4A5UB 1N8RW 4JV5O 3CWBH 4GKJO 3W7WA 4NXMO 4DV6O 4JYAO 3K08A 4NXNO 2OTJV 4UCVA 3CCMV 4BIUA 2HJDA 4ZBMA 4JI3O 3KKYA 4X66O 4PDLA 4GT1A 2E5LO 2F23A 4MVUA 3QO7A 1E1RG 5LL6Y 3B8NA 4XBFA 1Q3EA 1YJWV 2ZKOA 1RSOB 3EXAA 1QVGU 1DTOA 3UO3A 2R72A 1GN4A 1F23A 1OV9A 3K9SA 5IWAO 4DW1A 3T1HB 2UUBO 4K0KO 5L3EA 2GBOA 3AG3C 1IBMO 3L75H 3TETA 1JFFA 2E75B 4QGPA 4DRXA 3K04A 3K06A 3U11A 1JVMA 4TV9A 2NN4A 2Z0AA 1IBKB 4TWKA 3DXRA 3ETEA 1PKXA 3BABA 2F4VO 5JVDA 3RW0A 4J9ZB 4MTOA 3CC7V 2L6LA 4LF7O 1IBLB 1MZFA 2QKAA 4X89A 4MVOA 3HKBB 2VQFO 5B3SC 3BY6A 3W7XA 4LF5O 2XAJA 2WA4A 1NS1A 2RJZA 2EIKC 3SYQA 2UUCB 1SZTA 3FB6C 4FJCC 2BOCC 2YEVB 3OT7A 3JASB 3OUFA 3M8AA 5LA6A 1E1QG 1VQMV 2YC0A 3BHPA 3THOA 3B09A 3ZMSA 1RFYA 3SYPA 1RM1C 4GCZA 1DGSA 1K5QA 2FMLA 3BFRA 3SR2C 4DV2B 3WB1A 1SA0B 3CCLV 5K1XA 5C8YB 5FLXN 1N34B 2QWOB 5J2UB 4X64O 1Y74A 3N2KA 1WPBA 4EB6A 1QLEB 4B3TO 5GTIZ 1GN3A 4K3AA 2AHZA 1TGOA 3C90A 1QCEA 4H13B 3HKEA 3G67A 5EC2C 3VQYA 3K5MA 2HHHO 4O2AB 1Q8IA 3SYCA 1ZL8A 4NR1A 3T2MA 1Q6HA 4GKKB 3FD9A 3SPIA 1US6A 3ABMC 4JI7O 2IM9A 5ITZA 4QE9A 5KAFZ 3RYIA 1JJOA 4UB8Z 3BAAA 2EILB 1S3JA 3WB2A 2PTMA 1FKAO 1XHXA 1V55C 3JAWA 1MOFA 4NYKA 3QVNA 4RQFA 3FAVA 3E89A 3E8FA 1LUVA 2F43G 2F66C 3CP1A 2IU0A 1GTOA 3U0ZA 2BE3A 1K4DC 1TUBA 1SETA 1NKDA 5J2TB 2UUAB 4IIJA 1EM1A 2Q68A 4FK5C 1XL6A 2PGGA 2XOKG 2WLKA 4DV7B 4R8CA 1Q90D 1Z5VA 4DR7B 2OTLV 5LGTA 2VWKA 2XAGA 2VQEO 2LGWA 4FLTA 1YJNV 2UXCO 1XILA 3P30A 2WLIB 4PV1B 5K1PA 1DLBA 2ARHA 2XNDG 1KB9F 3E22B 1YITV 2P22C 1K8AW 2N74A 3CCVV 2HVJC 4LF4O 5EZYB 1VQ5V 5H6RA 2OCCC 3UQ8A 5KA5A 5LGNA 1S76D 3OD4A 2B1GA 4OPAA 4X88A 2B1IA 2V7QG 4BW5A 1BQ0A 4MSWC 2IH1C 3VBBA 4CZZA 1NJIW 3HR0A 3AK1A 2UXBO 3KZIZ 1BS3A 4AHCA 3NR7A 2DYRB 4W4LA 2OIEA 3CXCU 3SYOA 1MABG 4YHHO 3GWKC 5LXTA 1Y67A 2HP8A 4QE7A 3ASNB 5B1AB 1XMQB 2YDEA 3VOUA 4ABMA 2IJJA 2N04A 2ZDIC 2Q4PA 4F4LA 3F7YC 4JZGA 4PA7A 1AI5A 2R9IA 1M56B 1K92A 2YXLA 4IGGA 3SGIA 3CJHB 2UXDB 1WPXA 2M7WA 3ZHRA 3X2QC 4F6EA 3ML0A 3R65A 1XEQA 2XTAA 2AHYA 5JQGA 1VEWA 5IYCO 3M99B 1HR0O 3H01A 4JTAB 3K57A 4FPPA 4F6RB 1F4MA 1GO3F 5KMGB 4U3JB 3ABUA 1NT2B 3JAKA 2ZE5A 3TXQA 1V54C 4R7CA 4D6TH 4DV3B 2QM8A 5CN0A 1GM9A 3FFQA 4E2LA 2EIJC 1TAEA 3OR7C 2BOBC 4LFBO 3CRCA 1I08A 4YJ3A 4JI2B 3QO8A 5LYJA 2QKCA 3O9OA 3HKCA 2FL4A 1FXKC 3D3QA 2WLLB 2R9RB 2KQXA 1FAFA 3K79A 5E1AC 4O4LA 1GN2A 1WP7A 5KHGA 3JATA 1TUEB 2F93B 2X0LA 3JALB 2Q6AA 2QKSA 5KUKA 1EZJA 3ZRVA 4YJ2B 4XDJA 1YJ9V 5L3BA 2EZOA 4DXWA 4UVCA 1PP9H 1Q82W 3SPJA 5TISZ 2D3OW 5EC1C 5H2FZ 3GWOA 1I94O 4TV8A 2IJHA 3JAMN 1HNXO 3ZBHA 5E79Z 3ZRWB 1YTFB 3CD6V 2F95B 3LDCA 5EIBC 1WN7A 4HYOA 3E8BA 4PA6A 2OYQA 3BVOA 3WB0A 5CB4A 1FXHA 4JI5B 3LSSA 1S0VA 1W0JG 4PA4A 1FYJA 2QSAA 3IJ4A 1J5EB 1Q43A 5H5NA 2JGDA 1F4NA 2KG7A 2E3CA 3CCQV 1VARA 1U97A 2A06H 1XMOO 4FM1A 3RYHA 4FFBB 4OX9O 4NB5A 5EIBD 5IJ0A 1HDJA 1H2GA 3MDSA 1JJ2U 3ABTA 1EN6A 5FPOA 4JZ2A 1GKFA 2WLMA 1KECA 1BT8A 3CCSV 2UU9O 3UT5A 3F5TA 2LQTA 5IY5B 1SF9A 4X1IB 3OFNG 3RYFB 4KFMA 3CRAA 2AW9A 2MW2B 3QG5A 4JYCA 3WG7C 4TOIA 1KKDA 4HNAA 4DR1O 5IYDO 4JI0O 2QTSA 1VQLV 3L72H 1FFXB 4CC6A 2QWPB 3BPZA 1NH2B 2Q73A 1XNQO 3DC5A 3CS5A 3SPCA 2DQ3A 1NVPD 4BR6A 5GONB 4MVQA 4JPRA 5L3GA 4ZI7A 3E86A 1DK1A 5KAIZ 5JJNB 1JMKC 1M57C 1AB3A 2DYSB 4X20B 4ZOLA 4PA9A 1ZAUA 2Y4TA 4O2BB 4UB6Z 2ZM6B 2GHYA 3C3TA 4NKGB 2HLDG 2PY5A 3MAQA 2YIBA 1URFA 4IHJB 4I55A 1KP3A 4UV9A 1L1FA 1GAXA 3ZHTA 3JD0A 5BY1A 4WFBV 3STLC 2P67A 2QA4V 5IYBO 4O4IA 3SPHA 4KHPB 4Q20A 2RQ6A 2F1MA 4DUYO 4DR3O 1AROP 1K4CC 3CCJV 1YIJV 1HNWB 3RYCA 3P3NA 2P6JA 1ZLZA 5IYZA 2YIBD 1SA0A 4H37A 3OW2U 4PDMA 3EHBB 3TXSA 2BSKB 1JX9A 4I9QA 3RVZA 3ZHUA 1OCRC 5CBFA 4CH5A 3EFFK 1XNRB 2WLNA 1K3EA 2ZD9A 1G8MA 4G28B 4JV5B 4GKJB 4NXMB 4X62O 4DV6B 4FLXA 5C93A 4JYAB 3RN4A 1QQCA 4W4KA 1J95A 4NXNB 1AI7A 5IJ9A 4JI3B 2HR3A 4X66B 1YVWA 3C3SA 5KHIA 3H9VA 3N2GB 3OMIB 1R3IC 3T1YO 1S5LZ 2DJVA 2Y0PA 1EN5A 2E5LB 3QTCA 4KUMA 4TUYA 2CDYA 2Q8VA 4CC5A 2Q5ZA 3CRQA 4WBNB 4RAIA 4LF6O 2BTQB 1Y4MA 1KD1W 5L3FA 2EINB 2HVKC 2JEXA 1VQ6V 4JI1O 5IWAB 1BE3H 4DR5O 2RMKB 2UUBB 3Q4HA 4K0KB 1WA8A 3ABLB 2PI5A 1IBMB 1R6TA 3BA8A 4JYBA 1KU9A 3D36C 1KUQA 3ZX6A 1WB8A 3L70H 3TK1A 3J81N 4X8AA 1XL4A 2LW1A 1BHBA 1QU7A 3D36A 4I50B 1TVKB 2ZE8A 4DV1O 4NTXA 2Q7GA 2ZE6A 4UCTA 3H1HH 2Y4UA 1VF6C 2M6YA 2F4VB 4YY3O 4GX2A 5EYPA 4J11A 2YIDA 4LNUA 1RP3B 2R9AA 1S5HC 2WLIA 1VF6A 3E22A 2Q7HA 1OCOB 4LF7B 1SC5B 4ZKIA 4X1YA 3ABKB 2VQFB 4OXSA 1B6QA 4LF5B 4RUFA 2QE7G 4BIZA 1K97A 2B5UA 1AR5A 5CBHA 2JVDA 4DR4O 3APQA 1XBLA 2AGAA 5LMUO 1Q6UA 5B66Z 2GTAA 3F5WC 3GB7C 1N4CA 3FYIB 1GRJA 3CEIA 4I7ZB 3JARA 1P7BA 2ZR2A 1B04A 1WAZA 5B1OA 3AG4B 2X7RB 2P5OA 3RBZA 4AQYO 3LSUA 4LCUC 4IYIA 3LNMB 1Z2GA 4X1KA 3DTUB 5AG2A 2Y69C 2GUZA 1HWYA 4X64B 4LC1A 4MVRA 1Y76B 3J7AU 4B3TB 3L71H 2CH7B 4DR6O 2P4KA 4GUNA 3A8TA 2ZNIA 4PJ0Z 4QPJA 5LOVB 1OCZB 4LR3A 1PV0A 4B3SO 2EJRA 2HHHB 2K9PA 4FIPC 3AG1C 4LWSA 2YXYA 4NTYA 3G4SV 4JAUA 4J7KA 1OCCC 2VRZA 4J7ZA 1AR4A 1YI2V 2W6IG 4TQFA 4JI7B 3QNEA 2AXTZ 1SESA 4I0XB 1MZEA 4CH3A 2QTOA 1NU1H 5IDJA 3IC9A 4O4HB 5LP6B 3CXHF 2UXXA 2A9HA 2PYLA 4I4TB 2ZINA 5B1NA 1G4YB 3ETDA 1BGYH 5FNVA 2G38A 2QM7A 5LMNO 2NLJC 5CA1B 1NBMG 4X9QA 5CA0B 3OUSA 2A79B 5KUMA 1GN6A 1PNMA 4R50A 2QJ1A 2YSUB 1Q6IA 4GX1A 4B3RO 4UV8A 5CA3A 3OTFA 2Q7EA 4UUJC 5BZBA 3K9AA 2VQEB 4H0LB 2PYJA 4IT5A 4PDRA 2CAZC 2O57A 2AZ0A 2RNBA 4CS2A 2UXCB 4PI2A 3CCRV 4J41A 4DUZO 1K5SA 1W59A 1DF5A 1YEWA 4LF4B 4FLYA 2XUMA 4UCUA 1N33O 2WSSG 1FXVA 3IGAC 2ZT9B 1CP9A 4LF9O 1ZSPA 1B06A 1Y66A 2VS0A 2XASA 4Z2WA 2YUAA 4DV5O 2C2AA 2YI9A 3JCZA 1R73A 1JFFB 2UXBB 5JJJB 4DRXB 1QR9A 3ZRSA 3AG3B 4H33A 2CTWA 1M90W 4LF8O 3O65A 4TV9B 4YHHB 2YS8A 4HZ3A 1R3LC 3OMAB 1SQVH 4J7JA 1KMIZ 3RGBA 3DXRB 1H38A 2XT9A 5JVDB 4LFCO 2XHBA 4B3MO 1RPRA 2P4VA 1JOYA 1SZXA 2FTKA 1DF4A 2E74B 4X65O 3L74H 1BL8A 4YIPA 2CGNA 5LGUA 3PN1A 4JI6O 2EIMC 2P90A 3KCYA 1IDSA 3K5LA 1OZ0A 4WF9V 1H2LA 3K03A 3ZN0A 4FLUA 5B3SB 2LFRA 4X1IA 2Q0AA 1SQGA 3RYFA 5LA6B 3IC7A 1HR0B 1L0NH 3RWRD 2EIKB 4PI0A 3FB5C 4FLWA 4G27B 2OCHA 1MA1A 4JASA 5IT9N 3K3WA 1T5EA 1COWG 4C7UA 1VQOV 5KHKA 1NI8A 3JYCA 1RM1B 4WFEA 4LFBB 2UXNA 1AP6A 1F7YA 1S72V 1Y74B 3N2KB 1N36O 3VQXA 1CPYA 4PD4F 4EB6B 5BMVA 4JGSA 1UJWB 3ASOC 1XHZA 4HAMA 1IZ3A 1ROPA 1H2SB 2QR4A 3HKEB 2AZ2A 1K9MW 3CE2A 2FYUH 2JK5C 4O2BA 1S5JA 3W7TA 3W7UA 1SQFA 2HFEC 3ETQA 1ZL8B 3AK3A 3ZS8C 1HP8A 1VF5B 2ZE7A 2ZXWC 4MVSA 3CMEV 4UVBA 4JI8O 4ZHQA 2BTOA 2LO1A 4IHJA 3CRRA 2YXHA 4DV4O 2YIAA 4MT8A 4JI4O 3K0GA 1PPJH 3RYIB 2L35A 2FB5A 4DK0A 3FB7C 1AR1B 5KHHA 3G6EV 1NQTA 4HBNA 3ABMB 2JJ2G 4O4JB 5CMUA 3OTOO 1I94B 2QWRB 4YXWG 3JAWB 1HNXB 5B1BC 3AG2C 1K34A 5BR8O 1I5XA 3ZIAG 4K35A 1GMGA 1M9NA 1AJNA 3LSQA 1V55B 5FL7G 1UPGA 5JJEB 1TUBB 1XOUA 3B77A 4R6ZA 1KQSU 2H3OA 1ENVA 1PM9A 3OGIB 3TGUH 4GYCB 5EK0A 1BZKA 4AI8A 2DE0X 5D5PA 4DR2O 3D8CA 2IW5A 2HJFC 3DC6A 2Q9LA 4GX0A 1XMOB 1CXZB 1P84F 3UKMA 4NTWA 4OX9B 4XDKA 3SPGA 1GM7A 1FJGO 5F2VO 3VQWA 4RUEA 1SERA 2ZR3A 5EBWC 3I55V 2QGNA 3L9DA 1R3KC 1WB7A 1BHAA 2UU9B 2ADPA 3HPLC 4BIOA 2OCCB 4MW3A 4Z1MG 2ODMA 1RSOA 1VF7A 1WJZA 1O9HA 3ZHVA 3K58A 2QDOA 4FVMA 5LBQA 4DR1B 3RT3C 4LH6A 2ITCC 4JI0B 5LXTB 3ZMZA 3E8GA 2WLJA 2Z5UA 4CH6A 3K5NA 4MS2A 1XNQB 2WA3A 3P3PA 1XDCA 5JH7B 4LP8A 2YICA 5JCOC 1VQ4V 3HKDB 3ZMVA 5JWPA 4J80A 2QWQB 4TQDA 5JCOA 1YHQV 4LFAO 2HG5C 1VQPV 1PL0A 4PHZA 5B5EZ 3CRMA 1N0NA 2Y0IA 3TCUA 4PELA 3BRCA 4LBEC 2CK3G 3UO2A 2QM4A 2XAFA 5JQGB 3WU2Z 2KKWA 1XQ8A 3HKBA 2YI8A 4EFEA 2W6JG 3X2QB 2OIGA 3ZCCA 2PI4A 1H8HG 1SQPH 1ZUQA 4DUYB 1HNZO 4DR3B 2WAMA 3JAKB 3H1JH 2YEVA 2LFSA 3A0BZ 3JASA 5L3DA 1SQQH 1VQ7V 1H8EG 1N32O 4YJ3B 3ZN1A 1V54B 5LYJB 1SRYA 2KB1A 3CCEV 1IVSA 2EIJB 4B08A 2CE4A 3HKCB 2H8PC 4QIWF 1NTZH 1Y76A 2DWEC 4MTFA 3CX5F 1QLEC 4O4LB 1P7GA 4X62B 1XUQA 1X4TA 5C8YA 2QEXV 3ZEDA 1FXKB 2X6AA 3JATB 3SYAA 1U96A 2A3QA 4WFGA 5J2UA 3K0DA 2WWWA 5H6QA 3EVKA 1NTKH 3NXSA 5L3CA 3T1YB 2JJ1G 1P49A 1ORQC 1W0KG 2RCVA 3AEIA 4FLZA 1NR1A 4O2AA 2CTQA 4P30A 4DV0O 2EILC 5J9PC 4LF6B 3MHHC 4TV8B 4I4TA 4JI1B 4DR5B 2ILMA 2GTSA 2DWDC 1QNMA 3ZMTA 1M4UA 2LGQA 1SKVA 5CB4B 3IFXA 5IE9A 2PF4E 1EFRG 5KX5B 4L87A 5EBMC 3CSXA 3APOA 1R3JC 1P4RA 2IU3A 2JGDB 1QHTA 2KG7B 2V4DA 3FB8C 4DV1B 2W0XA 1BMFG 4YY3B 5J2TA 1VQ9V 1K7DA 1AILA 1Q86W 1I7FA 2PZSA 3RYHB 2EBOA 1QVFU 3LDDA 2R70A 1M93A 4MTXA 5IJ0B 4J42A 2K1EA 2GDSA 1JPXA 4KL1A 3TJTA 4U7NA 4D7SA 3UT5B 4GLXA 3UM7A 2EJ7A 1NR7A 3VQVA 5EZYA 1NVPB 4DR4B 5LMUB 4HNAB 1MSDA 3OGCC 3FYEB 3OAAG 1EZVH 3T1HO 1ZX3A 2XAQA 3BCCH 2OT5A 3WG7B 2DYRC 1H2NA 1TA8A 4WFHA 1SQXH 1GM8A 1H2KA 2IH3C 4AQYB 3A2FA 3ASNC 4QPKA 4UCSA 5B1AC 1IBKO 4ZI7B 1WNSA 4RQEA 4DR6B 4ZOLB 3K59A 1FS0G 2QWNB 1YDXA 1SQBH 3KG2A 1M56C 2N05A 4UVAA 4B3SB 1M57B 1XI1A 1I0HA 4I55B 1IBLO 2XAHA 4MTGA 3CJHA 1F51A 2LP7A 4GZRB 2LW7A 4O4IB 4JF3A 1AJQA 2UUCO 4MVMA 2EX3A 3RYCB 1OJHA 3ETGA 4K8ZA 5IYZB 1KYOF 2ZIOA 4G2KA 1D5NA 1L0LH 1QBZA 4F6RA 5HFLA 5KMGA 4U3JA 5LMNB 4CS3A 4DV2O 4JTDB 1OCRB 4JAAA 3AK2A 3MHSC 4N23A 3T4DA 4EKWA 1N34O 1OHHG 1K33A 1MMMA 2JEUA 1VQKV 4B3RB 2JRIA 2VWJA 5IJ9B 1PNLA 4IL6Z 2WLLA 5GTHZ 1BSMA 3PJSK 4P9PA 1XREA 3HB3B 2P06A 2H94A 1E79G 2ZNJA 2RN9A 4TUYB 4OPHA 3RFRA 4FLVA 1H2MA 4DUZB 2EZPA 2WPDG 1SS3A 1R6NA 3CPWU 1KKCA 3JALA 5DN6G 4GKKO 4O4JA 2HEPA 1BCCH 2IBZH 2LJ2A 1VIBA 4YJ2A 1N33B 3B2EE 4BW9A 4LF9B 3JD2A 1KC8W 3Q4HB 1EBOA 4DV5B 1WA8B 4DYLA 5KHJA 4EFBA 1LR1A 1CEZA 3DGEA 1RPOA 4Q6GA 3JD1A 3S3WA 4JAVA 2D2CB 3P32A 4BWAA 3ZRWA 4LF8B 2JGUA 3U10A 2A0LA 4FZ0A 5DECA 2MK3A 4D7TA 4K8XA 1Z5WA 5EYPB 2UUAO 4LFCB 4LNUB 3JSLA 4B3MB 4DW0A 4DV7O 2ZQMA 3LDEA 4DR7O 4IYHA 4GX5A 2JS3A 4X1YB 1YTFD 2ETNA 4X65B 5GW7A 1W2BU 2V1DA 3JSNA 4JI6B 1JR9A 4U3FH 3N27A 4FM0A 1I5YA 4FFBA 2DQ0A 3QF7A 1PL4A 4N21A 3G71V 4I9WA 3B8MA 5IY5C 1FFTB 1IX9A 3ZRXA 2NR5A 2JDIG 3JARB 4UFZA 3GVMA 4TT3G 1MG1A 3J80N 1YXBA 2DW4A 3T1CA 1KBHA 3S3XA 5JH7A 1JA8A 1O9GA 3HKDA 4X1KB 2KSDA 4QNHB 2IJIA 4ASUG 1QLNA 2GUZB 2Y48A 2FKXA 1N36B
chains in the Genus database with same CATH topology
5EC2C 5LBQA 1LNQA 3OEEG 4RAIA 2ITCC 1Y4MA 1KD1W 3ZMZA 3SYCA 2Y69B 2ZDIA 2EINB 5L3FA 3E8GA 2HVKC 2JEXA 2WLJA 1VQ6V 2Z5UA 3T2MA 3OM3B 4MS2A 4TSFG 2DYSC 4WFFA 3SPIA 4LP8A 3ABLB 1VQ4V 1WLEA 3ABMC 3ZMVA 2PI5A 4QE9A 2EILB 4JYBA 3AG1B 3RVYA 3W7SA 1NH2D 3TK1A 3LUTB 1YHQV 2Z3YA 2HG5C 1OCCB 1VQPV 4X8AA 1S3JA 1PL0A 4J9YB 1XL4A 3SJQC 1BHBA 2ATKC 1QR8A 4JTCB 1V55C 3D36A 1MOFA 3TCUA 4RQFA 4P2ZA 4PELA 3E89A 3E8FA 2F43G 3FKSG 4GX2A 3CP1A 2IU0A 1GTOA 1KP2A 4LBEC 1Q81W 1K4DC 2CK3G 2XAFA 1S5HC 2WLIA 3D3IA 1SETA 1NKDA 5DM6V 2W6JG 3X2QB 4MW8A 1OCOB 2Q68A 1THZA 4FK5C 4ZKIA 3ZCCA 1XL6A 1M1KW 2XOKG 2PI4A 3ABKB 1H8HG 3MD0A 2WLKA 4R8CA 2WAMA 4OXSA 1B6QA 2OTLV 5LGTA 4RUFA 2YEVA 2QE7G 2XAGA 4BIZA 1FXKA 2LFSA 5L3DA 1K97A 1YJNV 2B5UA 1VQ7V 3QO5A 1GK9A 5CBHA 1H8EG 3P30A 3ZN1A 1V54B 2WLIB 2NNUA 1DLBA 2XNDG 1YITV 3T4ZA 1K8AW 1SRYA 2KB1A 3CCEV 2EIJB 3CCVV 3F5WC 2HVJC 3GB7C 2H8PC 4QIWF 1VQ5V 2P7TC 5KA6A 2DWEC 3FYIB 3E83A 4MTFA 3F7VC 5H6RA 2OCCC 1QLEC 5KA5A 3CC2V 4WFAV 1P7BA 5LGNA 2QEXV 2ZR2A 1S76D 5B1OA 1FXKB 1AI4A 2X7RB 2X6AA 3AG4B 3RBZA 3SYAA 1VQNV 2B1GA 4WFGA 4LCUC 4X88A 1AI6A 3LNMB 4DO2A 2HKOA 3K0DA 2B1IA 4FMTA 2WWWA 2V7QG 5H6QA 3A0RA 4BW5A 4MSWC 4WCEV 3DTUB 2IH1C 3WFVA 3VBBA 2Y69C 4CZZA 2EINC 1NJIW 1HWYA 3NXSA 5L3CA 2JJ1G 2Q69A 5EBLC 4LC1A 4MVRA 1ORQC 1W0KG 2DYRB 3CXCU 3SYOA 5LHHA 3AEIA 1MABG 1NR1A 3ABLC 4QPJA 4QE7A 4XDLA 1OCZB 3CYOA 3ASNB 5B1AB 3BEHA 4P30A 2EILC 5J9PC 2EJRA 3MHHC 4FIPC 3AG1C 5LHIA 1PD3A 3VOUA 3G4SV 2IJJA 2X6BA 4JAUA 1OCCC 2ZDIC 4F4LA 1IXMA 2Q67A 3F7YC 4PA7A 2DWDC 1AI5A 1YI2V 2W6IG 3ZMTA 2R9IA 1AJPA 3QNEA 1M56B 1K92A 1SESA 1JCHA 3IFXA 2QTOA 5IDJA 2X6CA 4I5SA 1WPXA 1EFRG 4L87A 5EBMC 2UXXA 2M7WA 2A9HA 1K73W 1R3JC 1P4RA 1JQ0A 2IU3A 4UXNA 3X2QC 1OCOC 3ML0A 5B1NA 3FB8C 1G4YB 3R65A 3ABKC 2AHYA 4PA3A 4KP4A 3ETDA 5IYCO 1BMFG 3M99B 3H01A 4JTAB 1MSWD 2QM7A 1VQ9V 2EIMB 1K7DA 2NLJC 4FPPA 1Q86W 1VQ8V 1NBMG 3OUSA 2A79B 1F4MA 2EBOA 1QVFU 1GO3F 3LDDA 5KUMA 1PNMA 3ABUA 4MTXA 4R50A 1V54C 2W0FC 4R7CA 2JIZG 2YSUB 2K1EA 3CC4V 4GX1A 2QM8A 5CN0A 3CMAV 4UV8A 1GM9A 4E2LA 2EIJC 1JPXA 3OR7C 3ZMUA 2BOBC 5CA3A 4U7NA 4UUJC 5BZBA 2ITDC 3K9AA 3UM7A 3QO8A 5HFMA 4PDRA 1NR7A 1Q7YW 5H9CA 1FXKC 3AG4C 1NVPB 2WLLB 2R9RB 3CCRV 3I56V 3K79A 3OE7G 3CCUV 5E1AC 1K5SA 4P9OA 1DF5A 3E35A 3OGCC 3FYEB 3OAAG 1TUEB 2XAQA 2OT5A 3WG7B 2WSSG 2X0LA 2DYRC 3JD4A 1FXVA 3IGAC 1CP9A 4WFHA 1Y66A 2XASA 1GM8A 2Q6AA 2IH3C 3ASOB 2GSMB 2QKSA 1EZJA 3ZRVA 5KUKA 1OCZC 2C2AA 3ASNC 1R6KA 3JCZA 4QPKA 4XDJA 5B1AC 3STZC 1YJ9V 1R73A 5L3BA 2EZOA 4MVZA 4DXWA 4UVCA 2WLHA 1Q82W 3SPJA 2D3OW 5EC1C 1S77D 2ZXWB 1QR9A 3ZRSA 4RQEA 3AG3B 4H33A 3GWOA 1M90W 4BAYA 5LHGA 1FS0G 2IJHA 4HZ3A 1R3LC 3OMAB 3KG2A 1M56C 4UVAA 1ZWIC 3ZRWB 1M57B 1H38A 1YTFB 3CD6V 3LDCA 4U7OA 3E8HA 4QJFB 5CBGA 4HYOA 4PDVA 3E8BA 4PA6A 1RPRA 1JOYA 1YSCA 2XAHA 4MTGA 2FTKA 4CBCA 1FXHA 1F51A 1S0VA 3LSSA 3OR6C 5B1BB 1W0JG 2LP7A 4PA4A 3AG2B 1DF4A 4JF3A 1BL8A 1AJQA 4RO2A 2IJKA 5LGUA 2EIMC 2P90A 1F4NA 4MVMA 1PNKA 3CCQV 1OZ0A 3ETGA 4WF9V 3OEHG 3K03A 3ZN0A 3E2EA 5B3SB 2LFRA 4G2KA 3OMNB 3ZJZA 1QBZA 3JD3A 1N8RW 5HFLA 3IC7A 2EIKB 3W7WA 1H2GA 3FB5C 3K08A 4G27B 1JJ2U 3ABTA 2OTJV 4JASA 3CCMV 4JTDB 3K3WA 4BIUA 1OCRB 4ZBMA 3MHSC 1GKFA 1COWG 2WLMA 1KECA 4N23A 3T4DA 4EKWA 4PDLA 1OHHG 3CCSV 1K33A 1VQOV 2JEUA 1VQKV 4GT1A 3JYCA 1RM1B 5IY5B 1PNLA 4MVUA 3QO7A 1E1RG 3OFNG 4WFEA 4KFMA 2UXNA 2WLLA 3B8NA 4JYCA 3WG7C 1S72V 4XBFA 3PJSK 4P9PA 3HB3B 1CPYA 2H94A 1E79G 1KKDA 1YJWV 4JGSA 1UJWB 3ASOC 5IYDO 1QVGU 1DTOA 4HAMA 1VQLV 2EZPA 2WPDG 1ROPA 1R6NA 3CPWU 1K9MW 1F23A 5DN6G 2JK5C 1NH2B 3W7TA 3W7UA 2HFEC 5L3EA 3CMEV 2ZXWC 4MVSA 3SPCA 4UVBA 2DQ3A 1NVPD 3AG3C 3JD2A 1KC8W 3TETA 1EBOA 4MVQA 4JPRA 4MT8A 5L3GA 3E86A 3K04A 3K0GA 3K06A 1M57C 3FB7C 1AR1B 1CEZA 1JVMA 2DYSB 3DGEA 1RPOA 3G6EV 4PA9A 1NQTA 3JD1A 4JAVA 4TWKA 3ABMB 2JJ2G 2GHYA 5CMUA 3ETEA 3P32A 1PKXA 3ZRWA 2HLDG 4YXWG 5B1BC 2A0LA 3RW0A 3AG2C 1K34A 4UV9A 1KP3A 1L1FA 2MK3A 1I5XA 4J9ZB 3ZIAG 3JD0A 4MTOA 4WFBV 1GMGA 1M9NA 3STLC 2P67A 3CC7V 1AJNA 3LSQA 1V55B 5FL7G 2QA4V 5IYBO 3SPHA 3B77A 4MVOA 4R6ZA 4X89A 4Q20A 1KQSU 2ZQMA 3LDEA 5B3SC 1ENVA 1AROP 4GX5A 3BY6A 3W7XA 1K4CC 2XAJA 1YTFD 3CCJV 1YIJV 2EIKC 2P6JA 5GW7A 3SYQA 1W2BU 2V1DA 5EK0A 1SZTA 3FB6C 4FJCC 4H37A 2BOCC 3OW2U 2YEVB 4PDMA 3EHBB 2IW5A 2HJFC 1I5YA 3OUFA 1JX9A 2DQ0A 3RVZA 1OCRC 1E1QG 4GX0A 5CBFA 1VQMV 3EFFK 2WLNA 3UKMA 3ZMSA 4N21A 1K3EA 3SYPA 3G71V 2ZD9A 3B8MA 1G8MA 4G28B 4GCZA 4I9WA 1RM1C 5IY5C 4XDKA 1K5QA 1FFTB 3SPGA 1GM7A 5C93A 3ZRXA 1J95A 4RUEA 1SERA 2JDIG 2ZR3A 5EBWC 3CCLV 1AI7A 4TT3G 1MG1A 3I55V 2HR3A 1R3KC 1BHAA 2DW4A 3T1CA 3OMIB 1R3IC 3HPLC 2OCCB 4MW3A 1QLEB 4Z1MG 4KUMA 4QNHB 2IJIA 4ASUG 1QLNA 2AHZA 2Y48A 1QCEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4N23 A;  1Y66 A;  5CMU A;  3K9A A;  3M99 B;  3H01 A;  1K33 A;  5HFM A;  4FK5 C;  5H9C A;  2P6J A;  5KA6 A;  1Y4M A;  1ENV A;  2EZO A;  4G2K A;  1QR8 A;  1SZT A;  2EBO A;  4FJC C;  1K34 A;  1QBZ A;  1MG1 A;  3B8N A;  1MOF A;  2MK3 A;  5HFL A;  3CYO A;  5KA5 A;  1I5X A;  1DF5 A;  1EBO A;  1I5Y A;  1QR9 A;  2X7R B;  4JPR A;  3MHH C;  2LP7 A;  3MHS C;  2M7W A;  4JGS A;  3GWO A;  4FIP C;  1DF4 A;  3CP1 A;  4JF3 A;  5CN0 A;  1JQ0 A;  2OT5 A;  4E2L A;  4N21 A;  3B77 A;  3WFV A;  1JPX A;  2EZP A;  3P30 A;  3B8M A;  1DLB A;  1QCE A;  1F23 A; 
#chains in the Genus database with same CATH topology
 1FFX A;  1LNQ A;  2RDC A;  3OEE G;  1XMQ O;  2B9Z A;  4L8J A;  1YZB A;  3SJC C;  2Y69 B;  2ZDI A;  4FFK A;  1VP7 A;  3OM3 B;  4TSF G;  2DYS C;  1VMG A;  5GON A;  2OWO A;  4LWS B;  4WFF A;  3A0H Z;  4JI8 B;  2CTP A;  1WLE A;  3G6B A;  3ZHS A;  2PUS A;  2JS5 A;  4X20 A;  3BA9 A;  4DV4 B;  3AG1 B;  4JI4 B;  3RVY A;  3W7S A;  1NH2 D;  2UXD O;  2DN9 A;  3LUT B;  2Z3Y A;  1OCC B;  1NZ6 A;  4J9Y B;  3SJQ C;  2ATK C;  1QR8 A;  4JTC B;  4P2Z A;  3B40 A;  3SJB C;  3OTO B;  1FPO A;  3FKS G;  5ITZ B;  2CTR A;  1KP2 A;  1Q81 W;  3UCS C;  3JCU Z;  2DOS A;  5BR8 B;  5FNV B;  3D3I A;  3AG7 A;  5DM6 V;  4MW8 A;  1THZ A;  4DV3 O;  1M1K W;  5DED A;  3MD0 A;  4B7E A;  3B4S A;  3FAV B;  5KLV H;  4ZIB A;  4JI2 O;  2BSK A;  1FXK A;  1V9P A;  3QO5 A;  1GK9 A;  4DR2 B;  1LUW A;  2NNU A;  3T4Z A;  4IIJ B;  1MNG A;  4OGQ B;  2P7T C;  5KA6 A;  3E83 A;  2ZIM A;  3F7V C;  1IUR A;  3CC2 V;  4WFA V;  3FX7 A;  2ZCE A;  4FM2 A;  1FJG B;  1AI4 A;  1VQN V;  3N2G A;  1AI6 A;  4DO2 A;  4CH4 A;  2HKO A;  4FMT A;  3KCX A;  3A0R A;  3SDL A;  4WCE V;  5D5Q A;  3WFV A;  3DSQ A;  2EIN C;  4WBN A;  3M7M X;  2Q69 A;  5EBL C;  3I5D A;  3H1I H;  5LHH A;  2BTQ A;  3ABL C;  4XDL A;  3CYO A;  4CS4 A;  3BEH A;  1ZTE A;  1FD9 A;  5KX5 A;  5LHI A;  1PD3 A;  2A7W A;  2X6B A;  4EEQ A;  1Y6X A;  2CGO A;  1IXM A;  2GV9 A;  2Q67 A;  4E4E A;  4JI5 O;  4J10 A;  5FPR A;  1AJP A;  1J5E O;  4LH7 A;  1AP5 A;  1JCH A;  3K5O A;  2CUG A;  2X6C A;  1TVK A;  4I50 A;  4I5S A;  4LFA B;  1BQZ A;  1K73 W;  4UXN A;  1JQ0 A;  3R66 A;  1OCO C;  3H1L H;  3ABK C;  4PA3 A;  3IAY A;  4KP4 A;  1Q5O A;  3H1K H;  1MSW D;  2EIM B;  3ICX A;  1VQ8 V;  4YIO A;  1YF2 A;  1IXB A;  2W0F C;  1D2D A;  2JIZ G;  3L73 H;  4NVP A;  3CC4 V;  3CMA V;  2DMX A;  1HNZ B;  4RWU A;  3ZMU A;  4FZ1 A;  1M5I A;  4AIL C;  2ITD C;  5HFM A;  1G1X B;  1Q7Y W;  1GH6 A;  5H9C A;  3AG4 C;  4B7K A;  1N32 B;  1HW7 A;  3I56 V;  1AVM A;  3OE7 G;  3CCU V;  4P9O A;  3G80 A;  3E35 A;  5BMV B;  3JD4 A;  3SJA C;  2Q0O C;  3ASO B;  2GSM B;  1R1B A;  1OCZ C;  1R6K A;  3STZ C;  4ZHQ B;  4MVZ A;  4Z1V A;  1L8D A;  1YCI A;  1B3Q A;  2CH7 A;  2WLH A;  1S77 D;  5LOV A;  2ZM6 O;  2ZXW B;  3ZHQ A;  2BCC H;  1D5A A;  3LNN A;  4H44 B;  4BAY A;  5LHG A;  1X59 A;  4UCO A;  4KXR A;  4DV0 B;  1ZWI C;  1N0J A;  2E76 B;  4U7O A;  1UFI A;  3E8H A;  4QJF B;  5CBG A;  4PDV A;  2EUL A;  5LP6 C;  3CHX A;  4KHP O;  1YSC A;  4ICG A;  4JYY A;  4I0X A;  4CBC A;  5BXZ A;  3OR6 C;  5B1B B;  3AG2 B;  1WP8 A;  1HNW O;  4O4H A;  5LP6 A;  5A9G A;  4RO2 A;  5A2Q N;  1NTM H;  2IJK A;  1PNK A;  3OEH G;  4UCR A;  3CB2 A;  3E2E A;  1A32 A;  2ADQ B;  1XNR O;  5CA1 A;  3OMN B;  3ZJZ A;  4DK1 A;  5CA0 A;  1G6U A;  1EN4 A;  3JD3 A;  4A5U B;  1N8R W;  4JV5 O;  3CWB H;  4GKJ O;  3W7W A;  4NXM O;  4DV6 O;  4JYA O;  3K08 A;  4NXN O;  2OTJ V;  4UCV A;  3CCM V;  4BIU A;  2HJD A;  4ZBM A;  4JI3 O;  3KKY A;  4X66 O;  4PDL A;  4GT1 A;  2E5L O;  2F23 A;  4MVU A;  3QO7 A;  1E1R G;  5LL6 Y;  3B8N A;  4XBF A;  1Q3E A;  1YJW V;  2ZKO A;  1RSO B;  3EXA A;  1QVG U;  1DTO A;  3UO3 A;  2R72 A;  1GN4 A;  1F23 A;  1OV9 A;  3K9S A;  5IWA O;  4DW1 A;  3T1H B;  2UUB O;  4K0K O;  5L3E A;  2GBO A;  3AG3 C;  1IBM O;  3L75 H;  3TET A;  1JFF A;  2E75 B;  4QGP A;  4DRX A;  3K04 A;  3K06 A;  3U11 A;  1JVM A;  4TV9 A;  2NN4 A;  2Z0A A;  1IBK B;  4TWK A;  3DXR A;  3ETE A;  1PKX A;  3BAB A;  2F4V O;  5JVD A;  3RW0 A;  4J9Z B;  4MTO A;  3CC7 V;  2L6L A;  4LF7 O;  1IBL B;  1MZF A;  2QKA A;  4X89 A;  4MVO A;  3HKB B;  2VQF O;  5B3S C;  3BY6 A;  3W7X A;  4LF5 O;  2XAJ A;  2WA4 A;  1NS1 A;  2RJZ A;  2EIK C;  3SYQ A;  2UUC B;  1SZT A;  3FB6 C;  4FJC C;  2BOC C;  2YEV B;  3OT7 A;  3JAS B;  3OUF A;  3M8A A;  5LA6 A;  1E1Q G;  1VQM V;  2YC0 A;  3BHP A;  3THO A;  3B09 A;  3ZMS A;  1RFY A;  3SYP A;  1RM1 C;  4GCZ A;  1DGS A;  1K5Q A;  2FML A;  3BFR A;  3SR2 C;  4DV2 B;  3WB1 A;  1SA0 B;  3CCL V;  5K1X A;  5C8Y B;  5FLX N;  1N34 B;  2QWO B;  5J2U B;  4X64 O;  1Y74 A;  3N2K A;  1WPB A;  4EB6 A;  1QLE B;  4B3T O;  5GTI Z;  1GN3 A;  4K3A A;  2AHZ A;  1TGO A;  3C90 A;  1QCE A;  4H13 B;  3HKE A;  3G67 A;  5EC2 C;  3VQY A;  3K5M A;  2HHH O;  4O2A B;  1Q8I A;  3SYC A;  1ZL8 A;  4NR1 A;  3T2M A;  1Q6H A;  4GKK B;  3FD9 A;  3SPI A;  1US6 A;  3ABM C;  4JI7 O;  2IM9 A;  5ITZ A;  4QE9 A;  5KAF Z;  3RYI A;  1JJO A;  4UB8 Z;  3BAA A;  2EIL B;  1S3J A;  3WB2 A;  2PTM A;  1FKA O;  1XHX A;  1V55 C;  3JAW A;  1MOF A;  4NYK A;  3QVN A;  4RQF A;  3FAV A;  3E89 A;  3E8F A;  1LUV A;  2F43 G;  2F66 C;  3CP1 A;  2IU0 A;  1GTO A;  3U0Z A;  2BE3 A;  1K4D C;  1TUB A;  1SET A;  1NKD A;  5J2T B;  2UUA B;  4IIJ A;  1EM1 A;  2Q68 A;  4FK5 C;  1XL6 A;  2PGG A;  2XOK G;  2WLK A;  4DV7 B;  4R8C A;  1Q90 D;  1Z5V A;  4DR7 B;  2OTL V;  5LGT A;  2VWK A;  2XAG A;  2VQE O;  2LGW A;  4FLT A;  1YJN V;  2UXC O;  1XIL A;  3P30 A;  2WLI B;  4PV1 B;  5K1P A;  1DLB A;  2ARH A;  2XND G;  1KB9 F;  3E22 B;  1YIT V;  2P22 C;  1K8A W;  2N74 A;  3CCV V;  2HVJ C;  4LF4 O;  5EZY B;  1VQ5 V;  5H6R A;  2OCC C;  3UQ8 A;  5KA5 A;  5LGN A;  1S76 D;  3OD4 A;  2B1G A;  4OPA A;  4X88 A;  2B1I A;  2V7Q G;  4BW5 A;  1BQ0 A;  4MSW C;  2IH1 C;  3VBB A;  4CZZ A;  1NJI W;  3HR0 A;  3AK1 A;  2UXB O;  3KZI Z;  1BS3 A;  4AHC A;  3NR7 A;  2DYR B;  4W4L A;  2OIE A;  3CXC U;  3SYO A;  1MAB G;  4YHH O;  3GWK C;  5LXT A;  1Y67 A;  2HP8 A;  4QE7 A;  3ASN B;  5B1A B;  1XMQ B;  2YDE A;  3VOU A;  4ABM A;  2IJJ A;  2N04 A;  2ZDI C;  2Q4P A;  4F4L A;  3F7Y C;  4JZG A;  4PA7 A;  1AI5 A;  2R9I A;  1M56 B;  1K92 A;  2YXL A;  4IGG A;  3SGI A;  3CJH B;  2UXD B;  1WPX A;  2M7W A;  3ZHR A;  3X2Q C;  4F6E A;  3ML0 A;  3R65 A;  1XEQ A;  2XTA A;  2AHY A;  5JQG A;  1VEW A;  5IYC O;  3M99 B;  1HR0 O;  3H01 A;  4JTA B;  3K57 A;  4FPP A;  4F6R B;  1F4M A;  1GO3 F;  5KMG B;  4U3J B;  3ABU A;  1NT2 B;  3JAK A;  2ZE5 A;  3TXQ A;  1V54 C;  4R7C A;  4D6T H;  4DV3 B;  2QM8 A;  5CN0 A;  1GM9 A;  3FFQ A;  4E2L A;  2EIJ C;  1TAE A;  3OR7 C;  2BOB C;  4LFB O;  3CRC A;  1I08 A;  4YJ3 A;  4JI2 B;  3QO8 A;  5LYJ A;  2QKC A;  3O9O A;  3HKC A;  2FL4 A;  1FXK C;  3D3Q A;  2WLL B;  2R9R B;  2KQX A;  1FAF A;  3K79 A;  5E1A C;  4O4L A;  1GN2 A;  1WP7 A;  5KHG A;  3JAT A;  1TUE B;  2F93 B;  2X0L A;  3JAL B;  2Q6A A;  2QKS A;  5KUK A;  1EZJ A;  3ZRV A;  4YJ2 B;  4XDJ A;  1YJ9 V;  5L3B A;  2EZO A;  4DXW A;  4UVC A;  1PP9 H;  1Q82 W;  3SPJ A;  5TIS Z;  2D3O W;  5EC1 C;  5H2F Z;  3GWO A;  1I94 O;  4TV8 A;  2IJH A;  3JAM N;  1HNX O;  3ZBH A;  5E79 Z;  3ZRW B;  1YTF B;  3CD6 V;  2F95 B;  3LDC A;  5EIB C;  1WN7 A;  4HYO A;  3E8B A;  4PA6 A;  2OYQ A;  3BVO A;  3WB0 A;  5CB4 A;  1FXH A;  4JI5 B;  3LSS A;  1S0V A;  1W0J G;  4PA4 A;  1FYJ A;  2QSA A;  3IJ4 A;  1J5E B;  1Q43 A;  5H5N A;  2JGD A;  1F4N A;  2KG7 A;  2E3C A;  3CCQ V;  1VAR A;  1U97 A;  2A06 H;  1XMO O;  4FM1 A;  3RYH A;  4FFB B;  4OX9 O;  4NB5 A;  5EIB D;  5IJ0 A;  1HDJ A;  1H2G A;  3MDS A;  1JJ2 U;  3ABT A;  1EN6 A;  5FPO A;  4JZ2 A;  1GKF A;  2WLM A;  1KEC A;  1BT8 A;  3CCS V;  2UU9 O;  3UT5 A;  3F5T A;  2LQT A;  5IY5 B;  1SF9 A;  4X1I B;  3OFN G;  3RYF B;  4KFM A;  3CRA A;  2AW9 A;  2MW2 B;  3QG5 A;  4JYC A;  3WG7 C;  4TOI A;  1KKD A;  4HNA A;  4DR1 O;  5IYD O;  4JI0 O;  2QTS A;  1VQL V;  3L72 H;  1FFX B;  4CC6 A;  2QWP B;  3BPZ A;  1NH2 B;  2Q73 A;  1XNQ O;  3DC5 A;  3CS5 A;  3SPC A;  2DQ3 A;  1NVP D;  4BR6 A;  5GON B;  4MVQ A;  4JPR A;  5L3G A;  4ZI7 A;  3E86 A;  1DK1 A;  5KAI Z;  5JJN B;  1JMK C;  1M57 C;  1AB3 A;  2DYS B;  4X20 B;  4ZOL A;  4PA9 A;  1ZAU A;  2Y4T A;  4O2B B;  4UB6 Z;  2ZM6 B;  2GHY A;  3C3T A;  4NKG B;  2HLD G;  2PY5 A;  3MAQ A;  2YIB A;  1URF A;  4IHJ B;  4I55 A;  1KP3 A;  4UV9 A;  1L1F A;  1GAX A;  3ZHT A;  3JD0 A;  5BY1 A;  4WFB V;  3STL C;  2P67 A;  2QA4 V;  5IYB O;  4O4I A;  3SPH A;  4KHP B;  4Q20 A;  2RQ6 A;  2F1M A;  4DUY O;  4DR3 O;  1ARO P;  1K4C C;  3CCJ V;  1YIJ V;  1HNW B;  3RYC A;  3P3N A;  2P6J A;  1ZLZ A;  5IYZ A;  2YIB D;  1SA0 A;  4H37 A;  3OW2 U;  4PDM A;  3EHB B;  3TXS A;  2BSK B;  1JX9 A;  4I9Q A;  3RVZ A;  3ZHU A;  1OCR C;  5CBF A;  4CH5 A;  3EFF K;  1XNR B;  2WLN A;  1K3E A;  2ZD9 A;  1G8M A;  4G28 B;  4JV5 B;  4GKJ B;  4NXM B;  4X62 O;  4DV6 B;  4FLX A;  5C93 A;  4JYA B;  3RN4 A;  1QQC A;  4W4K A;  1J95 A;  4NXN B;  1AI7 A;  5IJ9 A;  4JI3 B;  2HR3 A;  4X66 B;  1YVW A;  3C3S A;  5KHI A;  3H9V A;  3N2G B;  3OMI B;  1R3I C;  3T1Y O;  1S5L Z;  2DJV A;  2Y0P A;  1EN5 A;  2E5L B;  3QTC A;  4KUM A;  4TUY A;  2CDY A;  2Q8V A;  4CC5 A;  2Q5Z A;  3CRQ A;  4WBN B;  4RAI A;  4LF6 O;  2BTQ B;  1Y4M A;  1KD1 W;  5L3F A;  2EIN B;  2HVK C;  2JEX A;  1VQ6 V;  4JI1 O;  5IWA B;  1BE3 H;  4DR5 O;  2RMK B;  2UUB B;  3Q4H A;  4K0K B;  1WA8 A;  3ABL B;  2PI5 A;  1IBM B;  1R6T A;  3BA8 A;  4JYB A;  1KU9 A;  3D36 C;  1KUQ A;  3ZX6 A;  1WB8 A;  3L70 H;  3TK1 A;  3J81 N;  4X8A A;  1XL4 A;  2LW1 A;  1BHB A;  1QU7 A;  3D36 A;  4I50 B;  1TVK B;  2ZE8 A;  4DV1 O;  4NTX A;  2Q7G A;  2ZE6 A;  4UCT A;  3H1H H;  2Y4U A;  1VF6 C;  2M6Y A;  2F4V B;  4YY3 O;  4GX2 A;  5EYP A;  4J11 A;  2YID A;  4LNU A;  1RP3 B;  2R9A A;  1S5H C;  2WLI A;  1VF6 A;  3E22 A;  2Q7H A;  1OCO B;  4LF7 B;  1SC5 B;  4ZKI A;  4X1Y A;  3ABK B;  2VQF B;  4OXS A;  1B6Q A;  4LF5 B;  4RUF A;  2QE7 G;  4BIZ A;  1K97 A;  2B5U A;  1AR5 A;  5CBH A;  2JVD A;  4DR4 O;  3APQ A;  1XBL A;  2AGA A;  5LMU O;  1Q6U A;  5B66 Z;  2GTA A;  3F5W C;  3GB7 C;  1N4C A;  3FYI B;  1GRJ A;  3CEI A;  4I7Z B;  3JAR A;  1P7B A;  2ZR2 A;  1B04 A;  1WAZ A;  5B1O A;  3AG4 B;  2X7R B;  2P5O A;  3RBZ A;  4AQY O;  3LSU A;  4LCU C;  4IYI A;  3LNM B;  1Z2G A;  4X1K A;  3DTU B;  5AG2 A;  2Y69 C;  2GUZ A;  1HWY A;  4X64 B;  4LC1 A;  4MVR A;  1Y76 B;  3J7A U;  4B3T B;  3L71 H;  2CH7 B;  4DR6 O;  2P4K A;  4GUN A;  3A8T A;  2ZNI A;  4PJ0 Z;  4QPJ A;  5LOV B;  1OCZ B;  4LR3 A;  1PV0 A;  4B3S O;  2EJR A;  2HHH B;  2K9P A;  4FIP C;  3AG1 C;  4LWS A;  2YXY A;  4NTY A;  3G4S V;  4JAU A;  4J7K A;  1OCC C;  2VRZ A;  4J7Z A;  1AR4 A;  1YI2 V;  2W6I G;  4TQF A;  4JI7 B;  3QNE A;  2AXT Z;  1SES A;  4I0X B;  1MZE A;  4CH3 A;  2QTO A;  1NU1 H;  5IDJ A;  3IC9 A;  4O4H B;  5LP6 B;  3CXH F;  2UXX A;  2A9H A;  2PYL A;  4I4T B;  2ZIN A;  5B1N A;  1G4Y B;  3ETD A;  1BGY H;  5FNV A;  2G38 A;  2QM7 A;  5LMN O;  2NLJ C;  5CA1 B;  1NBM G;  4X9Q A;  5CA0 B;  3OUS A;  2A79 B;  5KUM A;  1GN6 A;  1PNM A;  4R50 A;  2QJ1 A;  2YSU B;  1Q6I A;  4GX1 A;  4B3R O;  4UV8 A;  5CA3 A;  3OTF A;  2Q7E A;  4UUJ C;  5BZB A;  3K9A A;  2VQE B;  4H0L B;  2PYJ A;  4IT5 A;  4PDR A;  2CAZ C;  2O57 A;  2AZ0 A;  2RNB A;  4CS2 A;  2UXC B;  4PI2 A;  3CCR V;  4J41 A;  4DUZ O;  1K5S A;  1W59 A;  1DF5 A;  1YEW A;  4LF4 B;  4FLY A;  2XUM A;  4UCU A;  1N33 O;  2WSS G;  1FXV A;  3IGA C;  2ZT9 B;  1CP9 A;  4LF9 O;  1ZSP A;  1B06 A;  1Y66 A;  2VS0 A;  2XAS A;  4Z2W A;  2YUA A;  4DV5 O;  2C2A A;  2YI9 A;  3JCZ A;  1R73 A;  1JFF B;  2UXB B;  5JJJ B;  4DRX B;  1QR9 A;  3ZRS A;  3AG3 B;  4H33 A;  2CTW A;  1M90 W;  4LF8 O;  3O65 A;  4TV9 B;  4YHH B;  2YS8 A;  4HZ3 A;  1R3L C;  3OMA B;  1SQV H;  4J7J A;  1KMI Z;  3RGB A;  3DXR B;  1H38 A;  2XT9 A;  5JVD B;  4LFC O;  2XHB A;  4B3M O;  1RPR A;  2P4V A;  1JOY A;  1SZX A;  2FTK A;  1DF4 A;  2E74 B;  4X65 O;  3L74 H;  1BL8 A;  4YIP A;  2CGN A;  5LGU A;  3PN1 A;  4JI6 O;  2EIM C;  2P90 A;  3KCY A;  1IDS A;  3K5L A;  1OZ0 A;  4WF9 V;  1H2L A;  3K03 A;  3ZN0 A;  4FLU A;  5B3S B;  2LFR A;  4X1I A;  2Q0A A;  1SQG A;  3RYF A;  5LA6 B;  3IC7 A;  1HR0 B;  1L0N H;  3RWR D;  2EIK B;  4PI0 A;  3FB5 C;  4FLW A;  4G27 B;  2OCH A;  1MA1 A;  4JAS A;  5IT9 N;  3K3W A;  1T5E A;  1COW G;  4C7U A;  1VQO V;  5KHK A;  1NI8 A;  3JYC A;  1RM1 B;  4WFE A;  4LFB B;  2UXN A;  1AP6 A;  1F7Y A;  1S72 V;  1Y74 B;  3N2K B;  1N36 O;  3VQX A;  1CPY A;  4PD4 F;  4EB6 B;  5BMV A;  4JGS A;  1UJW B;  3ASO C;  1XHZ A;  4HAM A;  1IZ3 A;  1ROP A;  1H2S B;  2QR4 A;  3HKE B;  2AZ2 A;  1K9M W;  3CE2 A;  2FYU H;  2JK5 C;  4O2B A;  1S5J A;  3W7T A;  3W7U A;  1SQF A;  2HFE C;  3ETQ A;  1ZL8 B;  3AK3 A;  3ZS8 C;  1HP8 A;  1VF5 B;  2ZE7 A;  2ZXW C;  4MVS A;  3CME V;  4UVB A;  4JI8 O;  4ZHQ A;  2BTO A;  2LO1 A;  4IHJ A;  3CRR A;  2YXH A;  4DV4 O;  2YIA A;  4MT8 A;  4JI4 O;  3K0G A;  1PPJ H;  3RYI B;  2L35 A;  2FB5 A;  4DK0 A;  3FB7 C;  1AR1 B;  5KHH A;  3G6E V;  1NQT A;  4HBN A;  3ABM B;  2JJ2 G;  4O4J B;  5CMU A;  3OTO O;  1I94 B;  2QWR B;  4YXW G;  3JAW B;  1HNX B;  5B1B C;  3AG2 C;  1K34 A;  5BR8 O;  1I5X A;  3ZIA G;  4K35 A;  1GMG A;  1M9N A;  1AJN A;  3LSQ A;  1V55 B;  5FL7 G;  1UPG A;  5JJE B;  1TUB B;  1XOU A;  3B77 A;  4R6Z A;  1KQS U;  2H3O A;  1ENV A;  1PM9 A;  3OGI B;  3TGU H;  4GYC B;  5EK0 A;  1BZK A;  4AI8 A;  2DE0 X;  5D5P A;  4DR2 O;  3D8C A;  2IW5 A;  2HJF C;  3DC6 A;  2Q9L A;  4GX0 A;  1XMO B;  1CXZ B;  1P84 F;  3UKM A;  4NTW A;  4OX9 B;  4XDK A;  3SPG A;  1GM7 A;  1FJG O;  5F2V O;  3VQW A;  4RUE A;  1SER A;  2ZR3 A;  5EBW C;  3I55 V;  2QGN A;  3L9D A;  1R3K C;  1WB7 A;  1BHA A;  2UU9 B;  2ADP A;  3HPL C;  4BIO A;  2OCC B;  4MW3 A;  4Z1M G;  2ODM A;  1RSO A;  1VF7 A;  1WJZ A;  1O9H A;  3ZHV A;  3K58 A;  2QDO A;  4FVM A;  5LBQ A;  4DR1 B;  3RT3 C;  4LH6 A;  2ITC C;  4JI0 B;  5LXT B;  3ZMZ A;  3E8G A;  2WLJ A;  2Z5U A;  4CH6 A;  3K5N A;  4MS2 A;  1XNQ B;  2WA3 A;  3P3P A;  1XDC A;  5JH7 B;  4LP8 A;  2YIC A;  5JCO C;  1VQ4 V;  3HKD B;  3ZMV A;  5JWP A;  4J80 A;  2QWQ B;  4TQD A;  5JCO A;  1YHQ V;  4LFA O;  2HG5 C;  1VQP V;  1PL0 A;  4PHZ A;  5B5E Z;  3CRM A;  1N0N A;  2Y0I A;  3TCU A;  4PEL A;  3BRC A;  4LBE C;  2CK3 G;  3UO2 A;  2QM4 A;  2XAF A;  5JQG B;  3WU2 Z;  2KKW A;  1XQ8 A;  3HKB A;  2YI8 A;  4EFE A;  2W6J G;  3X2Q B;  2OIG A;  3ZCC A;  2PI4 A;  1H8H G;  1SQP H;  1ZUQ A;  4DUY B;  1HNZ O;  4DR3 B;  2WAM A;  3JAK B;  3H1J H;  2YEV A;  2LFS A;  3A0B Z;  3JAS A;  5L3D A;  1SQQ H;  1VQ7 V;  1H8E G;  1N32 O;  4YJ3 B;  3ZN1 A;  1V54 B;  5LYJ B;  1SRY A;  2KB1 A;  3CCE V;  1IVS A;  2EIJ B;  4B08 A;  2CE4 A;  3HKC B;  2H8P C;  4QIW F;  1NTZ H;  1Y76 A;  2DWE C;  4MTF A;  3CX5 F;  1QLE C;  4O4L B;  1P7G A;  4X62 B;  1XUQ A;  1X4T A;  5C8Y A;  2QEX V;  3ZED A;  1FXK B;  2X6A A;  3JAT B;  3SYA A;  1U96 A;  2A3Q A;  4WFG A;  5J2U A;  3K0D A;  2WWW A;  5H6Q A;  3EVK A;  1NTK H;  3NXS A;  5L3C A;  3T1Y B;  2JJ1 G;  1P49 A;  1ORQ C;  1W0K G;  2RCV A;  3AEI A;  4FLZ A;  1NR1 A;  4O2A A;  2CTQ A;  4P30 A;  4DV0 O;  2EIL C;  5J9P C;  4LF6 B;  3MHH C;  4TV8 B;  4I4T A;  4JI1 B;  4DR5 B;  2ILM A;  2GTS A;  2DWD C;  1QNM A;  3ZMT A;  1M4U A;  2LGQ A;  1SKV A;  5CB4 B;  3IFX A;  5IE9 A;  2PF4 E;  1EFR G;  5KX5 B;  4L87 A;  5EBM C;  3CSX A;  3APO A;  1R3J C;  1P4R A;  2IU3 A;  2JGD B;  1QHT A;  2KG7 B;  2V4D A;  3FB8 C;  4DV1 B;  2W0X A;  1BMF G;  4YY3 B;  5J2T A;  1VQ9 V;  1K7D A;  1AIL A;  1Q86 W;  1I7F A;  2PZS A;  3RYH B;  2EBO A;  1QVF U;  3LDD A;  2R70 A;  1M93 A;  4MTX A;  5IJ0 B;  4J42 A;  2K1E A;  2GDS A;  1JPX A;  4KL1 A;  3TJT A;  4U7N A;  4D7S A;  3UT5 B;  4GLX A;  3UM7 A;  2EJ7 A;  1NR7 A;  3VQV A;  5EZY A;  1NVP B;  4DR4 B;  5LMU B;  4HNA B;  1MSD A;  3OGC C;  3FYE B;  3OAA G;  1EZV H;  3T1H O;  1ZX3 A;  2XAQ A;  3BCC H;  2OT5 A;  3WG7 B;  2DYR C;  1H2N A;  1TA8 A;  4WFH A;  1SQX H;  1GM8 A;  1H2K A;  2IH3 C;  4AQY B;  3A2F A;  3ASN C;  4QPK A;  4UCS A;  5B1A C;  1IBK O;  4ZI7 B;  1WNS A;  4RQE A;  4DR6 B;  4ZOL B;  3K59 A;  1FS0 G;  2QWN B;  1YDX A;  1SQB H;  3KG2 A;  1M56 C;  2N05 A;  4UVA A;  4B3S B;  1M57 B;  1XI1 A;  1I0H A;  4I55 B;  1IBL O;  2XAH A;  4MTG A;  3CJH A;  1F51 A;  2LP7 A;  4GZR B;  2LW7 A;  4O4I B;  4JF3 A;  1AJQ A;  2UUC O;  4MVM A;  2EX3 A;  3RYC B;  1OJH A;  3ETG A;  4K8Z A;  5IYZ B;  1KYO F;  2ZIO A;  4G2K A;  1D5N A;  1L0L H;  1QBZ A;  4F6R A;  5HFL A;  5KMG A;  4U3J A;  5LMN B;  4CS3 A;  4DV2 O;  4JTD B;  1OCR B;  4JAA A;  3AK2 A;  3MHS C;  4N23 A;  3T4D A;  4EKW A;  1N34 O;  1OHH G;  1K33 A;  1MMM A;  2JEU A;  1VQK V;  4B3R B;  2JRI A;  2VWJ A;  5IJ9 B;  1PNL A;  4IL6 Z;  2WLL A;  5GTH Z;  1BSM A;  3PJS K;  4P9P A;  1XRE A;  3HB3 B;  2P06 A;  2H94 A;  1E79 G;  2ZNJ A;  2RN9 A;  4TUY B;  4OPH A;  3RFR A;  4FLV A;  1H2M A;  4DUZ B;  2EZP A;  2WPD G;  1SS3 A;  1R6N A;  3CPW U;  1KKC A;  3JAL A;  5DN6 G;  4GKK O;  4O4J A;  2HEP A;  1BCC H;  2IBZ H;  2LJ2 A;  1VIB A;  4YJ2 A;  1N33 B;  3B2E E;  4BW9 A;  4LF9 B;  3JD2 A;  1KC8 W;  3Q4H B;  1EBO A;  4DV5 B;  1WA8 B;  4DYL A;  5KHJ A;  4EFB A;  1LR1 A;  1CEZ A;  3DGE A;  1RPO A;  4Q6G A;  3JD1 A;  3S3W A;  4JAV A;  2D2C B;  3P32 A;  4BWA A;  3ZRW A;  4LF8 B;  2JGU A;  3U10 A;  2A0L A;  4FZ0 A;  5DEC A;  2MK3 A;  4D7T A;  4K8X A;  1Z5W A;  5EYP B;  2UUA O;  4LFC B;  4LNU B;  3JSL A;  4B3M B;  4DW0 A;  4DV7 O;  2ZQM A;  3LDE A;  4DR7 O;  4IYH A;  4GX5 A;  2JS3 A;  4X1Y B;  1YTF D;  2ETN A;  4X65 B;  5GW7 A;  1W2B U;  2V1D A;  3JSN A;  4JI6 B;  1JR9 A;  4U3F H;  3N27 A;  4FM0 A;  1I5Y A;  4FFB A;  2DQ0 A;  3QF7 A;  1PL4 A;  4N21 A;  3G71 V;  4I9W A;  3B8M A;  5IY5 C;  1FFT B;  1IX9 A;  3ZRX A;  2NR5 A;  2JDI G;  3JAR B;  4UFZ A;  3GVM A;  4TT3 G;  1MG1 A;  3J80 N;  1YXB A;  2DW4 A;  3T1C A;  1KBH A;  3S3X A;  5JH7 A;  1JA8 A;  1O9G A;  3HKD A;  4X1K B;  2KSD A;  4QNH B;  2IJI A;  4ASU G;  1QLN A;  2GUZ B;  2Y48 A;  2FKX A;  1N36 B; 
#chains in the Genus database with same CATH homology
 5EC2 C;  5LBQ A;  1LNQ A;  3OEE G;  4RAI A;  2ITC C;  1Y4M A;  1KD1 W;  3ZMZ A;  3SYC A;  2Y69 B;  2ZDI A;  2EIN B;  5L3F A;  3E8G A;  2HVK C;  2JEX A;  2WLJ A;  1VQ6 V;  2Z5U A;  3T2M A;  3OM3 B;  4MS2 A;  4TSF G;  2DYS C;  4WFF A;  3SPI A;  4LP8 A;  3ABL B;  1VQ4 V;  1WLE A;  3ABM C;  3ZMV A;  2PI5 A;  4QE9 A;  2EIL B;  4JYB A;  3AG1 B;  3RVY A;  3W7S A;  1NH2 D;  3TK1 A;  3LUT B;  1YHQ V;  2Z3Y A;  2HG5 C;  1OCC B;  1VQP V;  4X8A A;  1S3J A;  1PL0 A;  4J9Y B;  1XL4 A;  3SJQ C;  1BHB A;  2ATK C;  1QR8 A;  4JTC B;  1V55 C;  3D36 A;  1MOF A;  3TCU A;  4RQF A;  4P2Z A;  4PEL A;  3E89 A;  3E8F A;  2F43 G;  3FKS G;  4GX2 A;  3CP1 A;  2IU0 A;  1GTO A;  1KP2 A;  4LBE C;  1Q81 W;  1K4D C;  2CK3 G;  2XAF A;  1S5H C;  2WLI A;  3D3I A;  1SET A;  1NKD A;  5DM6 V;  2W6J G;  3X2Q B;  4MW8 A;  1OCO B;  2Q68 A;  1THZ A;  4FK5 C;  4ZKI A;  3ZCC A;  1XL6 A;  1M1K W;  2XOK G;  2PI4 A;  3ABK B;  1H8H G;  3MD0 A;  2WLK A;  4R8C A;  2WAM A;  4OXS A;  1B6Q A;  2OTL V;  5LGT A;  4RUF A;  2YEV A;  2QE7 G;  2XAG A;  4BIZ A;  1FXK A;  2LFS A;  5L3D A;  1K97 A;  1YJN V;  2B5U A;  1VQ7 V;  3QO5 A;  1GK9 A;  5CBH A;  1H8E G;  3P30 A;  3ZN1 A;  1V54 B;  2WLI B;  2NNU A;  1DLB A;  2XND G;  1YIT V;  3T4Z A;  1K8A W;  1SRY A;  2KB1 A;  3CCE V;  2EIJ B;  3CCV V;  3F5W C;  2HVJ C;  3GB7 C;  2H8P C;  4QIW F;  1VQ5 V;  2P7T C;  5KA6 A;  2DWE C;  3FYI B;  3E83 A;  4MTF A;  3F7V C;  5H6R A;  2OCC C;  1QLE C;  5KA5 A;  3CC2 V;  4WFA V;  1P7B A;  5LGN A;  2QEX V;  2ZR2 A;  1S76 D;  5B1O A;  1FXK B;  1AI4 A;  2X7R B;  2X6A A;  3AG4 B;  3RBZ A;  3SYA A;  1VQN V;  2B1G A;  4WFG A;  4LCU C;  4X88 A;  1AI6 A;  3LNM B;  4DO2 A;  2HKO A;  3K0D A;  2B1I A;  4FMT A;  2WWW A;  2V7Q G;  5H6Q A;  3A0R A;  4BW5 A;  4MSW C;  4WCE V;  3DTU B;  2IH1 C;  3WFV A;  3VBB A;  2Y69 C;  4CZZ A;  2EIN C;  1NJI W;  1HWY A;  3NXS A;  5L3C A;  2JJ1 G;  2Q69 A;  5EBL C;  4LC1 A;  4MVR A;  1ORQ C;  1W0K G;  2DYR B;  3CXC U;  3SYO A;  5LHH A;  3AEI A;  1MAB G;  1NR1 A;  3ABL C;  4QPJ A;  4QE7 A;  4XDL A;  1OCZ B;  3CYO A;  3ASN B;  5B1A B;  3BEH A;  4P30 A;  2EIL C;  5J9P C;  2EJR A;  3MHH C;  4FIP C;  3AG1 C;  5LHI A;  1PD3 A;  3VOU A;  3G4S V;  2IJJ A;  2X6B A;  4JAU A;  1OCC C;  2ZDI C;  4F4L A;  1IXM A;  2Q67 A;  3F7Y C;  4PA7 A;  2DWD C;  1AI5 A;  1YI2 V;  2W6I G;  3ZMT A;  2R9I A;  1AJP A;  3QNE A;  1M56 B;  1K92 A;  1SES A;  1JCH A;  3IFX A;  2QTO A;  5IDJ A;  2X6C A;  4I5S A;  1WPX A;  1EFR G;  4L87 A;  5EBM C;  2UXX A;  2M7W A;  2A9H A;  1K73 W;  1R3J C;  1P4R A;  1JQ0 A;  2IU3 A;  4UXN A;  3X2Q C;  1OCO C;  3ML0 A;  5B1N A;  3FB8 C;  1G4Y B;  3R65 A;  3ABK C;  2AHY A;  4PA3 A;  4KP4 A;  3ETD A;  5IYC O;  1BMF G;  3M99 B;  3H01 A;  4JTA B;  1MSW D;  2QM7 A;  1VQ9 V;  2EIM B;  1K7D A;  2NLJ C;  4FPP A;  1Q86 W;  1VQ8 V;  1NBM G;  3OUS A;  2A79 B;  1F4M A;  2EBO A;  1QVF U;  1GO3 F;  3LDD A;  5KUM A;  1PNM A;  3ABU A;  4MTX A;  4R50 A;  1V54 C;  2W0F C;  4R7C A;  2JIZ G;  2YSU B;  2K1E A;  3CC4 V;  4GX1 A;  2QM8 A;  5CN0 A;  3CMA V;  4UV8 A;  1GM9 A;  4E2L A;  2EIJ C;  1JPX A;  3OR7 C;  3ZMU A;  2BOB C;  5CA3 A;  4U7N A;  4UUJ C;  5BZB A;  2ITD C;  3K9A A;  3UM7 A;  3QO8 A;  5HFM A;  4PDR A;  1NR7 A;  1Q7Y W;  5H9C A;  1FXK C;  3AG4 C;  1NVP B;  2WLL B;  2R9R B;  3CCR V;  3I56 V;  3K79 A;  3OE7 G;  3CCU V;  5E1A C;  1K5S A;  4P9O A;  1DF5 A;  3E35 A;  3OGC C;  3FYE B;  3OAA G;  1TUE B;  2XAQ A;  2OT5 A;  3WG7 B;  2WSS G;  2X0L A;  2DYR C;  3JD4 A;  1FXV A;  3IGA C;  1CP9 A;  4WFH A;  1Y66 A;  2XAS A;  1GM8 A;  2Q6A A;  2IH3 C;  3ASO B;  2GSM B;  2QKS A;  1EZJ A;  3ZRV A;  5KUK A;  1OCZ C;  2C2A A;  3ASN C;  1R6K A;  3JCZ A;  4QPK A;  4XDJ A;  5B1A C;  3STZ C;  1YJ9 V;  1R73 A;  5L3B A;  2EZO A;  4MVZ A;  4DXW A;  4UVC A;  2WLH A;  1Q82 W;  3SPJ A;  2D3O W;  5EC1 C;  1S77 D;  2ZXW B;  1QR9 A;  3ZRS A;  4RQE A;  3AG3 B;  4H33 A;  3GWO A;  1M90 W;  4BAY A;  5LHG A;  1FS0 G;  2IJH A;  4HZ3 A;  1R3L C;  3OMA B;  3KG2 A;  1M56 C;  4UVA A;  1ZWI C;  3ZRW B;  1M57 B;  1H38 A;  1YTF B;  3CD6 V;  3LDC A;  4U7O A;  3E8H A;  4QJF B;  5CBG A;  4HYO A;  4PDV A;  3E8B A;  4PA6 A;  1RPR A;  1JOY A;  1YSC A;  2XAH A;  4MTG A;  2FTK A;  4CBC A;  1FXH A;  1F51 A;  1S0V A;  3LSS A;  3OR6 C;  5B1B B;  1W0J G;  2LP7 A;  4PA4 A;  3AG2 B;  1DF4 A;  4JF3 A;  1BL8 A;  1AJQ A;  4RO2 A;  2IJK A;  5LGU A;  2EIM C;  2P90 A;  1F4N A;  4MVM A;  1PNK A;  3CCQ V;  1OZ0 A;  3ETG A;  4WF9 V;  3OEH G;  3K03 A;  3ZN0 A;  3E2E A;  5B3S B;  2LFR A;  4G2K A;  3OMN B;  3ZJZ A;  1QBZ A;  3JD3 A;  1N8R W;  5HFL A;  3IC7 A;  2EIK B;  3W7W A;  1H2G A;  3FB5 C;  3K08 A;  4G27 B;  1JJ2 U;  3ABT A;  2OTJ V;  4JAS A;  3CCM V;  4JTD B;  3K3W A;  4BIU A;  1OCR B;  4ZBM A;  3MHS C;  1GKF A;  1COW G;  2WLM A;  1KEC A;  4N23 A;  3T4D A;  4EKW A;  4PDL A;  1OHH G;  3CCS V;  1K33 A;  1VQO V;  2JEU A;  1VQK V;  4GT1 A;  3JYC A;  1RM1 B;  5IY5 B;  1PNL A;  4MVU A;  3QO7 A;  1E1R G;  3OFN G;  4WFE A;  4KFM A;  2UXN A;  2WLL A;  3B8N A;  4JYC A;  3WG7 C;  1S72 V;  4XBF A;  3PJS K;  4P9P A;  3HB3 B;  1CPY A;  2H94 A;  1E79 G;  1KKD A;  1YJW V;  4JGS A;  1UJW B;  3ASO C;  5IYD O;  1QVG U;  1DTO A;  4HAM A;  1VQL V;  2EZP A;  2WPD G;  1ROP A;  1R6N A;  3CPW U;  1K9M W;  1F23 A;  5DN6 G;  2JK5 C;  1NH2 B;  3W7T A;  3W7U A;  2HFE C;  5L3E A;  3CME V;  2ZXW C;  4MVS A;  3SPC A;  4UVB A;  2DQ3 A;  1NVP D;  3AG3 C;  3JD2 A;  1KC8 W;  3TET A;  1EBO A;  4MVQ A;  4JPR A;  4MT8 A;  5L3G A;  3E86 A;  3K04 A;  3K0G A;  3K06 A;  1M57 C;  3FB7 C;  1AR1 B;  1CEZ A;  1JVM A;  2DYS B;  3DGE A;  1RPO A;  3G6E V;  4PA9 A;  1NQT A;  3JD1 A;  4JAV A;  4TWK A;  3ABM B;  2JJ2 G;  2GHY A;  5CMU A;  3ETE A;  3P32 A;  1PKX A;  3ZRW A;  2HLD G;  4YXW G;  5B1B C;  2A0L A;  3RW0 A;  3AG2 C;  1K34 A;  4UV9 A;  1KP3 A;  1L1F A;  2MK3 A;  1I5X A;  4J9Z B;  3ZIA G;  3JD0 A;  4MTO A;  4WFB V;  1GMG A;  1M9N A;  3STL C;  2P67 A;  3CC7 V;  1AJN A;  3LSQ A;  1V55 B;  5FL7 G;  2QA4 V;  5IYB O;  3SPH A;  3B77 A;  4MVO A;  4R6Z A;  4X89 A;  4Q20 A;  1KQS U;  2ZQM A;  3LDE A;  5B3S C;  1ENV A;  1ARO P;  4GX5 A;  3BY6 A;  3W7X A;  1K4C C;  2XAJ A;  1YTF D;  3CCJ V;  1YIJ V;  2EIK C;  2P6J A;  5GW7 A;  3SYQ A;  1W2B U;  2V1D A;  5EK0 A;  1SZT A;  3FB6 C;  4FJC C;  4H37 A;  2BOC C;  3OW2 U;  2YEV B;  4PDM A;  3EHB B;  2IW5 A;  2HJF C;  1I5Y A;  3OUF A;  1JX9 A;  2DQ0 A;  3RVZ A;  1OCR C;  1E1Q G;  4GX0 A;  5CBF A;  1VQM V;  3EFF K;  2WLN A;  3UKM A;  3ZMS A;  4N21 A;  1K3E A;  3SYP A;  3G71 V;  2ZD9 A;  3B8M A;  1G8M A;  4G28 B;  4GCZ A;  4I9W A;  1RM1 C;  5IY5 C;  4XDK A;  1K5Q A;  1FFT B;  3SPG A;  1GM7 A;  5C93 A;  3ZRX A;  1J95 A;  4RUE A;  1SER A;  2JDI G;  2ZR3 A;  5EBW C;  3CCL V;  1AI7 A;  4TT3 G;  1MG1 A;  3I55 V;  2HR3 A;  1R3K C;  1BHA A;  2DW4 A;  3T1C A;  3OMI B;  1R3I C;  3HPL C;  2OCC B;  4MW3 A;  1QLE B;  4Z1M G;  4KUM A;  4QNH B;  2IJI A;  4ASU G;  1QLN A;  2AHZ A;  2Y48 A;  1QCE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...