1K39A

The structure of yeast delta3-delta2-enoyl-coa isomerase complexed with octanoyl-coa
Total Genus 95
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
95
sequence length
269
structure length
269
Chain Sequence
b'EIRQNEKISYRIEGPFFIIHLINPDNLNALEGEDYIYLGELLELADRNRDVYFTIIQSSGRFFSSGADFKGIAKAQGDDTNKYPSETSKWVSNFVARNVYVTDAFIKHSKVLICCLNGPAIGLSAALVALCDIVYSINDKVYLLYPFANLGLITEGGTTVSLPLKFGTNTTYECLMFNKPFKYDIMCENGFISKNFNMPSSNAEAFNAKVLEELREKVKGLYLPSCLGMKKLLKSNHIDAFNKANSVEVNESLKYWVDGEPLKRFRQLG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords d3,d2-enoyl CoA isomerase ECI1
publication title The crystal structure of delta3-delta2-enoyl-CoA isomerase
doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Isomerase
total genus 95
structure length 269
sequence length 269
chains with identical sequence B, C
ec nomenclature ec 5.3.3.8: Delta(3)-Delta(2)-enoyl-CoA isomerase.
pdb deposition date 2001-10-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00378 ECH_1 Enoyl-CoA hydratase/isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.226.10 Alpha Beta Alpha-Beta Complex 2-enoyl-CoA Hydratase; Chain A, domain 1 2-enoyl-CoA Hydratase; Chain A, domain 1 1k39A00
1JXZA 5CTBA 1EY3A 2D3TA 2DUBA 2NP9A 3TRRA 4U0HA 3R6HA 4I52A 1YG6A 5DZKH 3HLN1 4ASIA 2VREA 4IZDA 1MJ3A 1DUBA 3IBBA 1HZDA 1FC7A 1NZYA 4RCNA 4JFCA 2QQ3A 3BPPA 4F47A 2A7KA 4L8KA 5DZKA 3BEZA 3SWXA 1UIYA 3JU1A 3P5MA 2EJ5A 4OMRA 1PJHA 2C8TA 4Q0GA 3RSIA 2W3PA 4U19A 1DCIA 2CBYA 3TZ3A 4EMLA 3QK8A 4FN7A 5G1RA 1UYTA 3HE2A 4ZDDA 3QREA 3R9QA 3R0OA 4JCQA 1HNUA 3QKAA 3HINA 3GF7A 1ON9A 3M6MA 1FCFA 4QFEA 1ON3A 1Q51A 4NEKA 4QIJA 3FDUA 5JBWA 4FB8A 3FF6A 1SG4A 5DUCA 1XNVA 3QMJA 2GTRA 5G1SA 4ZDBA 3HP0A 5KDRA 3H02A 3OT6A 3K8XA 3TVUA 3PZKA 3TV5A 3VIVA 3ZWBA 4B3JA 2FBMA 1XNYA 3ZW9A 2BZRA 1TG6A 3DORA 4K29A 2F9IB 3PEAA 4EMMA 1WDMA 1WDLA 1XX4A 3BF0A 1EF9A 3G64A 4JCTA 1FC6A 5C9GA 2ZL4A 3MFMA 3Q7HA 4OLQA 3IAVA 4L6WA 4JVTA 2J5GA 2ZQRA 4ZDCA 3KTGA 4MXIA 3KQFA 4JCSA 2FZSA 4MOUA 4LK5A 4KWBA 4KNPA 5JBXA 4Z0MA 3GMAA 5INFA 4KPKA 4ZU2A 4B3IA 5E0SH 4FZWA 3GKBA 5DU8A 2J5SA 4JOTA 4MI2A 1K39A 1XNWA 3T8BA 4DI1A 3KTJA 3DJAA 1N6FA 4FJWD 5IKLB 3ZW8A 5E0SA 3HRXA 3STAA 2FW2A 2A81A 3V5IA 4HC8A 1TYFA 2X58A 2F9YB 1W2XA 4ZDEA 3U9SB 5E0NX 4RYFH 1Y7OA 4JCRA 3MOYA 5DL1A 3U9RB 3R9SA 2F9IA 4FZWC 4I4ZA 3V5EA 1EF8A 2ZQQA 3Q1TA 2J5IB 3T8AA 4NNQA 5CTCA 4FN8A 2ZL0A 2IEXA 2J5GD 4IZCA 4RYFA 1J7XA 3MYBA 5G1QA 3R9TA 1OD4A 1K32A 3TDCA 3ST9A 4ZDFA 4Q1IA 1Q52A 5FUSA 3QYRA 3U9TB 3KTIA 5INGA 4HNKA 1UYRA 2VSSF 2VSUF 1RJMA 5MGBA 3PE8A 1N6DA 4K2NA 4ELWA 3OMEA 5KJPA 3T89A 3T88A 2CE3A 3GLMA 4JYJA 3H0QA 3ZWCA 4GM2A 3RSTA 4FNBA 2ZL3A 3SLLA 5DTPA 2F9YA 4ELSA 1HNOA 4FNDA 1VRGA 3PGQA 4U18A 3OC7A 2PG8A 4YLHA 3Q0GA 3T3WA 1WZ8A 2VSSA 2VSUA 3KTKA 3WG5A 2A7SA 1XO6A 4B3HA 3ISAA 3I47A 2J5IA 2VX2A 2F6QA 2ZL2A 3TT7A 2PPYA 3P85A 2X24A 3Q0JA 3GF3A 3TVWA 3H0UA 3LKEA 3L3SA 4U1AA 1WDKA 3KTHA 2F6IA 3H81A 4IZBA 1NZYB 4QIIA 2WTBA 4OG1A 4U0GH 2VSUC 1N6EA 2HW5A 4WYOB 4JWVA 1X0UA 5FIFA 3ZWAA 2DEOA 4JYLA 4KD6A 5DU6A 5C90A 1YG8A 3H0SA 1OD2A 2UZFA 4ELXA 1UYSA 3RRVA 2J5II 5INIA 3LAOA 4U0GA 4WCZA 3TLFA 1SZOA 3H0JA 3NJBA 4JJTA 4EMPA 5DTWA 3N6RB 3P2LA 2Q34A 3NJDA 3K50A 1RJNA 4WZ8B 3QXZA 4G2RA 3MT6A 1O8UA 5DUFA 2Q35A 4GHNA 5DKPA 3M6NA 3TT6A 3QWDA 5DU4A 1FC9A 2VSUE 1UYVA 2VSSE 4K3WA 3IB9A 4I42A 1PIXA 2PBPA 4JSBA 3QXIA 5KDRB 2Q2XA
chains in the Genus database with same CATH superfamily
1JXZA 5CTBA 1EY3A 2D3TA 2DUBA 2NP9A 3TRRA 4U0HA 3R6HA 4I52A 1YG6A 5DZKH 3HLN1 4ASIA 2VREA 4IZDA 1MJ3A 1DUBA 3IBBA 1HZDA 1FC7A 1NZYA 4RCNA 4JFCA 2QQ3A 3BPPA 4F47A 2A7KA 4L8KA 5DZKA 3BEZA 3SWXA 1UIYA 3JU1A 3P5MA 2EJ5A 4OMRA 1PJHA 2C8TA 4Q0GA 3RSIA 2W3PA 4U19A 1DCIA 2CBYA 3TZ3A 4EMLA 3QK8A 4FN7A 5G1RA 1UYTA 3HE2A 4ZDDA 3QREA 3R9QA 3R0OA 4JCQA 1HNUA 3QKAA 3HINA 3GF7A 1ON9A 3M6MA 1FCFA 4QFEA 1ON3A 1Q51A 4NEKA 4QIJA 3FDUA 5JBWA 4FB8A 3FF6A 1SG4A 5DUCA 1XNVA 3QMJA 2GTRA 5G1SA 4ZDBA 3HP0A 5KDRA 3H02A 3OT6A 3K8XA 3TVUA 3PZKA 3TV5A 3VIVA 3ZWBA 4B3JA 2FBMA 1XNYA 3ZW9A 2BZRA 1TG6A 3DORA 4K29A 2F9IB 3PEAA 4EMMA 3BPTA 1WDMA 1WDLA 1XX4A 3BF0A 1EF9A 3G64A 4JCTA 1FC6A 5C9GA 2ZL4A 3MFMA 3Q7HA 4OLQA 3IAVA 4L6WA 4JVTA 2J5GA 2ZQRA 4ZDCA 3KTGA 4MXIA 3KQFA 4JCSA 2FZSA 4MOUA 4LK5A 4KWBA 4KNPA 5JBXA 4Z0MA 3GMAA 5INFA 4KPKA 4ZU2A 4B3IA 5E0SH 4FZWA 3GKBA 5DU8A 2J5SA 2YJGA 4JOTA 4MI2A 1K39A 1XNWA 3T8BA 4DI1A 3KTJA 3DJAA 1N6FA 4FJWD 5IKLB 3ZW8A 5E0SA 3HRXA 3STAA 2FW2A 2A81A 4NARA 3V5IA 4HC8A 1TYFA 2X58A 2F9YB 1W2XA 4ZDEA 3U9SB 5E0NX 4RYFH 1Y7OA 4JCRA 3MOYA 5DL1A 3U9RB 3R9SA 2F9IA 4FZWC 4I4ZA 3V5EA 1EF8A 2ZQQA 3Q1TA 2J5IB 3T8AA 4NNQA 5CTCA 4FN8A 2ZL0A 2IEXA 2J5GD 4IZCA 4RYFA 1J7XA 3MYBA 5G1QA 3R9TA 1OD4A 1K32A 3TDCA 3ST9A 4ZDFA 4Q1IA 1Q52A 5FUSA 3QYRA 3U9TB 3KTIA 5INGA 4HNKA 1UYRA 2VSSF 2VSUF 1RJMA 5MGBA 3PE8A 4HDTA 1N6DA 4K2NA 4ELWA 3OMEA 5KJPA 3T89A 3T88A 2CE3A 3GLMA 4JYJA 3H0QA 3ZWCA 4GM2A 3RSTA 4FNBA 2ZL3A 3SLLA 5DTPA 2F9YA 4ELSA 4J2UA 1HNOA 4FNDA 1VRGA 3PGQA 4U18A 3OC7A 2PG8A 4YLHA 3Q0GA 3T3WA 1WZ8A 2VSSA 2VSUA 3KTKA 3WG5A 2A7SA 1XO6A 4B3HA 3ISAA 3I47A 2J5IA 2VX2A 2F6QA 2ZL2A 3TT7A 2PPYA 3P85A 2X24A 3Q0JA 3GF3A 3TVWA 3H0UA 3LKEA 3L3SA 4U1AA 1WDKA 3KTHA 2F6IA 3H81A 5HUQA 4IZBA 1NZYB 4QIIA 2WTBA 4OG1A 4U0GH 2VSUC 1N6EA 2HW5A 4WYOB 4JWVA 1X0UA 5FIFA 3ZWAA 2DEOA 4JYLA 4KD6A 5DU6A 5C90A 1YG8A 3H0SA 1OD2A 2UZFA 4ELXA 1UYSA 3RRVA 2J5II 5INIA 3LAOA 4U0GA 4WCZA 3TLFA 1SZOA 3H0JA 3NJBA 4JJTA 4EMPA 5DTWA 3N6RB 3P2LA 2Q34A 3NJDA 3K50A 1RJNA 4WZ8B 3QXZA 4G2RA 3MT6A 1O8UA 5DUFA 2Q35A 4GHNA 5DKPA 3M6NA 3TT6A 3QWDA 5DU4A 1FC9A 2VSUE 1UYVA 2VSSE 4K3WA 3IB9A 4I42A 1PIXA 2PBPA 4JSBA 3QXIA 5KDRB 2Q2XA
chains in the Genus database with same CATH topology
1JXZA 5CTBA 1EY3A 2D3TA 2DUBA 2NP9A 3TRRA 4U0HA 3R6HA 4I52A 1YG6A 5DZKH 3HLN1 4ASIA 2VREA 4IZDA 1MJ3A 1DUBA 3IBBA 1HZDA 1FC7A 1NZYA 4RCNA 4JFCA 2QQ3A 3BPPA 4F47A 2A7KA 4L8KA 5DZKA 3BEZA 3SWXA 1UIYA 3JU1A 3P5MA 2EJ5A 4OMRA 1PJHA 2C8TA 4Q0GA 3RSIA 2W3PA 4U19A 1DCIA 2CBYA 3TZ3A 4EMLA 3QK8A 4FN7A 5G1RA 1UYTA 3HE2A 4ZDDA 3QREA 3R9QA 3R0OA 4JCQA 1HNUA 3QKAA 3HINA 3GF7A 1ON9A 3M6MA 1FCFA 4QFEA 1ON3A 1Q51A 4NEKA 4QIJA 3FDUA 5JBWA 4FB8A 3FF6A 1SG4A 5DUCA 1XNVA 3QMJA 2GTRA 5G1SA 4ZDBA 3HP0A 5KDRA 3H02A 3OT6A 3K8XA 3TVUA 3PZKA 3TV5A 3VIVA 3ZWBA 4B3JA 2FBMA 1XNYA 3ZW9A 2BZRA 1TG6A 3DORA 4K29A 2F9IB 3PEAA 4EMMA 3BPTA 1WDMA 1WDLA 1XX4A 3BF0A 1EF9A 3G64A 4JCTA 1FC6A 5C9GA 2ZL4A 3MFMA 3Q7HA 4OLQA 3IAVA 4L6WA 4JVTA 2J5GA 2ZQRA 4ZDCA 3KTGA 4MXIA 3KQFA 4JCSA 2FZSA 4MOUA 4LK5A 4KWBA 4KNPA 5JBXA 4Z0MA 3GMAA 5INFA 4KPKA 4ZU2A 4B3IA 5E0SH 4FZWA 3GKBA 5DU8A 2J5SA 2YJGA 4JOTA 4MI2A 1K39A 1XNWA 3T8BA 4DI1A 3KTJA 3DJAA 1N6FA 4FJWD 5IKLB 3ZW8A 5E0SA 3HRXA 3STAA 2FW2A 2A81A 4NARA 3V5IA 4HC8A 1TYFA 2X58A 2F9YB 1W2XA 4ZDEA 3U9SB 5E0NX 4RYFH 1Y7OA 4JCRA 3MOYA 5DL1A 3U9RB 3R9SA 2F9IA 4FZWC 4I4ZA 3V5EA 1EF8A 2ZQQA 3Q1TA 2J5IB 3T8AA 4NNQA 5CTCA 4FN8A 2ZL0A 2IEXA 2J5GD 4IZCA 4RYFA 1J7XA 3MYBA 5G1QA 3R9TA 1OD4A 1K32A 3TDCA 3ST9A 4ZDFA 4Q1IA 1Q52A 5FUSA 3QYRA 3U9TB 3KTIA 5INGA 4HNKA 1UYRA 2VSSF 2VSUF 1RJMA 5MGBA 3PE8A 4HDTA 1N6DA 4K2NA 4ELWA 3OMEA 5KJPA 3T89A 3T88A 2CE3A 3GLMA 4JYJA 3H0QA 3ZWCA 4GM2A 3RSTA 4FNBA 2ZL3A 3SLLA 5DTPA 2F9YA 4ELSA 4J2UA 1HNOA 4FNDA 1VRGA 3PGQA 4U18A 3OC7A 2PG8A 4YLHA 3Q0GA 3T3WA 1WZ8A 2VSSA 2VSUA 3KTKA 3WG5A 2A7SA 1XO6A 4B3HA 3ISAA 3I47A 2J5IA 2VX2A 2F6QA 2ZL2A 3TT7A 2PPYA 3P85A 2X24A 3Q0JA 3GF3A 3TVWA 3H0UA 3LKEA 3L3SA 4U1AA 1WDKA 3KTHA 2F6IA 3H81A 5HUQA 4IZBA 1NZYB 4QIIA 2WTBA 4OG1A 4U0GH 2VSUC 1N6EA 2HW5A 4WYOB 4JWVA 1X0UA 5FIFA 3ZWAA 2DEOA 4JYLA 4KD6A 5DU6A 5C90A 1YG8A 3H0SA 1OD2A 2UZFA 4ELXA 1UYSA 3RRVA 2J5II 5INIA 3LAOA 4U0GA 4WCZA 3TLFA 1SZOA 3H0JA 3NJBA 4JJTA 4EMPA 5DTWA 3N6RB 3P2LA 2Q34A 3NJDA 3K50A 1RJNA 4WZ8B 3QXZA 4G2RA 3MT6A 1O8UA 5DUFA 2Q35A 4GHNA 5DKPA 3M6NA 3TT6A 3QWDA 5DU4A 1FC9A 2VSUE 1UYVA 2VSSE 4K3WA 3IB9A 4I42A 1PIXA 2PBPA 4JSBA 3QXIA 5KDRB 2Q2XA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1JXZ A;  5CTB A;  1EY3 A;  2D3T A;  2DUB A;  2NP9 A;  3TRR A;  4U0H A;  3R6H A;  4I52 A;  1YG6 A;  5DZK H;  3HLN 1;  4ASI A;  2VRE A;  4IZD A;  1MJ3 A;  1DUB A;  3IBB A;  1HZD A;  1FC7 A;  1NZY A;  4RCN A;  4JFC A;  2QQ3 A;  3BPP A;  4F47 A;  2A7K A;  4L8K A;  5DZK A;  3BEZ A;  3SWX A;  1UIY A;  3JU1 A;  3P5M A;  2EJ5 A;  4OMR A;  1PJH A;  2C8T A;  4Q0G A;  3RSI A;  2W3P A;  4U19 A;  1DCI A;  2CBY A;  3TZ3 A;  4EML A;  3QK8 A;  4FN7 A;  5G1R A;  1UYT A;  3HE2 A;  4ZDD A;  3QRE A;  3R9Q A;  3R0O A;  4JCQ A;  1HNU A;  3QKA A;  3HIN A;  3GF7 A;  1ON9 A;  3M6M A;  1FCF A;  4QFE A;  1ON3 A;  1Q51 A;  4NEK A;  4QIJ A;  3FDU A;  5JBW A;  4FB8 A;  3FF6 A;  1SG4 A;  5DUC A;  1XNV A;  3QMJ A;  2GTR A;  5G1S A;  4ZDB A;  3HP0 A;  5KDR A;  3H02 A;  3OT6 A;  3K8X A;  3TVU A;  3PZK A;  3TV5 A;  3VIV A;  3ZWB A;  4B3J A;  2FBM A;  1XNY A;  3ZW9 A;  2BZR A;  1TG6 A;  3DOR A;  4K29 A;  2F9I B;  3PEA A;  4EMM A;  1WDM A;  1WDL A;  1XX4 A;  3BF0 A;  1EF9 A;  3G64 A;  4JCT A;  1FC6 A;  5C9G A;  2ZL4 A;  3MFM A;  3Q7H A;  4OLQ A;  3IAV A;  4L6W A;  4JVT A;  2J5G A;  2ZQR A;  4ZDC A;  3KTG A;  4MXI A;  3KQF A;  4JCS A;  2FZS A;  4MOU A;  4LK5 A;  4KWB A;  4KNP A;  5JBX A;  4Z0M A;  3GMA A;  5INF A;  4KPK A;  4ZU2 A;  4B3I A;  5E0S H;  4FZW A;  3GKB A;  5DU8 A;  2J5S A;  4JOT A;  4MI2 A;  1K39 A;  1XNW A;  3T8B A;  4DI1 A;  3KTJ A;  3DJA A;  1N6F A;  4FJW D;  5IKL B;  3ZW8 A;  5E0S A;  3HRX A;  3STA A;  2FW2 A;  2A81 A;  3V5I A;  4HC8 A;  1TYF A;  2X58 A;  2F9Y B;  1W2X A;  4ZDE A;  3U9S B;  5E0N X;  4RYF H;  1Y7O A;  4JCR A;  3MOY A;  5DL1 A;  3U9R B;  3R9S A;  2F9I A;  4FZW C;  4I4Z A;  3V5E A;  1EF8 A;  2ZQQ A;  3Q1T A;  2J5I B;  3T8A A;  4NNQ A;  5CTC A;  4FN8 A;  2ZL0 A;  2IEX A;  2J5G D;  4IZC A;  4RYF A;  1J7X A;  3MYB A;  5G1Q A;  3R9T A;  1OD4 A;  1K32 A;  3TDC A;  3ST9 A;  4ZDF A;  4Q1I A;  1Q52 A;  5FUS A;  3QYR A;  3U9T B;  3KTI A;  5ING A;  4HNK A;  1UYR A;  2VSS F;  2VSU F;  1RJM A;  5MGB A;  3PE8 A;  1N6D A;  4K2N A;  4ELW A;  3OME A;  5KJP A;  3T89 A;  3T88 A;  2CE3 A;  3GLM A;  4JYJ A;  3H0Q A;  3ZWC A;  4GM2 A;  3RST A;  4FNB A;  2ZL3 A;  3SLL A;  5DTP A;  2F9Y A;  4ELS A;  1HNO A;  4FND A;  1VRG A;  3PGQ A;  4U18 A;  3OC7 A;  2PG8 A;  4YLH A;  3Q0G A;  3T3W A;  1WZ8 A;  2VSS A;  2VSU A;  3KTK A;  3WG5 A;  2A7S A;  1XO6 A;  4B3H A;  3ISA A;  3I47 A;  2J5I A;  2VX2 A;  2F6Q A;  2ZL2 A;  3TT7 A;  2PPY A;  3P85 A;  2X24 A;  3Q0J A;  3GF3 A;  3TVW A;  3H0U A;  3LKE A;  3L3S A;  4U1A A;  1WDK A;  3KTH A;  2F6I A;  3H81 A;  4IZB A;  1NZY B;  4QII A;  2WTB A;  4OG1 A;  4U0G H;  2VSU C;  1N6E A;  2HW5 A;  4WYO B;  4JWV A;  1X0U A;  5FIF A;  3ZWA A;  2DEO A;  4JYL A;  4KD6 A;  5DU6 A;  5C90 A;  1YG8 A;  3H0S A;  1OD2 A;  2UZF A;  4ELX A;  1UYS A;  3RRV A;  2J5I I;  5INI A;  3LAO A;  4U0G A;  4WCZ A;  3TLF A;  1SZO A;  3H0J A;  3NJB A;  4JJT A;  4EMP A;  5DTW A;  3N6R B;  3P2L A;  2Q34 A;  3NJD A;  3K50 A;  1RJN A;  4WZ8 B;  3QXZ A;  4G2R A;  3MT6 A;  1O8U A;  5DUF A;  2Q35 A;  4GHN A;  5DKP A;  3M6N A;  3TT6 A;  3QWD A;  5DU4 A;  1FC9 A;  2VSU E;  1UYV A;  2VSS E;  4K3W A;  3IB9 A;  4I42 A;  1PIX A;  2PBP A;  4JSB A;  3QXI A;  5KDR B;  2Q2X A; 
#chains in the Genus database with same CATH topology
 1JXZ A;  5CTB A;  1EY3 A;  2D3T A;  2DUB A;  2NP9 A;  3TRR A;  4U0H A;  3R6H A;  4I52 A;  1YG6 A;  5DZK H;  3HLN 1;  4ASI A;  2VRE A;  4IZD A;  1MJ3 A;  1DUB A;  3IBB A;  1HZD A;  1FC7 A;  1NZY A;  4RCN A;  4JFC A;  2QQ3 A;  3BPP A;  4F47 A;  2A7K A;  4L8K A;  5DZK A;  3BEZ A;  3SWX A;  1UIY A;  3JU1 A;  3P5M A;  2EJ5 A;  4OMR A;  1PJH A;  2C8T A;  4Q0G A;  3RSI A;  2W3P A;  4U19 A;  1DCI A;  2CBY A;  3TZ3 A;  4EML A;  3QK8 A;  4FN7 A;  5G1R A;  1UYT A;  3HE2 A;  4ZDD A;  3QRE A;  3R9Q A;  3R0O A;  4JCQ A;  1HNU A;  3QKA A;  3HIN A;  3GF7 A;  1ON9 A;  3M6M A;  1FCF A;  4QFE A;  1ON3 A;  1Q51 A;  4NEK A;  4QIJ A;  3FDU A;  5JBW A;  4FB8 A;  3FF6 A;  1SG4 A;  5DUC A;  1XNV A;  3QMJ A;  2GTR A;  5G1S A;  4ZDB A;  3HP0 A;  5KDR A;  3H02 A;  3OT6 A;  3K8X A;  3TVU A;  3PZK A;  3TV5 A;  3VIV A;  3ZWB A;  4B3J A;  2FBM A;  1XNY A;  3ZW9 A;  2BZR A;  1TG6 A;  3DOR A;  4K29 A;  2F9I B;  3PEA A;  4EMM A;  3BPT A;  1WDM A;  1WDL A;  1XX4 A;  3BF0 A;  1EF9 A;  3G64 A;  4JCT A;  1FC6 A;  5C9G A;  2ZL4 A;  3MFM A;  3Q7H A;  4OLQ A;  3IAV A;  4L6W A;  4JVT A;  2J5G A;  2ZQR A;  4ZDC A;  3KTG A;  4MXI A;  3KQF A;  4JCS A;  2FZS A;  4MOU A;  4LK5 A;  4KWB A;  4KNP A;  5JBX A;  4Z0M A;  3GMA A;  5INF A;  4KPK A;  4ZU2 A;  4B3I A;  5E0S H;  4FZW A;  3GKB A;  5DU8 A;  2J5S A;  2YJG A;  4JOT A;  4MI2 A;  1K39 A;  1XNW A;  3T8B A;  4DI1 A;  3KTJ A;  3DJA A;  1N6F A;  4FJW D;  5IKL B;  3ZW8 A;  5E0S A;  3HRX A;  3STA A;  2FW2 A;  2A81 A;  4NAR A;  3V5I A;  4HC8 A;  1TYF A;  2X58 A;  2F9Y B;  1W2X A;  4ZDE A;  3U9S B;  5E0N X;  4RYF H;  1Y7O A;  4JCR A;  3MOY A;  5DL1 A;  3U9R B;  3R9S A;  2F9I A;  4FZW C;  4I4Z A;  3V5E A;  1EF8 A;  2ZQQ A;  3Q1T A;  2J5I B;  3T8A A;  4NNQ A;  5CTC A;  4FN8 A;  2ZL0 A;  2IEX A;  2J5G D;  4IZC A;  4RYF A;  1J7X A;  3MYB A;  5G1Q A;  3R9T A;  1OD4 A;  1K32 A;  3TDC A;  3ST9 A;  4ZDF A;  4Q1I A;  1Q52 A;  5FUS A;  3QYR A;  3U9T B;  3KTI A;  5ING A;  4HNK A;  1UYR A;  2VSS F;  2VSU F;  1RJM A;  5MGB A;  3PE8 A;  4HDT A;  1N6D A;  4K2N A;  4ELW A;  3OME A;  5KJP A;  3T89 A;  3T88 A;  2CE3 A;  3GLM A;  4JYJ A;  3H0Q A;  3ZWC A;  4GM2 A;  3RST A;  4FNB A;  2ZL3 A;  3SLL A;  5DTP A;  2F9Y A;  4ELS A;  4J2U A;  1HNO A;  4FND A;  1VRG A;  3PGQ A;  4U18 A;  3OC7 A;  2PG8 A;  4YLH A;  3Q0G A;  3T3W A;  1WZ8 A;  2VSS A;  2VSU A;  3KTK A;  3WG5 A;  2A7S A;  1XO6 A;  4B3H A;  3ISA A;  3I47 A;  2J5I A;  2VX2 A;  2F6Q A;  2ZL2 A;  3TT7 A;  2PPY A;  3P85 A;  2X24 A;  3Q0J A;  3GF3 A;  3TVW A;  3H0U A;  3LKE A;  3L3S A;  4U1A A;  1WDK A;  3KTH A;  2F6I A;  3H81 A;  5HUQ A;  4IZB A;  1NZY B;  4QII A;  2WTB A;  4OG1 A;  4U0G H;  2VSU C;  1N6E A;  2HW5 A;  4WYO B;  4JWV A;  1X0U A;  5FIF A;  3ZWA A;  2DEO A;  4JYL A;  4KD6 A;  5DU6 A;  5C90 A;  1YG8 A;  3H0S A;  1OD2 A;  2UZF A;  4ELX A;  1UYS A;  3RRV A;  2J5I I;  5INI A;  3LAO A;  4U0G A;  4WCZ A;  3TLF A;  1SZO A;  3H0J A;  3NJB A;  4JJT A;  4EMP A;  5DTW A;  3N6R B;  3P2L A;  2Q34 A;  3NJD A;  3K50 A;  1RJN A;  4WZ8 B;  3QXZ A;  4G2R A;  3MT6 A;  1O8U A;  5DUF A;  2Q35 A;  4GHN A;  5DKP A;  3M6N A;  3TT6 A;  3QWD A;  5DU4 A;  1FC9 A;  2VSU E;  1UYV A;  2VSS E;  4K3W A;  3IB9 A;  4I42 A;  1PIX A;  2PBP A;  4JSB A;  3QXI A;  5KDR B;  2Q2X A; 
#chains in the Genus database with same CATH homology
 1JXZ A;  5CTB A;  1EY3 A;  2D3T A;  2DUB A;  2NP9 A;  3TRR A;  4U0H A;  3R6H A;  4I52 A;  1YG6 A;  5DZK H;  3HLN 1;  4ASI A;  2VRE A;  4IZD A;  1MJ3 A;  1DUB A;  3IBB A;  1HZD A;  1FC7 A;  1NZY A;  4RCN A;  4JFC A;  2QQ3 A;  3BPP A;  4F47 A;  2A7K A;  4L8K A;  5DZK A;  3BEZ A;  3SWX A;  1UIY A;  3JU1 A;  3P5M A;  2EJ5 A;  4OMR A;  1PJH A;  2C8T A;  4Q0G A;  3RSI A;  2W3P A;  4U19 A;  1DCI A;  2CBY A;  3TZ3 A;  4EML A;  3QK8 A;  4FN7 A;  5G1R A;  1UYT A;  3HE2 A;  4ZDD A;  3QRE A;  3R9Q A;  3R0O A;  4JCQ A;  1HNU A;  3QKA A;  3HIN A;  3GF7 A;  1ON9 A;  3M6M A;  1FCF A;  4QFE A;  1ON3 A;  1Q51 A;  4NEK A;  4QIJ A;  3FDU A;  5JBW A;  4FB8 A;  3FF6 A;  1SG4 A;  5DUC A;  1XNV A;  3QMJ A;  2GTR A;  5G1S A;  4ZDB A;  3HP0 A;  5KDR A;  3H02 A;  3OT6 A;  3K8X A;  3TVU A;  3PZK A;  3TV5 A;  3VIV A;  3ZWB A;  4B3J A;  2FBM A;  1XNY A;  3ZW9 A;  2BZR A;  1TG6 A;  3DOR A;  4K29 A;  2F9I B;  3PEA A;  4EMM A;  3BPT A;  1WDM A;  1WDL A;  1XX4 A;  3BF0 A;  1EF9 A;  3G64 A;  4JCT A;  1FC6 A;  5C9G A;  2ZL4 A;  3MFM A;  3Q7H A;  4OLQ A;  3IAV A;  4L6W A;  4JVT A;  2J5G A;  2ZQR A;  4ZDC A;  3KTG A;  4MXI A;  3KQF A;  4JCS A;  2FZS A;  4MOU A;  4LK5 A;  4KWB A;  4KNP A;  5JBX A;  4Z0M A;  3GMA A;  5INF A;  4KPK A;  4ZU2 A;  4B3I A;  5E0S H;  4FZW A;  3GKB A;  5DU8 A;  2J5S A;  2YJG A;  4JOT A;  4MI2 A;  1K39 A;  1XNW A;  3T8B A;  4DI1 A;  3KTJ A;  3DJA A;  1N6F A;  4FJW D;  5IKL B;  3ZW8 A;  5E0S A;  3HRX A;  3STA A;  2FW2 A;  2A81 A;  4NAR A;  3V5I A;  4HC8 A;  1TYF A;  2X58 A;  2F9Y B;  1W2X A;  4ZDE A;  3U9S B;  5E0N X;  4RYF H;  1Y7O A;  4JCR A;  3MOY A;  5DL1 A;  3U9R B;  3R9S A;  2F9I A;  4FZW C;  4I4Z A;  3V5E A;  1EF8 A;  2ZQQ A;  3Q1T A;  2J5I B;  3T8A A;  4NNQ A;  5CTC A;  4FN8 A;  2ZL0 A;  2IEX A;  2J5G D;  4IZC A;  4RYF A;  1J7X A;  3MYB A;  5G1Q A;  3R9T A;  1OD4 A;  1K32 A;  3TDC A;  3ST9 A;  4ZDF A;  4Q1I A;  1Q52 A;  5FUS A;  3QYR A;  3U9T B;  3KTI A;  5ING A;  4HNK A;  1UYR A;  2VSS F;  2VSU F;  1RJM A;  5MGB A;  3PE8 A;  4HDT A;  1N6D A;  4K2N A;  4ELW A;  3OME A;  5KJP A;  3T89 A;  3T88 A;  2CE3 A;  3GLM A;  4JYJ A;  3H0Q A;  3ZWC A;  4GM2 A;  3RST A;  4FNB A;  2ZL3 A;  3SLL A;  5DTP A;  2F9Y A;  4ELS A;  4J2U A;  1HNO A;  4FND A;  1VRG A;  3PGQ A;  4U18 A;  3OC7 A;  2PG8 A;  4YLH A;  3Q0G A;  3T3W A;  1WZ8 A;  2VSS A;  2VSU A;  3KTK A;  3WG5 A;  2A7S A;  1XO6 A;  4B3H A;  3ISA A;  3I47 A;  2J5I A;  2VX2 A;  2F6Q A;  2ZL2 A;  3TT7 A;  2PPY A;  3P85 A;  2X24 A;  3Q0J A;  3GF3 A;  3TVW A;  3H0U A;  3LKE A;  3L3S A;  4U1A A;  1WDK A;  3KTH A;  2F6I A;  3H81 A;  5HUQ A;  4IZB A;  1NZY B;  4QII A;  2WTB A;  4OG1 A;  4U0G H;  2VSU C;  1N6E A;  2HW5 A;  4WYO B;  4JWV A;  1X0U A;  5FIF A;  3ZWA A;  2DEO A;  4JYL A;  4KD6 A;  5DU6 A;  5C90 A;  1YG8 A;  3H0S A;  1OD2 A;  2UZF A;  4ELX A;  1UYS A;  3RRV A;  2J5I I;  5INI A;  3LAO A;  4U0G A;  4WCZ A;  3TLF A;  1SZO A;  3H0J A;  3NJB A;  4JJT A;  4EMP A;  5DTW A;  3N6R B;  3P2L A;  2Q34 A;  3NJD A;  3K50 A;  1RJN A;  4WZ8 B;  3QXZ A;  4G2R A;  3MT6 A;  1O8U A;  5DUF A;  2Q35 A;  4GHN A;  5DKP A;  3M6N A;  3TT6 A;  3QWD A;  5DU4 A;  1FC9 A;  2VSU E;  1UYV A;  2VSS E;  4K3W A;  3IB9 A;  4I42 A;  1PIX A;  2PBP A;  4JSB A;  3QXI A;  5KDR B;  2Q2X A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...