1K3BC

Crystal structure of human dipeptidyl peptidase i (cathepsin c): exclusion domain added to an endopeptidase framework creates the machine for activation of granular serine proteases
Total Genus 7
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
7
sequence length
69
structure length
69
Chain Sequence
b'DPFNPFELTNHAVLLVGYGTDSASGMDYWIVKNSWGTGWGENGYFRIRRGTDECAIESIAVAATPIPKL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords dipeptydil-peptidase I exclusion domain
publication title Structure of human dipeptidyl peptidase I (cathepsin C): exclusion domain added to an endopeptidase framework creates the machine for activation of granular serine proteases.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 7
structure length 69
sequence length 69
ec nomenclature ec 3.4.14.1: Dipeptidyl-peptidase I.
pdb deposition date 2001-10-02
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.170 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Cysteine proteinases. Chain C 1k3bC00
4CDDC 1ICFB 1K3BC 2DJFC 1MHWC 4OEMB 4OELB 2DJGC 4CDCC 4CDFC 4CDEC
chains in the Genus database with same CATH superfamily
1YNND 1TS4A 5JEAH 3CCMA 1CHPD 2B29A 3GTMH 4BXXH 2AUJD 1B3QA 1TWHH 1S5DD 4GNXA 3I70A 3QR8A 4GLAC 4QCLA 4DNRB 1X3GA 1XTDA 2PQAA 1TS3A 1P16A 3CCJA 1YJWA 2DUDA 2VW9A 2VQEQ 3J81i 2Z0SA 2OWOA 3CCRA 3I7FA 4BBRH 4DUZL 1LTTD 1G291 4R4IA 2KECA 3KDFA 1EFWA 3TMEA 1Q8IA 2UUBL 2A8VA 5E4WC 4ODGA 3G71A 1ZEQX 3UDIA 3H09A 4IPDA 4XQJA 2RCNA 1A63A 1DOMA 3S1NH 1A15A 4KJOA 1YZ6A 3HOZH 5JJKA 2D5DA 2A68D 2L5TA 2A5HA 2UU9Q 2IX1A 4K8JA 2IL8A 5M3MH 4F87A 2EY2A 2Z1CA 3M4YA 3S17H 3A55A 1GXDC 3M3YH 4A93B 3K8AA 3ZJYC 3S15H 1V1OA 2EQSA 5ELNA 2AQ3B 2TMPA 2FMMA 4DR3L 4Z9CB 5IYDH 4RKBA 2R92B 2R3ZA 4S3SA 2I0QA 2V4DA 1SNQA 1QJOA 4QUCA 1MSHA 3I3CA 4JI5L 3NK9A 5FKAC 4B08A 1V1PA 1PYWD 3WOFA 4JCVE 4JPBW 3M7NA 1SYEA 4R1JA 1MBYA 2VXWA 1Y1WH 1B9NA 4JI2Q 3Q23A 4IJHA 1UNSA 4A93G 2F4IA 2OQ0A 5J39A 5LMNL 2F0UA 4PZ6A 2RKSA 4X3KA 4NXML 4C2MH 1SE2A 1X56A 4DUYQ 2R92G 4L5RC 1IKLA 2CVRA 4KHZA 4B3RL 2CQOA 1XXGA 3SE0A 2WV6D 1O7LA 1E2WA 1U9RA 4YWKA 1YNJC 2EY5A 1IZ6A 3EBEA 4IUTA 2VS1A 4LFBL 2AWNA 4APVA 3I56A 4EQOA 3CQZH 1VQ7A 1YIJA 1XNRL 3M7GA 1CUKA 2F0VA 1V43A 3GTOH 1V1QA 3X3MA 4EQPA 3PIP3 2K03A 5FJ8G 2OQKA 2J4XA 3B6YA 3CW2C 3TRZA 3ULPA 2IHFA 2Z4IA 3KF6A 3D8GA 3GQBA 4DV3L 3I8ZA 3G48A 3NBHB 2C35B 4NW2A 1QVCA 1N33L 2YTXA 1EFID 1O7ZA 2XSCA 2UXBL 5C44B 3HOXB 4OWWB 3KF8A 2QW7A 1PV4A 3SGIA 4L6TB 4NKLA 4X66Q 3IKJA 2JEBI 1R9TB 4EVOA 2FINB 1F9SA 1ICWA 2KVMA 4DAVA 5IWAL 4UP8A 1RHPA 4QY7A 1TIID 1QE6A 3FPPA 2OCEA 4A3EB 5K36H 2HUGA 4HJAA 3GTLB 2NVTH 3DLLA 1EU3A 4LF6L 5C44G 3HOXG 4MNOA 4A3BB 5CV7A 4AH6A 2K6AA 1CK1A 1CQFA 2AWOA 3KUPA 3PSIA 1IBMQ 2PI2A 5BN4A 1IHZA 4UHVA 1KAAA 4LNQA 1XPOA 2AQ1B 1BCPC 1SYCA 3MXNB 5DM63 3H94A 1AE2A 2JQOA 2F0LA 2HD3A 5KNCA 4M8AA 3K5MA 2WB1E 2E5LL 1D7QA 2HCIA 3F2BA 3DEOA 4A3EG 3SDZA 2F0KA 2H5XA 4K5WA 1I4RA 3C1FA 1R4QB 5DM73 5CC4A 3EA6A 4NDXA 1TVXA 2H1EA 4DV6L 1J5EQ 2Q2IA 3FHWA 1N36Q 4A3BG 3PUVA 4KHPL 1XJVA 2A6HD 1QB5D 2PMZB 3RR5A 1T5XD 3UDGA 1FVIA 1PFNA 1EU4A 3PMFA 4H44C 1IBKL 3H91A 5DEHA 2E2JB 3TREA 1I50B 4ZK9B 3C2PA 4KD3A 2JJQA 2JYOA 3NUCA 2B2VC 4ILWA 1Y14B 3NHHA 1JOQA 4DV1Q 3D6WA 1EYCA 5J3BA 4JV5L 2MNAA 1TY2A 3LWUA 5C4JB 1IYJB 2O5IC 2Z6KC 4RGOS 5EKKA 1I94Q 1A8VA 4EX5A 4UP9A 3HOVB 2SEBD 1BNZA 3GDEA 1D5ZC 3CCQA 2E2IH 1Q12A 4DA2A 4CKBA 1STGA 5IGDA 1TXYA 4PZ7A 3L2PA 1CA5A 2IT1A 1B2TA 1IKMA 4LFCL 2LXJA 2L1BA 4OL7A 3V2TA 1DOKA 3P7JA 1ASYA 2IHEA 1FNVA 2WAQB 1XX8A 3VDYA 3S1MH 2A6ED 1Q86C 1BCPB 2RSOA 3T16A 1HHVA 4A3KH 3W3AA 1F2MA 1OXSC 1UE6A 2ES2A 1EWHA 4P74A 5C3XA 3ULJA 5D14A 4P75A 4JI3Q 3M4PA 3HOVG 3A74A 4A3GH 2VQFQ 1Q90A 3NTHA 1C4QA 1AFPA 3CCVA 1SRUA 2FHTA 2F52A 1G6PA 1LM0A 2LFNA 3JAML 3S1RH 3P20A 3Q0AA 3U4ZA 3PO2B 3RZDH 3GTPH 4UDUC 1FNUA 3W1BA 5J22A 3PIOA 2WAQG 3OHXC 3H0GH 2B3GA 2R7DA 5M9OA 3F1ZA 3NBHA 4JI0L 4DK0A 2EZVA 1D5MC 2A69C 2HQEA 2PNHA 3CRLC 3PQIA 2G9DA 4DU9A 1X9NA 1D1KA 3WDNA 2BA1A 5IODA 1RF2D 4LUVA 4BWGB 1W6JA 3GTKH 3S2HH 4YCUA 4YY3L 1VF7A 3PO2G 1IW7C 1E3PA 2RHSB 1I6VC 3AYHB 3ND9A 1STNA 2HHHL 3K5LA 4EGVA 5L37A 4WJ4A 1XMQQ 3PO3H 3J7AF 5BR8L 1PFSA 1PRTC 3TZUA 3SXHA 4QUFA 3H3VI 1YI2A 1O80A 1TWAB 1TS5A 4DV0Q 1GUNA 2LMCB 1ZXTA 1JB7A 2B2YA 1HRJA 2NVQB 4LF4Q 3HFZB 3EVQA 5D3DA 1MJEA 4LFAQ 5IYCG 4QIWE 2H4OA 4B3ML 4A3FH 2CW0C 5IP7G 3MXNA 1DONA 1EIYB 3GTGH 3MXPA 4IFDG 1KIXA 1TQOA 1UAPA 1EYGA 1GO3E 2K04A 3J80E 3RN5A 4LF7L 1NE3A 3EJIA 4EQ5A 4DV7Q 2R7ZH 3EFXD 2KHSA 1WTVA 1A62A 1WTPA 2OTJA 1OO9B 1UWVA 1LT3D 1BUVT 3AFPA 1Q82C 3JC66 4RAUC 3FRPB 1EQQA 4DR2L 4JI8Q 1V8QA 4WJ3M 5M5YB 1XMOQ 4DR1Q 4XT1B 1UEAB 5C4HA 4GKJL 4X64Q 3GTJH 1BR9A 1BBWA 1ONLA 1ZYRC 3ULLA 2EPBA 3D31A 4GLVB 1II3A 2EYHA 4BBSH 1Z47A 1SSOA 4IFDJ 3QOJA 1KDAA 2HCCA 3SK8A 4A3DH 3T1HL 4ZCKA 2ID0A 4B3SQ 2K4KA 2VB3X 2JEAI 4CKEA 4RWSC 1PTOF 2PW5A 4QJFA 1PRTB 2OT2A 1I4GA 1VQBA 4LW1A 1WD0A 3G6JB 4BY7B 4FVMA 1TWFB 5M5XH 4YWMA 2C5CA 3A7AB 3CMEA 1DOLA 3M9BA 3NPPA 1EY9A 3HOUB 2F3WA 2N49A 2IX3A 5FLXE 4Y7NB 3T4AC 5IGBA 2JA6G 3SK6A 3BVGA 4CDFC 2Q8TA 4LF5L 3DWQA 4BY1H 4A3JB 2CWPA 1KC8C 2PO4A 3M85A 1UUPA 4KN7C 5E3FA 3EN2A 1RKNA 4HJ8A 1BBUA 3UI2A 2VL6A 4BY7G 2MO0A 3ERQA 4R4OA 3GV3A 4KKTA 4PMBA 3A5UA 2JA6H 3RN2A 1STHA 1HNZL 1HZBA 1QNUA 1PA6A 4OO1H 3HOUG 4PQXA 3WWVA 1X54A 1BO0A 1AN8A 4N9PA 1E7ZA 2UXDL 1JJ2A 4CHTB 2NVXB 3S16B 4FF4A 1AE3A 2K5HA 3PIPA 5T1IA 2VUMB 2Q8IB 1WYDA 2Z6KA 1LTGD 3KBXA 4B3TL 4DR7L 1DM0B 2E2HH 2QDBA 1QG7A 1G51A 3CF5A 3IL8A 5CV6A 2F0QA 4A76A 4POGA 1PZJD 4J15A 1N32Q 3MC0B 4HIMA 4C3IH 3K59A 2BCOA 3I2ZA 3RZOB 5M3FH 3HOWB 4N9TA 4HMJA 4NXNL 3I4MH 1EYAA 2JP1A 1JJGA 1VQPA 4JYAQ 3E9IA 2K5DA 1GUGA 1X3FA 3E0JA 2L11A 1PTOD 3HOYB 3TDQA 1Y69U 1D6EC 2VUMG 1PYBA 1CFMA 1YEZA 1VQLA 3U4VA 2KOLA 1CTMA 5C3EH 1PYSB 4IQZA 2GN5A 3V05A 5FLMG 3KLSX 4JI7Q 1AEXA 1CSPA 4DR5L 1Q46A 1KRTA 4C3JH 4UAIA 3UE1A 4U68A 2DY8A 5C5MA 3HOWG 4YIJA 4IPHA 1PLFA 2QILA 1FJGQ 4RCNA 3T53B 4P2CB 3J80c 3HOYG 3MAQA 1S5CD 2JXMB 4IUNA 2NTTA 1XNQQ 4HMIA 5AJ3Q 1E1TA 5EPKA 4MN3A 2A74C 5EGTA 1W6KA 2OTLA 3R2TA 4P73A 1FR3A 4IOAA 1DD2A 1JICA 1EOVA 3CC2A 1O78A 3FEWX 1S72A 3SR1A 4H0LC 1VQ4A 2YU9H 3JAMc 3QG1A 4DPGA 1QCBD 4ZAIA 4JI1L 1SMYD 1WTXA 4DR6Q 2EJFC 3K5NA 1PTOH 1BVSA 5CYUA 2DJGC 3F2CA 5LMNW 1KD1C 5C4XB 4A3IH 1EQTA 4DNIA 3H15A 4R4CA 4F8MA 3ER0A 5IGFA 2BE5D 3I4LA 5M3MB 1G2TA 3HKZB 4J8QA 1A3UA 2DNEA 2NN6I 2K5WA 5M5WB 1MJCA 4C1NK 2PMZE 5JJIA 1VQGA 4F7XA 1NR2A 4K2KA 3CP0A 3CMAA 1PXUA 1NNXA 2JA7B 4RH6A 1LYLA 3U9SA 3M4QA 4YHHL 3K58A 2MUYA 4X65Q 4A3CG 1LO5D 2QF7A 3OYYA 5FLXc 4G7OC 4L5TA 5C4XG 1SNOA 4KTAA 2EOTA 2ASBA 3OTOL 1CQVA 1I3QB 1JWUD 3HKZG 1HNWL 2NTSA 4C3HB 1L2FA 1A2UA 1U4MA 1DCZA 2C9OA 3NWTA 5JPMC 1RCVD 1EQRA 3Q22A 2B63B 1PH6A 1WCMB 3T13A 2F0WA 1XYIA 2KUMA 4CJ1B 3Q24A 3GP7A 3MVVA 1YITA 3G6EA 2JA7G 1NAPA 4HJ7A 2WAQE 4RMFA 4OX9L 1H95A 2HIXA 1WVLA 3FVQA 4HIKA 4JI4L 3EQLC 2R6GA 1GM5A 1HZAA 1WJJA 2MQHA 5IGEA 1EY6A 4DUZQ 4OELB 3TN2A 1HA5A 4DV4L 1Y8NB 3CAMA 1J8IA 1FNWA 4C3HG 1ESFA 2UUBQ 1VQFA 2K32A 1HNXL 2B63G 1HQMC 1WCMG 4MTNA 4DR4L 1JMCA 1VQ6A 1JOKA 1JT8A 1LLRD 2F0SA 3D6CA 2Y0SB 4CDDC 2YTVA 4DK3C 3QO2A 2VNUD 2KCTA 2YTYA 4JBKA 3WOEA 4I65A 3RLFA 4GOPC 2AHOB 2VY3A 2CHBD 4A93H 4DR3Q 4H7BA 2SOBA 1H9RA 4IURA 5HGTA 1CKNA 5A2QL 1HUNA 1C0AA 5IOCA 2X69A 3CXCA 4RKLA 1Q7YC 2A1AA 3W1GA 2R92H 3J81j 2EDGA 4JI5Q 3RD4A 3TS0A 4DV2L 4LF8L 4UPAA 3BDOA 4KHVA 1JE5A 2NYZD 4DK1A 2Y0SG 4RA8A 3SHLA 3MFGA 2OEOA 5LMNQ 3OMCA 1GUWA 4LF9L 2JA9A 1K8AC 4NXMQ 3BZCA 1RJTA 4ZUJA 2R93B 2ZTEA 5FJ8H 2F3IA 4H13C 1PZKD 3NENA 4DGZA 2CKZB 3S14B 3RLOA 2OF1A 4B3RQ 2RSNA 2PNRC 3M4OB 1RDPD 1DGSA 4LFBQ 2RCFA 1K83B 1DZ1A 2I5HA 4IUVA 5EBCA 1CA6A 1A2TA 1PMRA 5IGCA 5GQOA 3G7LA 2A6HC 2EJMA 1XNRQ 1ENAA 1TWGB 2IJ0A 5ELBA 5KGUA 1YNJD 1NMGA 2Z8LA 1AZQA 2CCZA 2R93G 4DV3Q 2D62A 1QUQB 1EL0A 4GOPB 1C48A 5LL6X 1N33Q 4PMWA 1W3SA 3VR6A 1LTBD 2UXBQ 4ABNA 3H3VC 4FYDA 4Y52H 3S2DB 1YHQA 1STEA 2WFWA 3S1QB 5C44H 3RNUA 3HOXH 1XPRA 2MHVA 4NB3A 1OXXK 5IGGA 1SLJA 3L9AX 3E9HA 1KAWA 1JJCB 5IWAQ 1R9TH 4ZKBB 4IN3A 4DAYB 2BH2A 3R8BA 1H9KA 3CPWA 3RLNA 4GLXA 3PF5A 2E8GA 3I91A 2ZXRA 1F2ZA 1Q81C 4A3EH 2ZJPA 2QGQA 1BQQT 5H1SE 4LF6Q 1TR5A 3GTLH 1LTID 1AH9A 1E24A 2F0FA 2JSOA 3EROA 4IPGA 3STBC 2PYKA 2NZ1D 2YYZA 4A3BH 1X3EA 3BG3A 2OXPA 2UUAL 2SNSA 1VQ9A 1ASZA 2E5LQ 4OWXB 5FOBB 3I4NB 1X6OA 4K14A 3J81L 5CMDA 1WTQA 3DM1A 4DV6Q 3ND8A 3TP5A 4KKUA 4KHPQ 4CBVA 1HZ9A 3OW2A 1MIUA 1HUMA 2JE6I 4OEMB 3KYHC 4GN3B 4QL5A 2F03A 3VA7A 1D8LA 3TEHB 5I2YA 2BA0A 4JI6L 2HDLA 3MFYA 2M2LA 4QF4A 4V190 3D3RA 4YCVA 4FNFA 1IBKQ 4OIJA 1Q1BA 3EIVA 1ML0D 5GAGC 3I4NG 1K0RA 1K73C 2I5MX 2E2JH 3VYRA 3BZDB 1TT2A 1LV9A 1I50H 2KJXA 3NP8A 4JV5Q 4MIUA 1L1OC 4JBJA 1MD2D 1GKHA 4RGMA 2HT1A 2JA8B 4RGNA 3MTSA 2G9HD 5C4JH 2PPBC 1Q8KA 2UXCL 4DAPA 1F9RA 5E1FA 2PZUA 1FL0A 2XVSA 1U4PA 3HOVH 4GS3A 1VQAA 2EYJA 4JC0A 5I6WA 2QA4A 4HIOA 3CC4A 4KY5A 3J7AV 1K8MA 4HCEA 1B3AA 4XIGS 4F88A 4ME3A 4OGQC 4LFCQ 3MZ5A 4A75A 1F9PA 1VQDA 1K28A 1SE3A 4R8IA 3BJUA 2Q2TA 2KCNA 4L8JA 5DAUA 3C1EA 1MSGA 4HCSA 3P1HA 2LS01 3VR2A 2O2LD 2JA8G 4A3LG 2JK8A 4LWCA 1PH1A 5CV4A 4RG1A 2EYLA 1LACA 1UE1A 2LY7A 3HS0C 4JOIC 4NPSA 1N8RC 2X6GA 3FMCA 1TWCB 1JWSD 3TQYA 1EWIA 2PZWA 1KQSA 1W2BA 2WKDA 4LUZA 3LWEA 1HFGA 1VQ8A 4ULLA 1OXUA 1L0YB 1SJHD 3PO2H 3O13A 4FXGC 5F2DA 3DHQA 2JA5B 2DY7A 2KQ3A 4JI0Q 1HFNA 1QUQA 1RD9D 4TKOB 4GOPA 3QIAA 5J1ZA 4K0KL 2F4VL 1I6HB 2LXKA 4DXGA 3J81E 3K80C 1F77A 5D3IB 5D65A 3OSOA 5I6YA 1L1OB 1Y8OB 2WIIB 1B50A 1CZWA 1QVGA 2CQAA 1FYCA 2ENBA 4V0BA 4MZ9A 3F2UA 3DWPA 2B8FA 2A69D 5KNBA 1Z6HA 4YY3Q 4O2DA 1JOOA 3NEMA 2K5QA 3KJPA 2PZTA 1HZCA 5IYCH 3FKIB 2HHHQ 2XGTA 4DAYA 2CFMA 1GVPA 1LT4D 3X3NA 2EY6A 5IP7H 4WFN3 3TP7A 2JA5G 4IFDH 5BR8Q 5EAYA 2ZXOA 4PV1C 3MWYW 1A3VA 3JAME 1E1OA 4N8X1 3TP8A 3P75A 4IJLA 4FF3A 1KLGD 1S5ED 4OHJA 5CV9A 3NTIA 4B9XA 4GN5A 1TWAH 3K7AB 1U5KA 4HEDA 4AQYL 2UUCL 5FO9B 5K5PA 1QNKA 3HKZE 5CV5A 2MO1A 2FMCA 1PFBA 4B3MQ 3BS1A 2MP1A 1SAPA 1LTRD 2NVQH 1YBYA 1RIPA 2F0OA 4HAEA 3OOCA 5FO7B 3FKIG 1LT5D 1U0LA 1A6XA 1EEFD 4DV5L 4LF7Q 5IIFA 1DXMA 1UEBA 4ZYSA 4CDEC 2K5NA 1HA6A 4M1UB 3AB9A 2G5DA 4LMQD 1NR4A 2EIFA 2SNMA 2N3SA 1WI5A 3CRKC 3PV0A 5E4XA 3IAYA 4DR2Q 1VDZA 4GKKL 3IRBA 3E0EA 5HY6A 2EY1A 3CCLA 1ILPA 3U58A 4EQNA 4GKJQ 3D4DA 3I90A 5M5YH 1SFOB 2F0PA 3NBIA 3KFUA 5TSSA 3I73A 3HKSA 5ELCA 1H9SB 4KK7A 1VF5C 3D4RA 3T1HQ 2N88A 3SK5A 1H9JA 2EYMA 4HSVA 3PUXA 3UE0A 2D0OA 2K14A 2PCFB 4G7HC 1ZYRD 2EXDA 1S3OA 3CU7A 3GTQB 1PTOC 5DNFA 3T1YL 2Z4HA 1NCVA 2L9HA 1KNAA 4RHSA 1TKWB 3A0JA 5KIXA 1VMCA 1JCKB 2A19A 1I5FA 4BY7H 1V9PA 2F3VA 2B2VA 1Y1VB 2LKVA 4A3JG 4X6AH 1GHJA 1CZGA 1TWFH 4DXFA 1WFQA 5IE8A 1SDFA 1TY0A 1HR0L 2Y0SE 3OWFA 1F2YA 1SMXA 3HOUH 4K6LA 5IP9G 4LF5Q 3ERSX 4Y7NH 3A7LA 3KLSA 4A3MB 4FP5D 4XYQA 2L0CA 2B2UC 5C0XG 2AMCB 4OO1I 5E7NA 5ELFA 2ZT9C 5HURA 2BH8A 1KDBA 1Y1VG 1HNZQ 4NMZA 3TBIB 4K5XA 4G57A 5I2XA 1S5FD 1SNPA 1WOCA 2EE1A 2ZM6L 2NUCA 4P72A 1BBXC 1T9HA 2D0PA 2NZHA 2UXDQ 2FFKB 1D5XC 2N55A 2EXZA 4PNYA 1WTWA 4Q5VA 1S4ZA 2B2TC 2NVXH 1N9WA 3S16H 1RTOA 1L1OA 4A3MG 2YV5A 1PH9A 1YNNC 4ZKCB 4QGUA 1FGUA 1HH2P 3AQQA 3J81c 3CCEA 3MEHA 1N34L 4B3TQ 2NVYB 4DR7Q 2VUMH 4HR7B 5C0XI 4IALA 1SR3A 1B1ZA 2EYOA 3K81C 5LMUL 3DUZA 4YCWA 1JB3A 2P5ZX 3GTMB 5FLMH 1BF4A 2IPKD 1TWHB 3CCSA 2CWAA 1IBLQ 2XTIA 3PUWA 2B2WC 2NN6G 1U4LA 3PGZA 1M1KC 4NXNQ 1ICFB 2F0JA 5JJZA 3PUYA 3RZOH 3HOWH 4ZUIA 3SK4A 1STBA 4RFBA 1SYFA 4UY8C 4BBRB 2J0TD 5IYBG 1XWEA 2EYFA 1U4RA 1EY8A 4FF1A 2VQEL 3HOYH 4X62Q 1E0BA 4KJNA 1EOTA 5JEAG 2A68C 2Z9HA 4IOCA 1SNMA 4DR5Q 1S40A 1O7IA 4JOIA 4BXXG 5G3LF 3S1NB 1KRSA 1CM9A 5EKIA 1IYVA 3HOZB 1KL9A 1UE7A 2ICEC 1D2BA 1I4QA 1EZ6A 5JVG3 3J7A5 1AP0A 1HQRD 2B39A 3NXWA 3S17B 4CDCC 3M3YB 2LSSA 3S15B 2UU9L 4ZRZA 4K8IA 1RL2A 1DYQA 2EYPA 5EJWA 4BBRG 3VR4A 5JVH3 1ET6A 1X3QA 5NUCA 3U9OA 1VQEA 1X55A 2XN9C 1C7YA 3L3OC 5JEAJ 3NQTA 5GAHC 2DGYA 3K0YA 3HOZG 1Y1WB 2XRSD 1H9SA 5C4ZA 4DN4M 5M3MG 1EYDA 4JI1Q 5DLQE 1GUOA 2K50A 3J80i 4DF7A 4JI2L 3K7UC 4C2MB 3I55A 1MHWC 1PH2A 4A3CH 1OXVA 5AFWA 5IYDG 2KHJA 2I5LX 1X3PA 3IFTA 1STYA 5C4XH 2BDNA 2GVAA 2Q8RE 3A5ZB 3OIQA 4K2LA 4DUYL 1RTNA 4I7AA 4R9WA 4R8NA 1Y8PB 3N6RA 1J9OA 3T51B 2L15A 5GADC 3CQZB 5M5WH 2XNAC 1Y1WG 1SNCA 3URYA 2RVLA 3JAMi 4K5VA 3GTOB 1SXTA 2CH4A 4YHHQ 3D4WA 1PH7A 2JA7H 1KDCA 4JW0A 3G4SA 1HCZA 3BDCA 3TSSA 4POFA 3OTOQ 3BYTB 4BS9A 1JORA 5LL6S 4KY6A 2IWHA 1HNWQ 2L4NA 4OWTB 2I07B 2V1CC 1CI3M 4FXDA 2WACA 1I3QH 2KCCA 5G3LD 2CH4W 3FDTA 4C3HH 1VQCA 2WP8J 2ZJRA 4CGYB 2HIVA 2K52A 1CHQD 4GN4B 2XIWA 3QOLA 5GROA 4X66L 2B63H 2NZOA 1CT1D 1WCMH 2AQ2B 2B2YC 2O4XA 3GO5A 4OX9Q 4FF2A 1I4PA 1VQIA 4HIDA 4JBMA 2MGSA 4JI4Q 3DM3A 2NVTB 1VQOA 1NTGA 1EEID 2F0TA 4HJ9A 4DV4Q 4XQQA 4XQNA 4WRDA 3A56A 4CJ2C 3AMUA 4U673 1WTOA 3MHBA 3W2DA 3AEVA 5KYLA 1B9MA 1HNXQ 2ATWA 4N8FA 1IL2A 3A8IE 4CKCA 2F0IA 4DR4Q 2KA7A 2BOSA 4O1NA 1IBML 4LAAA 2I46A 5JJLA 3PUZA 1BCPF 1KLUD 1SJED 4ZQ3A 1G8ZD 1CSQA 4MHEA 2N78A 5K36G 1EY0A 1EIHA 4KN4C 3V96A 1LTSD 1HPCA 3KLRA 1Q3LA 3RMHA 3ZYYX 4IUPA 4L5QA 3TS2A 3ONAB 4JBWA 2RA4A 2RHQB 2B2UA 1NSNS 1J5EL 5CV8A 1NUCA 2Q2HA 1N36L 1EIGA 4DV2Q 4LF8Q 1O7YA 2RDHA 5FK9C 3DWAA 1MI2A 2KBNA 4RGTA 3BVZA 5CBAE 3AU7A 2F0GA 2ZTCA 3RUZA 3NWSA 4DAMA 1F2LA 3S24A 2HDMA 1FGBD 1NMFA 1G6ZA 5C6AA 3KJOA 3FP9A 3NSWA 4LF9Q 1Z9FA 1BOSA 3DMUA 5JPNC 4XDXA 1LTAD 1SE4A 4K6DA 1UE5A 4DV1L 4KV6A 4TQUS 2RDFA 4XT3B 3QWNA 2R93H 5ISRA 2B2TA 2RQXA 3OWEB 1JC7A 4AYBE 1I94L 3S14H 1M8AA 2R7FA 1B70B 3HZXA 3MXUA 4PMCA 2E2IB 2HQLA 3N52A 1NBWA 3A8JE 1QVFA 3TZDA 5IT9L 2A6EC 3M4OH 1VQHA 1KNEA 1ET9A 1F9QA 4HJ5A 1ILQA 1K83H 3CD6A 3BDLA 5I4DA 3H6MA 3F8TA 5A2QE 3S1MB 1ZKOA 1K0SA 2GVBA 4HTHA 5EKLA 2A73B 1TWGH 4CJ0B 1A3TA 4A3KB 2B2WA 3VR5A 2RBMA 5T1GA 1D1IA 1LTLA 1PHJA 2K05A 5ELOA 1I4XA 3NQIA 4A3GB 3CCUA 1EY7A 1T5EA 2DNCA 1KXLA 1XTCD 3UDFA 3CPFA 4JI3L 2VQFL 1B7YB 1HTLD 2N8NA 4B9WA 2RF4A 1SYGA 1G2SA 1HTPA 3S1RB 4FDBA 3S2DH 3RZDB 3GTPB 1EUJA 3S1QH 2PQEA 4J6HA 1BCPD 1ENCA 1B44D 1PH8A 1HXYD 1QOHA 4X3UA 1VCIA 2L55A 3H0GB 3I4OA 5HGQA 4AIMA 1WD1A 4H02A 4A3KG 3CHBD 1VS0A 3VYTA 5GAEC 5KYIA 4A3GG 1P8LA 2KENA 1JWMD 2O5JC 4TSSA 2X6LA 4ALPA 1I4HA 3K5OA 5I9PA 2QKIC 2K75A 4JG2A 3R2IA 3GTKB 3S2HB 3J80L 1SYBA 1GOZA 2GA4B 1M90C 4LJZC 1YHBA 3AFQA 4IUUA 2UUAQ 1MGSA 1CKOA 3H0GG 3I72A 3STBD 2ZJQA 2M9VA 4ID6A 2KEDA 1VQMA 3PO3B 2EVBA 2NBFA 1SBBB 4QB4A 5EBDA 3CC7A 3VYUA 3I4NH 1PRTF 1XMQL 1E2ZA 1PZID 2K1BA 5ELEA 3L7ZC 1G91A 1Q1EA 2F0HA 1YNXA 3LNNA 4DV0L 1E2VA 1LUZA 3LGJA 1S5BD 4E6IA 4A3FB 5IY0A 2F1MA 4LF4L 3OIPA 5IT9E 4JI6Q 1PH3A 3H3VH 4LFAL 3PF4A 3DEPA 1GUTA 3GTGB 1X32A 1QILA 4O42A 1SYDA 1KHIA 3PCOB 1J6QA 3PO3G 3NELA 5COYA 2R7ZB 4DKAC 4WJWA 3QJYA 2WKCA 2L12A 1B4OA 2NWGA 3HGBA 3Q8DA 4DV7L 2UXCQ 2MJ8A 4HN7A 2JA8H 4A3LH 1RODA 2KHIA 1AZPA 5FLXL 4TVAB 4BA2I 4A4IA 1VQKA 1H9MA 5CGKA 4A3FG 1JR0D 3W5OA 5CORA 4JI8L 3C46A 2VZAA 2AKWB 1E22A 3TP6A 3LX0A 4BA1I 1EWCA 1XMOL 4GNXC 4DR1L 3GTJB 4BBSB 1GUSA 3CKIB 4X64L 2F0MA 1BDOA 4A3DB 4X3SA 2R7ZG 5EPLA 5FO8B 5C3WA 4YWLA 2Q2UA 1STAA 2KEEA 4B3SL 2ZXPA 4PG3A 1R4PB 2NB0A 4OIKA 4QMGA 1KTKA 3KLWA 5M5XB 3C3LA 1IW7D 1EY5A 3IFDA 3FPUB 4KD4A 1TWCH 2XRQD 4ME5A 3HG9A 4AYBB 1MKHA 2K7VA 2XWBB 5A35A 4BBSG 1ESRA 2Z6BA 3E3XA 1HR0W 1L0WA 2MFIA 2E74C 2WB1B 4IO9A 4A3DG 2TSSA 1NY4A 4O0AA 1VQNA 1PRTD 3GD7A 4K0KQ 2F4VQ 2JA5H 4BY1B 4C1NI 2VB2X 2D9UA 1VQ5A 1I6HH 2E75C 3GV6A 1NJIC 1BXTA 4HSPA 2PI2E 4KKSA 1GHKA 2MPMA 1SEBD 1Z7TA 2CW0D 3BZKA 4IFDI 2JA6B 3K57A 2J7ZA 3BYYB 5EQ0A 1JQYD 4AYBG 4R4QA 2FJ2A 4ZLTF 1IL8A 2F0DA 1OXTA 3ICEA 1C8CA 3KK7A 4TRDA 1M4VA 3NTKA 1K3RA 2WB1G 3FKIH 1VMPA 1TS2A 3NE5B 3K0XA 4PZ8A 4GNXB 2ICIA 3MXGA 3SEBA 1GD7A 3VA5A 5EPJA 1B53A 1EQVA 5KRUA 3HP3A 3KOJA 4BY1G 3MEFA 2PQAB 1WTRA 3A8KE 4IUQA 1PFMA 2UUCQ 4RHRA 4L63B 4AQYQ 2E2HB 1VQJA 5CR3A 1EIFA 1A0IA 4OXPA 2R61A 2KCMA 3KDFB 3K7AH 3KBGA 4QQBX 3J7YW 3HRZC 3E6ZX 4OO1G 4C3IB 1IXRA 4JK1C 5M3FB 1SN8A 1PDQA 1WTHA 3VR3A 3I4MB 1N32L 4LK1C 1PVOA 4DV5Q 3D0FA 1QZHA 2F0EA 4JYAL 1B8AA 1QWYA 2F0NA 2EJGC 3OPOA 5C3EB 2QEXA 3BU2A 3QB3A 2B8GA 1EY4A 4IZ8A 5KNDA 4GKKQ 4WORA 5BN3A 4UP7A 1ENFA 4C3JB 2E76C 4XYOA 3UDXA 4JI7L 1PH4A 1CKMA 1X65A 3A54A 4KY7A 1K8GA 4LUOA 1V1PB 4C3IG 5I9OA 1JE4A 5M3FG 3OW7A 4I7ZC 5IT9c 3I4MG 4A3JH 1SFOH 1EZ8A 5BN5A 2JN4A 3ITPA 1FJGL 2QEJC 2PW7A 5IP9H 4NP5A 4G4KA 5C3EG 4FXKC 4DK6C 5JAVA 1FD7D 2IY5B 2M00A 3T1YQ 1XNQL 5AJ3L 1IBLL 2XWJB 3K6OA 4P71A 2WINB 5C0XH 2RDGA 3GTQH 1AW7A 4C3JG 3PIO3 3F2DA 2ALYB 1KABA 1BKBA 1IYUA 4R4TA 3VYSA 1SMYC 1HR0Q 2YU9B 1GJXA 5JOBA 1Y1VH 3SVMA 1LT6D 4DFAA 5C0XJ 4KLKA 3R3OA 1CKNB 2D2CC 1OTCA 2SDFA 1PTOB 2BE5C 4X62L 4KMUC 2FXQA 5ELDA 4IPCA 3T56B 1SROA 4A3IB 4RCOA 1DJRD 2QCPX 4DR6L 1YJ9A 3DXJC 4FO2A 5KEEA 5C5LA 2K28A 4KI0A 2K5VA 3KF6B 3R93A 4L5SA 2K01A 4A3MH 2IW3A 1K9MC 3J7ZC 2E2DC 3HEJA 1PH5A 4DNTB 2DN8A 1YJNA 5LHY1 4XTCS 4C56C 2QDLA 4QIWB 1YHAA 3KF8B 4Q0FA 4XXEA 4OONA 1TU2B 3E5SA 2ZM6Q 3MA2B 4J1MA 4G7ZC 1K3BC 2DJFC 5CBEE 3Q6SA 2K33A 1SE8A 3BVMA 2NN6H 4X3TA 4MTKA 4X65L 2ZTDA 4A3IG 1K8OA 1XPUA 1L0XB 1LABA 3L0OA 4JVZA 1SNDA 3U50C 2BDOA 2IX0A 1N34Q 5IYBH 2AUKA 3S9WA 4GZYC 1HJPA 5LMUQ 2NVYH 3OMGA 1YVCA 1QZGA 1C9OA
chains in the Genus database with same CATH topology
4CDDC 1ICFB 1K3BC 2DJFC 1MHWC 4OEMB 4OELB 2DJGC 4CDCC 4CDFC 4CDEC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4CDD C;  1ICF B;  1K3B C;  2DJF C;  1MHW C;  4OEM B;  4OEL B;  2DJG C;  4CDC C;  4CDF C;  4CDE C; 
#chains in the Genus database with same CATH topology
 1YNN D;  1TS4 A;  5JEA H;  3CCM A;  1CHP D;  2B29 A;  3GTM H;  4BXX H;  2AUJ D;  1B3Q A;  1TWH H;  1S5D D;  4GNX A;  3I70 A;  3QR8 A;  4GLA C;  4QCL A;  4DNR B;  1X3G A;  1XTD A;  2PQA A;  1TS3 A;  1P16 A;  3CCJ A;  1YJW A;  2DUD A;  2VW9 A;  2VQE Q;  3J81 i;  2Z0S A;  2OWO A;  3CCR A;  3I7F A;  4BBR H;  4DUZ L;  1LTT D;  1G29 1;  4R4I A;  2KEC A;  3KDF A;  1EFW A;  3TME A;  1Q8I A;  2UUB L;  2A8V A;  5E4W C;  4ODG A;  3G71 A;  1ZEQ X;  3UDI A;  3H09 A;  4IPD A;  4XQJ A;  2RCN A;  1A63 A;  1DOM A;  3S1N H;  1A15 A;  4KJO A;  1YZ6 A;  3HOZ H;  5JJK A;  2D5D A;  2A68 D;  2L5T A;  2A5H A;  2UU9 Q;  2IX1 A;  4K8J A;  2IL8 A;  5M3M H;  4F87 A;  2EY2 A;  2Z1C A;  3M4Y A;  3S17 H;  3A55 A;  1GXD C;  3M3Y H;  4A93 B;  3K8A A;  3ZJY C;  3S15 H;  1V1O A;  2EQS A;  5ELN A;  2AQ3 B;  2TMP A;  2FMM A;  4DR3 L;  4Z9C B;  5IYD H;  4RKB A;  2R92 B;  2R3Z A;  4S3S A;  2I0Q A;  2V4D A;  1SNQ A;  1QJO A;  4QUC A;  1MSH A;  3I3C A;  4JI5 L;  3NK9 A;  5FKA C;  4B08 A;  1V1P A;  1PYW D;  3WOF A;  4JCV E;  4JPB W;  3M7N A;  1SYE A;  4R1J A;  1MBY A;  2VXW A;  1Y1W H;  1B9N A;  4JI2 Q;  3Q23 A;  4IJH A;  1UNS A;  4A93 G;  2F4I A;  2OQ0 A;  5J39 A;  5LMN L;  2F0U A;  4PZ6 A;  2RKS A;  4X3K A;  4NXM L;  4C2M H;  1SE2 A;  1X56 A;  4DUY Q;  2R92 G;  4L5R C;  1IKL A;  2CVR A;  4KHZ A;  4B3R L;  2CQO A;  1XXG A;  3SE0 A;  2WV6 D;  1O7L A;  1E2W A;  1U9R A;  4YWK A;  1YNJ C;  2EY5 A;  1IZ6 A;  3EBE A;  4IUT A;  2VS1 A;  4LFB L;  2AWN A;  4APV A;  3I56 A;  4EQO A;  3CQZ H;  1VQ7 A;  1YIJ A;  1XNR L;  3M7G A;  1CUK A;  2F0V A;  1V43 A;  3GTO H;  1V1Q A;  3X3M A;  4EQP A;  3PIP 3;  2K03 A;  5FJ8 G;  2OQK A;  2J4X A;  3B6Y A;  3CW2 C;  3TRZ A;  3ULP A;  2IHF A;  2Z4I A;  3KF6 A;  3D8G A;  3GQB A;  4DV3 L;  3I8Z A;  3G48 A;  3NBH B;  2C35 B;  4NW2 A;  1QVC A;  1N33 L;  2YTX A;  1EFI D;  1O7Z A;  2XSC A;  2UXB L;  5C44 B;  3HOX B;  4OWW B;  3KF8 A;  2QW7 A;  1PV4 A;  3SGI A;  4L6T B;  4NKL A;  4X66 Q;  3IKJ A;  2JEB I;  1R9T B;  4EVO A;  2FIN B;  1F9S A;  1ICW A;  2KVM A;  4DAV A;  5IWA L;  4UP8 A;  1RHP A;  4QY7 A;  1TII D;  1QE6 A;  3FPP A;  2OCE A;  4A3E B;  5K36 H;  2HUG A;  4HJA A;  3GTL B;  2NVT H;  3DLL A;  1EU3 A;  4LF6 L;  5C44 G;  3HOX G;  4MNO A;  4A3B B;  5CV7 A;  4AH6 A;  2K6A A;  1CK1 A;  1CQF A;  2AWO A;  3KUP A;  3PSI A;  1IBM Q;  2PI2 A;  5BN4 A;  1IHZ A;  4UHV A;  1KAA A;  4LNQ A;  1XPO A;  2AQ1 B;  1BCP C;  1SYC A;  3MXN B;  5DM6 3;  3H94 A;  1AE2 A;  2JQO A;  2F0L A;  2HD3 A;  5KNC A;  4M8A A;  3K5M A;  2WB1 E;  2E5L L;  1D7Q A;  2HCI A;  3F2B A;  3DEO A;  4A3E G;  3SDZ A;  2F0K A;  2H5X A;  4K5W A;  1I4R A;  3C1F A;  1R4Q B;  5DM7 3;  5CC4 A;  3EA6 A;  4NDX A;  1TVX A;  2H1E A;  4DV6 L;  1J5E Q;  2Q2I A;  3FHW A;  1N36 Q;  4A3B G;  3PUV A;  4KHP L;  1XJV A;  2A6H D;  1QB5 D;  2PMZ B;  3RR5 A;  1T5X D;  3UDG A;  1FVI A;  1PFN A;  1EU4 A;  3PMF A;  4H44 C;  1IBK L;  3H91 A;  5DEH A;  2E2J B;  3TRE A;  1I50 B;  4ZK9 B;  3C2P A;  4KD3 A;  2JJQ A;  2JYO A;  3NUC A;  2B2V C;  4ILW A;  1Y14 B;  3NHH A;  1JOQ A;  4DV1 Q;  3D6W A;  1EYC A;  5J3B A;  4JV5 L;  2MNA A;  1TY2 A;  3LWU A;  5C4J B;  1IYJ B;  2O5I C;  2Z6K C;  4RGO S;  5EKK A;  1I94 Q;  1A8V A;  4EX5 A;  4UP9 A;  3HOV B;  2SEB D;  1BNZ A;  3GDE A;  1D5Z C;  3CCQ A;  2E2I H;  1Q12 A;  4DA2 A;  4CKB A;  1STG A;  5IGD A;  1TXY A;  4PZ7 A;  3L2P A;  1CA5 A;  2IT1 A;  1B2T A;  1IKM A;  4LFC L;  2LXJ A;  2L1B A;  4OL7 A;  3V2T A;  1DOK A;  3P7J A;  1ASY A;  2IHE A;  1FNV A;  2WAQ B;  1XX8 A;  3VDY A;  3S1M H;  2A6E D;  1Q86 C;  1BCP B;  2RSO A;  3T16 A;  1HHV A;  4A3K H;  3W3A A;  1F2M A;  1OXS C;  1UE6 A;  2ES2 A;  1EWH A;  4P74 A;  5C3X A;  3ULJ A;  5D14 A;  4P75 A;  4JI3 Q;  3M4P A;  3HOV G;  3A74 A;  4A3G H;  2VQF Q;  1Q90 A;  3NTH A;  1C4Q A;  1AFP A;  3CCV A;  1SRU A;  2FHT A;  2F52 A;  1G6P A;  1LM0 A;  2LFN A;  3JAM L;  3S1R H;  3P20 A;  3Q0A A;  3U4Z A;  3PO2 B;  3RZD H;  3GTP H;  4UDU C;  1FNU A;  3W1B A;  5J22 A;  3PIO A;  2WAQ G;  3OHX C;  3H0G H;  2B3G A;  2R7D A;  5M9O A;  3F1Z A;  3NBH A;  4JI0 L;  4DK0 A;  2EZV A;  1D5M C;  2A69 C;  2HQE A;  2PNH A;  3CRL C;  3PQI A;  2G9D A;  4DU9 A;  1X9N A;  1D1K A;  3WDN A;  2BA1 A;  5IOD A;  1RF2 D;  4LUV A;  4BWG B;  1W6J A;  3GTK H;  3S2H H;  4YCU A;  4YY3 L;  1VF7 A;  3PO2 G;  1IW7 C;  1E3P A;  2RHS B;  1I6V C;  3AYH B;  3ND9 A;  1STN A;  2HHH L;  3K5L A;  4EGV A;  5L37 A;  4WJ4 A;  1XMQ Q;  3PO3 H;  3J7A F;  5BR8 L;  1PFS A;  1PRT C;  3TZU A;  3SXH A;  4QUF A;  3H3V I;  1YI2 A;  1O80 A;  1TWA B;  1TS5 A;  4DV0 Q;  1GUN A;  2LMC B;  1ZXT A;  1JB7 A;  2B2Y A;  1HRJ A;  2NVQ B;  4LF4 Q;  3HFZ B;  3EVQ A;  5D3D A;  1MJE A;  4LFA Q;  5IYC G;  4QIW E;  2H4O A;  4B3M L;  4A3F H;  2CW0 C;  5IP7 G;  3MXN A;  1DON A;  1EIY B;  3GTG H;  3MXP A;  4IFD G;  1KIX A;  1TQO A;  1UAP A;  1EYG A;  1GO3 E;  2K04 A;  3J80 E;  3RN5 A;  4LF7 L;  1NE3 A;  3EJI A;  4EQ5 A;  4DV7 Q;  2R7Z H;  3EFX D;  2KHS A;  1WTV A;  1A62 A;  1WTP A;  2OTJ A;  1OO9 B;  1UWV A;  1LT3 D;  1BUV T;  3AFP A;  1Q82 C;  3JC6 6;  4RAU C;  3FRP B;  1EQQ A;  4DR2 L;  4JI8 Q;  1V8Q A;  4WJ3 M;  5M5Y B;  1XMO Q;  4DR1 Q;  4XT1 B;  1UEA B;  5C4H A;  4GKJ L;  4X64 Q;  3GTJ H;  1BR9 A;  1BBW A;  1ONL A;  1ZYR C;  3ULL A;  2EPB A;  3D31 A;  4GLV B;  1II3 A;  2EYH A;  4BBS H;  1Z47 A;  1SSO A;  4IFD J;  3QOJ A;  1KDA A;  2HCC A;  3SK8 A;  4A3D H;  3T1H L;  4ZCK A;  2ID0 A;  4B3S Q;  2K4K A;  2VB3 X;  2JEA I;  4CKE A;  4RWS C;  1PTO F;  2PW5 A;  4QJF A;  1PRT B;  2OT2 A;  1I4G A;  1VQB A;  4LW1 A;  1WD0 A;  3G6J B;  4BY7 B;  4FVM A;  1TWF B;  5M5X H;  4YWM A;  2C5C A;  3A7A B;  3CME A;  1DOL A;  3M9B A;  3NPP A;  1EY9 A;  3HOU B;  2F3W A;  2N49 A;  2IX3 A;  5FLX E;  4Y7N B;  3T4A C;  5IGB A;  2JA6 G;  3SK6 A;  3BVG A;  4CDF C;  2Q8T A;  4LF5 L;  3DWQ A;  4BY1 H;  4A3J B;  2CWP A;  1KC8 C;  2PO4 A;  3M85 A;  1UUP A;  4KN7 C;  5E3F A;  3EN2 A;  1RKN A;  4HJ8 A;  1BBU A;  3UI2 A;  2VL6 A;  4BY7 G;  2MO0 A;  3ERQ A;  4R4O A;  3GV3 A;  4KKT A;  4PMB A;  3A5U A;  2JA6 H;  3RN2 A;  1STH A;  1HNZ L;  1HZB A;  1QNU A;  1PA6 A;  4OO1 H;  3HOU G;  4PQX A;  3WWV A;  1X54 A;  1BO0 A;  1AN8 A;  4N9P A;  1E7Z A;  2UXD L;  1JJ2 A;  4CHT B;  2NVX B;  3S16 B;  4FF4 A;  1AE3 A;  2K5H A;  3PIP A;  5T1I A;  2VUM B;  2Q8I B;  1WYD A;  2Z6K A;  1LTG D;  3KBX A;  4B3T L;  4DR7 L;  1DM0 B;  2E2H H;  2QDB A;  1QG7 A;  1G51 A;  3CF5 A;  3IL8 A;  5CV6 A;  2F0Q A;  4A76 A;  4POG A;  1PZJ D;  4J15 A;  1N32 Q;  3MC0 B;  4HIM A;  4C3I H;  3K59 A;  2BCO A;  3I2Z A;  3RZO B;  5M3F H;  3HOW B;  4N9T A;  4HMJ A;  4NXN L;  3I4M H;  1EYA A;  2JP1 A;  1JJG A;  1VQP A;  4JYA Q;  3E9I A;  2K5D A;  1GUG A;  1X3F A;  3E0J A;  2L11 A;  1PTO D;  3HOY B;  3TDQ A;  1Y69 U;  1D6E C;  2VUM G;  1PYB A;  1CFM A;  1YEZ A;  1VQL A;  3U4V A;  2KOL A;  1CTM A;  5C3E H;  1PYS B;  4IQZ A;  2GN5 A;  3V05 A;  5FLM G;  3KLS X;  4JI7 Q;  1AEX A;  1CSP A;  4DR5 L;  1Q46 A;  1KRT A;  4C3J H;  4UAI A;  3UE1 A;  4U68 A;  2DY8 A;  5C5M A;  3HOW G;  4YIJ A;  4IPH A;  1PLF A;  2QIL A;  1FJG Q;  4RCN A;  3T53 B;  4P2C B;  3J80 c;  3HOY G;  3MAQ A;  1S5C D;  2JXM B;  4IUN A;  2NTT A;  1XNQ Q;  4HMI A;  5AJ3 Q;  1E1T A;  5EPK A;  4MN3 A;  2A74 C;  5EGT A;  1W6K A;  2OTL A;  3R2T A;  4P73 A;  1FR3 A;  4IOA A;  1DD2 A;  1JIC A;  1EOV A;  3CC2 A;  1O78 A;  3FEW X;  1S72 A;  3SR1 A;  4H0L C;  1VQ4 A;  2YU9 H;  3JAM c;  3QG1 A;  4DPG A;  1QCB D;  4ZAI A;  4JI1 L;  1SMY D;  1WTX A;  4DR6 Q;  2EJF C;  3K5N A;  1PTO H;  1BVS A;  5CYU A;  2DJG C;  3F2C A;  5LMN W;  1KD1 C;  5C4X B;  4A3I H;  1EQT A;  4DNI A;  3H15 A;  4R4C A;  4F8M A;  3ER0 A;  5IGF A;  2BE5 D;  3I4L A;  5M3M B;  1G2T A;  3HKZ B;  4J8Q A;  1A3U A;  2DNE A;  2NN6 I;  2K5W A;  5M5W B;  1MJC A;  4C1N K;  2PMZ E;  5JJI A;  1VQG A;  4F7X A;  1NR2 A;  4K2K A;  3CP0 A;  3CMA A;  1PXU A;  1NNX A;  2JA7 B;  4RH6 A;  1LYL A;  3U9S A;  3M4Q A;  4YHH L;  3K58 A;  2MUY A;  4X65 Q;  4A3C G;  1LO5 D;  2QF7 A;  3OYY A;  5FLX c;  4G7O C;  4L5T A;  5C4X G;  1SNO A;  4KTA A;  2EOT A;  2ASB A;  3OTO L;  1CQV A;  1I3Q B;  1JWU D;  3HKZ G;  1HNW L;  2NTS A;  4C3H B;  1L2F A;  1A2U A;  1U4M A;  1DCZ A;  2C9O A;  3NWT A;  5JPM C;  1RCV D;  1EQR A;  3Q22 A;  2B63 B;  1PH6 A;  1WCM B;  3T13 A;  2F0W A;  1XYI A;  2KUM A;  4CJ1 B;  3Q24 A;  3GP7 A;  3MVV A;  1YIT A;  3G6E A;  2JA7 G;  1NAP A;  4HJ7 A;  2WAQ E;  4RMF A;  4OX9 L;  1H95 A;  2HIX A;  1WVL A;  3FVQ A;  4HIK A;  4JI4 L;  3EQL C;  2R6G A;  1GM5 A;  1HZA A;  1WJJ A;  2MQH A;  5IGE A;  1EY6 A;  4DUZ Q;  4OEL B;  3TN2 A;  1HA5 A;  4DV4 L;  1Y8N B;  3CAM A;  1J8I A;  1FNW A;  4C3H G;  1ESF A;  2UUB Q;  1VQF A;  2K32 A;  1HNX L;  2B63 G;  1HQM C;  1WCM G;  4MTN A;  4DR4 L;  1JMC A;  1VQ6 A;  1JOK A;  1JT8 A;  1LLR D;  2F0S A;  3D6C A;  2Y0S B;  4CDD C;  2YTV A;  4DK3 C;  3QO2 A;  2VNU D;  2KCT A;  2YTY A;  4JBK A;  3WOE A;  4I65 A;  3RLF A;  4GOP C;  2AHO B;  2VY3 A;  2CHB D;  4A93 H;  4DR3 Q;  4H7B A;  2SOB A;  1H9R A;  4IUR A;  5HGT A;  1CKN A;  5A2Q L;  1HUN A;  1C0A A;  5IOC A;  2X69 A;  3CXC A;  4RKL A;  1Q7Y C;  2A1A A;  3W1G A;  2R92 H;  3J81 j;  2EDG A;  4JI5 Q;  3RD4 A;  3TS0 A;  4DV2 L;  4LF8 L;  4UPA A;  3BDO A;  4KHV A;  1JE5 A;  2NYZ D;  4DK1 A;  2Y0S G;  4RA8 A;  3SHL A;  3MFG A;  2OEO A;  5LMN Q;  3OMC A;  1GUW A;  4LF9 L;  2JA9 A;  1K8A C;  4NXM Q;  3BZC A;  1RJT A;  4ZUJ A;  2R93 B;  2ZTE A;  5FJ8 H;  2F3I A;  4H13 C;  1PZK D;  3NEN A;  4DGZ A;  2CKZ B;  3S14 B;  3RLO A;  2OF1 A;  4B3R Q;  2RSN A;  2PNR C;  3M4O B;  1RDP D;  1DGS A;  4LFB Q;  2RCF A;  1K83 B;  1DZ1 A;  2I5H A;  4IUV A;  5EBC A;  1CA6 A;  1A2T A;  1PMR A;  5IGC A;  5GQO A;  3G7L A;  2A6H C;  2EJM A;  1XNR Q;  1ENA A;  1TWG B;  2IJ0 A;  5ELB A;  5KGU A;  1YNJ D;  1NMG A;  2Z8L A;  1AZQ A;  2CCZ A;  2R93 G;  4DV3 Q;  2D62 A;  1QUQ B;  1EL0 A;  4GOP B;  1C48 A;  5LL6 X;  1N33 Q;  4PMW A;  1W3S A;  3VR6 A;  1LTB D;  2UXB Q;  4ABN A;  3H3V C;  4FYD A;  4Y52 H;  3S2D B;  1YHQ A;  1STE A;  2WFW A;  3S1Q B;  5C44 H;  3RNU A;  3HOX H;  1XPR A;  2MHV A;  4NB3 A;  1OXX K;  5IGG A;  1SLJ A;  3L9A X;  3E9H A;  1KAW A;  1JJC B;  5IWA Q;  1R9T H;  4ZKB B;  4IN3 A;  4DAY B;  2BH2 A;  3R8B A;  1H9K A;  3CPW A;  3RLN A;  4GLX A;  3PF5 A;  2E8G A;  3I91 A;  2ZXR A;  1F2Z A;  1Q81 C;  4A3E H;  2ZJP A;  2QGQ A;  1BQQ T;  5H1S E;  4LF6 Q;  1TR5 A;  3GTL H;  1LTI D;  1AH9 A;  1E24 A;  2F0F A;  2JSO A;  3ERO A;  4IPG A;  3STB C;  2PYK A;  2NZ1 D;  2YYZ A;  4A3B H;  1X3E A;  3BG3 A;  2OXP A;  2UUA L;  2SNS A;  1VQ9 A;  1ASZ A;  2E5L Q;  4OWX B;  5FOB B;  3I4N B;  1X6O A;  4K14 A;  3J81 L;  5CMD A;  1WTQ A;  3DM1 A;  4DV6 Q;  3ND8 A;  3TP5 A;  4KKU A;  4KHP Q;  4CBV A;  1HZ9 A;  3OW2 A;  1MIU A;  1HUM A;  2JE6 I;  4OEM B;  3KYH C;  4GN3 B;  4QL5 A;  2F03 A;  3VA7 A;  1D8L A;  3TEH B;  5I2Y A;  2BA0 A;  4JI6 L;  2HDL A;  3MFY A;  2M2L A;  4QF4 A;  4V19 0;  3D3R A;  4YCV A;  4FNF A;  1IBK Q;  4OIJ A;  1Q1B A;  3EIV A;  1ML0 D;  5GAG C;  3I4N G;  1K0R A;  1K73 C;  2I5M X;  2E2J H;  3VYR A;  3BZD B;  1TT2 A;  1LV9 A;  1I50 H;  2KJX A;  3NP8 A;  4JV5 Q;  4MIU A;  1L1O C;  4JBJ A;  1MD2 D;  1GKH A;  4RGM A;  2HT1 A;  2JA8 B;  4RGN A;  3MTS A;  2G9H D;  5C4J H;  2PPB C;  1Q8K A;  2UXC L;  4DAP A;  1F9R A;  5E1F A;  2PZU A;  1FL0 A;  2XVS A;  1U4P A;  3HOV H;  4GS3 A;  1VQA A;  2EYJ A;  4JC0 A;  5I6W A;  2QA4 A;  4HIO A;  3CC4 A;  4KY5 A;  3J7A V;  1K8M A;  4HCE A;  1B3A A;  4XIG S;  4F88 A;  4ME3 A;  4OGQ C;  4LFC Q;  3MZ5 A;  4A75 A;  1F9P A;  1VQD A;  1K28 A;  1SE3 A;  4R8I A;  3BJU A;  2Q2T A;  2KCN A;  4L8J A;  5DAU A;  3C1E A;  1MSG A;  4HCS A;  3P1H A;  2LS0 1;  3VR2 A;  2O2L D;  2JA8 G;  4A3L G;  2JK8 A;  4LWC A;  1PH1 A;  5CV4 A;  4RG1 A;  2EYL A;  1LAC A;  1UE1 A;  2LY7 A;  3HS0 C;  4JOI C;  4NPS A;  1N8R C;  2X6G A;  3FMC A;  1TWC B;  1JWS D;  3TQY A;  1EWI A;  2PZW A;  1KQS A;  1W2B A;  2WKD A;  4LUZ A;  3LWE A;  1HFG A;  1VQ8 A;  4ULL A;  1OXU A;  1L0Y B;  1SJH D;  3PO2 H;  3O13 A;  4FXG C;  5F2D A;  3DHQ A;  2JA5 B;  2DY7 A;  2KQ3 A;  4JI0 Q;  1HFN A;  1QUQ A;  1RD9 D;  4TKO B;  4GOP A;  3QIA A;  5J1Z A;  4K0K L;  2F4V L;  1I6H B;  2LXK A;  4DXG A;  3J81 E;  3K80 C;  1F77 A;  5D3I B;  5D65 A;  3OSO A;  5I6Y A;  1L1O B;  1Y8O B;  2WII B;  1B50 A;  1CZW A;  1QVG A;  2CQA A;  1FYC A;  2ENB A;  4V0B A;  4MZ9 A;  3F2U A;  3DWP A;  2B8F A;  2A69 D;  5KNB A;  1Z6H A;  4YY3 Q;  4O2D A;  1JOO A;  3NEM A;  2K5Q A;  3KJP A;  2PZT A;  1HZC A;  5IYC H;  3FKI B;  2HHH Q;  2XGT A;  4DAY A;  2CFM A;  1GVP A;  1LT4 D;  3X3N A;  2EY6 A;  5IP7 H;  4WFN 3;  3TP7 A;  2JA5 G;  4IFD H;  5BR8 Q;  5EAY A;  2ZXO A;  4PV1 C;  3MWY W;  1A3V A;  3JAM E;  1E1O A;  4N8X 1;  3TP8 A;  3P75 A;  4IJL A;  4FF3 A;  1KLG D;  1S5E D;  4OHJ A;  5CV9 A;  3NTI A;  4B9X A;  4GN5 A;  1TWA H;  3K7A B;  1U5K A;  4HED A;  4AQY L;  2UUC L;  5FO9 B;  5K5P A;  1QNK A;  3HKZ E;  5CV5 A;  2MO1 A;  2FMC A;  1PFB A;  4B3M Q;  3BS1 A;  2MP1 A;  1SAP A;  1LTR D;  2NVQ H;  1YBY A;  1RIP A;  2F0O A;  4HAE A;  3OOC A;  5FO7 B;  3FKI G;  1LT5 D;  1U0L A;  1A6X A;  1EEF D;  4DV5 L;  4LF7 Q;  5IIF A;  1DXM A;  1UEB A;  4ZYS A;  4CDE C;  2K5N A;  1HA6 A;  4M1U B;  3AB9 A;  2G5D A;  4LMQ D;  1NR4 A;  2EIF A;  2SNM A;  2N3S A;  1WI5 A;  3CRK C;  3PV0 A;  5E4X A;  3IAY A;  4DR2 Q;  1VDZ A;  4GKK L;  3IRB A;  3E0E A;  5HY6 A;  2EY1 A;  3CCL A;  1ILP A;  3U58 A;  4EQN A;  4GKJ Q;  3D4D A;  3I90 A;  5M5Y H;  1SFO B;  2F0P A;  3NBI A;  3KFU A;  5TSS A;  3I73 A;  3HKS A;  5ELC A;  1H9S B;  4KK7 A;  1VF5 C;  3D4R A;  3T1H Q;  2N88 A;  3SK5 A;  1H9J A;  2EYM A;  4HSV A;  3PUX A;  3UE0 A;  2D0O A;  2K14 A;  2PCF B;  4G7H C;  1ZYR D;  2EXD A;  1S3O A;  3CU7 A;  3GTQ B;  1PTO C;  5DNF A;  3T1Y L;  2Z4H A;  1NCV A;  2L9H A;  1KNA A;  4RHS A;  1TKW B;  3A0J A;  5KIX A;  1VMC A;  1JCK B;  2A19 A;  1I5F A;  4BY7 H;  1V9P A;  2F3V A;  2B2V A;  1Y1V B;  2LKV A;  4A3J G;  4X6A H;  1GHJ A;  1CZG A;  1TWF H;  4DXF A;  1WFQ A;  5IE8 A;  1SDF A;  1TY0 A;  1HR0 L;  2Y0S E;  3OWF A;  1F2Y A;  1SMX A;  3HOU H;  4K6L A;  5IP9 G;  4LF5 Q;  3ERS X;  4Y7N H;  3A7L A;  3KLS A;  4A3M B;  4FP5 D;  4XYQ A;  2L0C A;  2B2U C;  5C0X G;  2AMC B;  4OO1 I;  5E7N A;  5ELF A;  2ZT9 C;  5HUR A;  2BH8 A;  1KDB A;  1Y1V G;  1HNZ Q;  4NMZ A;  3TBI B;  4K5X A;  4G57 A;  5I2X A;  1S5F D;  1SNP A;  1WOC A;  2EE1 A;  2ZM6 L;  2NUC A;  4P72 A;  1BBX C;  1T9H A;  2D0P A;  2NZH A;  2UXD Q;  2FFK B;  1D5X C;  2N55 A;  2EXZ A;  4PNY A;  1WTW A;  4Q5V A;  1S4Z A;  2B2T C;  2NVX H;  1N9W A;  3S16 H;  1RTO A;  1L1O A;  4A3M G;  2YV5 A;  1PH9 A;  1YNN C;  4ZKC B;  4QGU A;  1FGU A;  1HH2 P;  3AQQ A;  3J81 c;  3CCE A;  3MEH A;  1N34 L;  4B3T Q;  2NVY B;  4DR7 Q;  2VUM H;  4HR7 B;  5C0X I;  4IAL A;  1SR3 A;  1B1Z A;  2EYO A;  3K81 C;  5LMU L;  3DUZ A;  4YCW A;  1JB3 A;  2P5Z X;  3GTM B;  5FLM H;  1BF4 A;  2IPK D;  1TWH B;  3CCS A;  2CWA A;  1IBL Q;  2XTI A;  3PUW A;  2B2W C;  2NN6 G;  1U4L A;  3PGZ A;  1M1K C;  4NXN Q;  1ICF B;  2F0J A;  5JJZ A;  3PUY A;  3RZO H;  3HOW H;  4ZUI A;  3SK4 A;  1STB A;  4RFB A;  1SYF A;  4UY8 C;  4BBR B;  2J0T D;  5IYB G;  1XWE A;  2EYF A;  1U4R A;  1EY8 A;  4FF1 A;  2VQE L;  3HOY H;  4X62 Q;  1E0B A;  4KJN A;  1EOT A;  5JEA G;  2A68 C;  2Z9H A;  4IOC A;  1SNM A;  4DR5 Q;  1S40 A;  1O7I A;  4JOI A;  4BXX G;  5G3L F;  3S1N B;  1KRS A;  1CM9 A;  5EKI A;  1IYV A;  3HOZ B;  1KL9 A;  1UE7 A;  2ICE C;  1D2B A;  1I4Q A;  1EZ6 A;  5JVG 3;  3J7A 5;  1AP0 A;  1HQR D;  2B39 A;  3NXW A;  3S17 B;  4CDC C;  3M3Y B;  2LSS A;  3S15 B;  2UU9 L;  4ZRZ A;  4K8I A;  1RL2 A;  1DYQ A;  2EYP A;  5EJW A;  4BBR G;  3VR4 A;  5JVH 3;  1ET6 A;  1X3Q A;  5NUC A;  3U9O A;  1VQE A;  1X55 A;  2XN9 C;  1C7Y A;  3L3O C;  5JEA J;  3NQT A;  5GAH C;  2DGY A;  3K0Y A;  3HOZ G;  1Y1W B;  2XRS D;  1H9S A;  5C4Z A;  4DN4 M;  5M3M G;  1EYD A;  4JI1 Q;  5DLQ E;  1GUO A;  2K50 A;  3J80 i;  4DF7 A;  4JI2 L;  3K7U C;  4C2M B;  3I55 A;  1MHW C;  1PH2 A;  4A3C H;  1OXV A;  5AFW A;  5IYD G;  2KHJ A;  2I5L X;  1X3P A;  3IFT A;  1STY A;  5C4X H;  2BDN A;  2GVA A;  2Q8R E;  3A5Z B;  3OIQ A;  4K2L A;  4DUY L;  1RTN A;  4I7A A;  4R9W A;  4R8N A;  1Y8P B;  3N6R A;  1J9O A;  3T51 B;  2L15 A;  5GAD C;  3CQZ B;  5M5W H;  2XNA C;  1Y1W G;  1SNC A;  3URY A;  2RVL A;  3JAM i;  4K5V A;  3GTO B;  1SXT A;  2CH4 A;  4YHH Q;  3D4W A;  1PH7 A;  2JA7 H;  1KDC A;  4JW0 A;  3G4S A;  1HCZ A;  3BDC A;  3TSS A;  4POF A;  3OTO Q;  3BYT B;  4BS9 A;  1JOR A;  5LL6 S;  4KY6 A;  2IWH A;  1HNW Q;  2L4N A;  4OWT B;  2I07 B;  2V1C C;  1CI3 M;  4FXD A;  2WAC A;  1I3Q H;  2KCC A;  5G3L D;  2CH4 W;  3FDT A;  4C3H H;  1VQC A;  2WP8 J;  2ZJR A;  4CGY B;  2HIV A;  2K52 A;  1CHQ D;  4GN4 B;  2XIW A;  3QOL A;  5GRO A;  4X66 L;  2B63 H;  2NZO A;  1CT1 D;  1WCM H;  2AQ2 B;  2B2Y C;  2O4X A;  3GO5 A;  4OX9 Q;  4FF2 A;  1I4P A;  1VQI A;  4HID A;  4JBM A;  2MGS A;  4JI4 Q;  3DM3 A;  2NVT B;  1VQO A;  1NTG A;  1EEI D;  2F0T A;  4HJ9 A;  4DV4 Q;  4XQQ A;  4XQN A;  4WRD A;  3A56 A;  4CJ2 C;  3AMU A;  4U67 3;  1WTO A;  3MHB A;  3W2D A;  3AEV A;  5KYL A;  1B9M A;  1HNX Q;  2ATW A;  4N8F A;  1IL2 A;  3A8I E;  4CKC A;  2F0I A;  4DR4 Q;  2KA7 A;  2BOS A;  4O1N A;  1IBM L;  4LAA A;  2I46 A;  5JJL A;  3PUZ A;  1BCP F;  1KLU D;  1SJE D;  4ZQ3 A;  1G8Z D;  1CSQ A;  4MHE A;  2N78 A;  5K36 G;  1EY0 A;  1EIH A;  4KN4 C;  3V96 A;  1LTS D;  1HPC A;  3KLR A;  1Q3L A;  3RMH A;  3ZYY X;  4IUP A;  4L5Q A;  3TS2 A;  3ONA B;  4JBW A;  2RA4 A;  2RHQ B;  2B2U A;  1NSN S;  1J5E L;  5CV8 A;  1NUC A;  2Q2H A;  1N36 L;  1EIG A;  4DV2 Q;  4LF8 Q;  1O7Y A;  2RDH A;  5FK9 C;  3DWA A;  1MI2 A;  2KBN A;  4RGT A;  3BVZ A;  5CBA E;  3AU7 A;  2F0G A;  2ZTC A;  3RUZ A;  3NWS A;  4DAM A;  1F2L A;  3S24 A;  2HDM A;  1FGB D;  1NMF A;  1G6Z A;  5C6A A;  3KJO A;  3FP9 A;  3NSW A;  4LF9 Q;  1Z9F A;  1BOS A;  3DMU A;  5JPN C;  4XDX A;  1LTA D;  1SE4 A;  4K6D A;  1UE5 A;  4DV1 L;  4KV6 A;  4TQU S;  2RDF A;  4XT3 B;  3QWN A;  2R93 H;  5ISR A;  2B2T A;  2RQX A;  3OWE B;  1JC7 A;  4AYB E;  1I94 L;  3S14 H;  1M8A A;  2R7F A;  1B70 B;  3HZX A;  3MXU A;  4PMC A;  2E2I B;  2HQL A;  3N52 A;  1NBW A;  3A8J E;  1QVF A;  3TZD A;  5IT9 L;  2A6E C;  3M4O H;  1VQH A;  1KNE A;  1ET9 A;  1F9Q A;  4HJ5 A;  1ILQ A;  1K83 H;  3CD6 A;  3BDL A;  5I4D A;  3H6M A;  3F8T A;  5A2Q E;  3S1M B;  1ZKO A;  1K0S A;  2GVB A;  4HTH A;  5EKL A;  2A73 B;  1TWG H;  4CJ0 B;  1A3T A;  4A3K B;  2B2W A;  3VR5 A;  2RBM A;  5T1G A;  1D1I A;  1LTL A;  1PHJ A;  2K05 A;  5ELO A;  1I4X A;  3NQI A;  4A3G B;  3CCU A;  1EY7 A;  1T5E A;  2DNC A;  1KXL A;  1XTC D;  3UDF A;  3CPF A;  4JI3 L;  2VQF L;  1B7Y B;  1HTL D;  2N8N A;  4B9W A;  2RF4 A;  1SYG A;  1G2S A;  1HTP A;  3S1R B;  4FDB A;  3S2D H;  3RZD B;  3GTP B;  1EUJ A;  3S1Q H;  2PQE A;  4J6H A;  1BCP D;  1ENC A;  1B44 D;  1PH8 A;  1HXY D;  1QOH A;  4X3U A;  1VCI A;  2L55 A;  3H0G B;  3I4O A;  5HGQ A;  4AIM A;  1WD1 A;  4H02 A;  4A3K G;  3CHB D;  1VS0 A;  3VYT A;  5GAE C;  5KYI A;  4A3G G;  1P8L A;  2KEN A;  1JWM D;  2O5J C;  4TSS A;  2X6L A;  4ALP A;  1I4H A;  3K5O A;  5I9P A;  2QKI C;  2K75 A;  4JG2 A;  3R2I A;  3GTK B;  3S2H B;  3J80 L;  1SYB A;  1GOZ A;  2GA4 B;  1M90 C;  4LJZ C;  1YHB A;  3AFQ A;  4IUU A;  2UUA Q;  1MGS A;  1CKO A;  3H0G G;  3I72 A;  3STB D;  2ZJQ A;  2M9V A;  4ID6 A;  2KED A;  1VQM A;  3PO3 B;  2EVB A;  2NBF A;  1SBB B;  4QB4 A;  5EBD A;  3CC7 A;  3VYU A;  3I4N H;  1PRT F;  1XMQ L;  1E2Z A;  1PZI D;  2K1B A;  5ELE A;  3L7Z C;  1G91 A;  1Q1E A;  2F0H A;  1YNX A;  3LNN A;  4DV0 L;  1E2V A;  1LUZ A;  3LGJ A;  1S5B D;  4E6I A;  4A3F B;  5IY0 A;  2F1M A;  4LF4 L;  3OIP A;  5IT9 E;  4JI6 Q;  1PH3 A;  3H3V H;  4LFA L;  3PF4 A;  3DEP A;  1GUT A;  3GTG B;  1X32 A;  1QIL A;  4O42 A;  1SYD A;  1KHI A;  3PCO B;  1J6Q A;  3PO3 G;  3NEL A;  5COY A;  2R7Z B;  4DKA C;  4WJW A;  3QJY A;  2WKC A;  2L12 A;  1B4O A;  2NWG A;  3HGB A;  3Q8D A;  4DV7 L;  2UXC Q;  2MJ8 A;  4HN7 A;  2JA8 H;  4A3L H;  1ROD A;  2KHI A;  1AZP A;  5FLX L;  4TVA B;  4BA2 I;  4A4I A;  1VQK A;  1H9M A;  5CGK A;  4A3F G;  1JR0 D;  3W5O A;  5COR A;  4JI8 L;  3C46 A;  2VZA A;  2AKW B;  1E22 A;  3TP6 A;  3LX0 A;  4BA1 I;  1EWC A;  1XMO L;  4GNX C;  4DR1 L;  3GTJ B;  4BBS B;  1GUS A;  3CKI B;  4X64 L;  2F0M A;  1BDO A;  4A3D B;  4X3S A;  2R7Z G;  5EPL A;  5FO8 B;  5C3W A;  4YWL A;  2Q2U A;  1STA A;  2KEE A;  4B3S L;  2ZXP A;  4PG3 A;  1R4P B;  2NB0 A;  4OIK A;  4QMG A;  1KTK A;  3KLW A;  5M5X B;  3C3L A;  1IW7 D;  1EY5 A;  3IFD A;  3FPU B;  4KD4 A;  1TWC H;  2XRQ D;  4ME5 A;  3HG9 A;  4AYB B;  1MKH A;  2K7V A;  2XWB B;  5A35 A;  4BBS G;  1ESR A;  2Z6B A;  3E3X A;  1HR0 W;  1L0W A;  2MFI A;  2E74 C;  2WB1 B;  4IO9 A;  4A3D G;  2TSS A;  1NY4 A;  4O0A A;  1VQN A;  1PRT D;  3GD7 A;  4K0K Q;  2F4V Q;  2JA5 H;  4BY1 B;  4C1N I;  2VB2 X;  2D9U A;  1VQ5 A;  1I6H H;  2E75 C;  3GV6 A;  1NJI C;  1BXT A;  4HSP A;  2PI2 E;  4KKS A;  1GHK A;  2MPM A;  1SEB D;  1Z7T A;  2CW0 D;  3BZK A;  4IFD I;  2JA6 B;  3K57 A;  2J7Z A;  3BYY B;  5EQ0 A;  1JQY D;  4AYB G;  4R4Q A;  2FJ2 A;  4ZLT F;  1IL8 A;  2F0D A;  1OXT A;  3ICE A;  1C8C A;  3KK7 A;  4TRD A;  1M4V A;  3NTK A;  1K3R A;  2WB1 G;  3FKI H;  1VMP A;  1TS2 A;  3NE5 B;  3K0X A;  4PZ8 A;  4GNX B;  2ICI A;  3MXG A;  3SEB A;  1GD7 A;  3VA5 A;  5EPJ A;  1B53 A;  1EQV A;  5KRU A;  3HP3 A;  3KOJ A;  4BY1 G;  3MEF A;  2PQA B;  1WTR A;  3A8K E;  4IUQ A;  1PFM A;  2UUC Q;  4RHR A;  4L63 B;  4AQY Q;  2E2H B;  1VQJ A;  5CR3 A;  1EIF A;  1A0I A;  4OXP A;  2R61 A;  2KCM A;  3KDF B;  3K7A H;  3KBG A;  4QQB X;  3J7Y W;  3HRZ C;  3E6Z X;  4OO1 G;  4C3I B;  1IXR A;  4JK1 C;  5M3F B;  1SN8 A;  1PDQ A;  1WTH A;  3VR3 A;  3I4M B;  1N32 L;  4LK1 C;  1PVO A;  4DV5 Q;  3D0F A;  1QZH A;  2F0E A;  4JYA L;  1B8A A;  1QWY A;  2F0N A;  2EJG C;  3OPO A;  5C3E B;  2QEX A;  3BU2 A;  3QB3 A;  2B8G A;  1EY4 A;  4IZ8 A;  5KND A;  4GKK Q;  4WOR A;  5BN3 A;  4UP7 A;  1ENF A;  4C3J B;  2E76 C;  4XYO A;  3UDX A;  4JI7 L;  1PH4 A;  1CKM A;  1X65 A;  3A54 A;  4KY7 A;  1K8G A;  4LUO A;  1V1P B;  4C3I G;  5I9O A;  1JE4 A;  5M3F G;  3OW7 A;  4I7Z C;  5IT9 c;  3I4M G;  4A3J H;  1SFO H;  1EZ8 A;  5BN5 A;  2JN4 A;  3ITP A;  1FJG L;  2QEJ C;  2PW7 A;  5IP9 H;  4NP5 A;  4G4K A;  5C3E G;  4FXK C;  4DK6 C;  5JAV A;  1FD7 D;  2IY5 B;  2M00 A;  3T1Y Q;  1XNQ L;  5AJ3 L;  1IBL L;  2XWJ B;  3K6O A;  4P71 A;  2WIN B;  5C0X H;  2RDG A;  3GTQ H;  1AW7 A;  4C3J G;  3PIO 3;  3F2D A;  2ALY B;  1KAB A;  1BKB A;  1IYU A;  4R4T A;  3VYS A;  1SMY C;  1HR0 Q;  2YU9 B;  1GJX A;  5JOB A;  1Y1V H;  3SVM A;  1LT6 D;  4DFA A;  5C0X J;  4KLK A;  3R3O A;  1CKN B;  2D2C C;  1OTC A;  2SDF A;  1PTO B;  2BE5 C;  4X62 L;  4KMU C;  2FXQ A;  5ELD A;  4IPC A;  3T56 B;  1SRO A;  4A3I B;  4RCO A;  1DJR D;  2QCP X;  4DR6 L;  1YJ9 A;  3DXJ C;  4FO2 A;  5KEE A;  5C5L A;  2K28 A;  4KI0 A;  2K5V A;  3KF6 B;  3R93 A;  4L5S A;  2K01 A;  4A3M H;  2IW3 A;  1K9M C;  3J7Z C;  2E2D C;  3HEJ A;  1PH5 A;  4DNT B;  2DN8 A;  1YJN A;  5LHY 1;  4XTC S;  4C56 C;  2QDL A;  4QIW B;  1YHA A;  3KF8 B;  4Q0F A;  4XXE A;  4OON A;  1TU2 B;  3E5S A;  2ZM6 Q;  3MA2 B;  4J1M A;  4G7Z C;  1K3B C;  2DJF C;  5CBE E;  3Q6S A;  2K33 A;  1SE8 A;  3BVM A;  2NN6 H;  4X3T A;  4MTK A;  4X65 L;  2ZTD A;  4A3I G;  1K8O A;  1XPU A;  1L0X B;  1LAB A;  3L0O A;  4JVZ A;  1SND A;  3U50 C;  2BDO A;  2IX0 A;  1N34 Q;  5IYB H;  2AUK A;  3S9W A;  4GZY C;  1HJP A;  5LMU Q;  2NVY H;  3OMG A;  1YVC A;  1QZG A;  1C9O A; 
#chains in the Genus database with same CATH homology
 4CDD C;  1ICF B;  1K3B C;  2DJF C;  1MHW C;  4OEM B;  4OEL B;  2DJG C;  4CDC C;  4CDF C;  4CDE C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...