1K3BC

Crystal structure of human dipeptidyl peptidase i (cathepsin c): exclusion domain added to an endopeptidase framework creates the machine for activation of granular serine proteases
Total Genus 7
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
7
sequence length
69
structure length
69
Chain Sequence
DPFNPFELTNHAVLLVGYGTDSASGMDYWIVKNSWGTGWGENGYFRIRRGTDECAIESIAVAATPIPKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords dipeptydil-peptidase I exclusion domain
publication title Structure of human dipeptidyl peptidase I (cathepsin C): exclusion domain added to an endopeptidase framework creates the machine for activation of granular serine proteases.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 7
structure length 69
sequence length 69
ec nomenclature ec 3.4.14.1: Dipeptidyl-peptidase I.
pdb deposition date 2001-10-02
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.170 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Cysteine proteinases. Chain C 1k3bC00
1MHWC 2DJFC 2DJGC 4CDEC 4CDFC 1ICFB 4OELB 4CDDC 4OEMB 4CDCC 1K3BC
chains in the Genus database with same CATH superfamily
3W5OA 1XMOL 4IOCA 1EY0A 4GKKL 3S2DB 5IGGA 3MXUA 2JP1A 2RHQB 3UDFA 2JA9A 1HNWQ 5EPKA 2FXQA 2WIIB 5FJ8G 1QVFA 2K5QA 1D5ZC 1I6VC 1Q3LA 5FLXE 2K6AA 3BG3A 1DZ1A 4BA2I 1UNSA 3U50C 4OX9Q 1LACA 3K80C 4C3IB 4NKLA 3EBEA 4LF8L 1SNPA 5K5PA 1PTOH 5J1ZA 2KUMA 3PIO3 1H95A 4RMFA 2I46A 4XQQA 4KY5A 1PFBA 1EIYB 1HNWL 2F0HA 1H9SA 3Q6SA 2HD3A 1SLJA 1SROA 2KHIA 2YYZA 3KOJA 2F0LA 3KK7A 1FYCA 4GN3B 3G48A 1L0YB 1NAPA 3CCLA 1FNWA 2F03A 3PUYA 1IHZA 1SDFA 2DN8A 3ICEA 3DM3A 3L0OA 3SGIA 1E24A 1PH5A 4KHZA 1YEZA 2NN6I 5CR3A 1JJ2A 3FVQA 3DEPA 2WAQB 3I3CA 3V05A 3S16H 4A3LH 5FO9B 3LWEA 3ERQA 4DR6Q 2KCMA 3W3AA 3Q24A 4POFA 2K5HA 4K8IA 3TP7A 1R9TH 5HGQA 1MJCA 1C0AA 5GAEC 2UUAL 5J39A 2PZTA 4QB4A 3J81c 1UE5A 2K5VA 1BCPF 1NTGA 2K4KA 1T5EA 4RHSA 1TU2B 2ZJPA 4JI3L 1GJXA 1X56A 5M3FG 2G9HD 4LFAL 4UAIA 2R3ZA 5CV8A 4LUZA 4DN4M 5LMNQ 4DR2L 3EA6A 1SBBB 2CKZB 2VUMB 4JI5L 1ZXTA 1PFNA 3PCOB 4P2CB 2WV6D 1JWMD 2NN6G 2UXBQ 1EZ8A 4R9WA 2BH2A 3P75A 1DOMA 1HFNA 2JA8B 1CT1D 5C44B 3W1GA 1QG7A 3RN2A 3BYTB 4OEMB 4L6TB 4LFBL 1VQFA 2L55A 4Z9CB 1EQRA 2JA7H 2KCTA 4GOPA 5EPLA 1SJED 2HT1A 2B3GA 3EN2A 1SYEA 2JQOA 1QOHA 1PYSB 5M5XH 1LTLA 4GOPC 2LSSA 4LF9L 3GTOB 1X6OA 4N8FA 5IY0A 2OQKA 2EY6A 4HTHA 1SR3A 1JE5A 2MO0A 4LJZC 2NVTH 4GLXA 2JA5B 4AYBB 1IYVA 2I5LX 2JA7G 1SFOB 3PIP3 2R7FA 2MP1A 2X6LA 4RGNA 4AQYL 2E8GA 1VQ9A 1SE2A 1K73C 1N32L 1PZJD 2Z9HA 4RA8A 1ESFA 4DV2L 5FLMH 4AIMA 4POGA 3K6OA 1VQKA 1VS0A 3KF6B 4X66L 3D3RA 5M5YB 2NWGA 2PPBC 2D0OA 1JOQA 5EKLA 1KTKA 3H94A 1RKNA 2HCCA 2EE1A 5FKAC 2KENA 5EPJA 1Q1BA 1XPRA 4JBMA 5EKIA 3FKIB 1J5EQ 1LLRD 2XRSD 1WJJA 1WTWA 3L9AX 3E9HA 4JOIA 3I4NG 1TWFB 4DF7A 1N34Q 2ZJRA 4FDBA 3CCEA 2IT1A 3A8KE 1JWUD 5TSSA 2Z6KA 1B8AA 4A3JH 3OSOA 2F1MA 1Y1VH 1D1IA 3PO2H 5GQOA 1VQ6A 2PQAB 4DK0A 4JOIC 3CCUA 1H9JA 3MXNA 2VB3X 4C2MB 2VQEL 2F0NA 3MFYA 3ITPA 4JI6L 3P20A 2Z6KC 4DV5Q 1VQLA 3SDZA 1QCBD 4P72A 2DGYA 5IP7H 3GTPB 1N34L 3RLOA 1UE1A 3U4VA 3S15H 2FMMA 3S2HH 2XVSA 2QGQA 2OF1A 3BJUA 3OWFA 1LTSD 1CA6A 2B63B 1ENAA 5ELNA 1EYCA 4K6DA 1JT8A 2A68C 2JA6B 4F8MA 2KOLA 5E4WC 2E2IH 1Y1VG 1Y8NB 4DA2A 5BR8L 4KK7A 2AQ3B 1DXMA 1SNDA 2EOTA 3S14B 3R2IA 3NBHB 2RCNA 4X62Q 1EIHA 1X9NA 2Q2TA 4YWLA 1JE4A 3HOVH 1Y14B 1IKMA 1EY6A 2KEEA 5IP7G 3D6WA 3S17H 4RAUC 4ZKBB 1CM9A 5G3LD 1GUWA 2PMZE 3CCMA 1LT5D 3CAMA 1I4PA 2EDGA 2Z0SA 2GVBA 4JYAQ 4ABNA 2WB1E 3UE1A 1PTOC 3GTGH 3U4ZA 1ASZA 1CZWA 3EFXD 4OONA 3TP6A 1TQOA 1YZ6A 3A54A 2OEOA 2ZXPA 1CFMA 3OIPA 1K83H 2SNSA 1CTMA 3S24A 2N3SA 4HAEA 4M1UB 1SEBD 3KDFA 1CA5A 1F77A 2X6GA 1WTHA 3H0GB 2AUJD 4A3KG 3K57A 3AU7A 2L4NA 3PO3B 4Y7NB 4V0BA 1GUGA 1HJPA 3EQLC 2QCPX 3IAYA 5BN4A 1S5CD 4Y52H 2A6EC 4PV1C 1CZGA 2F52A 3I90A 3HOVG 1L1OB 2RCFA 2OWOA 2E2HH 3TP8A 4CKEA 3E0EA 4CKBA 1VQBA 1F2LA 2LXKA 3IFDA 2HUGA 2XN9C 1KQSA 1E0BA 1J9OA 2L11A 3PF4A 2Q2IA 4BBRB 4DR4Q 1NY4A 1XTDA 2F0MA 2QDBA 1TWCB 3BZKA 1PTOF 3HZXA 3VR6A 1GVPA 2EYHA 2IX1A 1CKNA 1KDAA 1PDQA 2SOBA 3VYUA 2WKCA 3QJYA 3GTLB 4DV0L 3QG1A 3J80i 4DKAC 4B08A 2E2JH 3H91A 1O7IA 4WJ3M 2UU9L 1N36L 5C4JH 3K7AH 1F2ZA 1MSGA 4EQPA 1ENFA 1K3RA 3TZDA 3WDNA 1ZYRC 1YITA 3PUXA 3KJOA 1E3PA 2ZTCA 2A6HD 4DR4L 4BY1B 1DONA 2VW9A 3DWPA 1Y8PB 4J6HA 1VCIA 2RSNA 1TY0A 5F2DA 4LFCL 1B53A 1FGUA 3ND9A 4DUZQ 3RD4A 4F7XA 3PIOA 3M4QA 4A3EH 2HIVA 4RH6A 3T1HQ 2WACA 3A74A 4X6AH 5M3MH 4FVMA 2EXZA 3TRZA 3F2CA 1V1PB 3M4OH 5LL6S 1L1OC 3HEJA 2ICEC 1A3VA 1M1KC 3RZDB 1JCKB 3T1YQ 1VQ5A 3FDTA 1QVGA 4QGUA 2NTTA 4X3UA 2K32A 3C3LA 3GO5A 1X3FA 4A3IG 3WOFA 4KV6A 4DR7L 3EIVA 1MD2D 3J80L 2JE6I 4A3DH 3RUZA 2IW3A 1PH1A 4A3EG 4DV7L 4ME3A 1B44D 2R92G 3HS0C 4R8IA 4ZLTF 5M3MG 2JYOA 1JJGA 1UEBA 2L1BA 2EXDA 3E9IA 3FRPB 1BVSA 2NZ1D 3BZCA 3K81C 4JI0Q 2A5HA 3GTQB 4X64L 1YHBA 1STEA 3L2PA 4RGMA 3TS2A 1OXXK 1VQHA 1TVXA 1XYIA 3BDLA 1HNZQ 1YI2A 4RGOS 4QIWE 4C3HB 5KYLA 3GTMB 3S1NB 2DJGC 4KN4C 3H3VC 3M4PA 3MA2B 5ELCA 1K8GA 1SE8A 2G5DA 4B3RL 1V1PA 2Y0SE 2B8FA 5IODA 4A3DG 3NWTA 5IGEA 3K5OA 1YNJD 4ZKCB 3ONAB 4E6IA 4DV3Q 5CV6A 1HR0Q 4MTKA 4X3TA 2RF4A 5HY6A 4QY7A 1VQAA 5FLXL 3T4AC 3N6RA 4C3IH 1JQYD 1WCMH 3A5UA 4MIUA 3S1RB 2R7ZG 2FFKB 4H7BA 1YJWA 1O7LA 2VS1A 4K0KQ 1E22A 2VXWA 2EZVA 2RA4A 1FR3A 1AE2A 1HNXQ 4HMJA 1H9KA 1TWHH 3MXPA 5KNBA 1HA5A 1PRTB 2CVRA 3TEHB 3V96A 3X3MA 1GHKA 4A3CH 3BDOA 1ZKOA 3K5MA 1SYBA 3TBIB 4DV3L 2F0QA 2N49A 2VQFQ 2XTIA 2R93H 4U68A 2DUDA 3HOWB 3C46A 1H9RA 1VQPA 4LF6L 3X3NA 1KIXA 4UY8C 1PFMA 1VQEA 2ZTDA 1KAAA 3HOZB 4C3IG 4A3BH 4I7ZC 4DK6C 1K8MA 4A3FH 1N33L 2NVQB 3H6MA 4G57A 4IPHA 1LT6D 2D9UA 1EU3A 1T5XD 2JK8A 1O7YA 2B2WA 5CBEE 1LTID 1I50B 3OMCA 3OTOL 4KN7C 3LGJA 1DOLA 3HOUB 1ET6A 2IL8A 2VB2X 1M90C 2R93G 2RQXA 4V190 2B2WC 1PMRA 2A74C 4KD4A 4A3MB 4DR1L 1PV4A 4KHPQ 3D8GA 3CPWA 1NCVA 4DR5L 4NB3A 5LL6X 4RGTA 4PZ6A 3K0YA 2R6GA 1KRSA 1IXRA 1S5DD 1F9QA 3AB9A 4PZ7A 3FPUB 3F2UA 5KIXA 3GQBA 4DV1L 3HOYH 3NBIA 2P5ZX 4HMIA 4JI2L 2CFMA 2JA8H 1HCZA 1X3EA 1A2TA 1IL8A 2CW0D 3I2ZA 5KGUA 2HHHL 1V1QA 3BU2A 4YY3Q 3J80E 1HQMC 2JJQA 4XYOA 5CYUA 1T9HA 3S1QB 1XMOQ 1I4RA 2PNRC 4B3SQ 1IBML 2XNAC 2HIXA 4BY7B 1CSQA 4CGYB 5AFWA 1LTGD 4K2KA 1KHIA 2NVYB 4KJOA 2NVXH 1B9NA 1AE3A 4JW0A 2MNAA 3CMEA 1H9SB 1OXTA 4HSVA 2F3VA 1RD9D 4MNOA 3CMAA 4DK3C 1YNND 2EYPA 4R8NA 1YHAA 3O13A 4IURA 1IYUA 2VZAA 4KKUA 4YY3L 2F3IA 2Q8RE 4NMZA 4LF8Q 2JA8G 4BXXG 5FOBB 5C44G 1PXUA 1FD7D 4B3SL 4A93B 3R8BA 1F9RA 4NXNQ 2QKIC 4GNXA 4LF5L 3QWNA 1IZ6A 1TWAH 5C4XB 3DWAA 3FP9A 5E7NA 2JXMB 2EYJA 1SNMA 3SE0A 2IHEA 4PMBA 1IW7D 3BYYB 5ELFA 4G7OC 1CKMA 4TRDA 2OT2A 4GNXC 4DFAA 3NQIA 2A8VA 4J1MA 3STBD 3DWQA 4G7ZC 4NXNL 3CP0A 1ILPA 5M5WB 4JI8L 1YIJA 1VQIA 3MEHA 1BCPC 2QILA 2CHBD 2E75C 1LTTD 1XNRQ 1SYCA 3SR1A 4AYBG 4A3GB 4QL5A 1TWFH 2I5MX 1SE4A 1RHPA 2O4XA 2PMZB 4I7AA 2O2LD 1D5MC 2LXJA 2F3WA 2UUAQ 2A19A 3MHBA 3DLLA 5M3FH 1GXDC 4JV5L 4C1NK 2WB1B 5EBDA 1Z7TA 1L0XB 1BNZA 4JI3Q 1AP0A 4Q5VA 2PYKA 4IFDI 1CHPD 3TS0A 1KAWA 1UE6A 1UUPA 3RLFA 4C2MH 4LFAQ 4GOPB 5H1SE 3T56B 2V1CC 1E2VA 1KD1C 1DGSA 1KC8C 2NN6H 4DR2Q 1LM0A 1XNRL 1C8CA 4OHJA 2EY2A 4JI5Q 4FXDA 1Y1WH 3M7GA 5E4XA 3IFTA 4A75A 2HQLA 4YCUA 2F4VQ 3M4YA 3IRBA 2CQOA 2RDGA 3RZOH 4RG1A 2SEBD 3RNUA 2J4XA 3DEOA 4LFBQ 2HCIA 4PMWA 3QR8A 1LYLA 3CRKC 5JEAG 3DXJC 1Q8IA 3UDGA 1SNOA 5E3FA 1EY8A 1FL0A 1JJCB 4P74A 1MGSA 1Z6HA 4JPBW 2QA4A 2CQAA 2F0IA 2F4VL 4IFDG 3NPPA 1S72A 3BDCA 1Y1WG 1CSPA 2XIWA 1MJEA 3FMCA 1SYGA 3A5ZB 5C3XA 4LF9Q 2F4IA 3KYHC 3NK9A 1I6HB 1IYJB 1KDBA 3C2PA 3J80c 2K03A 5IT9E 1D5XC 2NZOA 4DXFA 1JMCA 1CQVA 2KBNA 2EIFA 3PUWA 1VQGA 1BKBA 1X55A 2A69C 3EVQA 2JA6G 4XTCS 3NP8A 5C3EB 4KHVA 2PZWA 1F2YA 5T1GA 2MUYA 1PH6A 1QUQB 3PO3H 2ALYB 3RLNA 1Q12A 2BA0A 4AQYQ 3S1MB 1N32Q 5DNFA 2M9VA 4JVZA 3NUCA 4DV2Q 4WFN3 2ATWA 4DV6L 1W2BA 4XYQA 4KMUC 2XSCA 1PH7A 2NZHA 4X66Q 1XX8A 3CC4A 1G91A 4GN4B 4EGVA 3MAQA 3G6EA 3MXNB 2H5XA 1VQ4A 1GUSA 4LUVA 3I4NH 3RMHA 3VR2A 5E1FA 4GKJL 1S5FD 2LMCB 1TWCH 5DM73 3OMGA 4IUVA 4ZK9B 1I4XA 3F1ZA 1WTRA 4CJ1B 1IBKL 4FF2A 1SYFA 2EYFA 1RJTA 1LT4D 3H0GG 4HJ9A 5FLXc 4WJ4A 2PW5A 4X3KA 4DR3L 2IPKD 3PO3G 1S40A 1HUMA 2K33A 5CV9A 1I94L 1L0WA 1K3BC 2D0PA 3SK4A 5FO7B 3Q22A 3M3YH 3AMUA 5I2YA 3ER0A 3GD7A 3NE5B 2VQEQ 1XJVA 1QUQA 3CRLC 5C3WA 4BY1H 4JI6Q 1D2BA 2MGSA 1A0IA 1GHJA 3A55A 3KF8A 4XIGS 3TSSA 2BE5C 3T51B 1WTQA 1RODA 4X65L 4QIWB 1PTOB 1WTPA 1A2UA 4FXGC 5G3LF 2FMCA 2EJFC 3E5SA 5A2QL 4ME5A 4DV4L 4A76A 2Y0SB 1Q86C 1K28A 4JI7L 4HIDA 2EY5A 5C0XI 1I4QA 2EYLA 3MZ5A 1BXTA 1PA6A 2F0WA 3HOXB 1A63A 1WOCA 1S4ZA 5BR8Q 2XGTA 2CWPA 2Z4HA 3TZUA 3KDFB 4U673 2JEAI 4BY1G 2XWJB 3A8JE 3K8AA 1EOTA 2FJ2A 4HSPA 3A8IE 2A6HC 3OW2A 2EY1A 1IKLA 2N88A 2BH8A 2K04A 4L63B 4FF4A 1RCVD 3ND8A 1V43A 5GADC 2LY7A 5JEAJ 4IZ8A 1SNQA 3VR5A 3A7LA 4A3KH 1G8ZD 1OXUA 2A1AA 4PMCA 3P7JA 1R9TB 2F0JA 1WD1A 4ID6A 4O1NA 1UEAB 3GTQH 5ISRA 5C0XG 4JBWA 1TS2A 2SDFA 4IFDJ 4PG3A 2LKVA 3GTMH 1JR0D 1CKNB 4YHHL 5AJ3L 1JOKA 1RL2A 2BDNA 3J81j 2Z1CA 5KNCA 3HRZC 4LF7L 5IP9G 1LTAD 4C1NI 2ES2A 1JOOA 4B3MQ 1PLFA 2MHVA 2ZM6L 1O78A 5IOCA 2YU9H 1UE7A 1TKWB 3CQZH 2G9DA 3JAMi 1AZPA 2K01A 3KBGA 2F0KA 3RN5A 3EJIA 2E74C 1MI2A 1SMYD 3QOLA 1KABA 4DAYA 4C3JB 1MHWC 4P73A 4DV0Q 4C3HG 3H15A 1Q1EA 1JICA 2D5DA 2UU9Q 3NENA 1QZGA 1N36Q 4B3ML 1A6XA 4KJNA 4HEDA 4DAVA 4JI4L 2H1EA 2F0SA 2KEDA 1X32A 3HOWH 3VA7A 1YJNA 2K05A 2N8NA 1DOKA 2UUCL 5C5MA 1YNJC 1O7ZA 2K28A 4C56C 1MBYA 4LFCQ 3HOZH 1EIGA 1JWSD 2AUKA 2C35B 1BDOA 2RDHA 4RCOA 5DEHA 4ZRZA 1STAA 5KNDA 2VNUD 1BBWA 2NVTB 3L3OC 2KHJA 3TMEA 4MZ9A 4ULLA 4H02A 4HR7B 5EGTA 4FO2A 5KRUA 5LHY1 4PQXA 4MHEA 4LMQD 5IYCH 1IBLL 1I50H 2O5IC 5K36G 1EOVA 3P1HA 1QNUA 4DNTB 3JAML 5L37A 5IWAL 4A3IH 4XXEA 3TDQA 1QE6A 1TXYA 1CK1A 2NTSA 1BOSA 1V1OA 5A2QE 3HOWG 5IGCA 1N8RC 3CU7A 2ZTEA 4JG2A 2UUBQ 2NYZD 1TWGH 3URYA 2R92H 4DR7Q 1VQ7A 2N78A 1N9WA 3HOZG 1QB5D 4BWGB 4DAMA 4DV7Q 4PZ8A 3DMUA 1L2FA 1ICFB 1Y69U 3NTIA 1FNUA 4R1JA 3AEVA 2PI2A 1WD0A 5IYCG 5CGKA 5T1IA 2UXCQ 3GV3A 4CJ2C 3K7UC 1XXGA 4YCVA 1E1OA 3D6CA 1S5BD 3HKZG 1NMFA 3MC0B 4X64Q 4DAPA 4A3JB 3I56A 3PO2B 4P75A 3HOUG 3G4SA 3A0JA 3UDXA 2UUBL 2ENBA 1KL9A 1VDZA 1EYAA 1YBYA 3GTKH 3M7NA 1XWEA 4JBKA 3NEMA 4BY7H 1ESRA 1SJHD 3LWUA 1EQVA 4A3MG 3GTJB 3E6ZX 4B3RQ 5C4ZA 1B3QA 5I6YA 1XNQQ 4L5SA 2UXDL 4NP5A 4L8JA 2D62A 3VYTA 3CXCA 2UXCL 1STBA 3S15B 3S2HB 4H13C 3U9SA 2R7ZH 2EYOA 4IPCA 4UPAA 1EZ6A 1HUNA 3TN2A 5C0XJ 3VR4A 4R4IA 3I4MB 2BDOA 3PUVA 3S2DH 2V4DA 1FJGL 1Q8KA 2E2IB 2RDFA 4BBSB 1GO3E 1CHQD 2CW0C 4IJHA 1NUCA 4N8X1 1KNAA 3G71A 2A6ED 3WWVA 1OXVA 1XNQL 2GN5A 4BY7G 4KY7A 3NHHA 4HJ5A 3BS1A 4S3SA 3KJPA 1JORA 4OELB 1LV9A 4IPGA 4N9PA 5LMUL 3KLSX 1EIFA 3S17B 2EPBA 3ULJA 2B39A 3R3OA 3Q0AA 1K8AC 2BCOA 2ASBA 2RKSA 4IUNA 4LF6Q 1C4QA 1C7YA 1YNNC 3FPPA 1N33Q 1B3AA 1K83B 4NDXA 3MFGA 4LF4L 4JK1C 3G7LA 1HHVA 5HGTA 1PH9A 1QJOA 1VQOA 2J7ZA 4A3GH 1Q90A 2F0TA 2QEJC 3D4WA 2F0OA 3OTOQ 5C4XG 3F8TA 3K59A 4R4OA 3K0XA 2E2HB 1ZYRD 4HJ7A 2WFWA 2B2YA 4O42A 1EEFD 2OCEA 4EX5A 4F87A 1QNKA 2ICIA 4DR1Q 1KNEA 1U5KA 3MTSA 4RKBA 4DR5Q 2OTJA 3STBC 1GKHA 1TS4A 4GN5A 3JAME 1R4PB 3T16A 2B2YC 1HH2P 3PIPA 1STYA 4DV1Q 2DY7A 1Z9FA 4A3GG 5CORA 4JI2Q 2OQ0A 1PYWD 1LTRD 3HFZB 4CKCA 2KHSA 2FHTA 1EUJA 2PCFB 2HHHQ 2E2JB 1G6PA 5NUCA 1G6ZA 4J8QA 1Q82C 3K7AB 1HXYD 3HKSA 1IBMQ 1XMQQ 2KCNA 2IHFA 3NWSA 4IN3A 4JI1L 2ZXRA 2WAQG 2VUMH 3GDEA 4GNXB 4KKTA 2BOSA 4DUYL 1VQMA 3Q8DA 4O2DA 2YTVA 5CMDA 4OIKA 4TSSA 4BXXH 1TS3A 5C44H 4QUFA 2PI2E 1BCPB 1X54A 3BZDB 2ZXOA 5M3MB 1GUNA 3T13A 4A4IA 1XMQL 1ET9A 5A35A 1WTVA 3SXHA 3C1EA 4G4KA 5IT9L 3DHQA 4LF5Q 3D4RA 3ULLA 3OHXC 1YHQA 4ALPA 1SSOA 3DM1A 4R4CA 1J8IA 4XT1B 2VUMG 3S9WA 1D6EC 2MFIA 3KLWA 2ZJQA 1Z47A 4TQUS 5IYBG 3GTOH 1OO9B 1SRUA 2I07B 3E0JA 1NSNS 4HIMA 2AHOB 2F0DA 5C5LA 1J6QA 1D8LA 1EFWA 2JA5H 4JI8Q 2GVAA 5HURA 2WP8J 1FGBD 4H44C 4OWXB 1DJRD 1SFOH 4RKLA 5FO8B 5C3EG 3K58A 2F0UA 3I55A 4ODGA 1JB3A 1BUVT 2L0CA 3I70A 3IKJA 3NQTA 4EQ5A 2K52A 1K0RA 4JBJA 4GLAC 4JV5Q 5JJKA 2SNMA 1A62A 1PRTF 5M5YH 2J0TD 3BVMA 4AH6A 4IQZA 1FNVA 2RHSB 3CPFA 3FKIH 1RTOA 4NXML 4L5QA 5JJZA 2JA5G 4RHRA 4UDUC 1VQNA 1I5FA 1WCMB 1A3TA 4TVAB 2EQSA 5JJIA 1PH4A 1Q7YC 1DM0B 1F9SA 1MIUA 5JJLA 2IX0A 5JEAH 3VR3A 2F0FA 4K8JA 4XDXA 1C48A 1TWHB 2A73B 2MO1A 2MJ8A 3HOXH 1EY9A 3PF5A 3LX0A 5C6AA 3CF5A 3ZJYC 1MSHA 4OX9L 1NR2A 2R93B 4IFDH 3PMFA 1EEID 2L15A 3JAMc 3GV6A 3ZYYX 3GTPH 2K7VA 3J7A5 3FKIG 3CC2A 3M85A 5ELDA 1HZBA 1G51A 2AKWB 1CKOA 1HPCA 1B50A 4A3BB 2B63H 3W2DA 4IOAA 3NELA 4A3FB 1LTBD 2QF7A 3CCSA 3OOCA 2JA6H 2N55A 3PGZA 4OWTB 1PRTD 2Y0SG 4QF4A 3SK5A 4KD3A 2AQ1B 5M9OA 3VYSA 4HJ8A 3S14H 3HOXG 1BBXC 1BF4A 2NB0A 4KKSA 1ZEQX 4EQNA 4I65A 4LW1A 1CQFA 2X69A 3CKIB 3AFQA 1TR5A 5CV7A 4IJLA 4DV6Q 1PHJA 2B63G 3KFUA 4DR6L 2TSSA 2IX3A 2EJMA 4A3LG 5D3IB 2DNCA 1VQ8A 2DNEA 3NSWA 4EQOA 1P8LA 4QJFA 4Q0FA 2I0QA 3HOYB 3H0GH 1VF7A 1II3A 3IL8A 1SMXA 4GKJQ 4JC0A 4Y7NH 4MN3A 2F0EA 1DYQA 1IBKQ 3KF8B 1YJ9A 3OIQA 5D14A 3D0FA 4JCVE 4ZUJA 4C3JH 1HTLD 4K5WA 4EVOA 4DR3Q 4NPSA 1PVOA 4IPDA 1TS5A 1I94Q 1M4VA 3J7YW 2QW7A 4HN7A 4K5VA 5LMNL 1O80A 4OGQC 5IGDA 2NVXB 4CDFC 1BBUA 1B7YB 1WYDA 2M2LA 5J3BA 4B9WA 4QQBX 1VF5C 1KDCA 2UXBL 1A8VA 4BBRH 4XQJA 3HKZE 2WINB 2PZUA 1MKHA 1I3QB 4HIKA 1BCPD 2KVMA 3UI2A 5IGFA 4X65Q 2JN4A 3GTLH 2Z4IA 4XT3B 1NMGA 2B29A 3R93A 3CW2C 4C3JG 2YV5A 3SK6A 3B6YA 3OPOA 4DV4Q 3CCVA 1SMYC 4JI7Q 2KECA 1K0SA 3H3VI 1F2MA 1HRJA 1ICWA 1TWAB 5JOBA 5IE8A 1G291 5I9PA 3NXWA 1GOZA 1STNA 3H3VH 4OIJA 1X3QA 4IALA 2HDLA 2EYMA 4BBRG 1BR9A 3KUPA 1HZAA 3I72A 2EJGC 1P16A 5KEEA 4UP7A 1LO5D 2E2DC 1YNXA 1STHA 3OWEB 1AN8A 5JVG3 2PO4A 1CI3M 5LMNW 4RCNA 5CC4A 1RIPA 1U4LA 4DK1A 2F0VA 4N9TA 4GZYC 3HG9A 3RZDH 3CCRA 3QOJA 4B3TQ 1R4QB 5C0XH 3TQYA 4CJ0B 3SHLA 4P71A 5CBAE 1E2ZA 5M3FB 1SYDA 4HIOA 1A15A 4YIJA 2NUCA 2C5CA 5IP9H 4LWCA 4DAYB 5FLMG 2ID0A 2B2UA 4YHHQ 5AJ3Q 3S16B 3CHBD 2C9OA 1U4MA 3I7FA 1WI5A 1Y8OB 3VDYA 1B1ZA 4LF7Q 3GTJH 2B2VA 2KA7A 2RVLA 1J5EL 2KCCA 3D31A 2PW7A 2H4OA 3QIAA 1VQCA 1NJIC 1AW7A 1XTCD 4ZQ3A 4CBVA 1Y1WB 4B3TL 4ZUIA 3TREA 4CDEC 2ZM6Q 2B2UC 3E3XA 1NE3A 1IL2A 1VQDA 2AMCB 4DPGA 3RZOB 2A69D 2Q2HA 1B4OA 1WFQA 1GUTA 2B2VC 3KF6A 4KLKA 3I4MH 1ILQA 2YTYA 5DLQE 4C3HH 3C1FA 4L5RC 3S1NH 2Z8LA 4A3JG 1PZID 1EYDA 2MPMA 3I4LA 3PO2G 4BBSH 1QWYA 4DV5L 2RSOA 3AYHB 3TP5A 3U9OA 5IT9c 4FNFA 3UDIA 1JB7A 4JI4Q 3QO2A 1NNXA 1RDPD 1VMCA 2D2CC 3HP3A 4K6LA 5ELEA 3VYRA 4YWMA 4BS9A 1VQJA 4L5TA 1NBWA 2Q8IB 1TT2A 4LK1C 2UUCQ 1KXLA 1TY2A 3S1RH 1Q46A 1G2TA 2F0GA 2IJ0A 2PQAA 1E1TA 2WKDA 3SEBA 1PZKD 2JA7B 3OYYA 4M8AA 3I4MG 2WAQE 5K36H 2L12A 4X62L 5EAYA 1K9MC 3F2DA 4BBSG 4LAAA 2CCZA 3PUZA 4WORA 5J22A 1HTPA 1HA6A 1IBLQ 1V9PA 5COYA 5M5XB 1LABA 2RBMA 3KLSA 5GAHC 3J81i 3U58A 1AZQA 3EROA 2XWBB 5IWAQ 4APVA 4CDCC 1EY4A 2OTLA 1OXSC 4JYAL 2LFNA 3NTHA 5IYDH 4RWSC 5JPMC 3GP7A 2KQ3A 4B9XA 1G2SA 1K8OA 3PQIA 5I6WA 2BE5D 2NVQH 4OO1I 2CWAA 4HCEA 3NBHA 1WVLA 4DGZA 4FXKC 4IO9A 4UP9A 1EWCA 3I4NB 1ENCA 1HFGA 4OO1H 1I4GA 4GS3A 4ZYSA 3MWYW 5GAGC 2M00A 4LNQA 3HOUH 3UE0A 4UHVA 3N52A 5EQ0A 5GROA 4F88A 1KLUD 2R61A 5JPNC 5D3DA 1Q81C 4CHTB 3M3YB 4A3MH 1SXTA 3Q23A 4DNRB 4O0AA 2IWHA 3BVZA 2QEXA 2HQEA 1LUZA 3QB3A 5IYDG 4LUOA 3FHWA 1DCZA 3ULPA 2TMPA 4OXPA 5KYIA 1WTOA 3MXGA 2XRQD 1VMPA 2UXDQ 1SNCA 2K1BA 2A68D 5CV4A 5ELBA 2DY8A 3J81L 4G7HC 4OO1G 1L1OA 3F2BA 1AFPA 1UAPA 2HDMA 1ASYA 1Y1VB 4K5XA 3S1QH 1B9MA 1PYBA 3A56A 5DAUA 1X3GA 4DU9A 1FJGQ 4DXGA 1EY5A 2NVYH 5EKKA 3L7ZC 2K14A 4OWWB 1EYGA 2K75A 4AYBE 1CUKA 2K5DA 4X3SA 2DJFC 1BO0A 1ONLA 2QDLA 4DUZL 1PTOD 1QZHA 3D4DA 1A3UA 1W3SA 4K14A 4DNIA 3T1HL 5LMUQ 1SN8A 3OW7A 1RTNA 2I5HA 4J15A 2E5LQ 3JC66 3SK8A 4A93H 3AQQA 2BA1A 2MQHA 2IY5B 1QILA 3T1YL 4A3KB 1EWHA 1S3OA 1FVIA 3G6JB 1GM5A 2B8GA 4ZCKA 2L5TA 4K2LA 4LF4Q 5C4XH 3VA5A 1D7QA 2K5NA 4KI0A 4QUCA 3HOVB 1JC7A 3CCQA 2CH4A 1M8AA 5IGBA 1ML0D 1U0LA 2E5LL 2FINB 4YCWA 1EFID 5I9OA 3M9BA 1HZCA 2F0PA 4IUQA 4FP5D 3LNNA 1C9OA 2K50A 3GTGB 4FF1A 4WJWA 3J7AF 5M5WH 1S5ED 1EWIA 4A93G 4HJAA 5I2XA 2GA4B 2YU9B 4ILWA 4WRDA 3K5NA 2R7DA 3CQZB 3PSIA 4R4TA 4OL7A 5BN5A 4JI0L 4IUPA 3J7ZC 3DUZA 5D65A 1HNZL 1AEXA 3SVMA 2Q2UA 1EY7A 2AWOA 5JAVA 5FK9C 1PH2A 4RFBA 1KLGD 2OXPA 3I91A 5DM63 4IUUA 1EQQA 1IW7C 3I4OA 3CD6A 1HZ9A 1AH9A 2PNHA 1HR0L 1I4HA 1STGA 4JI1Q 5IIFA 4KTAA 1EL0A 3CC7A 1X3PA 4DUYQ 2NBFA 1BQQT 4H0LC 2B2TA 3BVGA 1U4RA 5EBCA 1XPOA 3WOEA 4K0KL 3KBXA 1WCMG 1U9RA 1H9MA 4YWKA 5JVH3 1HNXL 1OTCA 2O5JC 5C4JB 2WB1G 3NTKA 4MTNA 4R4QA 2CH4W 5C4HA 2B2TC 2VQFL 3I73A 2AQ2B 1PH8A 3PV0A 4KY6A 2KJXA 3HKZB 2VY3A 4PNYA 4CDDC 3J81E 5ELOA 4A3CG 4A3IB 5IYBH 2E76C 4TKOB 1F9PA 1LT3D 3RR5A 2JSOA 3KLRA 2JEBI 1NR4A 1W6KA 2LS01 1E2WA 4A3EB 4BA1I 2YTXA 1TWGB 2R92B 4GLVB 3W1BA 1I6HH 3A7AB 1XPUA 1PH3A 1U4PA 4IUTA 4A3BG 3FEWX 3AFPA 1HQRD 4A3FG 3R2TA 1PFSA 4ZAIA 3M4OB 3HGBA 1V8QA 5C3EH 1WTXA 2Q8TA 1HR0W 1X65A 2VL6A 1E7ZA 2AWNA 4NW2A 2K5WA 4FF3A 1YVCA 5BN3A 1PRTC 4FYDA 3MVVA 3I8ZA 1TIID 3S1MH 1UWVA 3T53B 4HCSA 1EQTA 3MEFA 4QMGA 5FJ8H 1B2TA 4GKKQ 3GTKB 3H09A 4KHPL 4A3DB 5CV5A 3K5LA 1RF2D 5EJWA 2EVBA 1W6JA 4XQNA 1GUOA 2PQEA 1SAPA 1KRTA 1DD2A 4UP8A 3ERSX 1EU4A 1B70B 2ZT9C 5I4DA 4NXMQ 3J7AV 2L9HA 2R7ZB 1GD7A 3CCJA 1I3QH 1QVCA 1D1KA 3V2TA 3HOYG 4QCLA 1SE3A 2Z6BA
chains in the Genus database with same CATH topology
1MHWC 2DJFC 2DJGC 4CDEC 4CDFC 1ICFB 4OELB 4CDDC 4OEMB 4CDCC 1K3BC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1MHW C;  2DJF C;  2DJG C;  4CDE C;  4CDF C;  1ICF B;  4OEL B;  4CDD C;  4OEM B;  4CDC C;  1K3B C; 
#chains in the Genus database with same CATH topology
 3W5O A;  1XMO L;  4IOC A;  1EY0 A;  4GKK L;  3S2D B;  5IGG A;  3MXU A;  2JP1 A;  2RHQ B;  3UDF A;  2JA9 A;  1HNW Q;  5EPK A;  2FXQ A;  2WII B;  5FJ8 G;  1QVF A;  2K5Q A;  1D5Z C;  1I6V C;  1Q3L A;  5FLX E;  2K6A A;  3BG3 A;  1DZ1 A;  4BA2 I;  1UNS A;  3U50 C;  4OX9 Q;  1LAC A;  3K80 C;  4C3I B;  4NKL A;  3EBE A;  4LF8 L;  1SNP A;  5K5P A;  1PTO H;  5J1Z A;  2KUM A;  3PIO 3;  1H95 A;  4RMF A;  2I46 A;  4XQQ A;  4KY5 A;  1PFB A;  1EIY B;  1HNW L;  2F0H A;  1H9S A;  3Q6S A;  2HD3 A;  1SLJ A;  1SRO A;  2KHI A;  2YYZ A;  3KOJ A;  2F0L A;  3KK7 A;  1FYC A;  4GN3 B;  3G48 A;  1L0Y B;  1NAP A;  3CCL A;  1FNW A;  2F03 A;  3PUY A;  1IHZ A;  1SDF A;  2DN8 A;  3ICE A;  3DM3 A;  3L0O A;  3SGI A;  1E24 A;  1PH5 A;  4KHZ A;  1YEZ A;  2NN6 I;  5CR3 A;  1JJ2 A;  3FVQ A;  3DEP A;  2WAQ B;  3I3C A;  3V05 A;  3S16 H;  4A3L H;  5FO9 B;  3LWE A;  3ERQ A;  4DR6 Q;  2KCM A;  3W3A A;  3Q24 A;  4POF A;  2K5H A;  4K8I A;  3TP7 A;  1R9T H;  5HGQ A;  1MJC A;  1C0A A;  5GAE C;  2UUA L;  5J39 A;  2PZT A;  4QB4 A;  3J81 c;  1UE5 A;  2K5V A;  1BCP F;  1NTG A;  2K4K A;  1T5E A;  4RHS A;  1TU2 B;  2ZJP A;  4JI3 L;  1GJX A;  1X56 A;  5M3F G;  2G9H D;  4LFA L;  4UAI A;  2R3Z A;  5CV8 A;  4LUZ A;  4DN4 M;  5LMN Q;  4DR2 L;  3EA6 A;  1SBB B;  2CKZ B;  2VUM B;  4JI5 L;  1ZXT A;  1PFN A;  3PCO B;  4P2C B;  2WV6 D;  1JWM D;  2NN6 G;  2UXB Q;  1EZ8 A;  4R9W A;  2BH2 A;  3P75 A;  1DOM A;  1HFN A;  2JA8 B;  1CT1 D;  5C44 B;  3W1G A;  1QG7 A;  3RN2 A;  3BYT B;  4OEM B;  4L6T B;  4LFB L;  1VQF A;  2L55 A;  4Z9C B;  1EQR A;  2JA7 H;  2KCT A;  4GOP A;  5EPL A;  1SJE D;  2HT1 A;  2B3G A;  3EN2 A;  1SYE A;  2JQO A;  1QOH A;  1PYS B;  5M5X H;  1LTL A;  4GOP C;  2LSS A;  4LF9 L;  3GTO B;  1X6O A;  4N8F A;  5IY0 A;  2OQK A;  2EY6 A;  4HTH A;  1SR3 A;  1JE5 A;  2MO0 A;  4LJZ C;  2NVT H;  4GLX A;  2JA5 B;  4AYB B;  1IYV A;  2I5L X;  2JA7 G;  1SFO B;  3PIP 3;  2R7F A;  2MP1 A;  2X6L A;  4RGN A;  4AQY L;  2E8G A;  1VQ9 A;  1SE2 A;  1K73 C;  1N32 L;  1PZJ D;  2Z9H A;  4RA8 A;  1ESF A;  4DV2 L;  5FLM H;  4AIM A;  4POG A;  3K6O A;  1VQK A;  1VS0 A;  3KF6 B;  4X66 L;  3D3R A;  5M5Y B;  2NWG A;  2PPB C;  2D0O A;  1JOQ A;  5EKL A;  1KTK A;  3H94 A;  1RKN A;  2HCC A;  2EE1 A;  5FKA C;  2KEN A;  5EPJ A;  1Q1B A;  1XPR A;  4JBM A;  5EKI A;  3FKI B;  1J5E Q;  1LLR D;  2XRS D;  1WJJ A;  1WTW A;  3L9A X;  3E9H A;  4JOI A;  3I4N G;  1TWF B;  4DF7 A;  1N34 Q;  2ZJR A;  4FDB A;  3CCE A;  2IT1 A;  3A8K E;  1JWU D;  5TSS A;  2Z6K A;  1B8A A;  4A3J H;  3OSO A;  2F1M A;  1Y1V H;  1D1I A;  3PO2 H;  5GQO A;  1VQ6 A;  2PQA B;  4DK0 A;  4JOI C;  3CCU A;  1H9J A;  3MXN A;  2VB3 X;  4C2M B;  2VQE L;  2F0N A;  3MFY A;  3ITP A;  4JI6 L;  3P20 A;  2Z6K C;  4DV5 Q;  1VQL A;  3SDZ A;  1QCB D;  4P72 A;  2DGY A;  5IP7 H;  3GTP B;  1N34 L;  3RLO A;  1UE1 A;  3U4V A;  3S15 H;  2FMM A;  3S2H H;  2XVS A;  2QGQ A;  2OF1 A;  3BJU A;  3OWF A;  1LTS D;  1CA6 A;  2B63 B;  1ENA A;  5ELN A;  1EYC A;  4K6D A;  1JT8 A;  2A68 C;  2JA6 B;  4F8M A;  2KOL A;  5E4W C;  2E2I H;  1Y1V G;  1Y8N B;  4DA2 A;  5BR8 L;  4KK7 A;  2AQ3 B;  1DXM A;  1SND A;  2EOT A;  3S14 B;  3R2I A;  3NBH B;  2RCN A;  4X62 Q;  1EIH A;  1X9N A;  2Q2T A;  4YWL A;  1JE4 A;  3HOV H;  1Y14 B;  1IKM A;  1EY6 A;  2KEE A;  5IP7 G;  3D6W A;  3S17 H;  4RAU C;  4ZKB B;  1CM9 A;  5G3L D;  1GUW A;  2PMZ E;  3CCM A;  1LT5 D;  3CAM A;  1I4P A;  2EDG A;  2Z0S A;  2GVB A;  4JYA Q;  4ABN A;  2WB1 E;  3UE1 A;  1PTO C;  3GTG H;  3U4Z A;  1ASZ A;  1CZW A;  3EFX D;  4OON A;  3TP6 A;  1TQO A;  1YZ6 A;  3A54 A;  2OEO A;  2ZXP A;  1CFM A;  3OIP A;  1K83 H;  2SNS A;  1CTM A;  3S24 A;  2N3S A;  4HAE A;  4M1U B;  1SEB D;  3KDF A;  1CA5 A;  1F77 A;  2X6G A;  1WTH A;  3H0G B;  2AUJ D;  4A3K G;  3K57 A;  3AU7 A;  2L4N A;  3PO3 B;  4Y7N B;  4V0B A;  1GUG A;  1HJP A;  3EQL C;  2QCP X;  3IAY A;  5BN4 A;  1S5C D;  4Y52 H;  2A6E C;  4PV1 C;  1CZG A;  2F52 A;  3I90 A;  3HOV G;  1L1O B;  2RCF A;  2OWO A;  2E2H H;  3TP8 A;  4CKE A;  3E0E A;  4CKB A;  1VQB A;  1F2L A;  2LXK A;  3IFD A;  2HUG A;  2XN9 C;  1KQS A;  1E0B A;  1J9O A;  2L11 A;  3PF4 A;  2Q2I A;  4BBR B;  4DR4 Q;  1NY4 A;  1XTD A;  2F0M A;  2QDB A;  1TWC B;  3BZK A;  1PTO F;  3HZX A;  3VR6 A;  1GVP A;  2EYH A;  2IX1 A;  1CKN A;  1KDA A;  1PDQ A;  2SOB A;  3VYU A;  2WKC A;  3QJY A;  3GTL B;  4DV0 L;  3QG1 A;  3J80 i;  4DKA C;  4B08 A;  2E2J H;  3H91 A;  1O7I A;  4WJ3 M;  2UU9 L;  1N36 L;  5C4J H;  3K7A H;  1F2Z A;  1MSG A;  4EQP A;  1ENF A;  1K3R A;  3TZD A;  3WDN A;  1ZYR C;  1YIT A;  3PUX A;  3KJO A;  1E3P A;  2ZTC A;  2A6H D;  4DR4 L;  4BY1 B;  1DON A;  2VW9 A;  3DWP A;  1Y8P B;  4J6H A;  1VCI A;  2RSN A;  1TY0 A;  5F2D A;  4LFC L;  1B53 A;  1FGU A;  3ND9 A;  4DUZ Q;  3RD4 A;  4F7X A;  3PIO A;  3M4Q A;  4A3E H;  2HIV A;  4RH6 A;  3T1H Q;  2WAC A;  3A74 A;  4X6A H;  5M3M H;  4FVM A;  2EXZ A;  3TRZ A;  3F2C A;  1V1P B;  3M4O H;  5LL6 S;  1L1O C;  3HEJ A;  2ICE C;  1A3V A;  1M1K C;  3RZD B;  1JCK B;  3T1Y Q;  1VQ5 A;  3FDT A;  1QVG A;  4QGU A;  2NTT A;  4X3U A;  2K32 A;  3C3L A;  3GO5 A;  1X3F A;  4A3I G;  3WOF A;  4KV6 A;  4DR7 L;  3EIV A;  1MD2 D;  3J80 L;  2JE6 I;  4A3D H;  3RUZ A;  2IW3 A;  1PH1 A;  4A3E G;  4DV7 L;  4ME3 A;  1B44 D;  2R92 G;  3HS0 C;  4R8I A;  4ZLT F;  5M3M G;  2JYO A;  1JJG A;  1UEB A;  2L1B A;  2EXD A;  3E9I A;  3FRP B;  1BVS A;  2NZ1 D;  3BZC A;  3K81 C;  4JI0 Q;  2A5H A;  3GTQ B;  4X64 L;  1YHB A;  1STE A;  3L2P A;  4RGM A;  3TS2 A;  1OXX K;  1VQH A;  1TVX A;  1XYI A;  3BDL A;  1HNZ Q;  1YI2 A;  4RGO S;  4QIW E;  4C3H B;  5KYL A;  3GTM B;  3S1N B;  2DJG C;  4KN4 C;  3H3V C;  3M4P A;  3MA2 B;  5ELC A;  1K8G A;  1SE8 A;  2G5D A;  4B3R L;  1V1P A;  2Y0S E;  2B8F A;  5IOD A;  4A3D G;  3NWT A;  5IGE A;  3K5O A;  1YNJ D;  4ZKC B;  3ONA B;  4E6I A;  4DV3 Q;  5CV6 A;  1HR0 Q;  4MTK A;  4X3T A;  2RF4 A;  5HY6 A;  4QY7 A;  1VQA A;  5FLX L;  3T4A C;  3N6R A;  4C3I H;  1JQY D;  1WCM H;  3A5U A;  4MIU A;  3S1R B;  2R7Z G;  2FFK B;  4H7B A;  1YJW A;  1O7L A;  2VS1 A;  4K0K Q;  1E22 A;  2VXW A;  2EZV A;  2RA4 A;  1FR3 A;  1AE2 A;  1HNX Q;  4HMJ A;  1H9K A;  1TWH H;  3MXP A;  5KNB A;  1HA5 A;  1PRT B;  2CVR A;  3TEH B;  3V96 A;  3X3M A;  1GHK A;  4A3C H;  3BDO A;  1ZKO A;  3K5M A;  1SYB A;  3TBI B;  4DV3 L;  2F0Q A;  2N49 A;  2VQF Q;  2XTI A;  2R93 H;  4U68 A;  2DUD A;  3HOW B;  3C46 A;  1H9R A;  1VQP A;  4LF6 L;  3X3N A;  1KIX A;  4UY8 C;  1PFM A;  1VQE A;  2ZTD A;  1KAA A;  3HOZ B;  4C3I G;  4A3B H;  4I7Z C;  4DK6 C;  1K8M A;  4A3F H;  1N33 L;  2NVQ B;  3H6M A;  4G57 A;  4IPH A;  1LT6 D;  2D9U A;  1EU3 A;  1T5X D;  2JK8 A;  1O7Y A;  2B2W A;  5CBE E;  1LTI D;  1I50 B;  3OMC A;  3OTO L;  4KN7 C;  3LGJ A;  1DOL A;  3HOU B;  1ET6 A;  2IL8 A;  2VB2 X;  1M90 C;  2R93 G;  2RQX A;  4V19 0;  2B2W C;  1PMR A;  2A74 C;  4KD4 A;  4A3M B;  4DR1 L;  1PV4 A;  4KHP Q;  3D8G A;  3CPW A;  1NCV A;  4DR5 L;  4NB3 A;  5LL6 X;  4RGT A;  4PZ6 A;  3K0Y A;  2R6G A;  1KRS A;  1IXR A;  1S5D D;  1F9Q A;  3AB9 A;  4PZ7 A;  3FPU B;  3F2U A;  5KIX A;  3GQB A;  4DV1 L;  3HOY H;  3NBI A;  2P5Z X;  4HMI A;  4JI2 L;  2CFM A;  2JA8 H;  1HCZ A;  1X3E A;  1A2T A;  1IL8 A;  2CW0 D;  3I2Z A;  5KGU A;  2HHH L;  1V1Q A;  3BU2 A;  4YY3 Q;  3J80 E;  1HQM C;  2JJQ A;  4XYO A;  5CYU A;  1T9H A;  3S1Q B;  1XMO Q;  1I4R A;  2PNR C;  4B3S Q;  1IBM L;  2XNA C;  2HIX A;  4BY7 B;  1CSQ A;  4CGY B;  5AFW A;  1LTG D;  4K2K A;  1KHI A;  2NVY B;  4KJO A;  2NVX H;  1B9N A;  1AE3 A;  4JW0 A;  2MNA A;  3CME A;  1H9S B;  1OXT A;  4HSV A;  2F3V A;  1RD9 D;  4MNO A;  3CMA A;  4DK3 C;  1YNN D;  2EYP A;  4R8N A;  1YHA A;  3O13 A;  4IUR A;  1IYU A;  2VZA A;  4KKU A;  4YY3 L;  2F3I A;  2Q8R E;  4NMZ A;  4LF8 Q;  2JA8 G;  4BXX G;  5FOB B;  5C44 G;  1PXU A;  1FD7 D;  4B3S L;  4A93 B;  3R8B A;  1F9R A;  4NXN Q;  2QKI C;  4GNX A;  4LF5 L;  3QWN A;  1IZ6 A;  1TWA H;  5C4X B;  3DWA A;  3FP9 A;  5E7N A;  2JXM B;  2EYJ A;  1SNM A;  3SE0 A;  2IHE A;  4PMB A;  1IW7 D;  3BYY B;  5ELF A;  4G7O C;  1CKM A;  4TRD A;  2OT2 A;  4GNX C;  4DFA A;  3NQI A;  2A8V A;  4J1M A;  3STB D;  3DWQ A;  4G7Z C;  4NXN L;  3CP0 A;  1ILP A;  5M5W B;  4JI8 L;  1YIJ A;  1VQI A;  3MEH A;  1BCP C;  2QIL A;  2CHB D;  2E75 C;  1LTT D;  1XNR Q;  1SYC A;  3SR1 A;  4AYB G;  4A3G B;  4QL5 A;  1TWF H;  2I5M X;  1SE4 A;  1RHP A;  2O4X A;  2PMZ B;  4I7A A;  2O2L D;  1D5M C;  2LXJ A;  2F3W A;  2UUA Q;  2A19 A;  3MHB A;  3DLL A;  5M3F H;  1GXD C;  4JV5 L;  4C1N K;  2WB1 B;  5EBD A;  1Z7T A;  1L0X B;  1BNZ A;  4JI3 Q;  1AP0 A;  4Q5V A;  2PYK A;  4IFD I;  1CHP D;  3TS0 A;  1KAW A;  1UE6 A;  1UUP A;  3RLF A;  4C2M H;  4LFA Q;  4GOP B;  5H1S E;  3T56 B;  2V1C C;  1E2V A;  1KD1 C;  1DGS A;  1KC8 C;  2NN6 H;  4DR2 Q;  1LM0 A;  1XNR L;  1C8C A;  4OHJ A;  2EY2 A;  4JI5 Q;  4FXD A;  1Y1W H;  3M7G A;  5E4X A;  3IFT A;  4A75 A;  2HQL A;  4YCU A;  2F4V Q;  3M4Y A;  3IRB A;  2CQO A;  2RDG A;  3RZO H;  4RG1 A;  2SEB D;  3RNU A;  2J4X A;  3DEO A;  4LFB Q;  2HCI A;  4PMW A;  3QR8 A;  1LYL A;  3CRK C;  5JEA G;  3DXJ C;  1Q8I A;  3UDG A;  1SNO A;  5E3F A;  1EY8 A;  1FL0 A;  1JJC B;  4P74 A;  1MGS A;  1Z6H A;  4JPB W;  2QA4 A;  2CQA A;  2F0I A;  2F4V L;  4IFD G;  3NPP A;  1S72 A;  3BDC A;  1Y1W G;  1CSP A;  2XIW A;  1MJE A;  3FMC A;  1SYG A;  3A5Z B;  5C3X A;  4LF9 Q;  2F4I A;  3KYH C;  3NK9 A;  1I6H B;  1IYJ B;  1KDB A;  3C2P A;  3J80 c;  2K03 A;  5IT9 E;  1D5X C;  2NZO A;  4DXF A;  1JMC A;  1CQV A;  2KBN A;  2EIF A;  3PUW A;  1VQG A;  1BKB A;  1X55 A;  2A69 C;  3EVQ A;  2JA6 G;  4XTC S;  3NP8 A;  5C3E B;  4KHV A;  2PZW A;  1F2Y A;  5T1G A;  2MUY A;  1PH6 A;  1QUQ B;  3PO3 H;  2ALY B;  3RLN A;  1Q12 A;  2BA0 A;  4AQY Q;  3S1M B;  1N32 Q;  5DNF A;  2M9V A;  4JVZ A;  3NUC A;  4DV2 Q;  4WFN 3;  2ATW A;  4DV6 L;  1W2B A;  4XYQ A;  4KMU C;  2XSC A;  1PH7 A;  2NZH A;  4X66 Q;  1XX8 A;  3CC4 A;  1G91 A;  4GN4 B;  4EGV A;  3MAQ A;  3G6E A;  3MXN B;  2H5X A;  1VQ4 A;  1GUS A;  4LUV A;  3I4N H;  3RMH A;  3VR2 A;  5E1F A;  4GKJ L;  1S5F D;  2LMC B;  1TWC H;  5DM7 3;  3OMG A;  4IUV A;  4ZK9 B;  1I4X A;  3F1Z A;  1WTR A;  4CJ1 B;  1IBK L;  4FF2 A;  1SYF A;  2EYF A;  1RJT A;  1LT4 D;  3H0G G;  4HJ9 A;  5FLX c;  4WJ4 A;  2PW5 A;  4X3K A;  4DR3 L;  2IPK D;  3PO3 G;  1S40 A;  1HUM A;  2K33 A;  5CV9 A;  1I94 L;  1L0W A;  1K3B C;  2D0P A;  3SK4 A;  5FO7 B;  3Q22 A;  3M3Y H;  3AMU A;  5I2Y A;  3ER0 A;  3GD7 A;  3NE5 B;  2VQE Q;  1XJV A;  1QUQ A;  3CRL C;  5C3W A;  4BY1 H;  4JI6 Q;  1D2B A;  2MGS A;  1A0I A;  1GHJ A;  3A55 A;  3KF8 A;  4XIG S;  3TSS A;  2BE5 C;  3T51 B;  1WTQ A;  1ROD A;  4X65 L;  4QIW B;  1PTO B;  1WTP A;  1A2U A;  4FXG C;  5G3L F;  2FMC A;  2EJF C;  3E5S A;  5A2Q L;  4ME5 A;  4DV4 L;  4A76 A;  2Y0S B;  1Q86 C;  1K28 A;  4JI7 L;  4HID A;  2EY5 A;  5C0X I;  1I4Q A;  2EYL A;  3MZ5 A;  1BXT A;  1PA6 A;  2F0W A;  3HOX B;  1A63 A;  1WOC A;  1S4Z A;  5BR8 Q;  2XGT A;  2CWP A;  2Z4H A;  3TZU A;  3KDF B;  4U67 3;  2JEA I;  4BY1 G;  2XWJ B;  3A8J E;  3K8A A;  1EOT A;  2FJ2 A;  4HSP A;  3A8I E;  2A6H C;  3OW2 A;  2EY1 A;  1IKL A;  2N88 A;  2BH8 A;  2K04 A;  4L63 B;  4FF4 A;  1RCV D;  3ND8 A;  1V43 A;  5GAD C;  2LY7 A;  5JEA J;  4IZ8 A;  1SNQ A;  3VR5 A;  3A7L A;  4A3K H;  1G8Z D;  1OXU A;  2A1A A;  4PMC A;  3P7J A;  1R9T B;  2F0J A;  1WD1 A;  4ID6 A;  4O1N A;  1UEA B;  3GTQ H;  5ISR A;  5C0X G;  4JBW A;  1TS2 A;  2SDF A;  4IFD J;  4PG3 A;  2LKV A;  3GTM H;  1JR0 D;  1CKN B;  4YHH L;  5AJ3 L;  1JOK A;  1RL2 A;  2BDN A;  3J81 j;  2Z1C A;  5KNC A;  3HRZ C;  4LF7 L;  5IP9 G;  1LTA D;  4C1N I;  2ES2 A;  1JOO A;  4B3M Q;  1PLF A;  2MHV A;  2ZM6 L;  1O78 A;  5IOC A;  2YU9 H;  1UE7 A;  1TKW B;  3CQZ H;  2G9D A;  3JAM i;  1AZP A;  2K01 A;  3KBG A;  2F0K A;  3RN5 A;  3EJI A;  2E74 C;  1MI2 A;  1SMY D;  3QOL A;  1KAB A;  4DAY A;  4C3J B;  1MHW C;  4P73 A;  4DV0 Q;  4C3H G;  3H15 A;  1Q1E A;  1JIC A;  2D5D A;  2UU9 Q;  3NEN A;  1QZG A;  1N36 Q;  4B3M L;  1A6X A;  4KJN A;  4HED A;  4DAV A;  4JI4 L;  2H1E A;  2F0S A;  2KED A;  1X32 A;  3HOW H;  3VA7 A;  1YJN A;  2K05 A;  2N8N A;  1DOK A;  2UUC L;  5C5M A;  1YNJ C;  1O7Z A;  2K28 A;  4C56 C;  1MBY A;  4LFC Q;  3HOZ H;  1EIG A;  1JWS D;  2AUK A;  2C35 B;  1BDO A;  2RDH A;  4RCO A;  5DEH A;  4ZRZ A;  1STA A;  5KND A;  2VNU D;  1BBW A;  2NVT B;  3L3O C;  2KHJ A;  3TME A;  4MZ9 A;  4ULL A;  4H02 A;  4HR7 B;  5EGT A;  4FO2 A;  5KRU A;  5LHY 1;  4PQX A;  4MHE A;  4LMQ D;  5IYC H;  1IBL L;  1I50 H;  2O5I C;  5K36 G;  1EOV A;  3P1H A;  1QNU A;  4DNT B;  3JAM L;  5L37 A;  5IWA L;  4A3I H;  4XXE A;  3TDQ A;  1QE6 A;  1TXY A;  1CK1 A;  2NTS A;  1BOS A;  1V1O A;  5A2Q E;  3HOW G;  5IGC A;  1N8R C;  3CU7 A;  2ZTE A;  4JG2 A;  2UUB Q;  2NYZ D;  1TWG H;  3URY A;  2R92 H;  4DR7 Q;  1VQ7 A;  2N78 A;  1N9W A;  3HOZ G;  1QB5 D;  4BWG B;  4DAM A;  4DV7 Q;  4PZ8 A;  3DMU A;  1L2F A;  1ICF B;  1Y69 U;  3NTI A;  1FNU A;  4R1J A;  3AEV A;  2PI2 A;  1WD0 A;  5IYC G;  5CGK A;  5T1I A;  2UXC Q;  3GV3 A;  4CJ2 C;  3K7U C;  1XXG A;  4YCV A;  1E1O A;  3D6C A;  1S5B D;  3HKZ G;  1NMF A;  3MC0 B;  4X64 Q;  4DAP A;  4A3J B;  3I56 A;  3PO2 B;  4P75 A;  3HOU G;  3G4S A;  3A0J A;  3UDX A;  2UUB L;  2ENB A;  1KL9 A;  1VDZ A;  1EYA A;  1YBY A;  3GTK H;  3M7N A;  1XWE A;  4JBK A;  3NEM A;  4BY7 H;  1ESR A;  1SJH D;  3LWU A;  1EQV A;  4A3M G;  3GTJ B;  3E6Z X;  4B3R Q;  5C4Z A;  1B3Q A;  5I6Y A;  1XNQ Q;  4L5S A;  2UXD L;  4NP5 A;  4L8J A;  2D62 A;  3VYT A;  3CXC A;  2UXC L;  1STB A;  3S15 B;  3S2H B;  4H13 C;  3U9S A;  2R7Z H;  2EYO A;  4IPC A;  4UPA A;  1EZ6 A;  1HUN A;  3TN2 A;  5C0X J;  3VR4 A;  4R4I A;  3I4M B;  2BDO A;  3PUV A;  3S2D H;  2V4D A;  1FJG L;  1Q8K A;  2E2I B;  2RDF A;  4BBS B;  1GO3 E;  1CHQ D;  2CW0 C;  4IJH A;  1NUC A;  4N8X 1;  1KNA A;  3G71 A;  2A6E D;  3WWV A;  1OXV A;  1XNQ L;  2GN5 A;  4BY7 G;  4KY7 A;  3NHH A;  4HJ5 A;  3BS1 A;  4S3S A;  3KJP A;  1JOR A;  4OEL B;  1LV9 A;  4IPG A;  4N9P A;  5LMU L;  3KLS X;  1EIF A;  3S17 B;  2EPB A;  3ULJ A;  2B39 A;  3R3O A;  3Q0A A;  1K8A C;  2BCO A;  2ASB A;  2RKS A;  4IUN A;  4LF6 Q;  1C4Q A;  1C7Y A;  1YNN C;  3FPP A;  1N33 Q;  1B3A A;  1K83 B;  4NDX A;  3MFG A;  4LF4 L;  4JK1 C;  3G7L A;  1HHV A;  5HGT A;  1PH9 A;  1QJO A;  1VQO A;  2J7Z A;  4A3G H;  1Q90 A;  2F0T A;  2QEJ C;  3D4W A;  2F0O A;  3OTO Q;  5C4X G;  3F8T A;  3K59 A;  4R4O A;  3K0X A;  2E2H B;  1ZYR D;  4HJ7 A;  2WFW A;  2B2Y A;  4O42 A;  1EEF D;  2OCE A;  4EX5 A;  4F87 A;  1QNK A;  2ICI A;  4DR1 Q;  1KNE A;  1U5K A;  3MTS A;  4RKB A;  4DR5 Q;  2OTJ A;  3STB C;  1GKH A;  1TS4 A;  4GN5 A;  3JAM E;  1R4P B;  3T16 A;  2B2Y C;  1HH2 P;  3PIP A;  1STY A;  4DV1 Q;  2DY7 A;  1Z9F A;  4A3G G;  5COR A;  4JI2 Q;  2OQ0 A;  1PYW D;  1LTR D;  3HFZ B;  4CKC A;  2KHS A;  2FHT A;  1EUJ A;  2PCF B;  2HHH Q;  2E2J B;  1G6P A;  5NUC A;  1G6Z A;  4J8Q A;  1Q82 C;  3K7A B;  1HXY D;  3HKS A;  1IBM Q;  1XMQ Q;  2KCN A;  2IHF A;  3NWS A;  4IN3 A;  4JI1 L;  2ZXR A;  2WAQ G;  2VUM H;  3GDE A;  4GNX B;  4KKT A;  2BOS A;  4DUY L;  1VQM A;  3Q8D A;  4O2D A;  2YTV A;  5CMD A;  4OIK A;  4TSS A;  4BXX H;  1TS3 A;  5C44 H;  4QUF A;  2PI2 E;  1BCP B;  1X54 A;  3BZD B;  2ZXO A;  5M3M B;  1GUN A;  3T13 A;  4A4I A;  1XMQ L;  1ET9 A;  5A35 A;  1WTV A;  3SXH A;  3C1E A;  4G4K A;  5IT9 L;  3DHQ A;  4LF5 Q;  3D4R A;  3ULL A;  3OHX C;  1YHQ A;  4ALP A;  1SSO A;  3DM1 A;  4R4C A;  1J8I A;  4XT1 B;  2VUM G;  3S9W A;  1D6E C;  2MFI A;  3KLW A;  2ZJQ A;  1Z47 A;  4TQU S;  5IYB G;  3GTO H;  1OO9 B;  1SRU A;  2I07 B;  3E0J A;  1NSN S;  4HIM A;  2AHO B;  2F0D A;  5C5L A;  1J6Q A;  1D8L A;  1EFW A;  2JA5 H;  4JI8 Q;  2GVA A;  5HUR A;  2WP8 J;  1FGB D;  4H44 C;  4OWX B;  1DJR D;  1SFO H;  4RKL A;  5FO8 B;  5C3E G;  3K58 A;  2F0U A;  3I55 A;  4ODG A;  1JB3 A;  1BUV T;  2L0C A;  3I70 A;  3IKJ A;  3NQT A;  4EQ5 A;  2K52 A;  1K0R A;  4JBJ A;  4GLA C;  4JV5 Q;  5JJK A;  2SNM A;  1A62 A;  1PRT F;  5M5Y H;  2J0T D;  3BVM A;  4AH6 A;  4IQZ A;  1FNV A;  2RHS B;  3CPF A;  3FKI H;  1RTO A;  4NXM L;  4L5Q A;  5JJZ A;  2JA5 G;  4RHR A;  4UDU C;  1VQN A;  1I5F A;  1WCM B;  1A3T A;  4TVA B;  2EQS A;  5JJI A;  1PH4 A;  1Q7Y C;  1DM0 B;  1F9S A;  1MIU A;  5JJL A;  2IX0 A;  5JEA H;  3VR3 A;  2F0F A;  4K8J A;  4XDX A;  1C48 A;  1TWH B;  2A73 B;  2MO1 A;  2MJ8 A;  3HOX H;  1EY9 A;  3PF5 A;  3LX0 A;  5C6A A;  3CF5 A;  3ZJY C;  1MSH A;  4OX9 L;  1NR2 A;  2R93 B;  4IFD H;  3PMF A;  1EEI D;  2L15 A;  3JAM c;  3GV6 A;  3ZYY X;  3GTP H;  2K7V A;  3J7A 5;  3FKI G;  3CC2 A;  3M85 A;  5ELD A;  1HZB A;  1G51 A;  2AKW B;  1CKO A;  1HPC A;  1B50 A;  4A3B B;  2B63 H;  3W2D A;  4IOA A;  3NEL A;  4A3F B;  1LTB D;  2QF7 A;  3CCS A;  3OOC A;  2JA6 H;  2N55 A;  3PGZ A;  4OWT B;  1PRT D;  2Y0S G;  4QF4 A;  3SK5 A;  4KD3 A;  2AQ1 B;  5M9O A;  3VYS A;  4HJ8 A;  3S14 H;  3HOX G;  1BBX C;  1BF4 A;  2NB0 A;  4KKS A;  1ZEQ X;  4EQN A;  4I65 A;  4LW1 A;  1CQF A;  2X69 A;  3CKI B;  3AFQ A;  1TR5 A;  5CV7 A;  4IJL A;  4DV6 Q;  1PHJ A;  2B63 G;  3KFU A;  4DR6 L;  2TSS A;  2IX3 A;  2EJM A;  4A3L G;  5D3I B;  2DNC A;  1VQ8 A;  2DNE A;  3NSW A;  4EQO A;  1P8L A;  4QJF A;  4Q0F A;  2I0Q A;  3HOY B;  3H0G H;  1VF7 A;  1II3 A;  3IL8 A;  1SMX A;  4GKJ Q;  4JC0 A;  4Y7N H;  4MN3 A;  2F0E A;  1DYQ A;  1IBK Q;  3KF8 B;  1YJ9 A;  3OIQ A;  5D14 A;  3D0F A;  4JCV E;  4ZUJ A;  4C3J H;  1HTL D;  4K5W A;  4EVO A;  4DR3 Q;  4NPS A;  1PVO A;  4IPD A;  1TS5 A;  1I94 Q;  1M4V A;  3J7Y W;  2QW7 A;  4HN7 A;  4K5V A;  5LMN L;  1O80 A;  4OGQ C;  5IGD A;  2NVX B;  4CDF C;  1BBU A;  1B7Y B;  1WYD A;  2M2L A;  5J3B A;  4B9W A;  4QQB X;  1VF5 C;  1KDC A;  2UXB L;  1A8V A;  4BBR H;  4XQJ A;  3HKZ E;  2WIN B;  2PZU A;  1MKH A;  1I3Q B;  4HIK A;  1BCP D;  2KVM A;  3UI2 A;  5IGF A;  4X65 Q;  2JN4 A;  3GTL H;  2Z4I A;  4XT3 B;  1NMG A;  2B29 A;  3R93 A;  3CW2 C;  4C3J G;  2YV5 A;  3SK6 A;  3B6Y A;  3OPO A;  4DV4 Q;  3CCV A;  1SMY C;  4JI7 Q;  2KEC A;  1K0S A;  3H3V I;  1F2M A;  1HRJ A;  1ICW A;  1TWA B;  5JOB A;  5IE8 A;  1G29 1;  5I9P A;  3NXW A;  1GOZ A;  1STN A;  3H3V H;  4OIJ A;  1X3Q A;  4IAL A;  2HDL A;  2EYM A;  4BBR G;  1BR9 A;  3KUP A;  1HZA A;  3I72 A;  2EJG C;  1P16 A;  5KEE A;  4UP7 A;  1LO5 D;  2E2D C;  1YNX A;  1STH A;  3OWE B;  1AN8 A;  5JVG 3;  2PO4 A;  1CI3 M;  5LMN W;  4RCN A;  5CC4 A;  1RIP A;  1U4L A;  4DK1 A;  2F0V A;  4N9T A;  4GZY C;  3HG9 A;  3RZD H;  3CCR A;  3QOJ A;  4B3T Q;  1R4Q B;  5C0X H;  3TQY A;  4CJ0 B;  3SHL A;  4P71 A;  5CBA E;  1E2Z A;  5M3F B;  1SYD A;  4HIO A;  1A15 A;  4YIJ A;  2NUC A;  2C5C A;  5IP9 H;  4LWC A;  4DAY B;  5FLM G;  2ID0 A;  2B2U A;  4YHH Q;  5AJ3 Q;  3S16 B;  3CHB D;  2C9O A;  1U4M A;  3I7F A;  1WI5 A;  1Y8O B;  3VDY A;  1B1Z A;  4LF7 Q;  3GTJ H;  2B2V A;  2KA7 A;  2RVL A;  1J5E L;  2KCC A;  3D31 A;  2PW7 A;  2H4O A;  3QIA A;  1VQC A;  1NJI C;  1AW7 A;  1XTC D;  4ZQ3 A;  4CBV A;  1Y1W B;  4B3T L;  4ZUI A;  3TRE A;  4CDE C;  2ZM6 Q;  2B2U C;  3E3X A;  1NE3 A;  1IL2 A;  1VQD A;  2AMC B;  4DPG A;  3RZO B;  2A69 D;  2Q2H A;  1B4O A;  1WFQ A;  1GUT A;  2B2V C;  3KF6 A;  4KLK A;  3I4M H;  1ILQ A;  2YTY A;  5DLQ E;  4C3H H;  3C1F A;  4L5R C;  3S1N H;  2Z8L A;  4A3J G;  1PZI D;  1EYD A;  2MPM A;  3I4L A;  3PO2 G;  4BBS H;  1QWY A;  4DV5 L;  2RSO A;  3AYH B;  3TP5 A;  3U9O A;  5IT9 c;  4FNF A;  3UDI A;  1JB7 A;  4JI4 Q;  3QO2 A;  1NNX A;  1RDP D;  1VMC A;  2D2C C;  3HP3 A;  4K6L A;  5ELE A;  3VYR A;  4YWM A;  4BS9 A;  1VQJ A;  4L5T A;  1NBW A;  2Q8I B;  1TT2 A;  4LK1 C;  2UUC Q;  1KXL A;  1TY2 A;  3S1R H;  1Q46 A;  1G2T A;  2F0G A;  2IJ0 A;  2PQA A;  1E1T A;  2WKD A;  3SEB A;  1PZK D;  2JA7 B;  3OYY A;  4M8A A;  3I4M G;  2WAQ E;  5K36 H;  2L12 A;  4X62 L;  5EAY A;  1K9M C;  3F2D A;  4BBS G;  4LAA A;  2CCZ A;  3PUZ A;  4WOR A;  5J22 A;  1HTP A;  1HA6 A;  1IBL Q;  1V9P A;  5COY A;  5M5X B;  1LAB A;  2RBM A;  3KLS A;  5GAH C;  3J81 i;  3U58 A;  1AZQ A;  3ERO A;  2XWB B;  5IWA Q;  4APV A;  4CDC C;  1EY4 A;  2OTL A;  1OXS C;  4JYA L;  2LFN A;  3NTH A;  5IYD H;  4RWS C;  5JPM C;  3GP7 A;  2KQ3 A;  4B9X A;  1G2S A;  1K8O A;  3PQI A;  5I6W A;  2BE5 D;  2NVQ H;  4OO1 I;  2CWA A;  4HCE A;  3NBH A;  1WVL A;  4DGZ A;  4FXK C;  4IO9 A;  4UP9 A;  1EWC A;  3I4N B;  1ENC A;  1HFG A;  4OO1 H;  1I4G A;  4GS3 A;  4ZYS A;  3MWY W;  5GAG C;  2M00 A;  4LNQ A;  3HOU H;  3UE0 A;  4UHV A;  3N52 A;  5EQ0 A;  5GRO A;  4F88 A;  1KLU D;  2R61 A;  5JPN C;  5D3D A;  1Q81 C;  4CHT B;  3M3Y B;  4A3M H;  1SXT A;  3Q23 A;  4DNR B;  4O0A A;  2IWH A;  3BVZ A;  2QEX A;  2HQE A;  1LUZ A;  3QB3 A;  5IYD G;  4LUO A;  3FHW A;  1DCZ A;  3ULP A;  2TMP A;  4OXP A;  5KYI A;  1WTO A;  3MXG A;  2XRQ D;  1VMP A;  2UXD Q;  1SNC A;  2K1B A;  2A68 D;  5CV4 A;  5ELB A;  2DY8 A;  3J81 L;  4G7H C;  4OO1 G;  1L1O A;  3F2B A;  1AFP A;  1UAP A;  2HDM A;  1ASY A;  1Y1V B;  4K5X A;  3S1Q H;  1B9M A;  1PYB A;  3A56 A;  5DAU A;  1X3G A;  4DU9 A;  1FJG Q;  4DXG A;  1EY5 A;  2NVY H;  5EKK A;  3L7Z C;  2K14 A;  4OWW B;  1EYG A;  2K75 A;  4AYB E;  1CUK A;  2K5D A;  4X3S A;  2DJF C;  1BO0 A;  1ONL A;  2QDL A;  4DUZ L;  1PTO D;  1QZH A;  3D4D A;  1A3U A;  1W3S A;  4K14 A;  4DNI A;  3T1H L;  5LMU Q;  1SN8 A;  3OW7 A;  1RTN A;  2I5H A;  4J15 A;  2E5L Q;  3JC6 6;  3SK8 A;  4A93 H;  3AQQ A;  2BA1 A;  2MQH A;  2IY5 B;  1QIL A;  3T1Y L;  4A3K B;  1EWH A;  1S3O A;  1FVI A;  3G6J B;  1GM5 A;  2B8G A;  4ZCK A;  2L5T A;  4K2L A;  4LF4 Q;  5C4X H;  3VA5 A;  1D7Q A;  2K5N A;  4KI0 A;  4QUC A;  3HOV B;  1JC7 A;  3CCQ A;  2CH4 A;  1M8A A;  5IGB A;  1ML0 D;  1U0L A;  2E5L L;  2FIN B;  4YCW A;  1EFI D;  5I9O A;  3M9B A;  1HZC A;  2F0P A;  4IUQ A;  4FP5 D;  3LNN A;  1C9O A;  2K50 A;  3GTG B;  4FF1 A;  4WJW A;  3J7A F;  5M5W H;  1S5E D;  1EWI A;  4A93 G;  4HJA A;  5I2X A;  2GA4 B;  2YU9 B;  4ILW A;  4WRD A;  3K5N A;  2R7D A;  3CQZ B;  3PSI A;  4R4T A;  4OL7 A;  5BN5 A;  4JI0 L;  4IUP A;  3J7Z C;  3DUZ A;  5D65 A;  1HNZ L;  1AEX A;  3SVM A;  2Q2U A;  1EY7 A;  2AWO A;  5JAV A;  5FK9 C;  1PH2 A;  4RFB A;  1KLG D;  2OXP A;  3I91 A;  5DM6 3;  4IUU A;  1EQQ A;  1IW7 C;  3I4O A;  3CD6 A;  1HZ9 A;  1AH9 A;  2PNH A;  1HR0 L;  1I4H A;  1STG A;  4JI1 Q;  5IIF A;  4KTA A;  1EL0 A;  3CC7 A;  1X3P A;  4DUY Q;  2NBF A;  1BQQ T;  4H0L C;  2B2T A;  3BVG A;  1U4R A;  5EBC A;  1XPO A;  3WOE A;  4K0K L;  3KBX A;  1WCM G;  1U9R A;  1H9M A;  4YWK A;  5JVH 3;  1HNX L;  1OTC A;  2O5J C;  5C4J B;  2WB1 G;  3NTK A;  4MTN A;  4R4Q A;  2CH4 W;  5C4H A;  2B2T C;  2VQF L;  3I73 A;  2AQ2 B;  1PH8 A;  3PV0 A;  4KY6 A;  2KJX A;  3HKZ B;  2VY3 A;  4PNY A;  4CDD C;  3J81 E;  5ELO A;  4A3C G;  4A3I B;  5IYB H;  2E76 C;  4TKO B;  1F9P A;  1LT3 D;  3RR5 A;  2JSO A;  3KLR A;  2JEB I;  1NR4 A;  1W6K A;  2LS0 1;  1E2W A;  4A3E B;  4BA1 I;  2YTX A;  1TWG B;  2R92 B;  4GLV B;  3W1B A;  1I6H H;  3A7A B;  1XPU A;  1PH3 A;  1U4P A;  4IUT A;  4A3B G;  3FEW X;  3AFP A;  1HQR D;  4A3F G;  3R2T A;  1PFS A;  4ZAI A;  3M4O B;  3HGB A;  1V8Q A;  5C3E H;  1WTX A;  2Q8T A;  1HR0 W;  1X65 A;  2VL6 A;  1E7Z A;  2AWN A;  4NW2 A;  2K5W A;  4FF3 A;  1YVC A;  5BN3 A;  1PRT C;  4FYD A;  3MVV A;  3I8Z A;  1TII D;  3S1M H;  1UWV A;  3T53 B;  4HCS A;  1EQT A;  3MEF A;  4QMG A;  5FJ8 H;  1B2T A;  4GKK Q;  3GTK B;  3H09 A;  4KHP L;  4A3D B;  5CV5 A;  3K5L A;  1RF2 D;  5EJW A;  2EVB A;  1W6J A;  4XQN A;  1GUO A;  2PQE A;  1SAP A;  1KRT A;  1DD2 A;  4UP8 A;  3ERS X;  1EU4 A;  1B70 B;  2ZT9 C;  5I4D A;  4NXM Q;  3J7A V;  2L9H A;  2R7Z B;  1GD7 A;  3CCJ A;  1I3Q H;  1QVC A;  1D1K A;  3V2T A;  3HOY G;  4QCL A;  1SE3 A;  2Z6B A; 
#chains in the Genus database with same CATH homology
 1MHW C;  2DJF C;  2DJG C;  4CDE C;  4CDF C;  1ICF B;  4OEL B;  4CDD C;  4OEM B;  4CDC C;  1K3B C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...