1K3BC

Crystal structure of human dipeptidyl peptidase i (cathepsin c): exclusion domain added to an endopeptidase framework creates the machine for activation of granular serine proteases
Total Genus 7
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
7
sequence length
69
structure length
69
Chain Sequence
DPFNPFELTNHAVLLVGYGTDSASGMDYWIVKNSWGTGWGENGYFRIRRGTDECAIESIAVAATPIPKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of human dipeptidyl peptidase I (cathepsin C): exclusion domain added to an endopeptidase framework creates the machine for activation of granular serine proteases.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
molecule keywords dipeptydil-peptidase I exclusion domain
total genus 7
structure length 69
sequence length 69
ec nomenclature ec 3.4.14.1: Dipeptidyl-peptidase I.
pdb deposition date 2001-10-02
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.170 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Cysteine proteinases. Chain C 1k3bC00
4CDCC 2DJFC 1MHWC 4CDDC 4OEMB 4OELB 4CDFC 1K3BC 4CDEC 2DJGC 1ICFB
chains in the Genus database with same CATH superfamily
1VQHA 1UE6A 3PO2B 4FF2A 4A3MH 2WAQE 2XN9C 2C9OA 3L9AX 3VR3A 4GKJL 1FYCA 1S72A 4GN5A 4LF4L 1KLUD 2JA7G 4B9XA 5M5WH 1B44D 4DV0Q 5ISRA 1D5XC 4ULLA 3GTJH 1YITA 3OIQA 2ZT9C 4A3FG 4YWKA 3LWUA 1C48A 4DKAC 4QIWB 1AE2A 3E0EA 1ASYA 3T1HQ 2NN6I 5KYLA 1VQMA 2XWJB 2CQOA 4BS9A 1K83H 2B2WA 4ZAIA 3Q8DA 4RWSC 1XNRL 2F0SA 4ODGA 3EVQA 3TMEA 3I4MB 1HTPA 2B2VA 3W1GA 1VQPA 2RDHA 3GTGB 1O7IA 1CKNA 1F2MA 4V0BA 4N8FA 3K7AH 1L2FA 1K3BC 2I5LX 4QUFA 3ND8A 2UUCL 2XTIA 4CBVA 4R4CA 2RHQB 1OXSC 4IUVA 2R61A 2MO1A 4MTKA 3M4PA 3GP7A 3KBXA 3GTLH 4R4TA 2A6ED 2WACA 4A3GH 3OTOL 4DNRB 5IGBA 2PPBC 3CPFA 1BCPC 3BU2A 3NQIA 3CW2C 3NK9A 3D4DA 2Z6KA 2F0UA 4IPDA 1PH5A 1Z9FA 1ICWA 4IPHA 1PV4A 2HUGA 2E2IH 3KJOA 4DR6Q 4R4OA 1KQSA 1ZKOA 3S2DH 3CF5A 4MZ9A 3GDEA 4OWTB 1U4MA 3KOJA 1CKNB 3PCOB 4X65L 4ZRZA 3GTKH 4A3CG 1JOOA 4IO9A 1F9SA 2NZ1D 3QJYA 1RODA 2AUKA 2ENBA 4Y7NB 1GUSA 5M3MB 2D9UA 4H0LC 1PZKD 1JB3A 1RKNA 3PUZA 1DJRD 3KF6A 4IFDG 1U4PA 3SGIA 1LT5D 3QB3A 2Q8RE 4V190 4DAVA 2MJ8A 5FJ8H 1KLGD 1FNVA 4O0AA 3J81c 1SYBA 4B3MQ 2BH8A 3D4WA 4MN3A 3BZKA 4KKUA 3E5SA 2UXCL 1CI3M 3KF8B 2Z4HA 3CCVA 1PH1A 1E2VA 4APVA 4J8QA 2KCMA 3RZOH 4PV1C 2XRQD 1Y1VG 4RGTA 4CDDC 2V4DA 2A8VA 3DM3A 2F0VA 3U58A 2I5MX 1D8LA 4RKLA 4DF7A 1STBA 2Q2HA 1Z47A 2L11A 5CBEE 3RZDH 1GHJA 2E5LQ 1YJ9A 2RHSB 4XDXA 4DPGA 2EOTA 3IAYA 1RCVD 3VR4A 4JI1Q 4XYQA 2K03A 4R8NA 1HRJA 1XMOQ 1SR3A 2M00A 4P71A 2KOLA 3J80c 4YHHL 3H09A 1Y1VH 5LL6X 1RD9D 1D5ZC 4JI0L 5IYDH 1BR9A 1LV9A 1N34Q 4H02A 3HOVG 4JK1C 4JI7L 2ZXRA 5CC4A 2KA7A 4IFDH 3K5LA 4DV7Q 1A3TA 1JWSD 3SK6A 1IZ6A 1P16A 4P74A 3PIOA 1ZEQX 4OELB 3H3VH 1FR3A 4LF5Q 1CKOA 2R6GA 4K0KL 5C0XJ 1TS4A 4GKKL 3FMCA 1A3UA 4HIKA 2KENA 4LF6Q 3EQLC 5ELBA 1X3FA 5EJWA 3CC4A 2NWGA 4I7ZC 3VYUA 5M3MG 3CPWA 4DUYL 4A3JB 2I0QA 4YIJA 4NW2A 1S40A 5IP7G 1VQEA 3EA6A 3QO2A 4A75A 1S5BD 3S16B 1MIUA 2B2UC 2IY5B 5C0XI 2WINB 5D14A 1QVFA 4P2CB 2X69A 3HOXB 5I6WA 2OEOA 2G5DA 3HKZG 3QOLA 5EKKA 5GAHC 2B2YA 1CQFA 3WOEA 3PO3B 1HHVA 2JXMB 3F2UA 2Z8LA 3TRZA 1G6ZA 1S5ED 2WAQB 1R4QB 1M4VA 3BVMA 3R8BA 1BNZA 1PYBA 1VQFA 4OO1I 3VA7A 3M7GA 1B9NA 3PGZA 1DOMA 1SNMA 3S1MB 4O1NA 3B6YA 1AW7A 1JJGA 2A6HC 3I4NB 4LF8Q 1VS0A 2UUAQ 5CORA 1DM0B 2DJFC 4KY6A 1SNQA 1PLFA 2PW7A 2PW5A 4NMZA 2CH4A 4XT3B 3MC0B 1PFNA 2EE1A 1A63A 4ZK9B 3GTQB 3N52A 4LF7Q 2PNHA 4F7XA 4A3JH 1A8VA 4A3DB 4A3BG 3K8AA 2NVXH 3M4OH 3FHWA 4KLKA 2DY8A 5C4ZA 2F4VL 1F9RA 2E2HB 1VQGA 1G2SA 3PIP3 1M8AA 2BDNA 4X6AH 3SVMA 1E1OA 4OIKA 4PZ6A 4X66Q 1HPCA 5C3XA 5F2DA 3L2PA 2YTXA 4NXNL 1F2ZA 3A7LA 4HJ9A 4XQQA 3H0GG 4OX9Q 3VDYA 2F4IA 3CRLC 1N32L 1C8CA 4IQZA 4B3RQ 1XTCD 1X3GA 4NP5A 4JBKA 1H9SA 5EQ0A 4KKTA 4J1MA 3HS0C 1K83B 2A6EC 2D0PA 4DAMA 1X55A 3MWYW 1JOQA 2SOBA 4L5QA 4A3DG 4JI8Q 1EU3A 3WDNA 1LTAD 4FF4A 4IUPA 1Y8NB 1TY0A 1A62A 2F0EA 2WV6D 3BDOA 1AEXA 2F0FA 5C4XB 3OIPA 2AWNA 1JOKA 2YYZA 1IW7C 2MNAA 3DEOA 5DM73 5JJLA 2F0LA 3F8TA 1N33L 4KJNA 2NVXB 1JQYD 1PVOA 5ELFA 2EY5A 2F0MA 3KLWA 1UEAB 1VF7A 4EGVA 4PZ7A 1GUGA 4ZCKA 1QG7A 5IYBH 1PH6A 1EFID 3SK4A 3I4LA 2AHOB 1MD2D 1L0XB 1GM5A 1HCZA 1TWHB 2ID0A 1EWIA 5AFWA 3BVZA 4XQNA 2L4NA 1RDPD 3BS1A 2CWPA 2JA7B 1RIPA 4JI3Q 1HH2P 2F0OA 4HCSA 4A3FH 2HIVA 4ABNA 1EYCA 3J81E 5L37A 1TWAB 2XSCA 4LF9L 2K5NA 5EBDA 4AYBB 2WFWA 4LFBQ 5CV8A 5ELCA 1J9OA 3PF4A 4A3LH 4JG2A 2SDFA 1IKMA 4OWWB 4H7BA 3T53B 4DR6L 2RDFA 2A6HD 2EYLA 4EQOA 4IPGA 1S5FD 4KJOA 1QWYA 5IP9H 2JN4A 1PMRA 2UXDQ 4IJHA 4AIMA 1GUWA 4A3EB 1YNJD 1XJVA 3TS2A 4DR2L 1LT4D 2LXKA 4U673 1CZWA 2K33A 4KI0A 2O5IC 4BXXG 2B3GA 3K7UC 1RL2A 1JMCA 1EOVA 5J1ZA 1NMGA 4RFBA 1HNWQ 3J80E 1NNXA 3AFQA 3K0XA 2B2YC 3PO2G 2IX3A 1YNJC 1NMFA 3MXGA 4A3MB 3L0OA 1A2UA 3M4OB 4R4QA 4BA1I 2F0GA 1GUOA 1NE3A 2I5HA 3HFZB 3CMEA 2C5CA 4QQBX 2H5XA 4RKBA 5E7NA 3R93A 2L1BA 3NWSA 5I9PA 1JE4A 3F2CA 3JAME 1IBMQ 3CQZB 4NPSA 2VUMG 2NB0A 1X3PA 4KHZA 4LNQA 3VR6A 3OW2A 1Z7TA 2AUJD 2EXZA 1SNCA 3G48A 3MXNB 3CCMA 3P7JA 3CCLA 4E6IA 1MJEA 3A54A 5D65A 5COYA 2WIIB 4UP7A 4RAUC 2ES2A 1J6QA 3VR2A 1VMPA 4L6TB 1VQ7A 2E5LL 4DV4L 3S1MH 3I8ZA 3OHXC 3D6WA 1WTWA 4C3HB 1MJCA 2EY6A 3TREA 2NVQB 3BJUA 3G6JB 1LM0A 3SDZA 3U9OA 5IGEA 4J15A 4CJ2C 2ZM6L 2R3ZA 4OO1G 1I50B 1WTQA 1NCVA 1H9MA 3BYTB 5IT9c 5LMNQ 1L0YB 1I4RA 1BF4A 4UY8C 4WJWA 1CQVA 2XWBB 4B3TQ 3GTMH 3UDXA 2F1MA 3DWQA 2F0PA 4X3SA 5ELDA 2F0QA 1O80A 1PZID 5C5LA 2QKIC 3GTPB 3JAMi 2BA0A 2FMMA 4IUQA 3A8JE 1H9RA 1J5EQ 2FXQA 2Y0SB 3CKIB 1VQOA 1HNZQ 4WJ3M 1ENAA 1U5KA 1G8ZD 4HMIA 5M5XH 1HXYD 1DYQA 1SMYC 4JYAL 3K80C 2F0NA 3QIAA 1X6OA 1EYAA 2A68D 2E2JH 2DJGC 2PO4A 4PNYA 5AJ3L 3A8IE 2K5VA 2WB1E 2DNCA 3G71A 1TWGH 4DUYQ 4IUUA 4GS3A 2AQ1B 4C56C 1PTOF 2NN6G 3J7YW 3W5OA 2SEBD 2A69C 4RH6A 5BN5A 1BCPB 3WWVA 1I4HA 3TEHB 1D2BA 1PTOB 4A93H 1F9PA 4RMFA 5LMUL 1SE8A 4R9WA 3E0JA 2JA6G 2E2DC 5HURA 1HR0L 1SE4A 1YNXA 3GV6A 3NBIA 4DK3C 3F1ZA 3TP6A 1PYWD 5A35A 1RTOA 1F2YA 2EYHA 3RZOB 1SYGA 3ONAB 4BY7H 4P73A 1QE6A 1ASZA 2E75C 2KHIA 2OWOA 4I7AA 2KJXA 5EAYA 5IY0A 4N9PA 2WP8J 2B2TA 4XT1B 4LF8L 4OHJA 1PTOC 4QMGA 2Z6BA 3TZDA 5C3EG 5C4JB 4DFAA 1Q86C 4G57A 1CHPD 3G4SA 3NTKA 4TRDA 4POFA 1YEZA 5FLXc 2F0DA 5JEAG 2GN5A 1Q81C 3FPUB 2EYJA 2J7ZA 2JA8H 4A3LG 4QY7A 1FJGL 3MVVA 2M2LA 5IYBG 2PQAB 1EYGA 5ELNA 1XPUA 4BY7B 3A8KE 3GTMB 1NY4A 3CC2A 1AP0A 2L0CA 2B29A 3KDFB 5CR3A 3NELA 5G3LF 1CM9A 3UDFA 5K5PA 2R7FA 5J3BA 5C4XH 2EY1A 5FO9B 1QJOA 3OW7A 1DOKA 3X3MA 5C44B 3U4VA 3J81j 2UXCQ 2R93H 3IFTA 3RMHA 5C44G 3RLNA 2K28A 1V1QA 4KK7A 4KN4C 4NB3A 2KBNA 4QJFA 2TMPA 4MTNA 2BH2A 3CCRA 1K0SA 2TSSA 4EQ5A 4BY1B 2L9HA 1PXUA 2AMCB 4A3BH 5J22A 2OTJA 1X3EA 2QGQA 3MTSA 3LNNA 1PFBA 3JAML 1K8GA 2JJQA 1V1OA 1WJJA 2F3WA 3RLFA 1HUNA 4YCUA 1B4OA 2VUMH 4XXEA 4K6LA 3HOYG 4AH6A 2RDGA 2JA6B 1NSNS 3NBHB 2K6AA 1XMOL 5C3EH 4L8JA 5FO8B 4IPCA 2H1EA 4GKJQ 1CHQD 1QNUA 5C4HA 1I94L 3S2HH 4GNXA 1EY6A 3NUCA 1SYEA 2F3IA 4A3KG 2ATWA 4BA2I 3EFXD 3ERQA 1ILQA 1OTCA 1EU4A 4TSSA 5KNCA 4A3DH 3OSOA 3LGJA 2LY7A 3I73A 2HT1A 2NVTH 3Q23A 3GO5A 4PMBA 2RKSA 4YY3Q 3GTOH 2BE5C 3EN2A 1FGUA 4WFN3 3HOUB 3G7LA 5JJZA 3RN2A 3HKSA 2HDMA 2OQKA 4PMWA 4CGYB 4BY1G 2NBFA 1VQBA 1FL0A 1TIID 2EYPA 1SFOH 4LK1C 5FKAC 4DR1L 3AQQA 4UHVA 2UUCQ 3J7AV 5JOBA 4K2LA 5IYDG 4KHPQ 2Q8TA 3OMCA 2QDLA 2WKCA 5J39A 3NWTA 1WTPA 2Z0SA 1HTLD 4A4IA 1QOHA 4CJ0B 2EZVA 1IXRA 3T56B 2UXDL 5ELOA 5C44H 1T9HA 3CQZH 4A3FB 3OYYA 1W6JA 4BXXH 1EY9A 1AFPA 4YWMA 1B70B 3TBIB 2KUMA 1QVCA 3C46A 1HNWL 1TWFH 5I6YA 3HEJA 2LKVA 2IW3A 2D2CC 1UAPA 2N88A 2IPKD 4POGA 1O7LA 2KVMA 4HJ7A 2LFNA 3NENA 4RGOS 1HZBA 3GV3A 3QWNA 2QEJC 5TSSA 1VQ4A 3C2PA 5K36H 5T1GA 4DV6L 3VA5A 1KNAA 1JCKB 1IL2A 4C3JH 4A93G 4AQYQ 1Y14B 5IP9G 1A3VA 3HOWG 1EQVA 2RSNA 2PYKA 5BN4A 4KMUC 3S2HB 1KAWA 2F0TA 1X54A 2UU9Q 4A3MG 2EPBA 2B2UA 2R92H 1JWMD 1EEID 3NHHA 4F8MA 4HJ5A 3HOYB 3HOVB 1MHWC 2HQLA 2Q2TA 1IHZA 4HJ8A 3D31A 5DLQE 3S16H 3U9SA 3P1HA 2A69D 2MFIA 5NUCA 2JEAI 2YU9B 1AZPA 1SN8A 1I3QB 3QOJA 3E9HA 4LFCQ 3AU7A 3PF5A 3S1RB 1I4QA 3Q6SA 3EBEA 2PZUA 4QB4A 2VW9A 1M1KC 4LMQD 1H95A 1HA6A 2RSOA 3S1QH 3N6RA 1L1OA 3I55A 1QVGA 2L12A 4ZUIA 1XX8A 3L3OC 4A3KB 1XMQQ 5GAGC 1LLRD 3TP7A 1FNWA 1KXLA 5FLMH 5HY6A 1N36Q 4X64L 1YJNA 3D0FA 2HCCA 5IOCA 3TP8A 4DUZQ 3ULLA 1PFSA 1A2TA 4DV5Q 3K58A 2VQFL 4M8AA 1CTMA 1HNZL 4HIDA 1PH2A 1K28A 4DR3L 1I3QH 2IX0A 1N9WA 3PQIA 1S3OA 1BXTA 1KC8C 1PA6A 1WI5A 1EY8A 1B3AA 4RG1A 2BA1A 1K9MC 4JV5L 1FGBD 4QUCA 1YHQA 4LF4Q 1PRTF 2ZTDA 1C9OA 1C0AA 1KABA 3J81i 3C3LA 5IODA 1CFMA 1PRTD 1EWHA 2B8FA 2B63B 2RF4A 3KK7A 3CP0A 4XTCS 3I91A 2QA4A 2EYFA 4JI5L 1QB5D 3A74A 4UPAA 5DNFA 2DNEA 5K36G 2V1CC 1S5DD 3RZDB 2KQ3A 1V9PA 4RGNA 3GD7A 3LWEA 3RD4A 2ZXPA 4O2DA 4P75A 1XNRQ 1X65A 4KKSA 2VL6A 4KN7C 2IWHA 4CKBA 4LF9Q 3DEPA 2R93G 4XQJA 4QIWE 2Z4IA 3DMUA 4IOAA 1STHA 1ENFA 3UE1A 3MEHA 1CZGA 2BCOA 1TWCB 1DOLA 3I56A 3ZYYX 5M9OA 5M3MH 1NR2A 3NBHA 3IKJA 3PIPA 1HFNA 5KRUA 1EIFA 1KRSA 2VXWA 3Q22A 1ML0D 2BE5D 2DY7A 3V96A 2JA5B 1WD1A 5HGTA 4JBMA 1EWCA 4FF3A 2EJFC 1TY2A 4S3SA 2Y0SE 3MEFA 3TN2A 3K57A 2D5DA 1B2TA 3HZXA 5IE8A 2Z1CA 1DZ1A 3MHBA 1H9KA 4CHTB 1XNQQ 4EQNA 1GKHA 2CQAA 4DXFA 4FDBA 3CCJA 4DR7Q 2A1AA 2LMCB 4N8X1 4FP5D 1CUKA 3IFDA 4BWGB 2K5WA 4QGUA 4IZ8A 2UUAL 2LS01 1VQAA 2E2JB 5GADC 4IALA 4GOPC 4OGQC 1F2LA 1PZJD 5JAVA 1E2WA 2CH4W 4RA8A 2AWOA 5IGDA 3H3VC 1L1OB 3MA2B 1VQ9A 4HTHA 1C7YA 1AZQA 4KY7A 1WTVA 2J0TD 5A2QE 4GLAC 1YZ6A 1R4PB 5JVG3 5C6AA 2K7VA 2PI2E 2F0WA 4MNOA 3SHLA 1HR0W 4PQXA 3KF6B 2FJ2A 3A5ZB 1IBKQ 2R7ZG 2KHJA 2WKDA 1B9MA 4A3GB 3J7A5 1VQKA 1MBYA 1VQJA 4C3IG 4NXNQ 3TP5A 2B2TC 1D6EC 1IW7D 1Y8OB 1I4GA 2F0IA 4DV4Q 3CRKC 1G2TA 3H0GH 1P8LA 5M5YH 1VQLA 1NJIC 4KY5A 3VYRA 3BYYB 3FRPB 4U68A 3M9BA 1TVXA 3P20A 1HZ9A 2ZM6Q 2R93B 3HOZG 3SK8A 4HAEA 1I4XA 1TKWB 1WOCA 1SXTA 3K0YA 2ZJPA 4A3KH 4NXML 3I4MG 5H1SE 4PG3A 1W3SA 3I7FA 1G91A 3T1YQ 1IYVA 1GUTA 2ALYB 2OXPA 2RQXA 1CT1D 3K6OA 1X56A 2UXBQ 1TT2A 5EPJA 1XYIA 4Y7NH 1KRTA 5A2QL 1UE5A 1STGA 3E6ZX 2O2LD 4GLVB 2ZTEA 3R2TA 1EOTA 3U4ZA 3G6EA 1KD1C 2PMZB 5FK9C 3URYA 3GTKB 1I6VC 3KDFA 4K5VA 1K8AC 5IWAL 2XGTA 2DN8A 4ILWA 3BG3A 3RN5A 3HOXG 3DXJC 4DV0L 4KHVA 5I2XA 5C0XH 3FVQA 5AJ3Q 3S1NH 2R7ZH 2EDGA 3MXUA 1U4RA 1KHIA 4DV7L 3PUYA 4Q0FA 1SYDA 3HG9A 4XYOA 3RR5A 1A6XA 3FPPA 2IT1A 3GTLB 1BBWA 4LFBL 4A3CH 1VMCA 3CAMA 4LF6L 4CDCC 5M3FG 5JPNC 1GO3E 3I70A 4AYBG 2E74C 1VCIA 1G51A 3SK5A 3LX0A 1B1ZA 1IYUA 1SYCA 1R9TB 1ZYRC 4EVOA 5FLMG 4BBSG 3FKIG 2CHBD 4FYDA 2O4XA 2MQHA 3J81L 2GVBA 1SJED 1B53A 4DV6Q 3E3XA 3EROA 3QG1A 4AQYL 1L1OC 1K8MA 1EZ8A 2PQAA 5ELEA 2F0JA 1BQQT 2YTYA 2SNMA 1FVIA 4BY1H 1GD7A 1Q8KA 2JA8B 5C0XG 2HIXA 4N9TA 4JI6L 5EKLA 4L5SA 1YJWA 5T1IA 5CMDA 3SE0A 2VQEQ 2N78A 4BY7G 4OXPA 4GLXA 3I2ZA 4DR4L 4BBSB 1IBML 2HQEA 2QW7A 1DD2A 2I46A 1V1PA 3ITPA 3STBC 2NVTB 1NUCA 4LF7L 3S1RH 2JA5H 4DA2A 1ESRA 2A19A 3A7AB 3DM1A 1BCPF 1GUNA 2F4VQ 1SNDA 3CHBD 1E0BA 5JVH3 5JEAH 1V1PB 2JSOA 2B8GA 1B8AA 4UAIA 1PH3A 5BR8Q 2ZTCA 2PMZE 1CA5A 2CCZA 2HD3A 1OXTA 3NSWA 1QNKA 1PDQA 1YI2A 4OIJA 2IHFA 1GXDC 1O7ZA 1YHAA 2RBMA 4DUZL 2OF1A 1SSOA 3C1FA 2VY3A 5E4WC 4DV5L 2H4OA 4LUOA 4IURA 2VQFQ 3NP8A 1SLJA 1TXYA 1HA5A 1E1TA 2SNSA 1YIJA 4FXDA 1FD7D 1SNOA 1LO5D 4XIGS 2VB3X 4DAYB 4IN3A 4RCNA 1HNXL 3S1QB 1II3A 3W2DA 1ET6A 3I3CA 4BBSH 5CV5A 4TVAB 2NVYB 1U4LA 2KECA 3FDTA 1S4ZA 1TR5A 2M9VA 4A3JG 1J5EL 4X62L 3MXNA 1WD0A 4YY3L 1QZGA 4IFDJ 3PSIA 2PCFB 2JA7H 2N3SA 4JYAQ 1RTNA 1T5EA 3CMAA 3HOYH 2I07B 1QUQA 3ERSX 2VB2X 1LTRD 3HOUH 5C4JH 4QF4A 1N34L 2ICEC 2VNUD 2QF7A 3H6MA 2Y0SG 3I4NH 1VQDA 4A3IB 2AQ3B 3I4MH 3IRBA 1JR0D 4WJ4A 2A5HA 3K5MA 2GA4B 2D62A 4JI3L 4HSVA 4DGZA 2PZWA 4YCVA 4C2MH 1IBLQ 3M4YA 4DK6C 4GKKQ 2NZHA 4KD4A 4TQUS 1MGSA 1KIXA 2E2HH 1DONA 1LTLA 2K5DA 5KIXA 1XPRA 1EY5A 1K0RA 3BZDB 4MIUA 1WFQA 5C3EB 1SEBD 1WTRA 3MXPA 3X3NA 1PRTC 4Z9CB 2R92B 4IUTA 3A56A 1WCMB 1K73C 4JBWA 2KHSA 3BDCA 4DR7L 4ID6A 5EPKA 3OPOA 1K8OA 1SE2A 2X6GA 1Y1WB 5EGTA 1L0WA 3OTOQ 1O7YA 1I6HB 4WORA 2B63H 2IX1A 2K14A 1T5XD 5CV9A 1MI2A 3DWPA 2ICIA 4EQPA 1C4QA 1F9QA 5CYUA 2VUMB 3Q0AA 1D7QA 1IKLA 3TQYA 3HOWB 2NYZD 1FJGQ 2R7ZB 2LSSA 4DV3Q 1PYSB 2EJMA 1PFMA 1YBYA 1STEA 1CKMA 2OCEA 4R4IA 4IJLA 4ZLTF 4X65Q 1SNPA 2CWAA 4FVMA 2MPMA 3TS0A 1R9TH 4GZYC 4OL7A 2N49A 4BBRH 2JQOA 3DHQA 4JI4Q 4DV1Q 4B3SQ 1EIYB 4FNFA 1FNUA 1HZAA 1M90C 4X3KA 2JA9A 3P75A 3MFYA 1PHJA 2NZOA 3ND9A 4HIMA 1QZHA 1BO0A 4C3HH 3HOZH 3W1BA 1KTKA 4A3EG 1HUMA 1XMQL 3NTHA 4DN4M 4NXMQ 1NBWA 1XXGA 2KCNA 3E9IA 2QEXA 1N36L 1JORA 2KEEA 1I50H 1Z6HA 5BN3A 2F3VA 1WCMG 2PI2A 3M85A 3L7ZC 3GTGH 4B3RL 3IL8A 3J7ZC 1MSHA 3NQTA 4DR5L 4C3IH 5E4XA 3SEBA 4Q5VA 4DV2L 1AH9A 2JEBI 1X32A 5D3DA 3T16A 4K8JA 4EX5A 2EY2A 1EY7A 3H3VI 3FEWX 2N8NA 3T51B 1I94Q 4JI8L 1KAAA 1VQ8A 4K8IA 4LFAL 1BDOA 2UUBQ 1D5MC 2FHTA 3KFUA 4JOIC 4HN7A 2ASBA 2IJ0A 1ZXTA 5GAEC 4HCEA 4HIOA 1NR4A 2Q8IB 4JI1L 3HGBA 3EIVA 4GOPB 1TWGB 4FO2A 2Q2UA 2EYOA 1VF5C 1Q7YC 1BKBA 1TU2B 3OWEB 4FF1A 1RF2D 1TWAH 3UE0A 1PH7A 1Q1EA 1KDCA 3PMFA 3NXWA 1A15A 1E22A 2X6LA 3ZJYC 4A93B 3OOCA 3GTOB 4DR1Q 5E1FA 2LXJA 4DNIA 1V8QA 1EYDA 2Z6KC 1TWFB 3H15A 2D0OA 1TS5A 3S14B 3ULJA 3FKIB 3NE5B 1EZ6A 1G291 1X3QA 1V43A 1JE5A 3TSSA 4DU9A 2A74C 3H94A 4GN4B 4RCOA 1HR0Q 3R2IA 1W2BA 2IHEA 1IYJB 2KCTA 1JJ2A 1LTID 2YV5A 3KLSX 3ULPA 3VYTA 4ZQ3A 3T13A 4JCVE 3OWFA 3PUWA 4P72A 4ZYSA 3I4NG 2GVAA 2IL8A 1D1KA 2CW0D 1Q3LA 5JPMC 4YCWA 4JI6Q 1PTOH 2JP1A 2B39A 5M3FH 3K59A 2EXDA 4OEMB 2WAQG 1CK1A 5FO7B 1Q12A 3VYSA 4A3IH 4CDEC 1F77A 1DXMA 1UE1A 1PH8A 2B2WC 4DR2Q 4GN3B 1QUQB 2EJGC 3AEVA 4F88A 4HMJA 4DR4Q 4K6DA 4OONA 4I65A 3UDIA 1KL9A 3S2DB 4MHEA 2NN6H 3A0JA 2JE6I 4R8IA 4JI2Q 3M3YB 3V2TA 3R3OA 1EY0A 1A0IA 4JOIA 1ONLA 1BCPD 2UU9L 3H91A 3CXCA 1G6PA 4O42A 2EYMA 2FFKB 3CCQA 4IFDI 3RNUA 1ZYRD 4RHRA 3S17H 5BR8L 2F0HA 4PMCA 4KV6A 2HHHQ 5E3FA 1JWUD 1HZCA 4LJZC 1RHPA 2MO0A 3QR8A 2N55A 4H13C 3V05A 4FXGC 3K7AB 2EQSA 3CCUA 2CKZB 4LFCL 5I9OA 2MP1A 5CBAE 2KCCA 3BDLA 1UNSA 3KLSA 4K5XA 4LW1A 4TKOB 4G7OC 2BDOA 4CDFC 1LABA 3D6CA 3I90A 2Z9HA 2O5JC 5DM63 2K01A 1H9JA 3PO3H 1W6KA 1XTDA 1LTBD 4OX9L 3T1YL 3CU7A 3DWAA 3S14H 3S9WA 1N32Q 4M1UB 1XWEA 5GQOA 4CKEA 2EVBA 5IT9E 2K1BA 3TZUA 4UP9A 1KNEA 4KTAA 4RGMA 2EIFA 4GNXC 4X62Q 2WB1B 5FLXL 1EQRA 4DR3Q 1PTOD 1SYFA 4KD3A 4NKLA 2JYOA 1QCBD 2QILA 4JV5Q 4NDXA 5LMNL 2G9DA 5IWAQ 2PQEA 2XIWA 1NTGA 5IGGA 4A3EH 3AFPA 4ALPA 5GROA 3S15H 1E7ZA 3TDQA 2RCFA 4QL5A 4IOCA 1SE3A 4ME3A 4UDUC 3CCEA 3VR5A 4JVZA 4OWXB 1BBXC 3A55A 1GVPA 1BOSA 1K3RA 1LTTD 3J80L 5IIFA 4DAYA 4R1JA 3BVGA 3K5NA 3BZCA 5LL6S 5CV6A 4DK0A 3RLOA 1JT8A 1SBBB 4A3BB 1KDBA 2RA4A 1ESFA 2AKWB 5KNBA 5M5YB 2A73B 4C3JG 4IUNA 2K4KA 5G3LD 4JC0A 1SDFA 3HKZE 3M3YH 1CSQA 4JI7Q 4QCLA 5KNDA 4DNTB 1JJCB 2OQ0A 3T1HL 4A3GG 2CFMA 2Q2IA 1QILA 3AMUA 1BUVT 2OT2A 5C5MA 3PO3G 3GTQH 1EFWA 5FOBB 3PUXA 5LMUQ 3MAQA 1DGSA 3HKZB 4Y52H 1SROA 3FP9A 1UE7A 2MGSA 3GQBA 5IYCH 1WTOA 4C1NK 5LHY1 5C4XG 1SFOB 1ICFB 3S24A 5JJKA 4C2MB 1LYLA 2VS1A 3OMGA 4L63B 3KF8A 1J8IA 2C35B 1GOZA 3HOUG 2NUCA 2HCIA 1XNQL 1JC7A 5IP7H 3M4QA 1LACA 3T4AC 5I2YA 1SRUA 5FJ8G 2JK8A 4DV3L 4X3UA 3ICEA 2MUYA 1JB7A 3KYHC 1NAPA 3I4OA 2VZAA 3PV0A 3KLRA 4LAAA 1UEBA 3UI2A 2VQEL 4DAPA 5JEAJ 4K14A 4L5TA 1TWHH 2PZTA 1MKHA 2KEDA 3EJIA 3FKIH 5DEHA 5I4DA 4DV1L 4B3SL 3PO2H 3A5UA 5IGFA 2JA5G 1KDAA 2PNRC 4HEDA 2K50A 2L5TA 1LT6D 3NPPA 3S15B 4H44C 2YU9H 5CV4A 3PIO3 4JW0A 1Q82C 2XRSD 1O78A 1WTHA 2K75A 4LUZA 4C1NI 4A3IG 3S17B 1VQIA 2CVRA 4JBJA 5C3WA 5CV7A 4C3IB 2FINB 4DR5Q 4DV2Q 1JICA 3MFGA 1VDZA 4AYBE 1OO9B 4BBRG 2OTLA 3HP3A 1OXVA 5KEEA 4X66L 1I4PA 3KUPA 2NTTA 2ZXOA 1WVLA 1Q8IA 3HOZB 1WTXA 1TS2A 4B3ML 3J7AF 1CSPA 4J6HA 3SXHA 5HGQA 5DAUA 3KJPA 1Y1WG 3D3RA 4OO1H 3AB9A 1Q46A 2ZJRA 2K04A 1EIGA 3D8GA 2K52A 2F52A 2MHVA 4PZ8A 4ZKBB 1YVCA 1STYA 2F03A 1EQTA 4GNXB 1U0LA 3STBD 1EQQA 4B3TL 4ZUJA 1WYDA 5M5XB 3D4RA 1DCZA 3K81C 4BBRB 4DK1A 1VQ5A 4A76A 3WOFA 1UWVA 3K5OA 2NVQH 1YNND 2J4XA 4JI5Q 2NVYH 3MZ5A 2A68C 2HDLA 1STAA 3AYHB 2DGYA 1SMXA 1N33Q 1TS3A 2YTVA 1HFGA 2ZJQA 2E2IB 1X9NA 4YHHQ 4G7HC 1IBLL 1VQ6A 1Q90A 4B08A 4JI0Q 1Y1VB 2AQ2B 3CD6A 1AN8A 1GHKA 3SR1A 3C1EA 1SJHD 3F2BA 3HOWH 2XVSA 2G9HD 4UP8A 3HOVH 1Y8PB 4FXKC 4F87A 5KGUA 5IT9L 3KBGA 1EUJA 1TQOA 2E76C 1B7YB 4KHPL 5FLXE 2JA6H 4K2KA 2R92G 3CCSA 4LF5L 3HRZC 3NTIA 4YWLA 5JJIA 1H9SB 4HJAA 5CGKA 4K0KQ 1MSGA 1Y1WH 1SMYD 4X3TA 2B63G 1CA6A 1OXXK 1YNNC 1RJTA 4C3JB 4HSPA 2WB1G 3UDGA 1ILPA 1PRTB 1S5CD 1VQCA 1VQNA 1YHBA 4JI2L 1B50A 2L55A 1N8RC 4GOPA 4G4KA 3JAMc 5LMNW 4G7ZC 3CC7A 3W3AA 3Q24A 3M7NA 2QCPX 1HJPA 3O13A 5M3FB 2HHHL 2R7DA 1BBUA 2E8GA 1I6HH 5IYCG 1LTSD 2CW0C 3I72A 1PH4A 5EPLA 1D1IA 2JA8G 4JI4L 2F0KA 1EEFD 4L5RC 3NEMA 4CJ1B 1BVSA 2FMCA 1EIHA 2B2VC 4CKCA 2QDBA 2L15A 3H0GB 4K5WA 1STNA 4DXGA 1IBKL 3GTPH 1IL8A 1HQRD 4ZKCB 1LUZA 4B9WA 4C3HG 5M5WB 1EL0A 3HOXH 1EY4A 1LTGD 1B3QA 4HR7B 3J80i 1ET9A 1Q1BA 1WCMH 2K5QA 2RCNA 5D3IB 1GJXA 2RVLA 1I5FA 4ME5A 4LUVA 1OXUA 2K05A 1E2ZA 1XPOA 3DLLA 2K32A 1U9RA 1E24A 1TWCH 2K5HA 2XNAC 4WRDA 4RHSA 1LT3D 5KYIA 3U50C 2BOSA 2P5ZX 3F2DA 4JPBW 3GTJB 3DUZA 2NTSA 1SAPA 3RUZA 4LWCA 5EBCA 1PH9A 1UUPA 4X64Q 1HNXQ 4LFAQ 1Y69U 1ENCA 2UUBL 1E3PA 2DUDA 2UXBL 1AE3A 5IGCA 5EKIA 3S1NB 3ER0A 3PUVA 3JC66 1HQMC
chains in the Genus database with same CATH topology
4CDCC 2DJFC 1MHWC 4CDDC 4OEMB 4OELB 4CDFC 1K3BC 4CDEC 2DJGC 1ICFB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4CDC C;  2DJF C;  1MHW C;  4CDD C;  4OEM B;  4OEL B;  4CDF C;  1K3B C;  4CDE C;  2DJG C;  1ICF B; 
#chains in the Genus database with same CATH topology
 1VQH A;  1UE6 A;  3PO2 B;  4FF2 A;  4A3M H;  2WAQ E;  2XN9 C;  2C9O A;  3L9A X;  3VR3 A;  4GKJ L;  1FYC A;  1S72 A;  4GN5 A;  4LF4 L;  1KLU D;  2JA7 G;  4B9X A;  5M5W H;  1B44 D;  4DV0 Q;  5ISR A;  1D5X C;  4ULL A;  3GTJ H;  1YIT A;  3OIQ A;  2ZT9 C;  4A3F G;  4YWK A;  3LWU A;  1C48 A;  4DKA C;  4QIW B;  1AE2 A;  3E0E A;  1ASY A;  3T1H Q;  2NN6 I;  5KYL A;  1VQM A;  2XWJ B;  2CQO A;  4BS9 A;  1K83 H;  2B2W A;  4ZAI A;  3Q8D A;  4RWS C;  1XNR L;  2F0S A;  4ODG A;  3EVQ A;  3TME A;  3I4M B;  1HTP A;  2B2V A;  3W1G A;  1VQP A;  2RDH A;  3GTG B;  1O7I A;  1CKN A;  1F2M A;  4V0B A;  4N8F A;  3K7A H;  1L2F A;  1K3B C;  2I5L X;  4QUF A;  3ND8 A;  2UUC L;  2XTI A;  4CBV A;  4R4C A;  2RHQ B;  1OXS C;  4IUV A;  2R61 A;  2MO1 A;  4MTK A;  3M4P A;  3GP7 A;  3KBX A;  3GTL H;  4R4T A;  2A6E D;  2WAC A;  4A3G H;  3OTO L;  4DNR B;  5IGB A;  2PPB C;  3CPF A;  1BCP C;  3BU2 A;  3NQI A;  3CW2 C;  3NK9 A;  3D4D A;  2Z6K A;  2F0U A;  4IPD A;  1PH5 A;  1Z9F A;  1ICW A;  4IPH A;  1PV4 A;  2HUG A;  2E2I H;  3KJO A;  4DR6 Q;  4R4O A;  1KQS A;  1ZKO A;  3S2D H;  3CF5 A;  4MZ9 A;  3GDE A;  4OWT B;  1U4M A;  3KOJ A;  1CKN B;  3PCO B;  4X65 L;  4ZRZ A;  3GTK H;  4A3C G;  1JOO A;  4IO9 A;  1F9S A;  2NZ1 D;  3QJY A;  1ROD A;  2AUK A;  2ENB A;  4Y7N B;  1GUS A;  5M3M B;  2D9U A;  4H0L C;  1PZK D;  1JB3 A;  1RKN A;  3PUZ A;  1DJR D;  3KF6 A;  4IFD G;  1U4P A;  3SGI A;  1LT5 D;  3QB3 A;  2Q8R E;  4V19 0;  4DAV A;  2MJ8 A;  5FJ8 H;  1KLG D;  1FNV A;  4O0A A;  3J81 c;  1SYB A;  4B3M Q;  2BH8 A;  3D4W A;  4MN3 A;  3BZK A;  4KKU A;  3E5S A;  2UXC L;  1CI3 M;  3KF8 B;  2Z4H A;  3CCV A;  1PH1 A;  1E2V A;  4APV A;  4J8Q A;  2KCM A;  3RZO H;  4PV1 C;  2XRQ D;  1Y1V G;  4RGT A;  4CDD C;  2V4D A;  2A8V A;  3DM3 A;  2F0V A;  3U58 A;  2I5M X;  1D8L A;  4RKL A;  4DF7 A;  1STB A;  2Q2H A;  1Z47 A;  2L11 A;  5CBE E;  3RZD H;  1GHJ A;  2E5L Q;  1YJ9 A;  2RHS B;  4XDX A;  4DPG A;  2EOT A;  3IAY A;  1RCV D;  3VR4 A;  4JI1 Q;  4XYQ A;  2K03 A;  4R8N A;  1HRJ A;  1XMO Q;  1SR3 A;  2M00 A;  4P71 A;  2KOL A;  3J80 c;  4YHH L;  3H09 A;  1Y1V H;  5LL6 X;  1RD9 D;  1D5Z C;  4JI0 L;  5IYD H;  1BR9 A;  1LV9 A;  1N34 Q;  4H02 A;  3HOV G;  4JK1 C;  4JI7 L;  2ZXR A;  5CC4 A;  2KA7 A;  4IFD H;  3K5L A;  4DV7 Q;  1A3T A;  1JWS D;  3SK6 A;  1IZ6 A;  1P16 A;  4P74 A;  3PIO A;  1ZEQ X;  4OEL B;  3H3V H;  1FR3 A;  4LF5 Q;  1CKO A;  2R6G A;  4K0K L;  5C0X J;  1TS4 A;  4GKK L;  3FMC A;  1A3U A;  4HIK A;  2KEN A;  4LF6 Q;  3EQL C;  5ELB A;  1X3F A;  5EJW A;  3CC4 A;  2NWG A;  4I7Z C;  3VYU A;  5M3M G;  3CPW A;  4DUY L;  4A3J B;  2I0Q A;  4YIJ A;  4NW2 A;  1S40 A;  5IP7 G;  1VQE A;  3EA6 A;  3QO2 A;  4A75 A;  1S5B D;  3S16 B;  1MIU A;  2B2U C;  2IY5 B;  5C0X I;  2WIN B;  5D14 A;  1QVF A;  4P2C B;  2X69 A;  3HOX B;  5I6W A;  2OEO A;  2G5D A;  3HKZ G;  3QOL A;  5EKK A;  5GAH C;  2B2Y A;  1CQF A;  3WOE A;  3PO3 B;  1HHV A;  2JXM B;  3F2U A;  2Z8L A;  3TRZ A;  1G6Z A;  1S5E D;  2WAQ B;  1R4Q B;  1M4V A;  3BVM A;  3R8B A;  1BNZ A;  1PYB A;  1VQF A;  4OO1 I;  3VA7 A;  3M7G A;  1B9N A;  3PGZ A;  1DOM A;  1SNM A;  3S1M B;  4O1N A;  3B6Y A;  1AW7 A;  1JJG A;  2A6H C;  3I4N B;  4LF8 Q;  1VS0 A;  2UUA Q;  5COR A;  1DM0 B;  2DJF C;  4KY6 A;  1SNQ A;  1PLF A;  2PW7 A;  2PW5 A;  4NMZ A;  2CH4 A;  4XT3 B;  3MC0 B;  1PFN A;  2EE1 A;  1A63 A;  4ZK9 B;  3GTQ B;  3N52 A;  4LF7 Q;  2PNH A;  4F7X A;  4A3J H;  1A8V A;  4A3D B;  4A3B G;  3K8A A;  2NVX H;  3M4O H;  3FHW A;  4KLK A;  2DY8 A;  5C4Z A;  2F4V L;  1F9R A;  2E2H B;  1VQG A;  1G2S A;  3PIP 3;  1M8A A;  2BDN A;  4X6A H;  3SVM A;  1E1O A;  4OIK A;  4PZ6 A;  4X66 Q;  1HPC A;  5C3X A;  5F2D A;  3L2P A;  2YTX A;  4NXN L;  1F2Z A;  3A7L A;  4HJ9 A;  4XQQ A;  3H0G G;  4OX9 Q;  3VDY A;  2F4I A;  3CRL C;  1N32 L;  1C8C A;  4IQZ A;  4B3R Q;  1XTC D;  1X3G A;  4NP5 A;  4JBK A;  1H9S A;  5EQ0 A;  4KKT A;  4J1M A;  3HS0 C;  1K83 B;  2A6E C;  2D0P A;  4DAM A;  1X55 A;  3MWY W;  1JOQ A;  2SOB A;  4L5Q A;  4A3D G;  4JI8 Q;  1EU3 A;  3WDN A;  1LTA D;  4FF4 A;  4IUP A;  1Y8N B;  1TY0 A;  1A62 A;  2F0E A;  2WV6 D;  3BDO A;  1AEX A;  2F0F A;  5C4X B;  3OIP A;  2AWN A;  1JOK A;  2YYZ A;  1IW7 C;  2MNA A;  3DEO A;  5DM7 3;  5JJL A;  2F0L A;  3F8T A;  1N33 L;  4KJN A;  2NVX B;  1JQY D;  1PVO A;  5ELF A;  2EY5 A;  2F0M A;  3KLW A;  1UEA B;  1VF7 A;  4EGV A;  4PZ7 A;  1GUG A;  4ZCK A;  1QG7 A;  5IYB H;  1PH6 A;  1EFI D;  3SK4 A;  3I4L A;  2AHO B;  1MD2 D;  1L0X B;  1GM5 A;  1HCZ A;  1TWH B;  2ID0 A;  1EWI A;  5AFW A;  3BVZ A;  4XQN A;  2L4N A;  1RDP D;  3BS1 A;  2CWP A;  2JA7 B;  1RIP A;  4JI3 Q;  1HH2 P;  2F0O A;  4HCS A;  4A3F H;  2HIV A;  4ABN A;  1EYC A;  3J81 E;  5L37 A;  1TWA B;  2XSC A;  4LF9 L;  2K5N A;  5EBD A;  4AYB B;  2WFW A;  4LFB Q;  5CV8 A;  5ELC A;  1J9O A;  3PF4 A;  4A3L H;  4JG2 A;  2SDF A;  1IKM A;  4OWW B;  4H7B A;  3T53 B;  4DR6 L;  2RDF A;  2A6H D;  2EYL A;  4EQO A;  4IPG A;  1S5F D;  4KJO A;  1QWY A;  5IP9 H;  2JN4 A;  1PMR A;  2UXD Q;  4IJH A;  4AIM A;  1GUW A;  4A3E B;  1YNJ D;  1XJV A;  3TS2 A;  4DR2 L;  1LT4 D;  2LXK A;  4U67 3;  1CZW A;  2K33 A;  4KI0 A;  2O5I C;  4BXX G;  2B3G A;  3K7U C;  1RL2 A;  1JMC A;  1EOV A;  5J1Z A;  1NMG A;  4RFB A;  1HNW Q;  3J80 E;  1NNX A;  3AFQ A;  3K0X A;  2B2Y C;  3PO2 G;  2IX3 A;  1YNJ C;  1NMF A;  3MXG A;  4A3M B;  3L0O A;  1A2U A;  3M4O B;  4R4Q A;  4BA1 I;  2F0G A;  1GUO A;  1NE3 A;  2I5H A;  3HFZ B;  3CME A;  2C5C A;  4QQB X;  2H5X A;  4RKB A;  5E7N A;  3R93 A;  2L1B A;  3NWS A;  5I9P A;  1JE4 A;  3F2C A;  3JAM E;  1IBM Q;  3CQZ B;  4NPS A;  2VUM G;  2NB0 A;  1X3P A;  4KHZ A;  4LNQ A;  3VR6 A;  3OW2 A;  1Z7T A;  2AUJ D;  2EXZ A;  1SNC A;  3G48 A;  3MXN B;  3CCM A;  3P7J A;  3CCL A;  4E6I A;  1MJE A;  3A54 A;  5D65 A;  5COY A;  2WII B;  4UP7 A;  4RAU C;  2ES2 A;  1J6Q A;  3VR2 A;  1VMP A;  4L6T B;  1VQ7 A;  2E5L L;  4DV4 L;  3S1M H;  3I8Z A;  3OHX C;  3D6W A;  1WTW A;  4C3H B;  1MJC A;  2EY6 A;  3TRE A;  2NVQ B;  3BJU A;  3G6J B;  1LM0 A;  3SDZ A;  3U9O A;  5IGE A;  4J15 A;  4CJ2 C;  2ZM6 L;  2R3Z A;  4OO1 G;  1I50 B;  1WTQ A;  1NCV A;  1H9M A;  3BYT B;  5IT9 c;  5LMN Q;  1L0Y B;  1I4R A;  1BF4 A;  4UY8 C;  4WJW A;  1CQV A;  2XWB B;  4B3T Q;  3GTM H;  3UDX A;  2F1M A;  3DWQ A;  2F0P A;  4X3S A;  5ELD A;  2F0Q A;  1O80 A;  1PZI D;  5C5L A;  2QKI C;  3GTP B;  3JAM i;  2BA0 A;  2FMM A;  4IUQ A;  3A8J E;  1H9R A;  1J5E Q;  2FXQ A;  2Y0S B;  3CKI B;  1VQO A;  1HNZ Q;  4WJ3 M;  1ENA A;  1U5K A;  1G8Z D;  4HMI A;  5M5X H;  1HXY D;  1DYQ A;  1SMY C;  4JYA L;  3K80 C;  2F0N A;  3QIA A;  1X6O A;  1EYA A;  2A68 D;  2E2J H;  2DJG C;  2PO4 A;  4PNY A;  5AJ3 L;  3A8I E;  2K5V A;  2WB1 E;  2DNC A;  3G71 A;  1TWG H;  4DUY Q;  4IUU A;  4GS3 A;  2AQ1 B;  4C56 C;  1PTO F;  2NN6 G;  3J7Y W;  3W5O A;  2SEB D;  2A69 C;  4RH6 A;  5BN5 A;  1BCP B;  3WWV A;  1I4H A;  3TEH B;  1D2B A;  1PTO B;  4A93 H;  1F9P A;  4RMF A;  5LMU L;  1SE8 A;  4R9W A;  3E0J A;  2JA6 G;  2E2D C;  5HUR A;  1HR0 L;  1SE4 A;  1YNX A;  3GV6 A;  3NBI A;  4DK3 C;  3F1Z A;  3TP6 A;  1PYW D;  5A35 A;  1RTO A;  1F2Y A;  2EYH A;  3RZO B;  1SYG A;  3ONA B;  4BY7 H;  4P73 A;  1QE6 A;  1ASZ A;  2E75 C;  2KHI A;  2OWO A;  4I7A A;  2KJX A;  5EAY A;  5IY0 A;  4N9P A;  2WP8 J;  2B2T A;  4XT1 B;  4LF8 L;  4OHJ A;  1PTO C;  4QMG A;  2Z6B A;  3TZD A;  5C3E G;  5C4J B;  4DFA A;  1Q86 C;  4G57 A;  1CHP D;  3G4S A;  3NTK A;  4TRD A;  4POF A;  1YEZ A;  5FLX c;  2F0D A;  5JEA G;  2GN5 A;  1Q81 C;  3FPU B;  2EYJ A;  2J7Z A;  2JA8 H;  4A3L G;  4QY7 A;  1FJG L;  3MVV A;  2M2L A;  5IYB G;  2PQA B;  1EYG A;  5ELN A;  1XPU A;  4BY7 B;  3A8K E;  3GTM B;  1NY4 A;  3CC2 A;  1AP0 A;  2L0C A;  2B29 A;  3KDF B;  5CR3 A;  3NEL A;  5G3L F;  1CM9 A;  3UDF A;  5K5P A;  2R7F A;  5J3B A;  5C4X H;  2EY1 A;  5FO9 B;  1QJO A;  3OW7 A;  1DOK A;  3X3M A;  5C44 B;  3U4V A;  3J81 j;  2UXC Q;  2R93 H;  3IFT A;  3RMH A;  5C44 G;  3RLN A;  2K28 A;  1V1Q A;  4KK7 A;  4KN4 C;  4NB3 A;  2KBN A;  4QJF A;  2TMP A;  4MTN A;  2BH2 A;  3CCR A;  1K0S A;  2TSS A;  4EQ5 A;  4BY1 B;  2L9H A;  1PXU A;  2AMC B;  4A3B H;  5J22 A;  2OTJ A;  1X3E A;  2QGQ A;  3MTS A;  3LNN A;  1PFB A;  3JAM L;  1K8G A;  2JJQ A;  1V1O A;  1WJJ A;  2F3W A;  3RLF A;  1HUN A;  4YCU A;  1B4O A;  2VUM H;  4XXE A;  4K6L A;  3HOY G;  4AH6 A;  2RDG A;  2JA6 B;  1NSN S;  3NBH B;  2K6A A;  1XMO L;  5C3E H;  4L8J A;  5FO8 B;  4IPC A;  2H1E A;  4GKJ Q;  1CHQ D;  1QNU A;  5C4H A;  1I94 L;  3S2H H;  4GNX A;  1EY6 A;  3NUC A;  1SYE A;  2F3I A;  4A3K G;  2ATW A;  4BA2 I;  3EFX D;  3ERQ A;  1ILQ A;  1OTC A;  1EU4 A;  4TSS A;  5KNC A;  4A3D H;  3OSO A;  3LGJ A;  2LY7 A;  3I73 A;  2HT1 A;  2NVT H;  3Q23 A;  3GO5 A;  4PMB A;  2RKS A;  4YY3 Q;  3GTO H;  2BE5 C;  3EN2 A;  1FGU A;  4WFN 3;  3HOU B;  3G7L A;  5JJZ A;  3RN2 A;  3HKS A;  2HDM A;  2OQK A;  4PMW A;  4CGY B;  4BY1 G;  2NBF A;  1VQB A;  1FL0 A;  1TII D;  2EYP A;  1SFO H;  4LK1 C;  5FKA C;  4DR1 L;  3AQQ A;  4UHV A;  2UUC Q;  3J7A V;  5JOB A;  4K2L A;  5IYD G;  4KHP Q;  2Q8T A;  3OMC A;  2QDL A;  2WKC A;  5J39 A;  3NWT A;  1WTP A;  2Z0S A;  1HTL D;  4A4I A;  1QOH A;  4CJ0 B;  2EZV A;  1IXR A;  3T56 B;  2UXD L;  5ELO A;  5C44 H;  1T9H A;  3CQZ H;  4A3F B;  3OYY A;  1W6J A;  4BXX H;  1EY9 A;  1AFP A;  4YWM A;  1B70 B;  3TBI B;  2KUM A;  1QVC A;  3C46 A;  1HNW L;  1TWF H;  5I6Y A;  3HEJ A;  2LKV A;  2IW3 A;  2D2C C;  1UAP A;  2N88 A;  2IPK D;  4POG A;  1O7L A;  2KVM A;  4HJ7 A;  2LFN A;  3NEN A;  4RGO S;  1HZB A;  3GV3 A;  3QWN A;  2QEJ C;  5TSS A;  1VQ4 A;  3C2P A;  5K36 H;  5T1G A;  4DV6 L;  3VA5 A;  1KNA A;  1JCK B;  1IL2 A;  4C3J H;  4A93 G;  4AQY Q;  1Y14 B;  5IP9 G;  1A3V A;  3HOW G;  1EQV A;  2RSN A;  2PYK A;  5BN4 A;  4KMU C;  3S2H B;  1KAW A;  2F0T A;  1X54 A;  2UU9 Q;  4A3M G;  2EPB A;  2B2U A;  2R92 H;  1JWM D;  1EEI D;  3NHH A;  4F8M A;  4HJ5 A;  3HOY B;  3HOV B;  1MHW C;  2HQL A;  2Q2T A;  1IHZ A;  4HJ8 A;  3D31 A;  5DLQ E;  3S16 H;  3U9S A;  3P1H A;  2A69 D;  2MFI A;  5NUC A;  2JEA I;  2YU9 B;  1AZP A;  1SN8 A;  1I3Q B;  3QOJ A;  3E9H A;  4LFC Q;  3AU7 A;  3PF5 A;  3S1R B;  1I4Q A;  3Q6S A;  3EBE A;  2PZU A;  4QB4 A;  2VW9 A;  1M1K C;  4LMQ D;  1H95 A;  1HA6 A;  2RSO A;  3S1Q H;  3N6R A;  1L1O A;  3I55 A;  1QVG A;  2L12 A;  4ZUI A;  1XX8 A;  3L3O C;  4A3K B;  1XMQ Q;  5GAG C;  1LLR D;  3TP7 A;  1FNW A;  1KXL A;  5FLM H;  5HY6 A;  1N36 Q;  4X64 L;  1YJN A;  3D0F A;  2HCC A;  5IOC A;  3TP8 A;  4DUZ Q;  3ULL A;  1PFS A;  1A2T A;  4DV5 Q;  3K58 A;  2VQF L;  4M8A A;  1CTM A;  1HNZ L;  4HID A;  1PH2 A;  1K28 A;  4DR3 L;  1I3Q H;  2IX0 A;  1N9W A;  3PQI A;  1S3O A;  1BXT A;  1KC8 C;  1PA6 A;  1WI5 A;  1EY8 A;  1B3A A;  4RG1 A;  2BA1 A;  1K9M C;  4JV5 L;  1FGB D;  4QUC A;  1YHQ A;  4LF4 Q;  1PRT F;  2ZTD A;  1C9O A;  1C0A A;  1KAB A;  3J81 i;  3C3L A;  5IOD A;  1CFM A;  1PRT D;  1EWH A;  2B8F A;  2B63 B;  2RF4 A;  3KK7 A;  3CP0 A;  4XTC S;  3I91 A;  2QA4 A;  2EYF A;  4JI5 L;  1QB5 D;  3A74 A;  4UPA A;  5DNF A;  2DNE A;  5K36 G;  2V1C C;  1S5D D;  3RZD B;  2KQ3 A;  1V9P A;  4RGN A;  3GD7 A;  3LWE A;  3RD4 A;  2ZXP A;  4O2D A;  4P75 A;  1XNR Q;  1X65 A;  4KKS A;  2VL6 A;  4KN7 C;  2IWH A;  4CKB A;  4LF9 Q;  3DEP A;  2R93 G;  4XQJ A;  4QIW E;  2Z4I A;  3DMU A;  4IOA A;  1STH A;  1ENF A;  3UE1 A;  3MEH A;  1CZG A;  2BCO A;  1TWC B;  1DOL A;  3I56 A;  3ZYY X;  5M9O A;  5M3M H;  1NR2 A;  3NBH A;  3IKJ A;  3PIP A;  1HFN A;  5KRU A;  1EIF A;  1KRS A;  2VXW A;  3Q22 A;  1ML0 D;  2BE5 D;  2DY7 A;  3V96 A;  2JA5 B;  1WD1 A;  5HGT A;  4JBM A;  1EWC A;  4FF3 A;  2EJF C;  1TY2 A;  4S3S A;  2Y0S E;  3MEF A;  3TN2 A;  3K57 A;  2D5D A;  1B2T A;  3HZX A;  5IE8 A;  2Z1C A;  1DZ1 A;  3MHB A;  1H9K A;  4CHT B;  1XNQ Q;  4EQN A;  1GKH A;  2CQA A;  4DXF A;  4FDB A;  3CCJ A;  4DR7 Q;  2A1A A;  2LMC B;  4N8X 1;  4FP5 D;  1CUK A;  3IFD A;  4BWG B;  2K5W A;  4QGU A;  4IZ8 A;  2UUA L;  2LS0 1;  1VQA A;  2E2J B;  5GAD C;  4IAL A;  4GOP C;  4OGQ C;  1F2L A;  1PZJ D;  5JAV A;  1E2W A;  2CH4 W;  4RA8 A;  2AWO A;  5IGD A;  3H3V C;  1L1O B;  3MA2 B;  1VQ9 A;  4HTH A;  1C7Y A;  1AZQ A;  4KY7 A;  1WTV A;  2J0T D;  5A2Q E;  4GLA C;  1YZ6 A;  1R4P B;  5JVG 3;  5C6A A;  2K7V A;  2PI2 E;  2F0W A;  4MNO A;  3SHL A;  1HR0 W;  4PQX A;  3KF6 B;  2FJ2 A;  3A5Z B;  1IBK Q;  2R7Z G;  2KHJ A;  2WKD A;  1B9M A;  4A3G B;  3J7A 5;  1VQK A;  1MBY A;  1VQJ A;  4C3I G;  4NXN Q;  3TP5 A;  2B2T C;  1D6E C;  1IW7 D;  1Y8O B;  1I4G A;  2F0I A;  4DV4 Q;  3CRK C;  1G2T A;  3H0G H;  1P8L A;  5M5Y H;  1VQL A;  1NJI C;  4KY5 A;  3VYR A;  3BYY B;  3FRP B;  4U68 A;  3M9B A;  1TVX A;  3P20 A;  1HZ9 A;  2ZM6 Q;  2R93 B;  3HOZ G;  3SK8 A;  4HAE A;  1I4X A;  1TKW B;  1WOC A;  1SXT A;  3K0Y A;  2ZJP A;  4A3K H;  4NXM L;  3I4M G;  5H1S E;  4PG3 A;  1W3S A;  3I7F A;  1G91 A;  3T1Y Q;  1IYV A;  1GUT A;  2ALY B;  2OXP A;  2RQX A;  1CT1 D;  3K6O A;  1X56 A;  2UXB Q;  1TT2 A;  5EPJ A;  1XYI A;  4Y7N H;  1KRT A;  5A2Q L;  1UE5 A;  1STG A;  3E6Z X;  2O2L D;  4GLV B;  2ZTE A;  3R2T A;  1EOT A;  3U4Z A;  3G6E A;  1KD1 C;  2PMZ B;  5FK9 C;  3URY A;  3GTK B;  1I6V C;  3KDF A;  4K5V A;  1K8A C;  5IWA L;  2XGT A;  2DN8 A;  4ILW A;  3BG3 A;  3RN5 A;  3HOX G;  3DXJ C;  4DV0 L;  4KHV A;  5I2X A;  5C0X H;  3FVQ A;  5AJ3 Q;  3S1N H;  2R7Z H;  2EDG A;  3MXU A;  1U4R A;  1KHI A;  4DV7 L;  3PUY A;  4Q0F A;  1SYD A;  3HG9 A;  4XYO A;  3RR5 A;  1A6X A;  3FPP A;  2IT1 A;  3GTL B;  1BBW A;  4LFB L;  4A3C H;  1VMC A;  3CAM A;  4LF6 L;  4CDC C;  5M3F G;  5JPN C;  1GO3 E;  3I70 A;  4AYB G;  2E74 C;  1VCI A;  1G51 A;  3SK5 A;  3LX0 A;  1B1Z A;  1IYU A;  1SYC A;  1R9T B;  1ZYR C;  4EVO A;  5FLM G;  4BBS G;  3FKI G;  2CHB D;  4FYD A;  2O4X A;  2MQH A;  3J81 L;  2GVB A;  1SJE D;  1B53 A;  4DV6 Q;  3E3X A;  3ERO A;  3QG1 A;  4AQY L;  1L1O C;  1K8M A;  1EZ8 A;  2PQA A;  5ELE A;  2F0J A;  1BQQ T;  2YTY A;  2SNM A;  1FVI A;  4BY1 H;  1GD7 A;  1Q8K A;  2JA8 B;  5C0X G;  2HIX A;  4N9T A;  4JI6 L;  5EKL A;  4L5S A;  1YJW A;  5T1I A;  5CMD A;  3SE0 A;  2VQE Q;  2N78 A;  4BY7 G;  4OXP A;  4GLX A;  3I2Z A;  4DR4 L;  4BBS B;  1IBM L;  2HQE A;  2QW7 A;  1DD2 A;  2I46 A;  1V1P A;  3ITP A;  3STB C;  2NVT B;  1NUC A;  4LF7 L;  3S1R H;  2JA5 H;  4DA2 A;  1ESR A;  2A19 A;  3A7A B;  3DM1 A;  1BCP F;  1GUN A;  2F4V Q;  1SND A;  3CHB D;  1E0B A;  5JVH 3;  5JEA H;  1V1P B;  2JSO A;  2B8G A;  1B8A A;  4UAI A;  1PH3 A;  5BR8 Q;  2ZTC A;  2PMZ E;  1CA5 A;  2CCZ A;  2HD3 A;  1OXT A;  3NSW A;  1QNK A;  1PDQ A;  1YI2 A;  4OIJ A;  2IHF A;  1GXD C;  1O7Z A;  1YHA A;  2RBM A;  4DUZ L;  2OF1 A;  1SSO A;  3C1F A;  2VY3 A;  5E4W C;  4DV5 L;  2H4O A;  4LUO A;  4IUR A;  2VQF Q;  3NP8 A;  1SLJ A;  1TXY A;  1HA5 A;  1E1T A;  2SNS A;  1YIJ A;  4FXD A;  1FD7 D;  1SNO A;  1LO5 D;  4XIG S;  2VB3 X;  4DAY B;  4IN3 A;  4RCN A;  1HNX L;  3S1Q B;  1II3 A;  3W2D A;  1ET6 A;  3I3C A;  4BBS H;  5CV5 A;  4TVA B;  2NVY B;  1U4L A;  2KEC A;  3FDT A;  1S4Z A;  1TR5 A;  2M9V A;  4A3J G;  1J5E L;  4X62 L;  3MXN A;  1WD0 A;  4YY3 L;  1QZG A;  4IFD J;  3PSI A;  2PCF B;  2JA7 H;  2N3S A;  4JYA Q;  1RTN A;  1T5E A;  3CMA A;  3HOY H;  2I07 B;  1QUQ A;  3ERS X;  2VB2 X;  1LTR D;  3HOU H;  5C4J H;  4QF4 A;  1N34 L;  2ICE C;  2VNU D;  2QF7 A;  3H6M A;  2Y0S G;  3I4N H;  1VQD A;  4A3I B;  2AQ3 B;  3I4M H;  3IRB A;  1JR0 D;  4WJ4 A;  2A5H A;  3K5M A;  2GA4 B;  2D62 A;  4JI3 L;  4HSV A;  4DGZ A;  2PZW A;  4YCV A;  4C2M H;  1IBL Q;  3M4Y A;  4DK6 C;  4GKK Q;  2NZH A;  4KD4 A;  4TQU S;  1MGS A;  1KIX A;  2E2H H;  1DON A;  1LTL A;  2K5D A;  5KIX A;  1XPR A;  1EY5 A;  1K0R A;  3BZD B;  4MIU A;  1WFQ A;  5C3E B;  1SEB D;  1WTR A;  3MXP A;  3X3N A;  1PRT C;  4Z9C B;  2R92 B;  4IUT A;  3A56 A;  1WCM B;  1K73 C;  4JBW A;  2KHS A;  3BDC A;  4DR7 L;  4ID6 A;  5EPK A;  3OPO A;  1K8O A;  1SE2 A;  2X6G A;  1Y1W B;  5EGT A;  1L0W A;  3OTO Q;  1O7Y A;  1I6H B;  4WOR A;  2B63 H;  2IX1 A;  2K14 A;  1T5X D;  5CV9 A;  1MI2 A;  3DWP A;  2ICI A;  4EQP A;  1C4Q A;  1F9Q A;  5CYU A;  2VUM B;  3Q0A A;  1D7Q A;  1IKL A;  3TQY A;  3HOW B;  2NYZ D;  1FJG Q;  2R7Z B;  2LSS A;  4DV3 Q;  1PYS B;  2EJM A;  1PFM A;  1YBY A;  1STE A;  1CKM A;  2OCE A;  4R4I A;  4IJL A;  4ZLT F;  4X65 Q;  1SNP A;  2CWA A;  4FVM A;  2MPM A;  3TS0 A;  1R9T H;  4GZY C;  4OL7 A;  2N49 A;  4BBR H;  2JQO A;  3DHQ A;  4JI4 Q;  4DV1 Q;  4B3S Q;  1EIY B;  4FNF A;  1FNU A;  1HZA A;  1M90 C;  4X3K A;  2JA9 A;  3P75 A;  3MFY A;  1PHJ A;  2NZO A;  3ND9 A;  4HIM A;  1QZH A;  1BO0 A;  4C3H H;  3HOZ H;  3W1B A;  1KTK A;  4A3E G;  1HUM A;  1XMQ L;  3NTH A;  4DN4 M;  4NXM Q;  1NBW A;  1XXG A;  2KCN A;  3E9I A;  2QEX A;  1N36 L;  1JOR A;  2KEE A;  1I50 H;  1Z6H A;  5BN3 A;  2F3V A;  1WCM G;  2PI2 A;  3M85 A;  3L7Z C;  3GTG H;  4B3R L;  3IL8 A;  3J7Z C;  1MSH A;  3NQT A;  4DR5 L;  4C3I H;  5E4X A;  3SEB A;  4Q5V A;  4DV2 L;  1AH9 A;  2JEB I;  1X32 A;  5D3D A;  3T16 A;  4K8J A;  4EX5 A;  2EY2 A;  1EY7 A;  3H3V I;  3FEW X;  2N8N A;  3T51 B;  1I94 Q;  4JI8 L;  1KAA A;  1VQ8 A;  4K8I A;  4LFA L;  1BDO A;  2UUB Q;  1D5M C;  2FHT A;  3KFU A;  4JOI C;  4HN7 A;  2ASB A;  2IJ0 A;  1ZXT A;  5GAE C;  4HCE A;  4HIO A;  1NR4 A;  2Q8I B;  4JI1 L;  3HGB A;  3EIV A;  4GOP B;  1TWG B;  4FO2 A;  2Q2U A;  2EYO A;  1VF5 C;  1Q7Y C;  1BKB A;  1TU2 B;  3OWE B;  4FF1 A;  1RF2 D;  1TWA H;  3UE0 A;  1PH7 A;  1Q1E A;  1KDC A;  3PMF A;  3NXW A;  1A15 A;  1E22 A;  2X6L A;  3ZJY C;  4A93 B;  3OOC A;  3GTO B;  4DR1 Q;  5E1F A;  2LXJ A;  4DNI A;  1V8Q A;  1EYD A;  2Z6K C;  1TWF B;  3H15 A;  2D0O A;  1TS5 A;  3S14 B;  3ULJ A;  3FKI B;  3NE5 B;  1EZ6 A;  1G29 1;  1X3Q A;  1V43 A;  1JE5 A;  3TSS A;  4DU9 A;  2A74 C;  3H94 A;  4GN4 B;  4RCO A;  1HR0 Q;  3R2I A;  1W2B A;  2IHE A;  1IYJ B;  2KCT A;  1JJ2 A;  1LTI D;  2YV5 A;  3KLS X;  3ULP A;  3VYT A;  4ZQ3 A;  3T13 A;  4JCV E;  3OWF A;  3PUW A;  4P72 A;  4ZYS A;  3I4N G;  2GVA A;  2IL8 A;  1D1K A;  2CW0 D;  1Q3L A;  5JPM C;  4YCW A;  4JI6 Q;  1PTO H;  2JP1 A;  2B39 A;  5M3F H;  3K59 A;  2EXD A;  4OEM B;  2WAQ G;  1CK1 A;  5FO7 B;  1Q12 A;  3VYS A;  4A3I H;  4CDE C;  1F77 A;  1DXM A;  1UE1 A;  1PH8 A;  2B2W C;  4DR2 Q;  4GN3 B;  1QUQ B;  2EJG C;  3AEV A;  4F88 A;  4HMJ A;  4DR4 Q;  4K6D A;  4OON A;  4I65 A;  3UDI A;  1KL9 A;  3S2D B;  4MHE A;  2NN6 H;  3A0J A;  2JE6 I;  4R8I A;  4JI2 Q;  3M3Y B;  3V2T A;  3R3O A;  1EY0 A;  1A0I A;  4JOI A;  1ONL A;  1BCP D;  2UU9 L;  3H91 A;  3CXC A;  1G6P A;  4O42 A;  2EYM A;  2FFK B;  3CCQ A;  4IFD I;  3RNU A;  1ZYR D;  4RHR A;  3S17 H;  5BR8 L;  2F0H A;  4PMC A;  4KV6 A;  2HHH Q;  5E3F A;  1JWU D;  1HZC A;  4LJZ C;  1RHP A;  2MO0 A;  3QR8 A;  2N55 A;  4H13 C;  3V05 A;  4FXG C;  3K7A B;  2EQS A;  3CCU A;  2CKZ B;  4LFC L;  5I9O A;  2MP1 A;  5CBA E;  2KCC A;  3BDL A;  1UNS A;  3KLS A;  4K5X A;  4LW1 A;  4TKO B;  4G7O C;  2BDO A;  4CDF C;  1LAB A;  3D6C A;  3I90 A;  2Z9H A;  2O5J C;  5DM6 3;  2K01 A;  1H9J A;  3PO3 H;  1W6K A;  1XTD A;  1LTB D;  4OX9 L;  3T1Y L;  3CU7 A;  3DWA A;  3S14 H;  3S9W A;  1N32 Q;  4M1U B;  1XWE A;  5GQO A;  4CKE A;  2EVB A;  5IT9 E;  2K1B A;  3TZU A;  4UP9 A;  1KNE A;  4KTA A;  4RGM A;  2EIF A;  4GNX C;  4X62 Q;  2WB1 B;  5FLX L;  1EQR A;  4DR3 Q;  1PTO D;  1SYF A;  4KD3 A;  4NKL A;  2JYO A;  1QCB D;  2QIL A;  4JV5 Q;  4NDX A;  5LMN L;  2G9D A;  5IWA Q;  2PQE A;  2XIW A;  1NTG A;  5IGG A;  4A3E H;  3AFP A;  4ALP A;  5GRO A;  3S15 H;  1E7Z A;  3TDQ A;  2RCF A;  4QL5 A;  4IOC A;  1SE3 A;  4ME3 A;  4UDU C;  3CCE A;  3VR5 A;  4JVZ A;  4OWX B;  1BBX C;  3A55 A;  1GVP A;  1BOS A;  1K3R A;  1LTT D;  3J80 L;  5IIF A;  4DAY A;  4R1J A;  3BVG A;  3K5N A;  3BZC A;  5LL6 S;  5CV6 A;  4DK0 A;  3RLO A;  1JT8 A;  1SBB B;  4A3B B;  1KDB A;  2RA4 A;  1ESF A;  2AKW B;  5KNB A;  5M5Y B;  2A73 B;  4C3J G;  4IUN A;  2K4K A;  5G3L D;  4JC0 A;  1SDF A;  3HKZ E;  3M3Y H;  1CSQ A;  4JI7 Q;  4QCL A;  5KND A;  4DNT B;  1JJC B;  2OQ0 A;  3T1H L;  4A3G G;  2CFM A;  2Q2I A;  1QIL A;  3AMU A;  1BUV T;  2OT2 A;  5C5M A;  3PO3 G;  3GTQ H;  1EFW A;  5FOB B;  3PUX A;  5LMU Q;  3MAQ A;  1DGS A;  3HKZ B;  4Y52 H;  1SRO A;  3FP9 A;  1UE7 A;  2MGS A;  3GQB A;  5IYC H;  1WTO A;  4C1N K;  5LHY 1;  5C4X G;  1SFO B;  1ICF B;  3S24 A;  5JJK A;  4C2M B;  1LYL A;  2VS1 A;  3OMG A;  4L63 B;  3KF8 A;  1J8I A;  2C35 B;  1GOZ A;  3HOU G;  2NUC A;  2HCI A;  1XNQ L;  1JC7 A;  5IP7 H;  3M4Q A;  1LAC A;  3T4A C;  5I2Y A;  1SRU A;  5FJ8 G;  2JK8 A;  4DV3 L;  4X3U A;  3ICE A;  2MUY A;  1JB7 A;  3KYH C;  1NAP A;  3I4O A;  2VZA A;  3PV0 A;  3KLR A;  4LAA A;  1UEB A;  3UI2 A;  2VQE L;  4DAP A;  5JEA J;  4K14 A;  4L5T A;  1TWH H;  2PZT A;  1MKH A;  2KED A;  3EJI A;  3FKI H;  5DEH A;  5I4D A;  4DV1 L;  4B3S L;  3PO2 H;  3A5U A;  5IGF A;  2JA5 G;  1KDA A;  2PNR C;  4HED A;  2K50 A;  2L5T A;  1LT6 D;  3NPP A;  3S15 B;  4H44 C;  2YU9 H;  5CV4 A;  3PIO 3;  4JW0 A;  1Q82 C;  2XRS D;  1O78 A;  1WTH A;  2K75 A;  4LUZ A;  4C1N I;  4A3I G;  3S17 B;  1VQI A;  2CVR A;  4JBJ A;  5C3W A;  5CV7 A;  4C3I B;  2FIN B;  4DR5 Q;  4DV2 Q;  1JIC A;  3MFG A;  1VDZ A;  4AYB E;  1OO9 B;  4BBR G;  2OTL A;  3HP3 A;  1OXV A;  5KEE A;  4X66 L;  1I4P A;  3KUP A;  2NTT A;  2ZXO A;  1WVL A;  1Q8I A;  3HOZ B;  1WTX A;  1TS2 A;  4B3M L;  3J7A F;  1CSP A;  4J6H A;  3SXH A;  5HGQ A;  5DAU A;  3KJP A;  1Y1W G;  3D3R A;  4OO1 H;  3AB9 A;  1Q46 A;  2ZJR A;  2K04 A;  1EIG A;  3D8G A;  2K52 A;  2F52 A;  2MHV A;  4PZ8 A;  4ZKB B;  1YVC A;  1STY A;  2F03 A;  1EQT A;  4GNX B;  1U0L A;  3STB D;  1EQQ A;  4B3T L;  4ZUJ A;  1WYD A;  5M5X B;  3D4R A;  1DCZ A;  3K81 C;  4BBR B;  4DK1 A;  1VQ5 A;  4A76 A;  3WOF A;  1UWV A;  3K5O A;  2NVQ H;  1YNN D;  2J4X A;  4JI5 Q;  2NVY H;  3MZ5 A;  2A68 C;  2HDL A;  1STA A;  3AYH B;  2DGY A;  1SMX A;  1N33 Q;  1TS3 A;  2YTV A;  1HFG A;  2ZJQ A;  2E2I B;  1X9N A;  4YHH Q;  4G7H C;  1IBL L;  1VQ6 A;  1Q90 A;  4B08 A;  4JI0 Q;  1Y1V B;  2AQ2 B;  3CD6 A;  1AN8 A;  1GHK A;  3SR1 A;  3C1E A;  1SJH D;  3F2B A;  3HOW H;  2XVS A;  2G9H D;  4UP8 A;  3HOV H;  1Y8P B;  4FXK C;  4F87 A;  5KGU A;  5IT9 L;  3KBG A;  1EUJ A;  1TQO A;  2E76 C;  1B7Y B;  4KHP L;  5FLX E;  2JA6 H;  4K2K A;  2R92 G;  3CCS A;  4LF5 L;  3HRZ C;  3NTI A;  4YWL A;  5JJI A;  1H9S B;  4HJA A;  5CGK A;  4K0K Q;  1MSG A;  1Y1W H;  1SMY D;  4X3T A;  2B63 G;  1CA6 A;  1OXX K;  1YNN C;  1RJT A;  4C3J B;  4HSP A;  2WB1 G;  3UDG A;  1ILP A;  1PRT B;  1S5C D;  1VQC A;  1VQN A;  1YHB A;  4JI2 L;  1B50 A;  2L55 A;  1N8R C;  4GOP A;  4G4K A;  3JAM c;  5LMN W;  4G7Z C;  3CC7 A;  3W3A A;  3Q24 A;  3M7N A;  2QCP X;  1HJP A;  3O13 A;  5M3F B;  2HHH L;  2R7D A;  1BBU A;  2E8G A;  1I6H H;  5IYC G;  1LTS D;  2CW0 C;  3I72 A;  1PH4 A;  5EPL A;  1D1I A;  2JA8 G;  4JI4 L;  2F0K A;  1EEF D;  4L5R C;  3NEM A;  4CJ1 B;  1BVS A;  2FMC A;  1EIH A;  2B2V C;  4CKC A;  2QDB A;  2L15 A;  3H0G B;  4K5W A;  1STN A;  4DXG A;  1IBK L;  3GTP H;  1IL8 A;  1HQR D;  4ZKC B;  1LUZ A;  4B9W A;  4C3H G;  5M5W B;  1EL0 A;  3HOX H;  1EY4 A;  1LTG D;  1B3Q A;  4HR7 B;  3J80 i;  1ET9 A;  1Q1B A;  1WCM H;  2K5Q A;  2RCN A;  5D3I B;  1GJX A;  2RVL A;  1I5F A;  4ME5 A;  4LUV A;  1OXU A;  2K05 A;  1E2Z A;  1XPO A;  3DLL A;  2K32 A;  1U9R A;  1E24 A;  1TWC H;  2K5H A;  2XNA C;  4WRD A;  4RHS A;  1LT3 D;  5KYI A;  3U50 C;  2BOS A;  2P5Z X;  3F2D A;  4JPB W;  3GTJ B;  3DUZ A;  2NTS A;  1SAP A;  3RUZ A;  4LWC A;  5EBC A;  1PH9 A;  1UUP A;  4X64 Q;  1HNX Q;  4LFA Q;  1Y69 U;  1ENC A;  2UUB L;  1E3P A;  2DUD A;  2UXB L;  1AE3 A;  5IGC A;  5EKI A;  3S1N B;  3ER0 A;  3PUV A;  3JC6 6;  1HQM C; 
#chains in the Genus database with same CATH homology
 4CDC C;  2DJF C;  1MHW C;  4CDD C;  4OEM B;  4OEL B;  4CDF C;  1K3B C;  4CDE C;  2DJG C;  1ICF B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...