1K3UA

Crystal structure of wild-type tryptophan synthase complexed with n-[1h-indol-3-yl-acetyl]aspartic acid
Total Genus 101
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
101
sequence length
268
structure length
268
Chain Sequence
MERYENLFAQLNDRREGAFVPFVTLGDPGIEQSLKIIDTLIDAGADALELGVPFSDPLADGPTIQNANLRAFAAGVTPAQCFEMLALIREKHPTIPIGLLMYANLVFNNGIDAFYARCEQVGVDSVLVADVPVEESAPFRQAALRHNIAPIFICPPNADDDLLRQVASYGRGYTYLLSRSGVTGAENRGALPLHHLIEKLKEYHAAPALQGFGISSPEQVSAAVRAGAAGAISGSAIVKIIEKNLASPKQMLAELRSFVSAMKAASRA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Tryptophan Synthase Alpha Chain
publication title Crystal structures of a new class of allosteric effectors complexed to tryptophan synthase.
pubmed doi rcsb
source organism Salmonella typhimurium
molecule tags Lyase
total genus 101
structure length 268
sequence length 268
ec nomenclature ec 4.2.1.20: Tryptophan synthase.
pdb deposition date 2001-10-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00290 Trp_syntA Tryptophan synthase alpha chain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 1k3uA00
3S0CA 3W7IA 3W88A 4LRTA 3LCWA 4CQ9A 3ABSA 4O15A 5DLCA 2NWSA 4I7VA 1OFEA 5DBUA 1X1ZA 4TR9A 3PG8A 4AF0B 3GDRA 4UCGA 4BI7A 3W7NA 3STGA 4WD0A 4BFAA 5AN7A 3PUEA 5AHFA 3PR2A 2DZSA 2UV8G 3R8RA 4QSHA 3NA8A 1VS1A 4I9AA 4YCPA 3EXRA 3TXVA 5F2MA 4GXMA 1L2UA 1ZHAA 4N9BA 4IX0A 1LP6A 4MFEA 4M6PA 1EP2A 1WOAA 5G2WA 3Q2DA 1FY6A 3OHIA 2ZCGA 1OX4B 3G3MA 1KBJA 4MJMA 2QAPA 4A22A 2YZRA 3NZRA 3B0VC 3L0KA 4RZ4A 1ZY9A 1YPIA 2X2GA 4MYAA 4X22A 3A5FA 3LM7A 1JCMP 1P1XA 5IM51 3CT7A 3PB2A 3HGRA 5D32A 3UWQA 3ELFA 3GX9A 1A53A 5HMSA 5SWUA 1BKSA 1IGSA 1I4NA 4K38A 1S5TA 2CLMA 3KVMA 3GZ3A 3NVTA 4Z08A 4NNCA 1G4EA 1AL7A 4N4QA 2O7QA 1O95A 4N9DA 1VHCA 2A1YA 3SSJA 3GVGA 3TFCA 1H63A 1XCFA 3TFXA 5I3JA 5AHIA 2AQWA 1ZALA 4WY0F 3TQKA 1OX5A 3Q58A 5L6UA 3QW4B 2FLIA 1LRQA 1SFJA 2NLIA 3LLDA 3W7GA 3BW2A 3UD6A 5DELA 4JIPA 3P8IA 2ATMA 3VE9A 1M7PA 3MI2A 5EL1A 2HTMA 1CX9A 1F74A 4DEFA 3P67A 4FIRA 3W6YA 4NUWA 4O4WA 3M1ZA 1YLVA 1O4UA 4NJIA 4K6AA 1PV8A 3QYQA 1I2RA 2G96A 3U2OA 4PCFA 1F5ZA 1SZGA 3W1AA 3EB2A 3M5YA 1Q6OA 2A2IA 3QMTA 1TJRA 3NPXA 2CU0A 3KRZA 3F03K 1NVMA 3UWWA 4NQ1A 3L68A 3C2FA 1QPRA 4UNLA 3S9YA 3L5AA 3W7EA 4OBTA 3R13A 5TQLA 1WX0A 3W2JA 1VCVA 3SIZA 1JCJA 5AC6A 1QFEA 4OT7A 1EUAA 5D38A 2O7SA 1UASA 3MHFA 3P80A 3PVFA 3STCA 4QNWA 1DORA 5IBXC 4M19A 1PHWA 2Y61A 3LCFA 3TIMA 4UFKA 5EMUA 4UMCA 3NQ6A 3LLFA 3W7QA 1CI1A 3R12A 4R7JA 4OWGA 2P10A 5C54A 4XBSA 3B8DA 1KTCA 3UY7A 4N9CA 3P84A 1N7KA 1TREA 2WQPA 1JRBA 4K8HA 3IIOA 1YTEA 5FEXA 3KVKA 1ZAJA 2ZZ3A 1YTKA 3DFSA 3VI2A 5EY5A 5FF7A 1TJPA 3JRKA 3P8JA 4S2CA 2PE4A 4O0ZA 4RJEA 3PY2A 1FXPA 2CWNA 3G1FA 2VOMA 3WJWA 2V5LA 1LOQA 4Y90A 4Y6GA 5D2VA 3N19B 4UTIA 3W7OA 4JYFA 4MZYA 4QAIA 1SFLA 4NT0A 2ZA3A 3MYPA 2V8ZA 2Y62A 3LB0A 1IXOA 1DL3A 2DZWA 4UUIA 2Y7EA 2DZXA 2J9ZA 2NX3A 5KZEA 3VKJA 4QQ3A 3BV4A 3LX9A 1W5NA 4B5NA 1K7XA 4ICNA 3RFAA 2J6XA 1FCBA 1FBAA 4FNSA 1G4TA 4M6VA 2IQTA 1OFBA 2Y70A 3QJAA 3W3OA 3QSTA 1TTPA 1F6PA 1FWSA 4O1DA 5F2LA 4ONVA 3LTYA 1Z41A 4JY8A 3MWAA 4IMCA 1RZMA 5LGXA 1GWJA 2EPHA 4LNYA 1GPWA 2TSYA 2DZTA 3QMSA 5BOOA 2B4GA 3N34A 2PCQA 4PFMA 2GOUA 1HFBA 4JTTA 1I8JA 4YLWA 3BVJA 1TIMA 3W76A 4RLIA 3MI3A 3OVRA 3W7LA 1KFBA 3LERA 3IIXA 4UMAA 2WO5A 3DU0A 1GVFA 3HBLA 1GTHA 3NQAA 3DXIA 3P81A 4XZ9A 5EBUA 4EF8A 1Q6QA 5HWMA 1A5AA 1FX6A 1UUMA 1VYRA 3SJ3A 2DJXA 4WXYA 4XBKA 3LV5A 4AH7A 3OIXA 5K9DA 3P82A 5AB3A 2C3ZA 4RXFA 1H1ZA 1ZNNA 1DHPA 3KHJA 4O8RA 2C15A 1H62A 4GUGA 1VR6A 4JN6A 2DZPA 3L2IA 4OV9A 4NXSA 1QPNA 5CKSA 1HG3A 1W31A 3EX6A 3FKKA 4RCXA 3Q94A 3UWZA 1TV5A 4WQ6A 3FIGA 2NXIA 1IXPA 1P0KA 1JUKA 5KTLA 2VFEA 2QCDB 3IIPA 2H3DA 1P0NA 2HSAA 4ML9A 3NL6A 4YMZA 2QCGA 3VFLA 1SSGA 4GWEA 1JQVA 2NXGA 1UJPA 1QWGA 3OBKA 1KM6A 3O6DA 4ADTA 5LNRA 3ANYA 1IXNA 2VFIA 4NZFA 1KM1A 4AWSA 2VEIA 1ZAHA 4C1KA 3NQGA 3M5XA 2A85A 3WK0A 3W07A 3LDVA 5AHEA 2VKZG 3LHTA 2F84A 3USBA 3GDTA 3GXPA 1FWNA 3LTSA 1OFPA 4GUFA 2RH9A 3GNNA 3LRLA 3SY5A 1E51A 2C0AA 4WOQA 3OG3A 4UMBA 1OFQA 5CZ0A 1JCYA 2WNZA 3NXFA 3NL5A 4GUIA 2X1UA 1JUEA 2Y89A 3KVJA 3HO8A 2YXGA 3CU2A 1W37A 2V82A 4ADUA 3S5OA 3WK2A 1XDMA 2E1DA 2NWRA 4O17A 4CCCA 1TO3A 5AYZA 2F7FA 2ZRVA 1Z44A 3GR7A 4KWVA 2I1OA 3IGSA 4ZMGA 4KFPA 3UWYA 3NQEA 2I9EA 2ZRYA 3HB9A 3ZS4A 3HGJA 4R34A 3DZ1A 1KM0A 2NXHA 3KRSA 1ZJIA 1KV8A 1G69A 2CLFA 1T8XA 3I7SA 5LGZA 3WJSA 4XQ6A 2OT0A 2XFWA 1B9BA 4LVAA 1GVOA 1J4EA 1ICQA 5CSRA 1AW1A 3QW3A 2WV8A 4HNTA 3W1PA 3WJYA 2A6LA 2CW6A 3W7CA 4UTTA 4UFJA 4ZQMA 4DPQA 1LBMA 5E0KA 3BPWA 3S5NA 1L6SA 1WBHA 1P5BA 4FIQA 1F7BA 3CEPA 4KFOA 1YADA 3IVSA 5AYYA 1I2OA 1MXSA 2RHGA 2E6FA 3C2RA 1TPWA 1C8VA 4JDYA 2NUWA 2CLIA 4RX0A 4K8EA 4MZ1A 2BTMA 4O57A 3P60A 3G1DA 1JCXA 4AMAA 3NG3A 3TKFA 1JUBA 1QO2A 3T44A 5DY3A 1DVJA 3TAOA 2Y7FA 5K2ZA 4DELA 1V5XA 4WOZA 4Z1DA 4X9SA 3W2LA 3G1SA 1B57A 2FFCA 4GJ1A 1I2PA 3A9IA 1D3HA 1PHQA 1RQEA 2HS6A 4NVTA 3HG4A 5G2HA 4DF0A 4EOUA 1VQTA 2A7RA 3CWNA 4AF0A 1K03A 4JXCA 1FUYA 4IX2A 1U83A 2YSWA 1BTMA 2Q3OA 1AK5A 1WYIA 1H7RA 5AC8A 3W7PA 2NV1A 1WDWA 1H1YA 1SU5A 1F2JA 5G5IA 3V75A 2YFNA 1W0MA 2OX1A 4Y8FA 1J2WA 1TMHA 1TPH1 5G1TA 4E38A 1EIXA 5HJLA 4UTMA 2CLKA 5FF0A 5F4SA 4JTJA 3SGZA 4POCA 3DHDA 3EWYA 2VEKA 4CLMA 1OX4A 1HUVA 2CLHA 3B06A 1ALDA 4AWTA 2ISWA 2CLEA 2OT1A 1KFEA 3NO5A 3C2EA 4OHQA 5LSMA 1FCUA 3KRUA 3LCGA 3N9RA 3QH2A 1VYSX 2ZRWA 1LLZA 3KXQA 1TTIA 4JDBA 5K4ZA 1UBSA 1IF2A 2A4AA 3ABOA 4JTHA 4OE7A 5LKYA 1SR9A 2I14A 3IEBA 3TR2A 3C2VA 1LOSA 2OMAA 2QUUA 1G7VA 4O13A 1B4KA 3A5VA 5A5WA 1KM4A 1QMLA 4H3DA 3PB0A 1YYAA 5FF4A 1F73A 1DV7A 2RDWA 3W73A 1TSIA 5AHLA 1HO1A 2Z2UA 1XBZA 3HPZA 1HO4A 4FNTA 3KFTA 1EUNA 4N9EA 1LBFA 4Z0SA 1WAUA 2YCEA 3O15A 3TV8A 4CNPA 4LVBA 5CG7A 5FESA 2Z1BA 3LHYA 1OK4A 4RKAA 2VFFA 5F2IA 1HL2A 2E5CA 4AVFA 2GQ9A 3F4WA 4ZQPA 1W5PA 3DFOA 3MHGA 3W83A 2H6RA 3O07A 5DCBA 2XN1A 3KAOA 2H90A 4E2BA 3G8EA 1R2SA 4N02A 1VCFA 3W1TA 2PC4A 4CCDA 3AJXA 1TB3A 4AHOA 4PA8A 2WPBA 3S42A 2C16A 3TCEA 3LI1A 5TBOA 1ZENA 2BWGA 3EWZA 2FQIA 3HGSA 4L4MA 3W9ZA 3B0PA 1OYAA 2YR1A 3EWBX 1TTJA 4DO4A 3PWAA 3ZFHA 3MHUA 1QNVA 3IVTA 1NF7A 4MJZA 3TMQA 1K8XA 4L4LA 2DJLA 2X30A 5A8GA 1OABA 1PE1A 1XUZA 4DBDA 2V5BA 3IGXA 1QO5A 2BXVA 1PVNA 3I65A 2RKXA 4UFIA 3JR2A 5CSSA 3NM1A 3UY8A 1FDJA 3QF0A 4U4MA 3C3NA 5DXYA 1RV8A 1TPFA 2XN0A 1VLIA 5F1VA 3TU9A 1GQNA 3S1UA 3TDFA 5AYXA 4XWUA 2RDTA 3D0CA 2Q8LA 1FCQA 3FJLA 3BG3A 1OYBA 2X1SA 5AOUA 1GVSA 4IXXA 3TXZA 3L5MA 3L5LA 1Y0EA 2A7PA 2ZZ4A 5U4NA 4HNUA 4JY9A 2ZRUA 1LYXA 3S1VA 3EX1A 3W75A 4GNJA 1KTBA 3BLEA 3LCHA 4N6EA 3S6DA 3C52A 5BNKA 2ISSA 3W70A 4FNUA 2Z6JA 1YPFA 5F1UA 1XDLA 1QPQA 4RXGA 1OFRA 2ZQ0A 1OX6A 3TSBA 1AW2A 6TIMA 1MZHA 1KV5A 1KLZA 1ADOA 3RMJA 3OEXA 3NQDA 4LU0A 3I6RA 1TQXA 1EWDA 2AAMA 2ZTKA 4LC6A 1MSSA 4NX0A 4HN4A 2E6AA 4HPXA 1VLWA 2QJGA 3DH7A 3E12A 4GUHA 2ABBA 4MKNA 3DKJA 3LHVA 5LNVA 3PULA 3HG3A 2VC6A 3W7JA 3CB8A 3ZWSA 3GXNA 4ALDA 1S3HA 1OFAA 1KM3A 4JTKA 1ICPA 4FEZA 1LRTA 3BLFA 3PS7A 2VENA 5D2XA 1SO3A 5D05A 3TC7A 1SW0A 4NX5A 4U28A 1K8YA 1LLWA 4AAJA 1TRIA 1PIIA 1R46A 3HJZA 3TROA 1R30A 3CIXA 2EAWA 4UR8A 4Q32A 2NX9A 2QCHA 3UZJA 1ZFJA 3LV6A 2ISVA 1ME9A 3MUXA 3VE7A 3MBFA 1DBTA 4Z1BA 4BI6A 3EX4A 5U7SA 4LWWA 3TW7A 1GVRA 2CLOA 2WSQA 2YGYA 2EGZA 3ATYA 5C5YA 1H7WA 2ZTJA 3QQ0A 2ABAA 3DFNA 1VYPX 1F76A 4NJGA 1J5TA 4JYDA 3M6YA 4DO5A 4UTKA 1KFLA 3G0XA 1R47A 3IIZA 3L9CA 1THFD 3UWVA 2JGQA 1H60A 2GVGA 1EP3A 1W5QA 1NF0A 5I3KA 1W8SA 1JR1A 5G4EA 3EEGA 4JTIA 3W72A 3VCRA 5F2GA 4QIUA 1Z48A 3QMRA 4RZ5A 1SO6A 4IUOA 4DF1A 5DBTA 1EPXA 1XL9A 1Z42A 3INPA 4GFSA 4PEKA 2QCDA 1VZWA 3LI0A 3ABRA 1SPQA 3RNDA 3KOFA 3V1PA 3IGUA 3QM3A 3C6CA 3PBUA 2YFOA 2X1TA 3PC0A 1SUXA 5C6MA 1D9EA 3MYOA 3FLUA 1D3GA 3W2MA 4WJEA 2EHHA 4WX2A 3FYOA 3THQA 5HNRA 1FWRA 2ZZ7A 5AC7A 1Q6RA 2EKCA 4TX9A 1KFCA 2NV2A 4PC8A 5HULA 1GYLA 3MP3A 1GOXA 3NPWA 1TQJA 1OFOA 4O54A 3G1YA 1C9DA 3GKAA 4O28A 4LS1A 1N55A 3TSMA 2V30A 2KZHA 3M47A 1YXCA 1K7EA 4JX5A 1LDCA 4Z1CA 5EA9A 5BRBA 1K02A 4Y9AA 1V7YA 4GE8A 2QF7A 3U6WA 3F4NA 4LS2A 4O18A 1ME7A 2QDHA 1A5BA 3N3MA 1WXJA 1AG1O 4UFMA 3W86A 3UXAA 2JKAA 3HGOA 4LRSA 2QJIA 2Y7DA 4HHPA 4DQWA 2PRLA 1ZCOA 1H50A 1XKYA 4BK9A 4XKYB 1C29A 5I3GA 4AHQA 1R2TA 3TAKA 3N2MA 4LW7A 2W6RA 1EEPA 4PH6A 1MO0A 2BZNA 4QJ1A 5K3VA 3BGGA 3TNOA 4EVZA 1KTNA 3NL2A 3TK7A 3M5ZA 1VC4A 2QKFA 2QCEA 4ZZ9A 1KFKA 2GUUA 3B05A 1H7NA 3JS3A 4MVAA 3NQMA 2Y6ZA 2C14A 3O06A 4DPPA 2ZZ5A 3C2OA 1K3UA 4CNNA 5HR7A 1KFJA 2FPYA 1N8FA 4UTHA 4LVFA 4R33A 3S5YA 3PG9A 5EPDA 5LNSA 3FYPA 4NZJA 2G5WA 3A23A 1EP1A 4IPJA 4W9TA 5D33A 2YW4A 4JR5A 4O16A 3RK8A 3I7QA 4IJBA 1W54A 1LTDA 4JD4A 4QISA 4KKXA 2ALDA 2TMDA 5KSWA 3BGJA 2V2HA 3B04A 2ZFAA 4PL1A 3W1RA 3P7YA 4BWLA 5LNUA 2QCNA 2E68A 1A5CA 3LCLA 3IIVA 1OK6A 3DAQA 3CPRA 1I2NA 1QCWA 1TPVA 1TPB1 1OFDA 4FNRA 5CPNA 4UTJA 1H61A 5EKYA 4JTSA 3GKFA 2V81A 3G8RA 4PTNA 5D02A 2JBMA 4LUJA 3MI6A 3QC3A 7TIMA 3TJXA 4AWUA 4E2DA 4Q4KA 4OQVA 3C0JA 2JGYA 1GG1A 2P0OA 1SW3A 3NQFA 3QQ1A 5I3HA 1SO4A 2YW3A 3DBPA 3QPZA 3P5ZA 2RFGA 5KITA 3UPBA 2JKEA 1Q6LA 1FCVA 2QCFA 4K36A 5IBXA 1S5WA 4IXHA 2R14A 4DXVA 4WZHA 1W3NA 4LS0A 1W5MA 3TH6A 1LBLA 2VFDA 1KM5A 3GIYA 1MEIA 1SSDA 3G22A 4MLRA 2VXNA 5FF2A 3PBVA 1QAPA 3NQ8A 3BLIA 3ZWTA 2Q3RA 2C6QA 4FO4A 4OU1A 2J9YA 4X3ZA 4WY0B 1O5XA 3L65A 3AO0A 5AFDA 4XUGA 4LVGA 8TIMA 2GJNA 1GVQA 3SR7A 2WSRA 4MY1A 4FF7A 3RLUA 1LCOA 4JTEA 3BARA 2ZA2A 1GYNA 2V9DA 2DORA 4LTSA 2OCZA 4UXDA 3EWWA 4JX6A 4LV4A 4MYXA 3W87A 4IMFA 4FHAA 4FB7A 3STEA 1UUOA 3NR0A 3T40A 1DKWA 4Y96A 5D2WA 1W3TA 3CWOX 3HG5A 1GEQA 2H8XA 4JTFA 5I3FA 2Y63A 4CQAA 2J27A 3TE9A 4K37A 1KLYA 2WJZA 1AW5A 1WQ5A 3GNDA 3P5YA 4MLJA 1TTQA 2PRHA 1YDVA 4UC5A 1NEYA 4JX4A 3S1WA 2VFGA 4UTLA 1TV7A 4O14A 3A22A 4UR7A 1B3OA 4S1FA 2H8ZA 3WFAA 1QOQA 5MHBA 4M6QA 3IV3A 3E49A 3EXSA 2PURA 5FI8A 1QOPA 4CNOA 2E77A 3CM4A 2E6DA 3W7HA 3TJLA 3ATZA 2XN2A 3CLMA 5HQEA 3CC1A 1K7FA 1ZAIA 3FEMA 3Q37A 1EA0A 1Q3NA 3L0GA 3GDLA 2QJHA 3DFQA 2E5DA 1R2RA 3BG9A 2X1RA 2RDUA 1JCLA 4H6KA 5DCDA 4AXKA 4OV4A 3LBMA 5CZTA 3N73A 3W2NA 5D04C 5F4XA 4A21A 3NOEA 3O05A 4P2VA 4BF9A 1A5SA 3NGJA 1H7PA 3HF3A 1RVGA 2NUYA 2NX1A 2TRSA 3PSVA 2H3BA 3P74A 4NJHA 4WXZA 3I7RA 3W74A 2A21A 1PCKA 1G6CA 1JQXA 4FX6M 2YYUA 3O63A 2B7NA 2JK2A 1VGAA 2Y88A 2ZBTA 3M7WA 2DP3A 1DJQA 1YDNA 3A24A 3TW6A 4O12A 3L67A 4Z0JA 3THAA 4NJJA 1L6YA 5D2TA 1XBVA 5H91A 5K9CA 1WOBA 2ATSA 2X16A 3SW6A 3B03A 1KM2A 1YTDA 4QM1A 3H54A 3EKLA 4ZQOA 1B4EA 3N9SA 5FEZA 4JTGA 2R8WA 3WJZA 3MJYA 3GDMA 4OGZA 2ZRXA 4GC4A 4JGDA 3TX9A 1FQ0A 4E0CA 3G1VA 3UXDA 5HINA 5HWJA 3H53A 3T7VA 3G0UA 5LHEA 2Y7GA 4IMDA 3W7DA 5K4XA 4MUZA 3LXBA 5EYWA 4D2JA 2Z6IA 3L66A 4MY8A 3SZ8A 4WUIA 3EKZA 5D2YA 3EWUA 1XM3A 4ZVJA 4QITA 3E02A 3PUDA 3PM6A 3W1QA 3W85A 4AB4A 4YL2A 1IIGA 3K30A 4HIBA 1UB3A 2QEZA 2AGKA 1JVNA 1LOLA 4JEQA 1YDOA 2CZDA 4X2RA 2ZZ1A 3TC6A 3GLCA 4ORIA 1GG0A 3SGUA 5TIMA 5CPMA 4JICA 3M0ZA 4A29A 4O1CA 4JNMA 3NQ2A 5AHMA 3TSDA 2YX0A 4EF9A 4TIMA 2YPIA 3DI1A 2LLEA 1RQBA 3W1LA 1H5YA 3OVQA 4A2SA 5C2XA 4JTUA 2CZ5A 5T26A 1W3IA 3M5VA 1VRDA 2GQAA 3GAKA 3NQ7A 1OVDA 3QFEA 1RPXA 3C4UA 3T55A 4IQLA 4A3UA 1EX5A 4BWLC 1W5OA 3W1UA 2VFHA 2R91A 2V2DA 3TA6A 3YPIA 3NZ1A 1PCWA 1T96A 3HPSA 2QDGA 3PBYA 3LHZA 4JIQA 5GVJA 4NU7A 3RLVA 2WNQA 4NXKA 3IVUA 1SZNA 4O52A 1M7OA 3U8GA 3QPYA 2E6YA 3H55A 5D09A 1LORA 2JKPA 3OA3A 1F6KA 4UTWA 4MOZA 3CTLA 3S1XA 3T4CA 1OJXA 4RV8A 1H7OA 1WV2A 4UTTC 4NNBA 1AMKA 4ZQCA 4UTUA 1QPOA 4LY8A 5DY2A 2OZ0A 1LZOA 1FDZA 4NJKA 4HPJA 3W71A 3STFA 4EWND 2QUVA 1X8FA 3LRMA 5BMWA 1FWWA 3FS2A 3LBCA 1PL9A 4HNNA 4O10A 3MP4A 4TMBA 3CIWA 3LXAA 2Y85A 1GTEA 4TU1A 4TMCA 3CQ0A 1TV8A 1GZGA 3R5EA 1H7XA 4K7YA 4I7WA 1OHLA 3SECA 1JJKA 1MEWA 4ZQNA 1EWEA 2D73A 4IOTA 5E93A 5D30A 2C13A 3ABQA 3UPWA 1O60A 5KZDA 3UQNA 4GBUA 3E0IA 1ICSA 1GJPA 4UIOA 5CPOA 4N2YA 4JTLA 5AHNA 4DBEA 3DFTA 2WOQA 1KBIA 2Z0IA 4XKYA 1IXQA 3O8AA 1JCNA 3IRDA 3I68A 3FFSA 2BX7A 1VHNA 2VEPA 1TPUA 2YDAA 4LC8A 2QR6A 3UWUA 3O16A 1KW1A 3HQ1A 4XTIA 4G1KA 3B0UX 1X7FA 4FX7A 3VNDA 3FJ6A 4DF2A 1QR7A 1K8ZA 1TPDA 2J9XA 4O1AA 2GJLA 1LRNA 3BW3A 4NNAA 4KWWA 3S5ZA 3C56A 3R2GA 3EX3A 2TPSA 1DJNA 3SI9A 3G1XA 4R53A 2WNNA 1O5KA 2FPTA 1VPXA 2FB2A 1TPEA 1UCWA 3BO9A 5KZMA 4ZL1A 4O19A 4AHPA 2GQ8A 1DOSA 5D03A 2C18A 1RD5A 1VJIA 1H51A 1OF6A 1X6UA 3NDOA 1FXQA 3NM3A 1XI3A 3BW4A 1X1OA 4CQ8A 2FDSA 4BI5A 4GUJA 4XTDA 1VCGA 3NL3A 1MEHA 3UNDA 1LROA 3LHWA 3G0SA 2C1HA 2FTPA 1P4CA 1NFBA 4FXRA 1M6JA 3GAYA 3LXCA 4RZ6A 3N14A 1RQHA 1QDSA 4ADSA 2BLEA 3LHUA 3NAVA 3DGRA 1SQ7A 3GR8A 3RU6A 3MMTA 4IWWA 4HSNA 5LNWA 2FB3A 3B4UA 5HUPA 3EX2A 1OG0A 3W7MA 1HTIA 3RF9A 4PL2A 3WK3A 4DO6A 3W23A 4UFLA 3SFKA 1W1ZA 5CZJA 2WSYA 3M9YA 1JRCA 4O4VA 5BMXA 3L0NA 2J24A 5KMYA 3QRHA 3W1MA 3FOKA 1PS9A 5F4WA 5CPLA 3ZR4A 2GVLA 3QZEA 2B7OA 1CW2A 3HPXA 2PRMA 1BWKA 1AL8A 2VEMA 3LRKA 3FA5A 3FKRA 5LHFA 3W2KA 5G1YA 4JS3A 4JYEA 1F05A 4LT9A 4BR1A 1XFBA 3W2UA 3GB6A 5HR6A 3LTPA 1XBYA 4P61A 4HSOA 3KX6A 3EXTA 4RK8A 4A2RA 1W56A 3W1XA 3G24A 3LCIA 3GYEA 5FEWA 3C61A 1I45A 5H2ZA 4WY0A 1ME8A 1RR2A 1TCDA 2ZZ6A 1BEUA 2BSLA 1A50A 2P1FA 2V0TA 3S8HA 3UZ5A 1YXYA 4YCOA 3MP5A 3OVPA 4QNEA 3BK0A 1SW7A 5G4WA 2NZLA 4EIVA 2ZRZA 1LM1A 4Z1AA 2R94A 4TO8A 5G2IA 5FEPA 4HT3A 2QCCA 1T99A 4K39A 3QEZA 4LUIA 3UYCA 3BG5A 1Q45A 4IMEA 4C1LA 5BW6A 2CZEA 3NPVA 1DQWA 5J5RA 4K7VA 2J88A 1NAL1 2Q8ZA 2A5HA 2B0MA 3MO7A 1O94A 3PUOA 4O11A 1TYGA 4Q33A 4HKPA 2C19A 3O6CA 4IPIA 3PF3A 2CLLA 4GRSA 5J5DA 4IGHA 3M16A 4N6FA 3P61A 3TQ0A 3CHVA 1JULA 3N2XA 3W84A 2NUXA 5K7JA 1G4SA 4MY9A 3GXTA 5HWNA 2A6NA 3NEVA 3NQVA 5HUOA 4MFDA 2OJPA 2ZYFA 4FNQA 2CFFA 5C55A 4O0KA 3NPUA 3W7KA 3DKLA 2W79A 3HIJA 3DENA 1TPC1 4LOCA 2DZVA 3A21A 2ZZ2A 1WBJA 3GDKA 3M41A 2DZUA 3O1NA 4UNKA 2W0UA 4UTWC 3TUUA 2G95A 4LV9A 2V2CA 3W22A 1G4PA 5LZLA 3HMJG 3DHFA 4YWIA 5DXXA 3TQVA 1SZFA 2FPVA 5KINA 5DCEA 3F1QA 3KVLA 4O53A 1OYCA 1T0OA 1FWTA 3O6YX 1NSJA 4IMGA 2QUTA 3QSRA 3PBWA 3WK1A 4M7SA 2A0NA 4HNVA 2A7NA 3PSWA 1G7UA 5K9XA 1BWLA 3MBDA 1KA9F 3DFPA 4KFNA 4FXSA 3G18A 2GPTA 2HS8A 1XUUA 3LCXA 3M44A 1EB3A 3WJXA 1U5JA 4MPQA 1GT8A 1L9WA 4LVDA 4ZQRA 2B7PA 3T78A 2QAFA 2YYTA 2QCLA 3L21A 3LOTA 4AEOA 2ZA1A 4O1BA 5FF3A 1SO5A 3GK0A 3M43A 5ABTA 4N4PA 4PODA 1TRDA 4RR4A 3CEUA 3HG2A 4CCEA 4MIMA 4UFHA 4YXGA 1ONRA 3NQCA 5E1QA 2ZDRA 1M5WA 4S2BA 1ML1A 4J9JA 2FIQA 1DQXA 2QCMA 5D37A 3C8FA 1XC4A 1G67A 1XXXA 2CZFA 3HOJA 4FX8A 3TMLA 3DI0A 2E5BA 2G97A 5CGQA 4M5PA 1OF8A 2E09A 1L6WA 3P62A 2B7QA 1S5VA 2GVJA 4MZ8A 4O50A 4H4IA 5I3IA 1WA3A 3W1NA 3EWXA 3NYZA 3LGEA 3R89A 1VH7A 3E96A 2HMCA 4M7TA 1FDYA 3G1AA 3G3DA 2FJKA 2EF9A 3NNTA 4I7UA 2VELA 3W7RA 1IIHA 1SZEA 5L9FA 5DN1A 2TYSA 4ORMA 2WKJA 2DU2A 6ALDA 3E9AA 1I2QA 3MW7A 3PAJA 1XBXA 1YXDA 3G1HA 5CZSA 4FNPA
chains in the Genus database with same CATH superfamily
3OLGA 4J27A 3W7IA 4LRTA 2NQLA 4CQ9A 3UJEA 4MGGA 3ABSA 4I7VA 3UVAA 2ZWZA 1X1ZA 3PG8A 3TLQA 4AF0B 2NSXA 3DEQA 3GDRA 2XSXA 3L4TA 3H2NA 1EO7A 1EDTA 4F9DA 4DZIA 4BFAA 5AN7A 3PUEA 3MCNA 3NSMA 5G1MA 1ISWA 2UV8G 3T81A 2GDUA 4QSHA 1VS1A 4YCPA 3BOLA 3WY1A 4GXMA 1L2UA 4IX0A 4YVXA 2C71A 1RP8A 2VDGA 4MFEA 4RZBA 3MWCA 1EP2A 1XLGA 4PMXA 5CGMA 2YLLA 2PDUA 3CAQA 4JCLA 3UXKA 1KBJA 1A3XA 3NZRA 4RZ4A 1YPIA 4ZOCA 2HXUA 1W1YA 3A5FA 4FI4A 5JBDA 1P0DA 3L4XA 1QNOA 1X8CA 2PDQA 1J10A 3PB2A 5BCAA 5D32A 4S39A 4OTKA 5HMSA 1KKOA 1MDLA 4KCUA 4GI6A 2D0GA 3S6TA 2G41A 1UPMB 1AL7A 2O7QA 1VHCA 1S5MA 4P5UA 4MHBA 3CV7A 3SSJA 2E0PA 3EDEA 1CENA 3AU6A 4H8NA 3TYDA 3Q58A 4J5NA 5L6UA 3QW4B 2YCIX 1LG2A 4GIYA 4JTDA 5DELA 2ATMA 5J8LA 1GOMA 3VIGA 2PZ0A 1M7PA 3MI2A 3GG7A 2FMNA 3M1ZA 4H01A 5JVLA 1O4UA 1W1TA 2INZA 3GG8A 3WNPA 2YIHA 1J96A 1SZGA 3SCWA 3FAWA 3M5YA 2A2IA 3QMTA 3NPXA 4GNKB 2HBVA 3QKEA 3RG6A 3SAZA 3WLIA 4J2PA 3UWWA 1PIFA 2HBXA 4NQ1A 2XINA 3T2OA 1QPRA 4C6EA 3S9YA 1ZSXA 1EZ2A 4AZ7A 2RUSA 3KDNA 4ACZB 4PYSA 3DBNA 1N8IA 3UVIA 3EBVA 1MW2A 1EBHA 1C9WA 1QFEA 2WCGA 5HMEA 4AYGA 2HVOA 2XFFA 2PAJA 1DTNA 1UASA 2P88A 1AJ0A 1UWQA 3STCA 1FHUA 4P8UA 1HQTA 3LCFA 3TIMA 5I3DA 2AMGA 3JW7A 4UMCA 3NQ6A 2WMIA 2FHCA 4R7JA 2CBIA 1ZQ5A 2XIIA 2WQPA 4HQVA 4ZO6A 3IIOA 1YTEA 3KVKA 4PFHA 2ZZ3A 3VI2A 3N6HA 3ID7A 2WVSA 2J62A 2PWGA 1ZBKA 2CWNA 3TVAA 1TWIA 4Y90A 1FWGC 3N19B 4PMRA 4UTIA 4JYFA 2R82A 3MYPA 1TMQA 3ZR6A 3PJTA 4QAWA 5LIKX 1IXOA 5GJMA 2VO5A 2DZXA 4DYEA 1CLVA 5KZEA 1YE4A 1XR2A 3LX9A 3I4KA 4B5TA 2R9RA 4X61A 2D2JA 2DQWA 3OU8A 5DMMA 3CMJA 3L4ZA 4AVOA 3GNPA 2J6XA 3CZ8A 1WDDA 3QSTA 4O1DA 3QVQA 1KGXA 5F2LA 4ONVA 3LTYA 2Y8UA 2BS9A 4IMCA 5LGXA 3BOXA 2OEKA 2D24A 4CU8A 3SY8A 1FA2A 2VZTA 5BOOA 2B4GA 4PFMA 2GOUA 1WKFA 1FHLA 1EIBA 1QI5A 4JTTA 1I8JA 2RGMA 4B5XA 1HJVA 4B9ZA 4DLFA 2P8CA 1PXGA 5IDIA 1KKRA 3OVRA 1TG7A 4ZE4A 5HWMA 5CC3A 1A5AA 1UP3A 1VFOA 3CO4A 1UUMA 4S3GA 2GGGA 1X98A 3NSXA 3UJRA 3LV5A 2HWGA 1TMLA 1EDGA 4YNGA 2ZX9A 3T0TA 2C15A 1H62A 4GUGA 4KIEA 1VR6A 3R0KA 4JN6A 1NQ6A 3WLRA 1DHKA 3VKKA 1RP9A 2AMXA 3EGJA 4OV9A 4R5EA 4A3YA 3AIWA 4GY0A 4RCXA 4WDTA 4MMWA 3CV2A 4B3KA 1B1YA 4AY8A 1MVYA 1JUKA 4IZGA 9CGTA 3VU2A 4U3CA 5CPQA 4G8TA 5I77A 4ML9A 3BLKA 2PEVA 4ZB2A 3GTNA 1JQVA 2NXGA 3WQEA 1OSEA 2Z27A 3HPFA 1QWGA 2RDXA 1C92A 5LNRA 4GQ0A 4RDVA 1HJSA 3CO8A 2W67A 1HGYA 4E8CA 3M5XA 2POZA 3QV8A 3LDVA 5CJMA 5BZAA 3LHTA 3USBA 3GDTA 1BXBA 1E51A 3OG3A 1V6YA 3HQPA 5CZ0A 5C70A 4XD5A 2WNZA 3NXFA 3NL5A 4GUIA 1WB0A 3WQ6A 3KVJA 2J8FA 2ZXQA 4XZMX 3CU2A 1W37A 2V82A 4X60A 3S5OA 3B9NA 1XDMA 2NWRA 1XF0A 1KNWA 3TZFA 1TJ1A 2ZRVA 1BSIA 1C90A 1QBBA 2WWCA 1W9DM 4KWVA 1UHVA 2I1OA 1V51A 3GFXA 3BE7A 1DEDA 3ZS4A 3BAXA 4A3QA 1OINA 1KM0A 3DZ1A 1G69A 4GINA 3ARYA 2QULA 3CHDA 2YL8A 4LB3A 3VIIA 2INEA 3VNZA 2XFWA 3ALGA 5CSRA 1AW1A 1FH9A 2J7DA 4NG3A 2PLCA 3N6JA 3AXHA 3MQTA 3MDWA 4LEFA 4UTTA 3QR0A 1WNOA 3C0LA 3WQGA 1WBHA 2Z7KA 4FIQA 1E0VA 3CEPA 1BTCA 4H2HA 3IVSA 1I2OA 1C8VA 4PCPA 2NVDA 1TZ9A 4K8EA 1K70A 3G1DA 1JCXA 3PWGA 2ANUA 3TKFA 3KZSA 1J18A 1V77A 3T44A 3E0VA 3BQ5A 4FLQA 1B3XA 2Y7FA 3A6OA 4WDWA 1WXZA 1CYGA 1DJXA 2FFCA 3UEQA 4GJ1A 3SN1A 1DJGA 5CJNA 3MCOA 1E55A 4WVXA 1D3HA 1REQB 1P0EA 3EAUA 4NVTA 3HG4A 4H9YA 1FKXA 5IHRA 2DVUA 4EOUA 1VQTA 3RR1A 4YHEA 4AF0A 1FUYA 2G50A 3K2GA 3BUVA 1ELSA 2JE8A 2YSWA 1H11A 3WNOA 5AC8A 3GTFA 1SU5A 4MAVA 2Q01A 3CAKA 2P76A 4ATWA 2B31A 2XGZA 2YFNA 4ZXOA 2IPFA 1J2WA 4M24A 2J7HA 1O7AA 2YCJA 4Y8FA 3N29A 4B4HA 3WLQA 1TMHA 4RE0A 1B31A 3SUVA 3WLMA 1ESWA 4QSFA 1Z7AA 2CLKA 3R10A 4D6IA 4ZOAA 1ALDA 1PX4A 4AWTA 2ISWA 3BMVA 3KXQA 5CSYA 3SB0A 3ABOA 4PTWA 1HVXA 4FOJA 3TR2A 1LOSA 1OADA 1AZ2A 3HN3A 2YBUA 1DXEA 4ZO7A 4AYSA 1NM9A 1WDSA 5A5WA 4XSMA 2PDGA 2PA6A 3LLXA 3PUGA 1AODA 4DUOA 5FF4A 1F73A 1TSIA 3RPMA 3KFTA 2XPKA 1Z32X 3TV8A 5IFTA 2VC5A 4RKAA 1OK4A 4W8LA 4F0HA 4AVFA 2GQ9A 1KR0A 3MU7A 4JBRA 3N9KA 5DCBA 2XN1A 3KAOA 2H90A 4URIA 1R2SA 2J66A 1IR1A 3AJXA 1TB3A 2WPBA 1KRCC 3C5QA 3KCLA 3S42A 4JQ4A 1XG4A 1A5OC 3TCEA 3LI1A 2PP0A 3GY1A 4L4MA 3B0PA 4DO4A 1TTJA 2VUNA 2VZOA 4CN4A 4PMQA 4ACZA 4DNMA 1E9LA 5CH9A 3B9DA 1XUZA 4A05A 3IARA 3WD2A 1QO5A 4UFIA 1PVNA 1MW0A 3KL3A 1R87A 3QF0A 4XAFA 3WNKA 1TPFA 2XN0A 1QK2A 4ZOBA 1OZMA 4NAEB 3PFRA 1J93A 2RDTA 4LB4A 3VDAA 1U5HA 4QXIA 1DYSA 5HMDA 3F4CA 3MDUA 4O1EA 3AZTA 4E8DA 4IXXA 1V3KA 3WYZA 2VM8A 2ZZ4A 3GH4A 4JY9A 1LYXA 3EX1A 1XSIA 1XLKA 1MDRA 1P48A 3ZJ6A 3S6DA 3WLLA 2ISSA 4EP8C 3W70A 1UKPA 2OOFA 1X6LA 2HVMA 4RXGA 4C7FA 1OFRA 4AQLA 1Q65A 2PB1A 3E5BA 2XWEA 4Q8WA 4UQAA 4LU0A 3I6RA 2ALRA 1EWDA 2AAMA 4L9XA 1MSSA 4NX0A 1A49A 4JKLA 5FKYA 4HPXA 2QJGA 1NELA 4ZOEA 4GUHA 4DYKA 4ERAA 5LNVA 4JFSA 4HK5A 3GXNA 4ALDA 4ROPA 3IJQA 4NIRA 3LS9A 2VENA 4E8GA 4NX5A 1LLWA 4AAJA 1VFTA 3HJZA 1R30A 2XFRA 4Q8NA 2EAWA 1EXPA 3B8VA 3BCFA 1XIJA 4JCMA 1E3ZA 3QHMA 4BI6A 1RJRA 1SGJA 4TX8A 2CLOA 1UJQA 1AH0A 2VL4A 2ZTJA 4V1XA 3OYXA 2P5NA 5HK4A 3BZJA 3CGTA 3T8QA 4DO5A 3FK4A 1QHOA 3ZLHA 3GH5A 3KL0A 3L9CA 3UWVA 2JGQA 1W1A1 2WZMA 4GJIA 1JFHA 3TJ4A 3ARWA 3L4UA 3PK7A 2XDFA 3EEGA 4JTIA 3W72A 3VCRA 3WQ4A 1IEXA 2PGRA 3H12A 4B2DD 1Z42A 4UWMA 1OGSA 1VZWA 4DHGA 3ABRA 1SPQA 3R6IA 2FVMA 3RNDA 2VCAA 3KOFA 4DY1A 1MNSA 4MKSA 3C6CA 1ZP3A 1MRQA 3PC0A 4H00A 3AMLA 1XH0A 1XPYA 3WN6A 4NYUA 5TNVA 4DO7A 2QF8A 4WJEA 4YTUA 3FYOA 5HNRA 1JAKA 4TX9A 2NV2A 4PC8A 1ADDA 3MP3A 1GOXA 1XJBA 3VFCA 3K46A 3AIUA 3RM9A 4O54A 3G1YA 3WLKX 1O68A 4WGHA 2BY3A 2PWEA 2V30A 1YXCA 1K7EA 2OO0A 4JX5A 2VQTA 4Z1CA 4HSHA 4I9MA 4F40A 4GE8A 2NT1A 3U6WA 3DHUA 4LS2A 3N3MA 3PPFA 1AG1O 2JKAA 3FX4A 3SUSA 1ZZMA 2Y7DA 4HHPA 2BVWA 3Q67A 4BK9A 5I3GA 2UY5A 1AVAA 3FVDA 4H1ZA 2IPWA 3T0DA 2YXXA 2CETA 2FHFA 4JOMA 3VPLA 3DGBA 1MO0A 5K3VA 3UWEA 2OVLA 4XAYA 1BF2A 3TNOA 2VZVA 5CC7A 1VC4A 2QKFA 2NV9A 4KWOA 1VJSA 4QJ5B 2ZX7A 4YHGA 2Y6ZA 3GTHA 4DPPA 2G3JA 2VEFA 4HOXA 5DEZA 1CGTA 4CNNA 2ZE0A 4GIAA 3E2RA 4F0MA 4NZ1A 3LU2A 1KFJA 2FPYA 4G1NA 4R33A 1EPVA 2PDXA 1VIZA 1IGWA 3WZ0E 5LNSA 1JF6A 2G5WA 4HZMA 4IPJA 2D0FA 5D33A 3PAOA 2I9UA 1IT0A 1BG9A 1W54A 1REQA 1LTDA 2TMDA 2X41A 3B04A 1TE1A 3S2CA 3AISA 2ZFAA 1GVIA 3BJTA 2KAUC 3P7YA 4PL1A 2QCNA 3RR4A 1A5CA 4WF7A 2BGSA 4UOQA 1HL8A 1OK6A 1QCWA 3ANVA 4LF2A 1BGAA 4UTJA 5EKYA 4FF5A 1ZU8A 3GKFA 4LPCA 3G8RA 3N13A 4PTNA 4BS0A 1ZPTA 3VKCA 3MI6A 2QYGA 2VYOA 2FZDA 4F66A 4AWUA 2VWTA 1B30A 3CPGA 3A64A 1H41A 1EYEA 4QCFA 3DFHA 1L8NA 3QQ1A 4DXKA 4DUVA 1EX1A 4GI4A 1QNQA 1Q6LA 2E40A 4IXHA 1CB7B 4H41A 3ZM8A 4RUBA 4DXVA 4BHYA 4WZHA 3EDDA 3TTYA 4Q7IA 3UG4A 2VFDA 4S38A 4MLRA 3PBVA 3VGDA 3NQ8A 3ZWTA 4L4PA 2ZC1A 4PUEA 4F0KA 2C6QA 5BYWA 3NWRA 4X3ZA 1O5XA 3L65A 4FA3A 1S1PA 5AFDA 4HNLA 1BQCA 2C8NA 4LVGA 4DI9A 1GVQA 4GYPA 3K8KA 4EACA 4MY1A 1D8WA 2XTKA 2ZA2A 1GYNA 2WJFA 4UXDA 2OCZA 3EWWA 1DJIA 4X9YA 3MUZ1 4XD3A 1Q7QA 3BQ6A 3W87A 4ERIA 3M0IA 4IMFA 1UD8A 2FMOA 3JZUA 1UUOA 4Y96A 5LIYX 1ZUAX 1GEQA 1W1IE 2W62A 5CPSA 3XISA 2UY4A 1XGEA 1KLYA 7A3HA 3P5YA 4FMVA 2O9RA 3VZXA 3WQFA 3PJWA 4KERA 4B3ZA 1KGUA 4UC5A 3S1WA 2BVYA 4UTLA 3E74A 2XM1A 4HPNA 2H8ZA 4GI9A 1QOQA 3VIKA 5FA5A 1LG1A 2WQDA 3EXSA 4G7EB 2OQYA 1PKNA 1LQ2A 4NAEA 3CLMA 2GDVA 2CIPA 2CITA 1K7FA 2PDYA 2GL5A 1Q3NA 5I07A 3E5PA 2BXYA 4KGLA 2RDUA 2W9MA 2CZVA 2Y4SA 5DCDA 1CLKA 3LBMA 3N73A 1JFXA 5D04C 1JG9A 1YNYA 4E3VA 4YVVA 4J3TA 1EJSC 3H2AA 5B7YA 1R5YA 4P2VA 3ZR5A 3AXKA 1XYFA 1H7PA 5FCZA 1B3VA 1RLCL 2TRSA 4GPNA 5CJ5A 1GKRA 3ITOA 3P0XA 3OLIA 4XZBA 1L6FA 3BC9A 2PDHA 2PGFA 5MF5A 2JK2A 1FWDC 1KWGA 3NDZA 1YDNA 1C7SA 1JPMA 3THAA 1TA3B 3WQVA 1L6YA 1T40A 4IHCA 1WOBA 2ATSA 4ZSTA 4HU4A 3B03A 4QG8A 1YTDA 4QM1A 3N9SA 4JTGA 2R8WA 2BOEX 4K1GA 2ZRXA 1XYCA 4JGDA 4DWSB 5IFPA 1DPMA 3PZNA 3H53A 4PEEA 5HWJA 3G0UA 4GOAA 4L1WA 4DZAA 2J47A 1EF3A 1I0DA 4IMDA 3NVDA 3WH5A 2PF0A 3L66A 4MY8A 1M7JA 5D2YA 3QPEA 3WD4A 1BYBA 3PM6A 2XSBA 2FKPA 4JIIX 1Z8AA 1OY0A 4YL2A 2HCVA 2DH2A 3UR8A 3K30A 4L6OA 4HIBA 1UB3A 2QEZA 2XIQA 1JVNA 4JEQA 2WK2A 2OTDA 3PTDA 2ZZ1A 1ZGDA 3TC6A 1GKQA 1XIIA 5ABEA 4JICA 3M0ZA 4JNMA 3VKAA 1VFFA 3TSDA 4AIUA 2PDFA 1YX1A 3VOGA 2JEPA 2VUYA 3DI1A 3OO2A 1TZ7A 2A3AA 3GIPA 4A2SA 3VNJA 1HW6A 2GQAA 3RN6A 4B92A 2OWWA 4W4QA 3CZKA 1EX5A 4BWLC 3F2BA 3W1UA 2VFHA 1PO9A 2QDGA 3PBYA 3LEPA 3LHZA 4NU7A 3M07A 7CGTA 3B8TA 4XBJA 3CBWA 4LF1A 2NQJA 4NXKA 1NDWA 3IVUA 4O52A 3IPWA 2YOCA 3U8GA 2J13A 1LORA 3OA3A 3F2CA 2OZ8A 4MOZA 2BG5A 1ADSA 1H7OA 4UTTC 4NNBA 4ZQCA 5DY2A 2OZ0A 3P0WA 4I3GA 1KR1A 3IJ7A 3LRMA 2G3NA 2Z00A 1MUCA 3LBCA 3B97A 1RUSA 4O10A 3A4XA 1W3JA 3CIWA 5CBBA 1X1NA 2GGJA 1KD0A 4RE4A 4XV0A 6ENLA 1R86A 1BWVA 1TV8A 1W3KA 1UWSA 4I7WA 1JJKA 1MEWA 1TUFA 3AHYA 3G6LA 5AZ1A 3E0WA 2C79A 4PB3A 3ABQA 1O60A 4PBEA 2GOKA 2ZDSA 5CPOA 4DBEA 1DWIM 2PDLA 3SRHA 2WM1A 3I68A 2BX7A 4W89A 1TPUA 1PIGA 1CTNA 1KW1A 1RJPA 4EANA 3B0UX 3VNDA 5BWFA 1P43A 2GZXA 3USZA 2DT2A 4F2TA 2F6KA 2QDEA 3BANA 3EPOA 3KHDA 4PMUA 5CZKA 2QQ6A 4WSKA 4L4OA 5D8ZA 2J7GA 4GO8A 1O5KA 3A47A 1GKPA 3VO0A 2Y1HA 5CSUA 1TPEA 1HF6A 5KZMA 2YL9A 1EJXC 1MQRA 4ZL1A 2Z2AA 2GQ8A 5D03A 3GRIA 4IGSA 1WZMA 3N12A 1FXQA 3NDOA 5A8QA 1X39A 3EPNA 4XUYA 3OB8A 1ECQA 4DJED 1K1DA 2ZOXA 2PWDA 1LROA 4WHBA 3BAIA 3M0LA 2AKMA 4FXRA 3HJEA 2FVLA 3UG3A 4GD0A 4L1GA 3ZXWA 3DGRA 1SQ7A 4K8GA 4BQ3A 3MMTA 1FWHC 2FB3A 3B4UA 1MYRA 3EX2A 3W7MA 4DO6A 1I1WA 5H6HA 4M81A 1W1ZA 4DXXA 1LWHA 4O4VA 1L6GA 4HA3A 1NH6A 3GHRA 1W9UA 3OW1A 5JXQA 2ASHA 4XK2A 2G37A 3IAPA 2WKGA 3QBUA 1A4MA 2GVLA 3ZR4A 2B7OA 1CW2A 2VEMA 4AY7A 1IE7C 1E15A 3IJ6A 4YPJA 2WBKA 4QS5A 5HR6A 5FAGA 3VD9A 2J77A 1FOBA 4GKTA 4HSOA 4BA0A 4ES4A 1W56A 3E2QA 2DSWA 4CKQA 1I45A 3FW6A 4OECA 3S2JA 1RR2A 4CQCA 2ZZ6A 2BSLA 1A50A 3OTRA 3UZ5A 1K9TA 1O1ZA 3BK0A 2NZLA 2F2HA 1OGGA 4Z2HA 4EK7A 4Z1AA 2R94A 4TO8A 4K39A 2QCCA 5BW6A 1BVWA 5J5RA 4J40A 1ZP4A 1PTGA 4O11A 4MG4A 2Y5EA 3SQMA 3NDYA 5DO8A 7PTDA 4W5UA 4J3UA 3NJ3A 1AH4A 5D9NA 2ZXAA 3UF9A 1F07A 3ENLA 3WQ5A 4FLRA 1IHIA 1POKA 3N2XA 1KXTA 1KQZA 3U48A 4RE3A 1G4SA 5HWNA 5AY7A 4J28A 1O12A 4MFDA 4G7EA 3O2LA 2CFFA 5C55A 3NPUA 1XSKA 3M0XA 4YWSA 2DW6A 4XZHA 3FY1A 2D2GA 2V6AA 3A21A 3RJYA 4J4KA 2ZZ2A 4IJRA 3H23A 2QDDA 1K77A 1SMAA 4LV9A 2WCAA 5DXXA 3HMCA 2FPVA 3F1QA 4O53A 5BXSA 1T0OA 1NSJA 1DIKA 4PB4A 3PBWA 3WK1A 2A7NA 2V5DA 5K9XA 1BWLA 3MBDA 4G6CA 5D8WA 2XISA 3SO7A 4IIHA 2HS8A 1UP0A 1V3HA 2ACSA 4TQTA 4JEJA 2QGHA 1FWBC 1TA3A 4MDPA 5I06A 3VIOA 3KM8A 4XIAA 1E40A 3P6LA 3CL6A 3J7HA 4DX3A 3T78A 2QAFA 4IJCA 2QCLA 3OZOA 1VBGA 4O1BA 4N4PA 3LNMA 4RR4A 3S9IA 4KF1A 4KT2A 1CPUA 3D5HA 3NQCA 3VOHA 4HPGA 4GGHA 4H9XA 4DWSA 1YKWA 3VVGA 3SCSA 3C8FA 2NVAA 3TMLA 2QUNA 4NP7A 2Z1XA 1JPDX 4L9YA 4TVUA 5IHSA 3GS6A 4GCAA 1LL7A 3PANA 4PR4A 1WA3A 3W1NA 4GYKA 1UG6A 4NI3A 1E5JA 3G1AA 3WCZA 4P7LA 2FDMA 2BDQA 5AYIA 2W61A 5DN1A 2TYSA 4DBWA 3IJ9A 1M7XA 4Q4RA 3G1HA 2F2KA 4KBXA 3V16A 1PBGA 2EG7A 2XVGA 4H9UA 5DLCA 1SJCA 3LQLA 1J9YA 3BJFA 3PZGA 2XIOA 3GHSA 4DM2A 3II1A 4R27A 4D6HA 2EJAA 3PR2A 1F3TA 3FGCB 3VABA 2DZSA 3R8RA 4DBSA 3BTNA 4L6HA 1AD1A 5F2MA 1ZHAA 4N9BA 2PI6A 1ECEA 1LP6A 1XYMA 5G2WA 4FP1A 1F3WA 3Q2DA 3V0TA 4C90A 4E6MA 5XIMA 2ZCGA 3H26A 3G3MA 4HYVA 2QAPA 2DEPA 4GC3A 4X22A 2X2GA 2Q09A 3LM7A 4DJEC 1JCMP 3IWPA 5IM51 4M1BA 3BL3A 3OODA 4WDXA 1BKSA 4JHZA 1I4NA 3FA4A 1S5TA 4CVUA 3UPMA 2PDWA 1O95A 3GU1A 4Q8OA 3GVGA 3TFCA 1H63A 1XCFA 1UH3A 4QR6A 5I3JA 2WHMA 4ATLA 1ZALA 3TQKA 1OX5A 4NKCA 1ZJBA 2NLIA 3RUBL 4ZXLA 4V1YA 3UD6A 3P8IA 2D23A 7REQB 3VE9A 3RX3A 1XRTA 1CX9A 5IXEA 4GIRA 1F74A 3P67A 3WBYA 3MSGA 4FIRA 1W1VA 4NUWA 4O4WA 4UOJA 2OYMA 3RLGA 1AUSL 2FVKA 2F61A 1PV8A 2OZTA 3QYQA 1I2RA 3BICA 2G96A 4AD0A 3W1AA 3ABXA 1Q6OA 1XX1A 2AL2B 5DRCA 3KRZA 2AQVA 4DJDD 3U2ZA 2PD5A 1IV8A 5DF0A 2PLMA 3C2FA 4UNLA 3URAA 3URQA 3ABZA 5LXXA 3W7EA 1EJTC 2DW7A 4XKMA 2Z4GA 3R13A 2Z1WA 3W2JA 2PTZA 1JCJA 2HE8A 1XLHA 1XWYA 3WQCA 2V5CA 4AVNA 4D72A 3PVFA 3NSNA 2VZSA 4C6MA 3CH0A 3TYEA 2O56A 5A3HA 3EWCA 3WEZA 1Q6DA 2V3GA 3W7QA 2VC7A 2BVDA 3APYA 4XBSA 1WPCA 1KTCA 3UY7A 4N9CA 1H0IA 1N7KA 1TREA 4RL3A 2JEQA 3LYEA 5FF7A 1QW7A 3JRKA 3P8JA 2BOGX 1FXPA 4GYPC 1AQ0A 1RALA 4DLMA 1UP2A 2Z2BA 2O0TA 4Y6GA 1K9EA 1SFLA 2VR2A 4NT0A 1TCMA 2ZA3A 2V8ZA 3NXLA 1V02A 3D6NA 3KS6A 1HT6A 2Y62A 4RDZA 2Y7EA 2QT3A 2WHLA 1A4LA 2YZ5A 4H9MA 3A3HA 4B5NA 2FH6A 1K7XA 2DUAA 5LA1A 5D9PA 4Q8MA 1E43A 2QPSA 4PZVA 3AMDA 3QOKA 4RPQA 3RFAA 1FCBA 1UYQA 1FBAA 3VD4A 4M6VA 2Y70A 3QJAA 3N4AA 2ZE3A 1Z41A 1QATA 4JY8A 4H8UA 2EPHA 4MPKA 2ISDA 4LNYA 2PP3A 3QZAA 5HXMA 2DZTA 3SSZA 4ENLA 3QMSA 3MC5A 3UCDA 1HFBA 4BEQA 1HJWA 3U3HA 4YLWA 2G4FA 4RLIA 3GWQA 1W9VA 4OIFA 1GOQA 3IIXA 4UMAA 4WSJA 3DU0A 3GXIA 3HBLA 1GTHA 3NQAA 3DXIA 4EF8A 1Q6QA 2WVVB 1FX6A 4NHVA 5A1AA 4MAZA 5D9MA 4XBKA 1GJUA 2ZVIA 1T5AA 4QP0A 1CT5A 3BSMA 3VTRA 1JPKA 1N2VA 1V6VA 2C3ZA 2OSYA 1H1ZA 1NOFA 1DHPA 3AOFA 3KHJA 3G6MA 1SVDA 2YBTA 3GUGA 5BXTA 3ZOAA 2OWXA 2WBGA 3L2IA 4TXEA 1YW1A 1I9CB 1CGYA 3T08A 3DYPA 1S2VA 1TV5A 2Y5JA 3FIGA 3L7RA 6XIMA 2NXIA 1KRMA 1P0KA 3NEHA 2MNRA 1ZBVA 4B5SA 5HNNA 1JZ3A 1K4HA 3U4AA 2H3DA 2HSAA 3VFLA 4WRHA 4LXFA 5HA7A 1SSGA 2XFYA 3MS8A 4UNIA 4MB1A 4Y9NA 3O0KA 1FP8A 4WGXA 1XLEA 4O0QA 4NZFA 1KM1A 2WPGA 2VEIA 1CLXA 2X1IA 4ZA0A 2A85A 3WK0A 1FHVA 2OYLA 1MWOA 1LQ0A 4ZO8A 1R3SA 5AHEA 2E4TA 4HNOA 1TWWA 3LTSA 1OFPA 2RH9A 1JDEA 5DX7A 1ITUA 3SY5A 3WIJA 2CKSA 2ZADA 3PFMA 3EEZA 2R24A 5I7GA 1KCXA 2Y89A 3D3AA 1A3HA 4ADUA 4O17A 3STPA 5H8PA 1TO3A 4QS6A 2DSUA 2OGJA 5AYZA 3MZNA 2CWXA 2F7FA 1TV2A 1TVLA 3T0CA 2PGEA 5LA0A 2PCEA 4ZMGA 1IEVA 1EFZA 2EPNA 4KFPA 1QI4A 1RHCA 2ZRYA 3HB9A 3CNYA 2I5QA 2VZUA 3KEHA 1J6OA 1ZJIA 1KV8A 2CLFA 1T8XA 2OR2A 4XQ6A 4UTFA 2WMFA 1M41A 3UZWA 2OT0A 3BCDA 1GVOA 1PKLA 2WV8A 3H4GA 4HNTA 3ME3A 3W1PA 3WJYA 4E5TA 1RA0A 2WAGA 3W7CA 4UQDA 1FFQA 2FHBA 1XRFA 4XD6A 2GUYA 4GISA 1P5BA 4FLOA 1C8YA 1K9DA 4MTVA 2PTXA 2VI0A 5AYYA 2RHGA 2E6FA 4JDYA 4MZ1A 5REQB 1US3A 3S6OA 4AMAA 3NG3A 2QMKA 1QO2A 3WQ8A 3TAOA 5K2ZA 2OSXA 1WO2A 4XG1A 3ITYA 2OPJA 3G1SA 4ZBCA 1O6IA 5C9WA 1PZ1A 3UESA 1UW9A 4JL1A 1QBAA 4GQGA 1U1UA 4AX6A 5G2HA 4TX6A 5T9CE 5E09A 1K03A 2BXZA 3VOJA 4DJDC 4Q7NA 1U83A 3RM8A 3JVAA 1Q4NX 1WKYA 4HMEA 3PZMA 2Q3OA 1AK5A 4DVOA 3TYZA 3FGCA 2NV1A 4W8AA 1QNRA 3VINA 1W0MA 2INFA 4EXAA 2X42A 5G1TA 1TPH1 2E3ZA 1WDRA 4E38A 5HJLA 1JIBA 5LXEA 4UTMA 1E6NA 5H1WA 1PPIA 4PE8A 1Q13A 3ITTA 3SGZA 1YBQB 3EWYA 1S46A 4CLMA 1HUVA 2Y5SA 1IT8A 2CLEA 1JNEA 1PAMA 2OT1A 1PX8A 1R0MA 3OVGA 3NO5A 4AW7A 3EA1A 5LSMA 2IKHA 3UR2A 2QJNA 2PDBA 3WL1A 2ZRWA 3N6QA 1L8PA 1TTIA 4JDBA 4D8LA 5K4ZA 4JTHA 4OE7A 5LKYA 3QQWA 2OG9A 3IEBA 3KBJA 5GNZA 5BXPA 2VWSA 4FPSA 3T8LA 1Y5WA 1FH7A 2QZRA 1CXKA 3O7UA 4X2PA 1KM4A 1QMLA 4MADA 2CBJA 1YYAA 1DV7A 2Z2UA 1XBZA 1HO4A 3XINA 5I09A 2VJXA 3MVTA 2NSOA 4Z0SA 2VP8A 4CNPA 1UZHA 4LVBA 5CG7A 3LHYA 4GACA 1R38A 2VFFA 2FGZA 5FJUA 7REQA 5F2IA 2E5CA 4HJWA 3A13A 1JYVA 4MWAC 7ODCA 5JU6A 3ZYZA 3F4WA 1IR2A 1W5PA 2PWHA 2H6RA 4QHRA 4E4FA 5T91A 4E2BA 3G8EA 4YTQA 3W1TA 4CCDA 3VCNA 3OBEA 2QPUA 1PB0A 2BWGA 1HIZA 4HMCA 2FQIA 3RRAA 1OYAA 3EWBX 4ZE5A 5BRPA 3PWAA 1QNVA 3TMQA 3NURA 1K8XA 2DJLA 2DQXA 1TVNA 1OABA 2XG9A 4QE4A 4PRRA 1GK8A 3OJGA 3OQEA 3UY8A 4IQDA 4AXNA 4RW3A 4U4MA 4H7CA 1BXCA 5DXYA 1UROA 1VLIA 3UNTA 4UZSA 2O9PA 1GQNA 3CK5A 3PZQA 2EO7A 4C6QA 2V5KA 4AD1A 4C5YA 4HOZA 1OYBA 5AOUA 1RVKA 3AHTA 3CZEA 3F5KA 1Y0EA 4R88A 6TAAA 2A7PA 3AYSA 4UOZA 2ZRUA 3HA1A 3Q65A 3KP0A 3LCHA 3R0DA 3AQUA 1Q66A 3AIEA 3CV1A 2Z6JA 3S83A 1JI1A 5F1UA 1RPKA 3CHEA 3EA2A 3H8AA 3TSBA 4PUJA 1KV5A 3GR4A 1KLZA 3N3TA 3RMJA 4B5UA 1DIEA 1QNPA 3OEXA 2OB3A 3L2LA 5I79A 1TQXA 4IIFA 3OPSA 3VA8A 1QI0A 3BLLA 2XJ7A 2AQOA 1W3LA 1HVQA 1VPQA 4KEMA 3SCTA 1EO5A 3PULA 1KQYA 3HG3A 2VC6A 1XGDA 1MMFA 3CB8A 1VFMA 3E0LA 3ZWSA 1V02E 3WMBA 1S3HA 1Z89A 5JH2A 1FWIC 1KM3A 3B0XA 3KBSA 3WLSA 5D2XA 2VX6A 4GQBA 4U28A 4U2YA 3N11A 1TRIA 1R46A 4OOZA 1SM9A 3TROA 1BYDA 3CASA 3N18A 4Q32A 5ECUA 1CGVA 1ZFJA 2RJHA 4LH8A 3RO8A 2XU2A 3MBFA 2Y2WA 4Z1BA 1I1XA 1OT2A 2WSQA 2YGYA 5BROA 4B15A 3ATYA 2WVVA 5JBFA 2GSHA 1H7WA 1CXEA 4B9YA 3ARRA 4BEUA 1F76A 4NJGA 1J5TA 4JYDA 1W1PA 4LBRA 4UTKA 1KFLA 1R47A 4XX6A 1TR9A 3VILA 3VD5A 4KRTA 1H60A 2F38A 2DT0A 1FHDA 3TW9A 1XH1A 1RCOB 1XIEA 4XZLX 4GGBA 5I3KA 1JR1A 1S2WA 4W7UA 5G4EA 3AS0A 3GBDA 3LGGA 3MO4A 1UWIA 1Z48A 3QMRA 4RZ5A 4N42A 4IUOA 4DF1A 3MKCA 1XL9A 3INPA 4PEKA 1WUEA 3AYRA 4FOKA 3TCSA 3V1PA 1OC7A 3IGUA 2OSWA 1WE5A 1D9EA 3NFUA 1KO0A 3R43A 1U5VA 4AISA 3FLUA 3LPOA 3CQHA 1HKIA 5CG0A 2RJGA 4WX2A 3WLOA 2OLHA 2ACQA 1FWRA 5AC7A 2VURA 3COTA 3M4HA 1Q6RA 1GUVA 4HD5A 2QIWA 1TQJA 1TV4A 1C9DA 4O8AA 3EDJA 2ON3A 4LS1A 2OEJA 2SFPA 1N55A 3VDBA 2KZHA 3OZPA 1R7OA 3ONCA 3R7MA 3LG3A 3SURA 4C7GA 4HA1A 1ME7A 3QXBA 1RY0A 1VKFA 1A5BA 2CKRA 1K6WA 1PYFA 2QXWA 3W86A 3M46A 4LRSA 2QJIA 2V69A 4UQ9A 3MCMA 1H50A 4FK9A 4IG2B 1C29A 4XKYB 5HJXA 3EA3A 4LEQA 1R2TA 3EB3A 4P7RA 1TWSA 3N2MA 4LW7A 2W6RA 3FJ4A 1RK5A 1VD6A 3IUHA 1BYAA 3BGGA 3DIPA 1H2JA 4LJ3A 2PLJA 3NL2A 3TK7A 4QROA 2GUUA 3B05A 4LYQA 3I6TA 3NQMA 2C14A 3TZNA 3O06A 2WZEA 1MXGA 3C2OA 4DJFC 5A6AA 1VEPA 4KGJA 3B8WA 2DSKA 5HR7A 1P6WA 4ROQA 1N8FA 4UTHA 4LVFA 2VHLA 5REQA 1C93A 1V3IA 3RGTA 3A23A 1E73M 4KIRA 1WXYA 4GZJA 4Y9MA 3BSGA 4Z2LA 1R7AA 4JR5A 2HE5A 4HNCA 3OGVA 2XYLA 3WNLA 2DSVA 3DG3A 4PTDA 4D1JA 5KZ6A 4IJBA 4CEXC 2D69A 1RH9A 5KSWA 3BGJA 4CU7A 3CT2A 1RD6A 3W1RA 4ZFMA 2POTA 1KBBA 3IIVA 3TNBA 3T6CA 2VX5A 3DAQA 1IWPA 4FNRA 5CPNA 1S2CA 1H61A 4JTSA 1E6PA 2V81A 3R25A 2XUCA 3QFWA 1XISA 5D02A 3BMWA 4E2DA 1KCLA 4Q4KA 4OQVA 5DT7A 3C0JA 1GG1A 3IV8A 4B5WA 1SW3A 1YBQA 1V3MA 4H9VA 3W53A 5I3HA 2Y8VA 4US6A 2RFGA 2REQB 4S3AA 1CEOA 3UPBA 2O4MA 5IBXA 4K36A 1GEHA 1S5WA 3LN3A 1V6UA 4MSSA 1VB9A 3S47A 1C91A 1W3NA 2NQHA 5A6LA 1V79A 3GIYA 3CZLA 2WANA 3H21A 3G22A 4Z17A 2VXNA 2Y8KA 5FF2A 3VX1A 3GG0A 1J79A 1PYMA 1UWAA 4GFIA 4FO4A 4OU1A 2J9YA 2GJNA 3VNIA 3WSUA 1B0IA 4JTEA 3IK4A 1A5MC 4IIEA 2E8ZA 2DORA 4LTSA 1AMYA 2OQHA 3LNPA 2V63A 1EJWC 3NR0A 1DKWA 5D2WA 1W3TA 3JUGA 1XLFA 4JTFA 1RY8A 1EJRC 3LD5A 3TE9A 1XW8A 4C5ZA 1AW5A 4MLJA 1TTQA 4UQBA 3VZZA 3VKDA 1FWFC 1TJ0A 2PRHA 4D6DA 2PS2A 8XIMA 1CGWA 3L4YA 3VX0A 4JX4A 2VFGA 4YTTA 5FL1A 1ZB5A 4DUWA 3WFAA 5MHBA 3E49A 4CNOA 1PZ3A 1U30A 2E77A 3CM4A 1EHNA 1UWTA 2XN2A 5HQEA 3Q37A 1EA0A 1EGMA 1DJZA 2E5DA 3A9BA 1JCLA 4H6KA 2WNWA 4AXKA 4HU0A 5FACA 4A21A 3NOEA 4BF9A 2YXOA 1A5SA 1SJDA 3VD7A 4KRUA 2NUYA 2NX1A 3P74A 1OC6A 4DYJA 1UWUA 5AC4A 5I6SA 4QFUA 4YTSA 1JYNA 1PCKA 3WF4A 1G6CA 4Q7BA 5CQ1A 2ZBTA 3M7WA 1WAWA 2DUZA 4BKNA 3BAJA 1V0MA 1DJYA 4O12A 4HTBA 4Z0JA 3MV11 1XBVA 4RDWA 5H91A 3RPDA 3WDPP 3GD6A 1JD7A 3CUFA 1GOKA 3SCQA 1JPIA 3IUDA 4ZQOA 1B4EA 5FEZA 3WJZA 3V0UA 3MJYA 3MZ2A 3N2CA 1UD4A 2VCCA 4OGZA 4PCSA 1FQ0A 4PUMA 5HINA 2AAAA 4JFWA 3T7VA 4BCEA 3W7DA 3B3DA 3HZ3A 1S2UA 3PPCA 5EYWA 2DIJA 4WUIA 2YCLB 3EKZA 1ISZA 3MKVA 4S3CA 1QT1A 3PUDA 3W85A 4AB4A 3K13A 4LNCA 1UD6A 3GO2A 1VBHA 2FGLA 5DMNA 2AGKA 1W9XA 1W2VA 2CZDA 3PJUA 4AUBA 2FZBA 3DYOA 2P8BA 4U3AA 4A29A 3T07A 2WW5A 2YX0A 4EF9A 1ONXA 2Z29A 3WUFA 2YPIA 3FDGA 5E0CA 1RSCA 3W1LA 3OVQA 2CZ5A 5T26A 1E0UA 3RM4A 4PUUA 4HP5A 1VRDA 3E6EA 3GAKA 1J0JA 1OVDA 3LSBA 4S23A 3T55A 3A4JA 3RDKA 2P0IA 2QHAA 3N2OA 4AIOA 2R91A 3SUWA 3CIVA 5GVJA 1QHZA 2WC7A 3HFYA 4JIQA 2VRJA 1YRRA 4ZCWA 1M7OA 2E6YA 3MSRA 4V27A 1QOXA 4TVDA 4Q4PA 4W7VA 1F6KA 4UTWA 4J3XA 1XCXA 1XGZA 3GZAA 1W2PA 3OLDA 3B8SA 1VFSA 5CGTA 1Y5VA 1EEXA 3GTIA 1WV2A 1XYLA 1IQ8A 3SUTA 9XIAA 4LY4A 4UTUA 2Y24A 3B9AA 4HGXA 1LZOA 1PKYA 4KETA 5A6BA 1VP5A 1GZ1A 2OODA 3H22A 2F9RA 2QUVA 5BMWA 6CGTA 1PL9A 2GJRA 2Z7GA 1GQJA 3MP4A 4IMAA 3LXAA 1AFSA 3CQ0A 1UD3A 3IACA 4IQJA 1H7XA 1HJUA 3MUIA 5T9BG 4OBSA 5HATA 4CD6A 1EWEA 4IOTA 4G9PA 5D30A 2C13A 4AC7C 4M6UA 4DZ5A 4GBUA 4NF7A 4AEEA 3GE7A 4UIOA 4MWAE 1UR4A 3IGHX 2WOQA 1KBIA 4RV3A 4IG2A 4XKYA 4GMEA 1P6CA 1X7FA 4FX7A 3FJ6A 2J9XA 1O1HA 2CC0A 2I5IA 5I78A 2DT1A 3BLOA 4PUNA 3BW3A 3U7VA 3BGAA 3F7JA 3U7BA 3DERA 3U57A 3SI9A 3G1XA 4KWSA 3R8GA 5AVHA 2OXNA 2XM2A 2FPTA 3VMOA 1JZ6A 4IP4A 3SCNA 5C9ZA 3GW0A 2G8ZA 2YL6A 4H2CA 3QV7A 1U2YA 1H51A 3DOPA 4KW2A 3UJFA 3UFYA 2OWCA 2FDSA 1B3WA 4LAMA 4XTDA 1VCGA 2ZUTA 2BY2A 2EBNA 3G0SA 2FTPA 3LXCA 4XVEA 2I16A 5KETA 5TD4A 3R58A 3SQLA 3VAVA 3W28A 3WF1A 5B80A 3ZJ8A 5LNWA 2IMRA 2X0HA 1OG0A 4ASTA 3ZSSA 4PL2A 2VD8A 3M64A 4UFLA 2DZAA 1BPLB 3RCNA 2WSYA 4S3EA 4AIEA 1JRCA 1XLDA 1CGXA 2J24A 5KMYA 3QRHA 3W1MA 3W02A 4HVXA 5H8MA 3CUHA 4ERGA 3WUGA 2XH2A 1KXHA 4W85A 5A8OA 3EZ4A 3HPXA 2PRMA 2WC3A 3HU7A 1AL8A 2REQA 1Y65A 3FKRA 4AU0A 3W2KA 5G1YA 2WJEA 4WKFA 4JYEA 1B90A 3KW3A 4LT9A 2VD9A 4E2VA 2V5JA 3UZZA 4OUIA 4RK8A 2C91A 3LCIA 4J2MA 5FEWA 1ZS2A 1OZQA 4DAIA 1TCDA 4PGLA 4HHHA 5GNYA 4W5ZA 3WENA 3R1ZA 3WH9A 2IUZA 1SW7A 5G4WA 5E70A 4OBRA 3MUY1 1LM1A 2HDJA 5ABFB 5G2IA 5FEPA 1XPGA 4HT3A 4YYCA 3EWDA 5CBJA 4W7WA 3UYCA 4C1LA 3SGGA 3PTQA 5BU9A 3NPVA 4K7VA 2J88A 2A5HA 3ES7A 3MO7A 1E9ZB 4QEEA 1HXJA 4KEVA 2E25A 3KL5A 2J7CA 2WC4A 3TTSA 1XRVA 4N6FA 2GVEA 3P61A 1E3XA 3TQ0A 1JULA 3WBWA 4PULA 1W9PA 3M6DA 2HPIA 3EMZA 5K7JA 3GXTA 1PWLA 3KE0A 3GU9A 1M65A 3TYAA 3MB9A 1F4HA 1UBPC 2OJPA 3B0YA 3CLWA 3W7KA 3HIJA 4LOCA 4LCQA 1NFPA 3W81A 1OD0A 1WBJA 5JBEA 2D0HA 4C6OA 2W0UA 3RIKA 2E9LA 2G95A 3W22A 4DIAA 2PTDA 4LAUA 3DHFA 4XB3A 5DCEA 1ZCCA 3PTMA 1JYXA 3GW3A 5PTDA 3N04A 4IT1A 5A69A 2A0NA 2HK0A 5EBAA 3W37A 4HNVA 3PSWA 1KA9F 3DFPA 4FXSA 3LPPA 3WUBA 2GPTA 3ARQA 3PZOA 3M44A 2BASA 4GHRA 3WD0A 4PUDA 2PZNA 4ZQRA 2B7PA 3OGRA 3ARPA 1MW3A 2BY0A 5FF3A 3BDKA 3GK0A 2V3DA 2HXTA 3ONBA 3FNDA 3HG2A 4CCEA 4GI8A 3CTTA 4IP5A 3VUPA 5E1QA 3NIYA 1M5WA 1ML1A 5ENLA 2HROA 4J9JA 4V28A 3VNLA 1W6TA 3WL0A 2W91A 3RAOA 1XXXA 2CZFA 3HOJA 4FX8A 3WMLA 4JQ3A 2E5BA 1M3UA 2G97A 1JNDA 3WDJA 4I8YA 1ONEA 2YCLA 5I3IA 4MZ8A 3TYBA 1I0BA 2QGYA 3MUCA 1KXVA 1RJQA 4WJXA 3O6AA 4HCLA 3LGEA 3H24A 4EPDC 3WF2A 1FDYA 8CGTA 2FJKA 2EF9A 3NNTA 4I7UA 2VELA 3OZYA 3W7RA 4LAKA 2E67A 3K4DA 2WKJA 4LYKA 2DU2A 1A5NC 1I2QA 4OUEA 3PAJA 1DQUA 5CZSA 4DN1A 4P7OA 3UXLA 3S0CA 1JCTA 3W88A 4KS0A 3LCWA 3WX7A 1OFEA 4IFKB 3WNNA 1BXNA 3VCCA 2GWNA 1O5RA 4BI7A 1TJ2A 4JFVA 3STGA 1EC7A 3S4TA 4WD0A 1HN1A 1S38A 2GYIA 4AG0A 4I9AA 1XP3A 1RBLA 3QY8A 4IIGA 3ZT6A 3BMXA 4M6PA 1KBLA 4LSBA 1FY6A 3QKZA 2E9MA 9XIMA 1OX4B 1Y7VA 2PDCA 4MJMA 1GPFA 2YZRA 3NCOA 2RAGA 3AICA 3B0VC 1ZY9A 3AFBA 2EG6A 2BHUA 1LWIA 1P1XA 4L1XA 1QHPA 3POCA 1XYZA 3GUWA 3UWQA 3ELFA 1A53A 5AVNA 2G3IA 1IGSA 5BWAA 2CLMA 3KVMA 3GZ3A 3NVTA 4NNCA 2ONEA 1G4EA 2QUMA 1AQHA 2H9AB 4N4QA 3RO6A 3FDKA 3B8UA 2A1YA 3F4VA 3WKZA 3ZO9A 3TFXA 1FP9A 1W3HA 5C7VA 1XLMA 2AQWA 2FLIA 3I4EA 4LUTB 3BW2A 5RUBA 4JIPA 4WIWA 3RPTA 4HU8A 5EL1A 2HTMA 2CBVA 4HMNA 2IKJA 1YLVA 2BVTA 4NJIA 1KBKA 4K6AA 3TYUA 2J78A 3DFYA 3U2OA 2WB5A 4XAZA 3WG6A 2CU0A 4LANA 4CCZA 2YL5A 2CNCA 4D6CA 3L5AA 1M04A 5A8NA 4OBTA 2BGNE 2CCRA 5TQLA 3KOYA 1F6YA 4PMYA 4OT7A 5D38A 1PJ9A 3MHFA 1CBGA 3P80A 2QV5A 4QNWA 1SFSA 2Q71A 3UXIA 5IBXC 1PHWA 3W82A 3FHAA 2HISA 1QU4A 3OG2A 4UFKA 5EMUA 3S2NA 5A6TC 1CI1A 4OWGA 2P10A 1IZKA 3KOXA 4NRRA 1JRBA 3QN3A 4IL2A 5FEXA 1XD0A 4EXBA 1TE6A 4W87A 1YTKA 3T2PA 5EY5A 2ICSA 4S2CA 4KMQA 3DESA 4RJEA 3PY2A 5FAJA 4QX4A 2TAAA 3WJWA 2V5LA 3S1GA 5D2VA 4RNFA 3W7OA 4MZYA 4QAIA 1IEQA 3GFYA 2I7GA 5J04A 3ZT5A 1TR1A 1DL3A 2DZWA 4DB7A 4UUIA 4OZOA 2WCSA 1XG3A 4P7QA 3PBMA 4JKMA 1Y5XA 1W5NA 3BXWA 4PMVA 4FZIA 5M1TA 2FTWA 2PTYA 3U0HA 1V7AA 4ICNA 2Q6ZA 4FNSA 1VFHA 3DCPA 1UR8A 2IQTA 3W3OA 5A6SA 4W8BA 1F6PA 3TN4A 3CHCA 4M29A 1EJUC 5C8BB 4AZ5A 4KQNA 3UG8A 1ZJHA 3KDOA 3OLEA 1XIDA 2JQXA 3MWAA 1MUMA 1UC4A 2TSYA 4NRSA 4Q6XA 3M0KA 1W8GA 1XLLA 3DX5A 1DXIA 2MUCA 3N15A 1E0TA 3ZLGA 1TIMA 2W92A 2P53A 4D1IA 3MI3A 1KFBA 3LERA 4W86A 5A94A 4I90A 4I5RA 4PCTA 4XZ9A 5EBUA 1DIOA 5CC5A 5ABFA 1VYRA 2DJXA 2KX9A 4WXYA 2V3FA 3VGHA 4US5A 4AH7A 4AZHA 2EPOA 5BXRA 2PSNA 2DV0A 3GXDA 2BHZA 2WYSA 3I6EA 5K9DA 3APTA 5AB3A 1ZNNA 3WMSA 3POHA 1ZTVA 3NZGA 4O8RA 2OLSA 3IJDA 1Q5MA 1U33A 2QPXA 4A3RA 1JYWA 2WZIA 2JF7A 4G2DA 2DZPA 4GNVA 4NXSA 1QPNA 1QJWA 1HG3A 1W31A 1V8EA 3P3BA 4MDOA 2IPGA 3PPHA 1XD1A 3UWZA 1IXPA 3CMFA 1GVEA 2VFEA 5KTLA 3KBWA 2QCDB 3IIPA 1P0NA 4UB9A 2QCGA 3FXGA 3O3RA 3OBKA 4L64A 2HK1A 2J7BA 4XO7A 2VFIA 4AWSA 4RNHA 1W1B1 1NARA 4C1KA 2PDJA 3WBEA 1W91A 2XHYA 2J7EA 3W07A 2PU0A 2HNHA 2VKZG 3UERA 5M5DA 3GXPA 1FWNA 1QASA 3LRLA 5HJYA 2GGEA 3Q45A 2C0AA 3LBOA 4F2UA 1OFQA 1IZCA 4MJ2A 4D6JA 1JCYA 4EPEC 3V18A 4A8NA 1JUEA 3HO8A 5LA2A 2YXGA 1F3EA 1DWGM 1GHRA 2IXVA 5E5CA 3WK2A 2E1DA 3FXYA 2CERA 4LYPA 2WLYA 1YEYA 4D71A 3IGSA 5IOBA 3HQOA 1QI2A 1NOUA 3NQEA 4H83A 3HGJA 4R34A 4Y9PA 2NXHA 4WKAA 1X96A 1B9BA 1XIGA 4IICA 1F4AA 1X97A 3BJSA 3B40A 3VUSA 1UPPA 2JIWA 1ZBCA 4CNSA 2A6LA 1FTXA 2CW6A 2V68A 4UFJA 5E9XA 4V2XA 3WD3A 1LBMA 1F3XA 5EMKA 4AFYA 2AGTA 4KFOA 1G0CA 3T0BA 3LM3A 1MXSA 3C2RA 1NU5A 1TPWA 1WCGA 5FJTA 2NUWA 1TUXA 2X7VA 3BZGA 1EYWA 1LF1A 1JUBA 2D2HA 4S3FA 4MNJA 2C0HA 1DVJA 3GC4A 4C91A 4LFYA 1HNYA 1V5XA 1TVPA 1MI3A 4WOZA 4X9SA 4Z1DA 2R1PA 3QHNA 4IL0A 1VBJA 1PHQA 3QYSA 4TTUA 1VBRA 4HPHA 4TTGA 6PTDA 4DF0A 1P1MA 3IANA 4IFKA 4NL1A 3CWNA 1HP4A 4I5UA 1UOKA 1BTMA 4OVXA 1WYIA 1H7RA 2VT0A 3B8IA 1ODUA 1WDWA 5G5IA 1A3WA 2OX1A 5FJRA 3T0AA 2WKLA 4RPPA 5CAHA 3BAKA 4RNIA 2UWFA 4GZ7A 4POCA 4Q8QA 2VEKA 4UZUA 1OX4A 2CLHA 3B06A 1QWKA 3GXFA 2X05A 5EB8A 4FXFA 1KFEA 3GNOA 5DANA 3C2EA 1FCUA 3KRUA 3QH2A 4QDPA 1VYSX 1EOKA 3FHQA 4Q6JA 5CLTA 4L80A 4UCFA 5GJPA 2FJUB 1UBSA 1IF2A 2A4AA 4G7FA 1SR9A 1TX0A 4F48A 2I14A 4EE9A 5GPRA 3WH6A 2NT0A 4IP7A 1G7VA 4QCEA 4O13A 3ARUA 3AIQA 5HQMA 4W84A 2C1IA 4MKVA 2H9AA 3W6LA 3CMGA 2RDWA 3W73A 5AHLA 1QPKA 1HO1A 4IM4A 3HPZA 3WQOA 1EUNA 4N9EA 3H70A 1KCKA 2P50A 4BJHA 1WAUA 2YCEA 3O15A 4QJ3B 1GW9A 4LUTA 4H6EA 5FESA 1QW8A 1E1EA 1MQPA 2IQ0A 2VRQA 3AI0A 4JN8A 4RNJA 5I02A 4CVWA 3NZQA 4ZQPA 3DFOA 4QQUA 3W83A 3GHUA 4FS9A 1JD9A 4B4FA 2PC4A 4WK9A 4PTVA 4ZODA 3AROA 4AHOA 4PA8A 4GBDA 2YCKX 2C16A 1ZRQA 1BFNA 1BVNP 5TBOA 2PD9A 4DZHA 3W9ZA 1HKVA 4J7RA 3MHUA 3IVTA 3ZFHA 1NF7A 3IK2A 4L4LA 1V0NA 2E7FA 3CUXA 2ZX5A 2X30A 2PWVA 1UOZA 1I60A 4KEUA 4I8DA 1H4PA 3JR2A 5CSSA 2BP1A 1IWAA 4M1RA 4Q4MA 1RV8A 4HCDA 3SCPA 1JPHA 2AKZA 1F8IA 1SYTA 1OBAA 5F1VA 1NJJA 1XCWA 1E6ZA 1FCQA 3BV7A 3TWBA 3BG3A 4Q22A 1NY1A 4WJ8A 1AJZA 2X1SA 2F8QA 1GVSA 2GWGA 3L5LA 3XIMA 4QE5A 5U4NA 4HNUA 3S1VA 2FZMA 4GVFA 4GNJA 1BVZA 4BQ2A 4TV5A 4K68A 1OC5A 3C52A 2FZ9A 5BNKA 5LIUX 4FNUA 4LALA 1YPFA 3MUAA 1XDLA 2P3ZA 2VRKA 4KRZA 1OX6A 2GJPA 1LLOA 1UD5A 2FH8A 1GCYA 4CQBA 4LC6A 2ODOA 4HN4A 2E6AA 3WLPA 1E70M 4C6DA 3DH7A 3E12A 2ABBA 1B2YA 2D20A 1UUQA 4MKNA 3DKJA 3VIHA 3LHVA 3PZUA 5M2FX 1G5AA 1CZ1A 3WLNA 3A12A 1NQKA 1OFAA 1JZ7A 2YDQA 1LL6A 3JU2A 2Y0FA 4FEZA 5JIPA 3T42A 3BLFA 1E4MM 3PS7A 3VKBA 1SO3A 3AWNA 3GTXA 1K8YA 3E3HA 1PIIA 4ZGYA 4KWUA 2XGIA 5TAOA 4LCSA 2V67A 3U5YA 1VJZA 1XH2A 3CIXA 4UR8A 3PHAA 4NZ5A 4UQEA 2QCHA 3UZJA 3LV6A 1DIDA 3MUXA 4MNLA 4PN2A 3QY7A 1DBTA 2E28A 1Z69A 5C71A 3RLHA 4LWWA 1GVRA 1E6SM 3MA8A 3QQ0A 3DFNA 1V08A 1VYPX 1RK6A 2A3LA 3M6YA 3NOYA 4S3JA 1NWRA 3IIZA 4IIDA 1THFD 1SR0A 1GORA 1V3JA 4A35A 2GVGA 1EP3A 1W5QA 2A79A 1KRAC 4UBPC 4WKHA 1W8SA 5LIXX 1FWAC 5F2GA 1B3ZA 3U2CA 4JTCA 1SO6A 5DBTA 3F5LA 1YHTA 2WM0A 2VDHA 1UMYA 2QCDA 3LI0A 4US5D 3KLKA 3PBUA 2X1TA 1SUXA 5C