1K3UA

Crystal structure of wild-type tryptophan synthase complexed with n-[1h-indol-3-yl-acetyl]aspartic acid
Total Genus 101
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
101
sequence length
268
structure length
268
Chain Sequence
MERYENLFAQLNDRREGAFVPFVTLGDPGIEQSLKIIDTLIDAGADALELGVPFSDPLADGPTIQNANLRAFAAGVTPAQCFEMLALIREKHPTIPIGLLMYANLVFNNGIDAFYARCEQVGVDSVLVADVPVEESAPFRQAALRHNIAPIFICPPNADDDLLRQVASYGRGYTYLLSRSGVTGAENRGALPLHHLIEKLKEYHAAPALQGFGISSPEQVSAAVRAGAAGAISGSAIVKIIEKNLASPKQMLAELRSFVSAMKAASRA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Tryptophan Synthase Alpha Chain
publication title Crystal structures of a new class of allosteric effectors complexed to tryptophan synthase.
pubmed doi rcsb
source organism Salmonella typhimurium
molecule tags Lyase
total genus 101
structure length 268
sequence length 268
ec nomenclature ec 4.2.1.20: Tryptophan synthase.
pdb deposition date 2001-10-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00290 Trp_syntA Tryptophan synthase alpha chain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 1k3uA00
5L9FA 2WNQA 2FDSA 2QCLA 5FEPA 3TA6A 5EYWA 4JDYA 2C3ZA 5F2MA 2ZRUA 3W87A 4QITA 2HMCA 3C52A 3LXAA 1LDCA 2NX3A 4FEZA 3L5LA 1TQJA 5F4WA 1IF2A 1AW2A 4QSHA 1PIIA 2QCCA 2VFIA 3IIOA 3ATYA 2BX7A 2C18A 3A5FA 3NM1A 1M7OA 3QQ1A 3P61A 3S1VA 1TV7A 4BR1A 3FYOA 1VYPX 1RD5A 5EY5A 4CCCA 1T8XA 3ABOA 1K7XA 3FKRA 4TR9A 5TBOA 2Q3RA 4IX0A 4IXXA 4KFNA 4U28A 3QSTA 2QAPA 2QJGA 1W3TA 4HSOA 2QUVA 3GAYA 5D38A 5HWJA 3RLVA 2GVGA 3JS3A 3LCIA 5AOUA 2QUUA 1XFBA 1NSJA 1YTKA 3WJYA 2E5BA 4DO5A 1F6KA 4NX5A 1H50A 1AW1A 1Q45A 3ABSA 3STEA 5D30A 3NA8A 1S5VA 2YDAA 4I7VA 1QDSA 1PVNA 4H6KA 3VKJA 4JR5A 1GTEA 3LERA 2WQPA 2I14A 1SW7A 2B4GA 4FIQA 4Z08A 4MIMA 1WBJA 2VKZG 4NJGA 4BF9A 3UY7A 3M16A 4UIOA 3M5ZA 5CPMA 1TPWA 3SSJA 1VPXA 3NPWA 3W72A 4GNJA 5HWNA 4N6FA 4DBDA 1EWDA 1ZHAA 4MUZA 4LC6A 1L2UA 4C1KA 1YDVA 4O14A 3CM4A 1EWEA 1NF0A 3W7NA 5KZEA 1AK5A 3W1MA 1EP1A 3CEPA 3NQGA 4NNCA 3W07A 4XUGA 1O95A 1K8YA 2RHGA 2ZZ4A 5C55A 4XTDA 4WOZA 3HF3A 2PCQA 4LV9A 5HMSA 4NJIA 1ZY9A 3ZR4A 3P5YA 4FX8A 3QC3A 2ALDA 4ZQOA 1J4EA 1NEYA 4K37A 5CZ0A 1UJPA 5I3IA 1OFAA 4LVBA 1CX9A 4JS3A 1HFBA 4XZ9A 3M1ZA 3H54A 3TAOA 2A4AA 5D37A 1DOSA 1EP2A 3B0VC 1FCVA 3T7VA 3KRUA 3SFKA 4AXKA 2ZDRA 4BWLC 1OYAA 1OFQA 4FIRA 3S9YA 4O1CA 3NQCA 1WOAA 4DQWA 4FNUA 5FEZA 1TQXA 2VOMA 4DO6A 1K7FA 3HG4A 2V2CA 4UTWA 3OIXA 5CPLA 4XKYA 5LGZA 4MKNA 3S1UA 3UWQA 3GXTA 1WQ5A 2VFDA 3TIMA 1U83A 4ORMA 2PRHA 1SUXA 3LCGA 3MP4A 3W1LA 2HSAA 3N14A 4EF8A 4P61A 1DHPA 4JX5A 5HR6A 4NXSA 3PF3A 4NNAA 4Z1BA 3W7JA 2WKJA 4MY9A 4O57A 3NZRA 4JYFA 1H7NA 3HMJG 4JICA 3EKZA 3FS2A 4FF7A 1L6SA 3IIVA 3GLCA 1SW3A 4BI6A 2H3BA 3H55A 1LLZA 2BTMA 2ISSA 4LU0A 1ZAIA 1SU5A 3C0JA 3LCXA 4TIMA 1FXQA 3CQ0A 1CI1A 4MZYA 1LYXA 3W7MA 4IX2A 2ISVA 3PBUA 1YXDA 4WY0F 5DCBA 5HR7A 3W7LA 1A53A 1KV5A 2WJZA 4O1AA 3W7CA 3NAVA 5BMWA 1VZWA 2OZ0A 2PRMA 3C8FA 4UTKA 1XL9A 1DL3A 2TRSA 2A1YA 3T4CA 1KM0A 1VHNA 3B8DA 1OFEA 2ZTJA 3QQ0A 4JTSA 3R8RA 2FPTA 4WD0A 1B57A 3PB2A 5E93A 3I68A 1J2WA 3FA5A 3W1QA 5CZTA 3NPVA 3OVRA 3C6CA 3FJ6A 3L5MA 4FNRA 4EVZA 3W1RA 3DKLA 1FY6A 4BK9A 1Q6OA 3I65A 2J27A 4TU1A 5DBTA 1WAUA 4UC5A 2WNZA 4XQ6A 3T44A 4UFHA 5AHNA 4MJMA 4O28A 3TR2A 3N2MA 4OE7A 1QMLA 2V81A 3K30A 5D2XA 1KLYA 4IUOA 2FB2A 3LM7A 1IXPA 2NUXA 5CZSA 3O16A 3LV5A 3ELFA 1FWTA 4H3DA 3G3MA 1W5OA 3S5OA 1OYBA 2J88A 3T40A 2NXIA 3BG5A 3IVSA 1TIMA 1XBYA 2KZHA 4UFLA 4ZQMA 4AH7A 4M6PA 1WA3A 1WYIA 5FEWA 3NEVA 2R8WA 5K9XA 1G7UA 1TJPA 2CLKA 2ZRWA 5EKYA 3LRKA 1F76A 2FTPA 3MP3A 2F84A 4OQVA 1GQNA 4PC8A 1H1ZA 2CWNA 3QEZA 5D03A 1H51A 2X1UA 5J5RA 1B4EA 2NWRA 1BKSA 1WV2A 3SIZA 5J5DA 1G6CA 3W71A 4BFAA 3LB0A 2Z1BA 1RV8A 1F2JA 4L4LA 3P60A 1NFBA 2F7FA 3DFTA 1Z42A 4UTJA 2O7SA 2VELA 1GVRA 3CC1A 1Z48A 3GDRA 1RPXA 3HGSA 3L68A 4FX7A 4GC4A 2A6NA 3O6CA 1XI3A 5D2TA 1KM5A 2Y62A 4CLMA 1GWJA 1TPB1 1SQ7A 3USBA 3BG3A 2QDGA 3NQFA 1I2QA 2H90A 1J5TA 1FWSA 1KTNA 1VYRA 3UXAA 2A7NA 3I7RA 4AAJA 2X1TA 1UCWA 5FI8A 4JYDA 4G1KA 3JRKA 5BW6A 3QMTA 4IPJA 3W22A 3GB6A 3KVMA 2B7QA 3DI1A 3YPIA 3TW7A 1KTCA 4AWSA 3MI2A 2CLOA 1GYNA 2V5LA 1UUMA 3LCWA 5DELA 1TPC1 3TXZA 2VC6A 5DXXA 3EB2A 2GVJA 5H91A 1A5CA 1LLWA 1ICSA 1RQBA 2AGKA 5AHFA 2C19A 3CU2A 5C2XA 2B7OA 5HJLA 3QW4B 4UNLA 4UXDA 8TIMA 5HULA 4LUJA 1TCDA 5CZJA 3FKKA 4LT9A 3L67A 2AAMA 3N73A 3ABRA 4Y96A 4ORIA 4O1DA 3O05A 4CNNA 3W7PA 1W0MA 2QCHA 3LLFA 3N34A 3LRLA 3P84A 2VFHA 1GTHA 4LWWA 2EKCA 3PSVA 3MHGA 4UFKA 3BV4A 3LBCA 1I2PA 2Y7EA 1P0KA 4KWVA 2Y61A 4WY0A 1BEUA 1W5PA 2DZXA 5U4NA 2XN1A 1LOQA 3W73A 2CLLA 2J9ZA 3LHUA 4HPJA 4Z0SA 3TAKA 4X2RA 3NQ7A 1FDZA 2XN0A 3UYCA 4O15A 1F6PA 1D3HA 3CWOX 3G1AA 3ZWSA 3W1TA 1H7PA 3ABQA 3FIGA 1QFEA 3UPBA 3TU9A 3A9IA 4M5PA 4GRSA 3S42A 4HNUA 1PL9A 4RV8A 2RDTA 5I3GA 4PL2A 3E02A 3BO9A 4OV4A 5FF7A 5LNRA 2QCEA 3FEMA 1VR6A 1X6UA 2G97A 3BW4A 1DQXA 4LW7A 4NXKA 5T26A 5D05A 3W85A 4E2BA 4HNNA 4BI5A 4EWND 4OT7A 2PURA 2QJIA 1O60A 3IIXA 5LNVA 4S2CA 4GUGA 4AWUA 1FXPA 3W2KA 3FFSA 1L6WA 3PG8A 2TSYA 4PCFA 1L6YA 5FF3A 4CNOA 3NR0A 4AF0A 3LBMA 4KFPA 1JUBA 3DI0A 3QMRA 5F1VA 4QNEA 3G1DA 5LNUA 2B0MA 1CW2A 1O4UA 1ALDA 5D04C 3SR7A 3TK7A 3NG3A 3NYZA 1H1YA 3NO5A 3BG9A 4DEFA 2V9DA 1LBMA 2ABAA 1S3HA 5KMYA 2ZQ0A 3UY8A 3DZ1A 4ADUA 1TRIA 4O53A 3RU6A 3A21A 5IBXC 4XWUA 2QJHA 1GYLA 1TYGA 3KVLA 3PM6A 4JY9A 2PRLA 1H7RA 4QQ3A 3CPRA 1KV8A 3CLMA 2GQ9A 1EUNA 4IMEA 2VFGA 1LM1A 2DJXA 4JTUA 2CW6A 3WJXA 4IPIA 5CGQA 4EF9A 2E77A 2BLEA 3S8HA 3EXTA 3W1UA 5A5WA 3SI9A 3D0CA 1EP3A 5HINA 4RZ5A 1LTDA 1ICQA 5E0KA 1LROA 3E49A 3TKFA 1OX4A 4YXGA 3TQKA 1XBXA 4M7TA 4DPPA 3LTSA 3TSBA 2E6DA 4TMBA 3FYPA 1GT8A 3A22A 3LLDA 1JCXA 2BWGA 4NJJA 4YMZA 1TPDA 2V2DA 1JULA 1YTDA 4JTJA 4BI7A 5HUPA 3PR2A 5I3HA 4N9DA 3LOTA 3OA3A 3GKAA 3HOJA 5DY3A 1XKYA 4JTGA 4KWWA 1G67A 3UPWA 1OF6A 1MEWA 1TTPA 2Y63A 4DPQA 5AYZA 1VGAA 5A8GA 1D3GA 1KFKA 2RH9A 1SO4A 1ZAJA 2FLIA 3DH7A 5EBUA 4M19A 4DXVA 4OBTA 3CT7A 1R2TA 1QWGA 5DCDA 4N6EA 2ZA3A 3LDVA 4QJ1A 1I2OA 1XBVA 3BK0A 5K3VA 3P8IA 3GNNA 4RKAA 1NAL1 5AN7A 4HT3A 5LNWA 4M7SA 3PG9A 3BPWA 3P5ZA 2X30A 2VEPA 3HGJA 3DHDA 1KFCA 2DZSA 3HG5A 4S1FA 1DKWA 4GUIA 3DXIA 1MZHA 3G0SA 3LI0A 1AW5A 4O0KA 1HTIA 3QMSA 1VH7A 3IGXA 1K8ZA 3TNOA 5E1QA 1KTBA 3P67A 4RK8A 1O5KA 2E6AA 3NL3A 4LVFA 1AMKA 4N02A 3ZFHA 3TMLA 1T0OA 1VHCA 3W74A 2YSWA 4RLIA 3VE7A 2JGQA 4JTKA 5LNSA 1ML1A 3VCRA 5KZDA 2A7RA 4P2VA 1QOPA 2I9EA 2DZUA 3PS7A 4HNTA 5G4WA 4Y6GA 1PV8A 3L5AA 4YCOA 3BW3A 1VJIA 4QISA 3QJAA 3NZ1A 3EWXA 3I6RA 4OV9A 3F03K 3UQNA 2DU2A 4LS0A 4QIUA 3UD6A 3RLUA 1TTIA 3NGJA 3NPXA 3B05A 4E38A 1OHLA 3NQ2A 3TXVA 4K36A 1HO4A 5AC7A 1QNVA 1VCVA 4DF1A 1H7WA 1NF7A 2VEMA 3DFSA 1UB3A 5FF0A 2JKEA 1W56A 4HKPA 2ZTKA 3DU0A 1E51A 5DXYA 3G0UA 3CIWA 4JDBA 1JUKA 2A0NA 3EWWA 3GVGA 3NQMA 2QCNA 3GXPA 3P62A 3RFAA 4UNKA 1RQHA 1THFD 2GQAA 1JJKA 2WV8A 3W86A 5F2GA 1PCWA 3F4WA 3MYOA 1S5WA 2Y88A 3N19B 4UTLA 4AWTA 3TC7A 2FQIA 4TMCA 3QF0A 5LHFA 3INPA 2V8ZA 4O10A 1TV8A 3B06A 4Z1DA 1LBFA 3KOFA 4IMGA 1FCQA 1SO5A 3CHVA 3LV6A 4O18A 1IXNA 2QEZA 3W7GA 1FDJA 4NZJA 2ZZ6A 4QNWA 2TPSA 2J9YA 3LX9A 1FCUA 4O54A 3P7YA 1P1XA 2FB3A 3C56A 3Q58A 2ZFAA 1VYSX 2Q3OA 3T78A 3EXSA 5CSSA 1R47A 3TQ0A 4N4QA 3LCHA 4O50A 3MHUA 4PODA 4DO4A 4UMBA 1MSSA 1R30A 5CG7A 1MO0A 4UTIA 1YDNA 3L2IA 4JTEA 3BLEA 4JXCA 5DY2A 2JBMA 4ZMGA 3CIXA 3NL6A 4MFDA 3W7HA 1JCJA 3MO7A 2GPTA 4MZ8A 1W3NA 3MI3A 3S6DA 3S5NA 1N7KA 2YCEA 1TTJA 2OT1A 2NLIA 3PUDA 1T99A 5AHIA 2TYSA 5U7SA 3O06A 5EL1A 5SWUA 2CLEA 3TC6A 2JGYA 1JCYA 3EKLA 3MUXA 5IBXA 2NZLA 3N9SA 3PULA 3TUUA 4JNMA 3GDLA 1G4EA 1LRNA 4YLWA 4UR8A 1MXSA 3STCA 4JX6A 4MZ1A 3W2LA 2BXVA 3V75A 1MEIA 3LXCA 2EHHA 3PBYA 3BLFA 3NNTA 5I3KA 5F2IA 1FCBA 1LRTA 3TH6A 3KAOA 3R12A 3R13A 3NQAA 3M43A 4R33A 3W7EA 1KM1A 3B4UA 2ZZ1A 1EPXA 2ZZ5A 2JKPA 4Q4KA 3KFTA 4KKXA 1GVOA 1GPWA 4UMCA 2NX1A 4RXFA 2DZTA 3IIPA 4UFJA 3GR7A 3G1VA 2Y89A 4HHPA 1KW1A 1QPNA 3F1QA 2PE4A 2YZRA 3W2NA 3OVPA 4NU7A 4A21A 3GIYA 3W2UA 1KFLA 3FJLA 4AHPA 1TPVA 2P10A 3QPZA 4MYXA 2ZBTA 1W1ZA 1HG3A 1TPEA 3B04A 1OFDA 4JTTA 2DZWA 3C2EA 3GKFA 2X16A 4K7VA 2R94A 2YFNA 3KRSA 1WBHA 2CZEA 1OF8A 4N9CA 1TPFA 1G4SA 3TCEA 4D2JA 4LOCA 5G4EA 1FQ0A 1HO1A 3GK0A 4X22A 1ZENA 1G7VA 3NXFA 5DCEA 1QCWA 3NPUA 1H7XA 3O1NA 4IGHA 2CLMA 4YL2A 1H63A 4RJEA 4JTHA 4JN6A 1ADOA 3GDKA 4K38A 4FHAA 3WJSA 2NV2A 3DFNA 1TPH1 1XBZA 2A85A 3STGA 4MY8A 3HG2A 3G1XA 5D2VA 1OABA 2I1OA 4WQ6A 5CPNA 5AFDA 2ZRYA 1GOXA 5HWMA 1G69A 1GVQA 4XKYB 3L65A 1K8XA 4O4WA 2C16A 3THQA 1K03A 1YXYA 2EAWA 3W7RA 1X1ZA 3MYPA 4ZZ9A 3QYQA 1SZGA 3QH2A 1GZGA 4Y9AA 4RZ6A 1ME8A 3OEXA 1JUEA 5KTLA 4GUFA 5GVJA 4IOTA 4O16A 3W7DA 3W84A 3EX1A 6ALDA 1W54A 1KA9F 3HPZA 3WK1A 1KM4A 4CQAA 1LOSA 1I2NA 1U5JA 4X9SA 3PBVA 1SO3A 1YADA 2C15A 1VLIA 1LCOA 3W7OA 3W88A 5F1UA 1Z44A 4ML9A 4FO4A 2J24A 2GQ8A 2VFEA 4NJHA 4AMAA 4BWLA 4A2SA 4NZFA 4WXYA 4HNVA 5IM51 2HS6A 3NQ8A 4ZVJA 1DORA 3PAJA 3G8EA 2WNNA 2FFCA 1X8FA 4UR7A 2Z6JA 4NVTA 3EEGA 3QM3A 4JYEA 1YXCA 1FWWA 3OG3A 3LHZA 2A7PA 1GG1A 2BSLA 1AG1O 4NT0A 4ZQNA 3VI2A 3M6YA 3EWYA 4CQ9A 4IXHA 2AQWA 4JEQA 1OX5A 4JIQA 1K3UA 4LVDA 2H6RA 3T55A 3EXRA 2TMDA 4K39A 2ZYFA 1ZNNA 1IXQA 1EX5A 5LSMA 3GZ3A 2W79A 3DFOA 4E0CA 1SW0A 2YW3A 3EX6A 2YPIA 4A3UA 4YCPA 1RR2A 2ZZ3A 3SZ8A 4Z1CA 1JRBA 3EX3A 3R2GA 4LNYA 3TFCA 3IVUA 4FX6M 3W7QA 4XTIA 3UWVA 2QCDA 4FXRA 3M7WA 3EWZA 3TQVA 4TO8A 1TV5A 2CLHA 2WSYA 3BGGA 4O11A 4UTWC 2B7NA 5AYYA 1C8VA 3AJXA 3P80A 1F5ZA 5AYXA 3NQEA 2FPYA 3M5XA 2EPHA 1ME7A 3C2FA 3C4UA 3FOKA 3PSWA 1R2SA 4O4VA 4ADTA 4EIVA 4O8RA 4PTNA 2UV8G 2H8XA 3KX6A 2FJKA 3HPSA 2ATMA 1FUYA 4M6QA 4AB4A 5HQEA 2WSRA 2E6YA 3MP5A 2D73A 2V5BA 5LZLA 4K6AA 4NNBA 3G1HA 4PH6A 1Q6RA 3HPXA 1TJRA 2DZPA 1OK6A 1KLZA 1VLWA 2ISWA 3C2OA 3Q94A 4CQ8A 4NUWA 5D02A 2R91A 1KFJA 1KM6A 4I9AA 1SFJA 2WO5A 4MVAA 2NXGA 2YXGA 3S0CA 5G5IA 3QFEA 2NX9A 2OX1A 1QOQA 4CCEA 3N2XA 2CLFA 2VXNA 5AHLA 3TMQA 2ZZ7A 2DP3A 4GFSA 4MLRA 2H3DA 2XFWA 2RFGA 2YX0A 4WZHA 1OFRA 3C2VA 3HGRA 5G1YA 3GNDA 5K9DA 1ONRA 1JR1A 2C1HA 4C1LA 4TX9A 4MOZA 3QRHA 1QPQA 3IRDA 3O15A 1A5AA 1RQEA 3FLUA 2GUUA 4IQLA 1ZALA 4GUHA 1OX6A 3HJZA 4FNTA 3ZS4A 5EMUA 2ZA1A 1QPRA 1M6JA 2VEKA 3L66A 3M41A 1X7FA 3KVKA 2QUTA 1ZJIA 2YW4A 1BWLA 1EIXA 3KRZA 3E0IA 2RDUA 4HIBA 4ZQCA 2E09A 3U6WA 1LORA 1DQWA 2NUYA 3P74A 5CPOA 3VNDA 3MWAA 1FDYA 3MI6A 3W23A 3W6YA 2QF7A 1FWRA 5D2YA 1A50A 1LP6A 2OCZA 3DKJA 3M47A 3W1NA 3W9ZA 1TPUA 4LS2A 3SY5A 4NX0A 3L21A 3GDTA 1SZEA 3E96A 3M5VA 4Y90A 2X2GA 5AC6A 3TX9A 2ABBA 3PUOA 3MMTA 2W0UA 5LHEA 5AC8A 1TSIA 3NQDA 2G95A 1TO3A 2ATSA 3W7IA 2YR1A 3GX9A 2JK2A 1WOBA 4L4MA 4DBEA 1VCFA 4MY1A 4WY0B 5BNKA 4DF2A 2G96A 3GXNA 4PA8A 5BMXA 4XBSA 5CKSA 2IQTA 2DORA 1A5BA 1TTQA 4IWWA 3U8GA 1JQXA 2Y85A 1QPOA 4N4PA 4CNPA 2Y7DA 3WK0A 1B9BA 3MJYA 3NDOA 1SSDA 1WDWA 1SFLA 1JQVA 3DFPA 2CFFA 1NVMA 1FWNA 4WX2A 3LI1A 5FEXA 5KITA 2ZCGA 3BARA 3Q2DA 4IMCA 1DJQA 1GG0A 1N55A 5EA9A 3MW7A 1EA0A 2QCDB 3M0ZA 2OJPA 3WFAA 1T96A 1K02A 3C3NA 4WXZA 3W76A 3O8AA 2V82A 1SO6A 3W70A 2NUWA 3CWNA 3LTYA 3G1YA 5K4ZA 1ME9A 3UXDA 3TW6A 2RKXA 3NQ6A 5BRBA 4POCA 3LRMA 2R14A 1KFEA 2Z2UA 4AF0B 1H5YA 4JTIA 5F4SA 3HBLA 4UMAA 1QO2A 5H2ZA 3G0XA 1ICPA 3S1XA 1MEHA 3QZEA 3M44A 4ADSA 2NV1A 3SGZA 4YWIA 2E6FA 2E1DA 3A24A 3KVJA 4A22A 3LCLA 3DBPA 5LKYA 3UZ5A 4U4MA 1QO5A 2EF9A 4HN4A 3IGSA 5I3FA 1JVNA 3E9AA 2LLEA 4JTFA 4Z1AA 1GVSA 3QW3A 3W2MA 1B4KA 3BW2A 4FNQA 2P1FA 3KHJA 4K7YA 3IGUA 3L0NA 4ICNA 4LRSA 1XUUA 1YTEA 2A21A 1ZAHA 3TV8A 1ZFJA 3UWUA 3S5YA 1R46A 2XN2A 2GVLA 3STFA 5F4XA 3BGJA 5G2IA 5KSWA 5L6UA 4ALDA 1PS9A 1Z41A 4GJ1A 1OX4B 1RVGA 1SPQA 4MLJA 1I8JA 1KBJA 4N9EA 2ZRXA 1K7EA 3DGRA 4RR4A 1OFPA 5D09A 3EWBX 4GUJA 2RDWA 1OVDA 3B0PA 3HGOA 5G2WA 5TQLA 3IV3A 4E2DA 4I7UA 3W75A 2C0AA 3G1FA 2DJLA 2E5CA 3E12A 5D2WA 3B0UX 2X1SA 1D9EA 1W37A 1P4CA 2QDHA 5C54A 5MHBA 5D32A 4R7JA 3GR8A 3HQ1A 1YPFA 2A6LA 2G5WA 1W31A 1Q6QA 2PC4A 3SJ3A 2CZDA 3Q37A 3W1XA 1O94A 4DF0A 2WSQA 2W6RA 2ZRVA 4OWGA 1WXJA 4LRTA 4R53A 3LHWA 4PEKA 2B7PA 3N9RA 4JD4A 3WK3A 3O63A 4S2BA 3BVJA 1SR9A 3NL5A 3GDMA 3DHFA 4FXSA 1ZCOA 3O07A 1LOLA 3HIJA 1KBIA 4LVAA 1RZMA 3S5ZA 1B3OA 4UFMA 3LGEA 5FF2A 2X1RA 2Y70A 5HUOA 2OT0A 4UTTC 1TMHA 2QAFA 1XDMA 2J9XA 3IIZA 1LRQA 3MHFA 1SZNA 4H4IA 5AHMA 3L0GA 3W2JA 3OHIA 1JCLA 2FIQA 4UTUA 4FB7A 1PHWA 2E68A 1UASA 1GJPA 4HSNA 1F73A 1LZOA 4RXGA 3KXQA 3UWWA 4O13A 1F74A 1H60A 3LCFA 3EX4A 3V1PA 3TSMA 4RX0A 4O0ZA 1O5XA 1H61A 1VQTA 4UCGA 1YLVA 3TSDA 1UUOA 3OVQA 1JCNA 5K7JA 3W1PA 1DVJA 2DZVA 3G8RA 2CU0A 3A5VA 1PCKA 4O1BA 1WX0A 3G22A 4LC8A 3RNDA 4O12A 1P5BA 3TDFA 4MYAA 1VS1A 3RK8A 3SGUA 5C6MA 2C14A 2CLIA 2ZRZA 3TJLA 4OHQA 4PL1A 2Y7FA 2V2HA 2OMAA 4AEOA 5LGXA 3CTLA 4WOQA 4LTSA 1P0NA 3A23A 4Y8FA 4AHOA 4CCDA 3NOEA 4Q32A 3UNDA 3AO0A 1PE1A 5K9CA 2NXHA 3TE9A 3DENA 1OK4A 4GE8A 3HB9A 4OU1A 3R5EA 3I7QA 4Z0JA 2YYUA 4AHQA 2Z6IA 3M9YA 5ABTA 1XXXA 5I3JA 3EX2A 5EPDA 3EWUA 5AB3A 3W3OA 4RCXA 4IMDA 2GJNA 1OFBA 1XDLA 3P8JA 1N8FA 4J9JA 4LV4A 3ANYA 2QCGA 1YYAA 1BTMA 1AL8A 2FPVA 3F4NA 3LHYA 5DLCA 2BZNA 2V30A 3PBWA 1W5QA 4B5NA 1KM2A 3DFQA 1XM3A 3LHVA 2NWSA 1I45A 4N2YA 1DV7A 5DBUA 1KFBA 2YFOA 4MPQA 1IGSA 3WJZA 4LVGA 3P82A 5D33A 3C61A 1UBSA 3LXBA 2E5DA 2YYTA 3VE9A 3DAQA 4NJKA 2WOQA 3O6YX 3G3DA 1V5XA 1XCFA 3N3MA 1HL2A 4OGZA 3ATZA 1IIHA 3TFXA 3B03A 5K4XA 1F05A 4JGDA 1W5NA 2Q8ZA 4IJBA 3GAKA 3NM3A 2P0OA 5C5YA 3TJXA 1OYCA 1G4PA 5FF4A 2EGZA 3ZWTA 1H62A 5CSRA 2Y6ZA 2Y7GA 1VC4A 2V0TA 2Q8LA 3HG3A 1OJXA 4FNSA 2CZ5A 4R34A 4RZ4A 1W8SA 5AHEA 3L9CA 1EUAA 1M5WA 1FX6A 5KZMA 4IMFA 3CEUA 4HPXA 1IIGA 3G18A 5BOOA 4GXMA 1QAPA 1M7PA 5FESA 1KM3A 1TREA 3UZJA 5HNRA 4ZL1A 3UWYA 1GEQA 3W83A 5K2ZA 2HTMA 3M5YA 4DELA 4UTHA 2JKAA 4LUIA 4O19A 4GBUA 2C13A 1XUZA 1OFOA 3G24A 4FNPA 3MBFA 1DBTA 1VRDA 3QSRA 2C6QA 3WJWA 3MBDA 6TIMA 3TROA 3SW6A 2Z0IA 2VFFA 1W3IA 3IVTA 3R89A 3G1SA 1Q3NA 3L0KA 3CB8A 3PC0A 4JIPA 3NL2A 2H8ZA 2HS8A 1SSGA 2YGYA 3PY2A 4GWEA 3LHTA 3RF9A 4K8HA 1DJNA 3PUEA 5DN1A 3JR2A 1HUVA 2QCMA 4LY8A 5G2HA 1PHQA 3HO8A 1XC4A 1A5SA 4W9TA 4NQ1A 2QCFA 1VCGA 3C2RA 3NVTA 5TIMA 4MFEA 4JY8A 1FBAA 5G1TA 4K8EA 4UFIA 4A2RA 1I2RA 3W1AA 1V7YA 7TIMA 4I7WA 3THAA 3H53A 1TB3A 1L9WA 4O17A 1YDOA 4XBKA 5F2LA 1AL7A 3VFLA 4ZQRA 4ZQPA 4UTMA 5KINA 2ZA2A 1Y0EA 2CZFA 1X1OA 1H7OA 4N9BA 2GOUA 4A29A 4X3ZA 1SZFA 3LTPA 1TRDA 3OBKA 1BWKA 1R2RA 1W5MA 1S5TA 1EEPA 3RMJA 3U2OA 4ONVA 1EB3A 4UTTA 4QM1A 4UUIA 1C29A 3I7SA 1Q6LA 4KFOA 1OG0A 1YPIA 2VEIA 4WJEA 2WPBA 3NQVA 3PB0A 4O52A 2GJLA 1C9DA 4MJZA 4WUIA 3BLIA 3IEBA 4QAIA 1IXOA 2VENA 1LBLA 1JCMP 3GYEA 4EOUA 1GVFA 4M6VA 1G4TA 2A5HA 2J6XA 3W7KA 3S1WA 4PFMA 4JTLA 1F7BA 3P81A 2ZZ2A 1JRCA 3PWAA 3SECA 3WK2A 4JX4A 3PVFA 4LS1A 2A2IA 2QKFA 1QR7A 2O7QA 2QR6A 3QPYA 4AVFA 3O6DA 3UWZA 1I4NA 4Q33A
chains in the Genus database with same CATH superfamily
3VIJA 1GOOA 5CC6A 3TA6A 5EYWA 4JDYA 3LM3A 3QY7A 4L9YA 3W87A 4FMVA 3JZUA 1GORA 5TAOA 4FEZA 3FNDA 4DUVA 5DT5A 1IF2A 3SUUA 2QCCA 4HPNA 3POHA 4EK7A 2C18A 3A5FA 2HV5A 1EDTA 3FYOA 1P6BA 1N82A 4E8CA 5EY5A 3EWDA 1R3RA 1T8XA 1DQUA 1JL8A 1K7XA 4N7QA 4TR9A 3REQB 3R94A 3TA9A 5M3WA 1A3WA 2W27A 4IXXA 1BSIA 2WJFA 1BYAA 2QJGA 4WCJA 4JEJA 5D38A 1RCOB 4W8LA 3BSGA 2QUUA 2PDYA 1AFSA 1YTKA 3L4VA 3WJYA 4AD5A 4XD6A 1FWHC 2GGJA 3U7VA 4NX5A 3T9PA 4IPNB 1H50A 4S23A 3RO6A 2YDAA 1JZ3A 2WVVA 1GTEA 1XGEA 3CHEA 2B4GA 3WY1A 2WMFA 1Q6GA 3M0IA 1WUEA 3SN4A 2AL2A 3BZGA 1VKFA 4Z2IA 1ISXA 4IZGA 2ZVRA 4Z42C 3VOJA 3UY7A 4S3GA 1GUVA 1TPWA 3CL8A 4AZHA 3SSJA 1JYWA 3EOOA 3QGKC 4AZGA 1VRXA 1NF0A 1D7KA 4GQGA 4A8LA 3W1MA 3RM9A 4WLCA 1K9TA 1K8YA 2ZZ4A 4AY7A 1OC5A 3HF3A 2J74A 3URNA 3ZR4A 4G7EB 1XPYA 3GS6A 5ABFB 4K37A 1UJPA 5I3IA 1CX9A 3KDNA 2CXEA 3QC0A 1OQFA 4PUWA 2QMKA 2OYLA 4XX6A 2A4AA 5D37A 2E40A 1DOSA 1BVNP 3EB4A 4LUTB 3SFKA 2X42A 2ZDRA 1QU4A 1DWHM 3S9YA 4O1CA 3NQCA 4DQWA 1OIMA 4G1NA 2EBNA 1TQXA 3WLRA 2VOMA 4GGBA 4OTKA 3B8VA 3OBEA 5D9NA 4K1GA 3EA3A 3OGSA 3SRHA 5CPLA 4XKYA 3VCCA 3GXTA 2VFDA 2G8ZA 1U83A 3WLNA 1OADA 4KETA 5DRIA 3ES7A 4NIRA 2OZTA 1NQ6A 1DHPA 2WMGA 5HNUA 1Z69A 4NXSA 3PF3A 2XG9A 4B5VA 4O57A 4JYFA 3P0XA 3HMJG 3CQIA 3FS2A 3IIVA 2BVDA 2ZADA 3ITVA 4BI6A 3VM7A 2H3BA 3WF3A 2BTMA 4AZ7A 4QEHA 3ITGA 2NV9A 2IUZA 2WJEA 3W6LA 1ZAIA 4DX3A 3LPOA 1FXQA 4DWSB 4EP8C 1XYBA 3H2OA 4IX2A 4NSBA 4HBKA 1M7JA 3VOFA 4XG1A 3VDHA 2Q01A 4RE2A 2XFFA 2PDJA 2D0GA 5HQMA 2XM2A 4JFVA 3T4CA 1O5RA 1QHOA 1GJUA 1KXVA 1OFEA 3B8DA 4L4PA 5E93A 1EHNA 3I68A 3C6CA 4DJDD 4BK9A 2E9MA 2PLKA 2HWGA 4EKJA 5I6SA 2W3ZA 4L9ZA 3ZSTA 1VEMA 5HAOA 4XQ6A 1PKYA 2XYLA 5AHNA 4MJMA 1AH3A 5I23A 3N2MA 4Q6XA 2PTWA 1QMLA 2V81A 3K30A 5D2XA 4CEXC 3LM7A 1EGVA 2JF7A 2NUXA 4H3DA 4G9PA 1ISYA 1LQ0A 3G3MA 3H24A 3U5UA 2GGEA 1TG7A 2J88A 3VTRA 3T40A 4CD5A 2NXIA 3FVDA 3RRAA 1F07A 2KZHA 1W3KA 1JZ6A 3MDUA 3CV6A 1TJPA 3QPEA 2ZRWA 3LRKA 3GUGA 3UG8A 3MZNA 4H1ZA 3QEZA 3ARZA 5J5RA 2NWRA 1BKSA 1WV2A 3SIZA 1GQLA 1NWSA 1XQLA 3THDA 1GKQA 1RV8A 5HJXA 3T05A 4JFSA 1LWJA 3ARSA 1CXHA 2VELA 4YYCA 1CGVA 3RLGA 1ENUA 3GDRA 4F9DA 3H2CA 4GC4A 5D2TA 4PUDA 1QK0A 3VILA 4MJ2A 3GBDA 1TPB1 2X0YA 3USBA 4QTGA 4JL1A 3KCJA 4ES4A 4D6IA 4M51A 4YVVA 4M56A 2A7NA 2DUAA 3I7RA 1E5JA 4HYVA 3MKVA 5FI8A 3S2NA 2JIWA 2VCBA 3F7JA 3UF9A 4IPJA 3KVMA 5AC5A 1EJXC 4TUFA 3MI2A 1GNXA 1KXHA 1GYNA 2V5LA 4BY3A 3KLLA 3LCWA 4AISA 5H91A 1JCTA 1RAKA 1ICSA 1NY1A 3AS0A 2XIBA 3O0KA 3QW4B 4UXDA 3CMJA 3E0WA 1DWAM 4REQB 4MWAA 2DUXA 3MUY1 3FKKA 3L67A 3L12A 1WE5A 1S5NA 3N73A 9XIAA 5HBFA 4ORIA 3ARRA 4O1DA 3T0AA 4RE0A 6REQB 1UPPA 4QJ5B 3MU7A 4ZOBA 4ACZB 4US5D 1GTHA 2PTZA 1VB9A 2DGAA 4LWWA 4PN2A 3PBGA 3O9NA 2Y7EA 1NELA 1CXEA 2DZXA 1LOQA 2CLLA 4Z0SA 4GCAA 1R3YA 3HURA 3NQ7A 3K8MA 4H8VA 4XKMA 4GVFA 2XN0A 2WPGA 4Q3MA 1D3HA 2NQZA 3TN6A 1H7PA 3ABQA 3UNTA 1QFEA 4JQ4A 4IIGA 4HNUA 3VGEA 1PL9A 4QFUA 1UR1A 1B3ZA 2J7CA 2RDTA 5I3GA 3E02A 1HZYA 3UT0A 1IT7A 1EXPA 1F8MA 5LNRA 3FEMA 3T4WA 3UERA 3CL7A 2XZ9A 4LW7A 1DQXA 1Z89A 2BODX 3FXYA 1E0XA 3W85A 4C6IA 1CDGA 5AYIA 1PZ0A 1S2VA 4YVPA 4OT7A 4C7DA 1PX4A 4HB7A 1UBPC 3MSYA 3W2KA 4XB3A 3O6AA 3PG8A 2TSYA 4XBJA 3WQPA 4PCFA 1L6YA 5FF3A 4CNOA 4OUEA 1R3QA 4AF0A 3LBMA 1P6CA 1E6SM 2E1WA 3BMXA 4KFPA 3W53A 1HQTA 2PTDA 4HNCA 2XSXA 1X96A 4JFTA 3TK7A 3DIPA 1H1YA 2NT1A 1LBMA 4GA8A 2ABAA 1S3HA 3FK4A 4DJFA 3TN3A 4ADUA 1Z3NA 3O7UA 1S39A 3DESA 3HZ3A 4E3VA 2QJHA 3T6CA 1UR2A 3CH9A 4QQ3A 3UYIA 1KV8A 2VFGA 1LM1A 3CUXA 4HNLA 5LIYX 4DJED 3ITLA 3VDBA 4IP7A 1MW2A 3EXTA 3L7RA 3SI9A 1KGWA 4L80A 3ARXA 1EBGA 3LMZA 5HINA 1ICQA 2EG8A 1LROA 3TKFA 1JAKA 3E2VA 3LTSA 1DIOA 2E6DA 3FYPA 1GT8A 4OFCA 1J0HA 3N2CA 4D6JA 3BCDA 4YMZA 2V2DA 3IJ8A 1JULA 3UGVA 4UQBA 5HUPA 3VIGA 3S1GA 3NVDA 5HXMA 5FACA 3GKAA 3LG3A 1TE1A 3HOJA 1XKYA 3AUOA 2WM0A 2QJNA 4KW2A 1KRMA 3IJ6A 3GXIA 1MEWA 2FTYA 4DPQA 4MGGA 3V0TA 2XFRA 1D3GA 2PDLA 2RH9A 3WKZA 4GX8A 3WLSA 1ZAJA 4TV5A 4P8VA 1A80A 3CT7A 1R2TA 4C6CA 2YCIX 3GW3A 3PFRA 1QWGA 4N6EA 3HFTA 4YVXA 2ZA3A 3VIPA 2ZXDA 1TIWA 3ZJ8A 4RKAA 3GIQA 5LNWA 4M7SA 3P5ZA 2X30A 3VKCA 2VEPA 1X1NA 3KW3A 1J12A 1KFCA 2DZSA 3WD2A 3UP8A 2WVTA 1TWSA 3D6NA 1DKWA 1MZHA 1UKOA 7ODCA 3BLPX 4KWOA 3QMSA 1K8ZA 3WQFA 3U4FA 1AZ1A 4HA0A 4LVFA 3VYLA 3ZFHA 5IHRA 3BANA 3IUHA 3S46A 1QPKA 3N4EA 4UOQA 1GVIA 2MANA 3L5AA 2PZ0A 4Z2JA 2E8YA 3QJAA 3I6RA 3F03K 4TVDA 1D3CA 3VGDA 2CKSA 4QIUA 4JQ3A 1VPYA 2XFYA 5D8ZA 1Q8AA 3NPXA 2YJQA 2Y5SA 3SCQA 4E38A 1JG9A 4K36A 3RILA 4J3VA 3H21A 2VI0A 3A3XA 2BOEX 2VEMA 3DFSA 5MKGA 2W63A 4BQ3A 2FJUB 4FSAA 1V02E 5DXYA 3C2YA 1JUKA 1SVDA 2PDBA 3GVGA 2DUZA 3WEZA 3UEQA 3MA8A 1BG4A 5CJNA 2CETA 2Y88A 3N19B 3LU2A 4AWTA 4HZ8A 1EXBA 2V8ZA 3IJ9A 4Z1DA 1E9LA 1LBFA 4IMGA 3LNMA 1XYAA 2HZGA 3CHVA 3I6TA 4O18A 1E15A 2Y5JA 2X1IA 3NIYA 5JH2A 1IXNA 1D8WA 5C8BB 3TYCA 4WEVX 2J9YA 4PMVA 1P1XA 4Z2HA 5CZKA 1BTCA 2R1MA 2ZFAA 3ITTA 3T78A 5CSSA 2YBTA 1Q13A 2POZA 1YDNA 3L2IA 4Z2KA 5DY2A 4ZMGA 3CIXA 4E8GA 2DSZA 3SCSA 5JIPA 2ZXQA 4AMCA 4OOUA 3MO7A 4HN8A 1TELA 4CGTA 3MI3A 5JXQA 3S5NA 2NLIA 4JTRA 5U7SA 5EL1A 3AHTA 2CLEA 3OU8A 4MNMA 1JCYA 3GNOA 4F3HA 3TUUA 2PMQA 4LPCA 3C5QA 1H1NA 1QW9A 4JTAA 4LCQA 4UR8A 5ECUA 4MZ1A 4IFRA 1MEIA 3LXCA 2EHHA 3PBYA 3P2VA 3C8NA 4J2MA 3WFLA 2ALRA 4WGXA 2HROA 3KAOA 4R33A 3W7EA 1E6QM 2WVVB 2ZZ5A 1XRTA 4P7QA 3EDDA 3GXDA 1V0NA 4IISA 1RA0A 4D6FA 3W38A 3RHGA 4FA3A 2XGBA 4LALA 2FZMA 1GQKA 3E3HA 3WBEA 3ONBA 4PMJA 2E9BA 1UOKA 4GISA 4A21A 1U1JA 3GIYA 5I79A 1XSKA 1W1ZA 3AOFA 1TPEA 4JTTA 4MB1A 6XIMA 2X16A 4K7VA 4X60A 4AX7A 1BG9A 1RK6A 2CZEA 1UH4A 2GGHA 5G4EA 2BY1A 1HO1A 4PBEA 4D71A 3B8SA 1ZENA 1BRLA 2O4QA 2WKLA 4U5IA 5A2BA 1VFHA 2R82A 3NXFA 1R86A 3W28A 2HXTA 4DWSC 3AZRA 1H63A 4JTHA 4AZ6A 4K38A 4RL3A 1RUSA 4URIA 3N4AA 2JQXA 1TWIA 1BPLB 2A85A 5D2VA 2C91A 5EFFA 1NARA 2INZA 4WQ6A 5CGMA 5AFDA 2ZRYA 2QVHA 3VAVA 2ISDA 3A3WA 1W3LA 1VJSA 2FZDA 3UZXA 4XKYB 4AD4A 2J7HA 1K8CA 1K03A 2VL4A 1YXYA 2EAWA 5A6BD 3W7RA 3I6EA 1X1ZA 3AMCA 3IJIA 2HBVA 1W1PA 1HN1A 1HKJA 5CPSA 2VOTA 1E1EA 6ALDA 4ZE5A 1KA9F 3HPZA 2VGBA 1KM4A 4CU6A 1U5JA 5DF0A 1SO3A 2C15A 3SCNA 3NURA 1W3HA 4H7VA 4HQVA 1Z44A 4UQDA 3S2JA 2VFEA 2I56A 3ONCA 3VDAA 4K3ZA 1E4IA 4UR7A 2Z6JA 3EEGA 4L1WA 2BGNE 1EJ7L 4AX6A 2VR4A 3OG3A 3LHZA 1GG1A 2H9AA 3H8AA 3PTMA 1CPUA 3VMPA 4JIQA 1EEXA 3C3UA 1E1FA 1KXQA 4J3TA 3EXRA 1IXQA 1EX5A 2FKPA 3S2MA 1H0IA 3EX6A 2JF6A 4YCPA 1HL8A 2ZZ3A 1J93A 3LPFA 3MVIA 1UKSA 3CAKA 2HE5A 3IVUA 4FX6M 1DE6A 4PTWA 2CCRA 2A3BA 4NG3A 4NHVA 3TQVA 2CLHA 2WSYA 3PZQA 1H4PA 3VMNA 3EBVA 3P80A 1F5ZA 3SY1A 1C9WA 2PPGA 4PYSA 3M5XA 3C4UA 3FOKA 1R2SA 1OT2A 2ZVIA 3PZGA 1MFUA 3QZ6A 2H8XA 4GD0A 4KEZA 3I4KA 3LUTA 2E6YA 3AXMA 2BB0A 3SCVA 4PH6A 1Q63A 2VTFA 1OK6A 1VLWA 2ISWA 3CHCA 3KBJA 3Q94A 4NUWA 4B16A 1SFJA 3MWCA 4QLKA 5G5IA 3NJ3A 3SUTA 4PULA 2PB1A 4B4HA 1EOMA 3BWWA 3ITOA 3N2XA 1MDLA 4GNKB 2CLFA 4GH1A 3TMQA 1PZ1A 3EGJA 3UW6A 1XLIA 2HPIA 2XFWA 3GNXA 2RFGA 1WKYA 4DBUA 1PKNA 4PMXA 4LBSA 1O6IA 2KAUC 1CGXA 4MOZA 4MNJA 3IJ7A 3IRDA 1A5AA 4GHRA 3FLUA 4F0MA 4RDVA 1DIKA 3LQLA 5A3HA 3ZS4A 5EMUA 3XINA 2F6XA 4UQEA 1JF5A 1QPRA 3M0JA 4NAEA 3V36A 3U3HA 3OPSA 1JDCA 2G37A 1ZJIA 2YW4A 2YB1A 1XRFA 4HIBA 2E09A 2YL5A 1B3WA 1DQWA 2NUYA 2RAGA 4MWAB 1G5AA 2QF7A 4Q8MA 5D2YA 1A50A 1LP6A 3DKJA 3M47A 2PWGA 1TPUA 4QRNA 3PPGA 4BJHA 4U3CA 1JZ7A 4KESA 2GWNA 3TX9A 4IQEA 3PUOA 1NDZA 3W02A 4L1XA 1OC6A 1PWLA 2G95A 1T40A 1I6NA 1TO3A 3W7IA 3GX9A 4HA1A 2OEJA 4L4MA 8CGTA 4DXKA 4Q4QA 5BNKA 2BG5A 4LCRA 4DF2A 3GXNA 4PA8A 5BRPA 3N04A 4QQUA 2XISA 3DHPA 1UJQA 2Y85A 4JIRA 3EDJA 4N4PA 4CNPA 1V3JA 2YLLA 2Y7DA 3GWQA 2XZ7A 1XLGA 2PFHA 4S3KA 2CFFA 1NVMA 3MKKA 1PXGA 1Q7QA 3ZT7A 3LI1A 5FEXA 3W82A 1GG0A 1CLVA 2J78A 1Q6EA 2J7FA 3IK4A 3LMYA 1EA0A 3KL0A 2V63A 3C3NA 5IDZA 3W76A 3P0WA 1EQCA 2V82A 3R1ZA 1J8VA 3CWNA 4HOZA 3RYSA 3MMUA 1WZAA 2BY3A 1ME9A 2RKXA 4WJXA 4DM1A 2HK0A 2AMGA 3LRMA 4RNIA 1KFEA 4AF0B 2DT2A 5XIMA 3G0XA 1H3GA 3BDKA 3UFYA 4ADSA 1SJBA 3ZOAA 3RDKA 3RM4A 1TR9A 5JU6A 4NZ5A 1P7TB 3UZ5A 4M1BA 5EGRA 5B7YA 3F2DA 1IWPA 5I3FA 3B8UA 4JTFA 1EF2A 1GVSA 1NDYA 3LA4A 3NSXA 4WKFA 3DDMA 3T0BA 4PRRA 5LIUX 1XUUA 4JAWA 4C6KA 1UKQA 4EE9A 5C0QA 3SQLA 4GKLA 2XN2A 3STFA 5F4XA 5L6UA 2ZICA 3AU2A 1A4MA 1I8JA 1KBJA 4BQ5A 5D4YA 2ZRXA 1NOFA 1K7EA 4I3GA 1QOXA 1EC7A 1N8IA 3W29A 3AISA 3OBAA 2RDWA 3WMSA 3B0PA 5TQLA 3UWEA 3IV3A 1EC9A 4TQTA 3W75A 2J7EA 3QLDA 1NJJA 2DJLA 3PZIA 4IQJA 3G6LA 4FLRA 5CQ1A 3CUHA 2UY2A 1FWDC 2Z25A 1KKRA 3GR8A 3MSRA 1FHLA 2OQHA 2A6LA 3WBXA 1E9YB 2C1IA 1UUQA 2CZDA 3Q37A 2W6RA 2ZRVA 3N13A 4PMQA 4QROA 3WF2A 1S2UA 2R1PA 1WXJA 4OZOA 4PUMA 4X61A 1SR9A 2QJJA 2CWXA 3DHFA 1ZCOA 2EPOA 1R3SA 3GD6A 3Q45A 4GBDA 3HIJA 1KBIA 5CC5A 3ENLA 4HHMA 1QHZA 3CUZA 1VFTA 4IJRA 1J0IA 5FF2A 3AALA 2OT0A 4UTTC 1TMHA 2HISA 3MHFA 4H4IA 1JZ2A 4PB4A 3W2JA 1JCLA 2F61A 3KBVA 5ABEA 1UD4A 2E68A 1WPCA 3R43A 3A64A 4NILA 3QTPA 4HSNA 1UD6A 4V33A 1YPXA 4P8XA 4E4PA 3LCFA 3HM7A 1NIUA 1O5XA 3WQGA 2PP1A 1VQTA 1YLVA 4F40A 5K7JA 1B31A 5AVNA 2OWCA 3LZ5A 1RLCL 4LSBA 2CLPA 2DZVA 3VZYA 4H01A 1XGDA 1XIEA 3CWHA 1GKPA 1WX0A 3AXXA 1TMLA 2BV9A 5ENLA 4HD5A 3TJLA 3H7VA 3CAWA 3GHSA 4PL1A 4F66A 3QBUA 4Z17A 3CTLA 1C91A 4AHOA 3NOEA 1Q4WA 4Q32A 3UNDA 1CB7B 1IE7C 5MKGB 2ZUSA 3E5BA 3HB9A 3R5EA 2HVMA 3WD1A 3M9YA 2ASHA 5EPDA 3CV7A 4KS0A 3EWUA 3W3OA 1OFBA 2WXDM 3P8JA 1N8FA 3PK7A 4E2OA 3CO4A 3IV8A 2VNCA 2IPFA 2IW0A 2FPVA 3HPAA 1NP2A 3WQ6A 1VBGA 3PBWA 3DFQA 5CAKA 2OKOA 3THUA 2E5DA 3VE9A 5M17A 5BXSA 3FAWA 3SCUA 2DQWA 1K70A 3N3MA 2C1GA 3ATZA 5K4XA 5A94A 2Q8ZA 4IJBA 3GAKA 4HMNA 3VOGA 4J3WA 2FMNA 3VGBA 1J0ZA 1OYCA 3ZWTA 5C2GA 2G3IA 2V0TA 4FNSA 2CZ5A 4R34A 3WDRA 1W8SA 3SJNA 2EG7A 2UY4A 5KZMA 1FX6A 1IIGA 4H19A 3QOKA 3Q65A 5BYWA 5FESA 3LBOA 3V16A 3UZJA 4FI4A 2PAJA 3A6OA 5HNRA 3EPMA 4ZL1A 3UWYA 3F5LA 4W5ZA 3W83A 3ZQ9A 4ZFMA 2XIMA 1U22A 2HTMA 1PIFA 4DELA 1CEOA 4O19A 5JBDA 1WNOA 4ZEPA 3ZLGA 1LWIA 1H0GA 1R5YA 1VRDA 3FHQA 2AAAA 2C6QA 3EZ4A 3WJWA 4ATWA 3TROA 3SW6A 1BXBA 3V0SA 2WHLA 2GOKA 1W3IA 3IVTA 2YXXA 2BFGA 1RH9A 1CCWB 3K8KA 2D2HA 2HS8A 2E3ZA 4GYPA 5LIWX 3LHTA 2PD5A 4K8HA 5DN1A 3VKBA 3JR2A 2QCMA 3SCTA 1TFVA 1A5SA 2P53A 1SJAA 4NQ1A 4NF7A 3CUJA 4MFEA 3VOCA 3KS6A 5CEWA 3ZJ6A 3U5YA 4JY8A 1FBAA 3TP4A 3MT1A 5I00A 4UFIA 3U4AA 2Z1VA 4QDWA 1TCMA 5CJ5A 1L9WA 1JFHA 1A3HA 4KWSA 3VD5A 4W86A 4QS6A 1X1OA 4H7CA 4US5A 1BGAA 2GOUA 4X3ZA 4LGXA 3LTPA 1TRDA 4DUWA 4XO6A 4QP0A 1S5TA 4UCFA 2G50A 2DIKA 3R10A 4J5NA 1A5OC 3RPDA 4HK7A 3W25A 1EB3A 4UQ9A 4W5UA 4AU0A 3I7SA 1OCJA 1OG0A 3KL3A 2VEIA 4WJEA 2WPBA 1FWBC 3UESA 3B3DA 1U2YA 3M0KA 3BLIA 3IEBA 4M0XA 3VKAA 5A6JA 4NZ4A 4P5UA 2VENA 1LBLA 4EOUA 4CQBA 1GVFA 1G4TA 3W7KA 3S1WA 1FWCC 3QVQA 4PFMA 5IFTA 4JTLA 4UNIA 3P81A 5GQBA 3SECA 5M03A 4JX4A 4LS1A 1FHDA 3RCNA 2O7QA 2R24A 3WQWA 2I7GA 3O6DA 3UWZA 4AC1X 2FDSA 2ZRUA 2HMCA 4MKVA 4DYEA 1UQZA 3MC5A 1V3HA 3TW9A 2V3GA 4PMNA 3N18A 2XIOA 5F4WA 4KEVA 1AW2A 1I1WA 4QSHA 2NSXA 1SJCA 1ZSXA 5CBJA 3IIOA 4DN1A 3AMLA 1M7OA 2J66A 3S1VA 1TV7A 4X63A 4BR1A 1P6WA 2VRQA 1VYPX 1RD5A 4CCCA 2QW5A 4IIHA 5TBOA 1YEYA 2W9MA 1PDYA 2Z1WA 1XYZA 3QSTA 2QUVA 5HWJA 3UVIA 1SFTA 1R7AA 4IM4A 3UG3A 5CC3A 3LCIA 2H9AB 5AOUA 2FGLA 1ISVA 3BOLA 1NSJA 1O68A 3AROA 2E5BA 4DO5A 3PJWA 1F6KA 4RUBA 3SCPA 4NRSA 1Q45A 5D30A 1S5VA 2P5NA 1QDSA 3GG7A 3VKJA 2WQPA 1NWUA 3VIKA 1H5VA 4H41A 2DSVA 4JKKA 1JDEA 2PU0A 1M3UA 1AVAA 3VGFA 3AXIA 1Z6KA 1A0EA 1J96A 1YX1A 1P43A 1AJZA 4S3AA 1VPXA 3RLHA 3W72A 2XSBA 2GJPA 4N6FA 4DZAA 4LC6A 2XUCA 1L2UA 4C1KA 4O14A 1HJSA 3VVGA 3AYTA 1EP1A 4F48A 2XHYA 2XPKA 2FMOA 2PU1A 1F61A 1EJWC 1MUWA 4R88A 4AZBA 2PCQA 4NJIA 3RIKA 3MB9A 4FX8A 4MWAC 3QC3A 3AJ7A 2EJ1A 4CCZA 3TCSA 1NP0A 2WSKA 3VIFA 1HGYA 1OFAA 1J10A 3M1ZA 3DN5A 2BVYA 3AHYA 3VC6A 3TAOA 4S3EA 3UJFA 1NFPA 3HA1A 3KRUA 4AXKA 4WDUA 4BWLC 4QAWA 1OFQA 4FIRA 4EPBC 1OBAA 4DXXA 2PGWA 3PBMA 2V2CA 5EMKA 2QYGA 4UTWA 1ZB5A 3P93A 2JE8A 2GQ3A 1WQ5A 1C90A 3TIMA 1EX1A 1IEIA 3PZVA 2HSAA 3N14A 2PGEA 2V5DA 4NAEB 5HR6A 2PDNA 4XAFA 3BMWA 3O3RA 4PTXA 2Z28A 3NYDA 3MANA 4Q4MA 3NZRA 3S6TA 1H7NA 3RAOA 4FF7A 1L6SA 4ATDA 1SMAA 5CPQA 2UZ9A 3GLCA 1WDQA 3R79A 1LLZA 1RK5A 2ISSA 4H8NA 3DC0A 3LCXA 4TIMA 4EAMA 4DZHA 4Q8TA 3PBUA 1DJYA 2X7WA 7ENLA 4WY0F 5HR7A 1F3WA 2PWDA 3W7LA 1KV5A 3CQJA 3POCA 2WJZA 4M3PA 2HNHA 4DI8A 2OZ0A 3C8FA 2EO7A 3ERPA 1XL9A 4Q22A 4G5DA 1C8QA 4J3ZA 2TRSA 1KM0A 4UOZA 3B4YA 4INFA 2FPTA 4WD0A 5A69A 1B57A 4B3ZA 2VZOA 3FA5A 3NPVA 1K6AA 4IIFA 3FJ6A 4FNRA 3BAWA 3DKLA 3MV01 2O9RA 2J27A 3I65A 7REQA 3QTGA 4DJFC 1FP8A 1WAUA 9CGTA 4UC5A 2XH0A 1KCXA 2D2OA 3AS3A 4QDMA 3F5JA 3EWCA 4O28A 4AUBA 2RGLA 1K77A 5E70A 3WDPP 1KLYA 3QHNA 4R9XA 3GVQA 1IXPA 4PMZA 3LV5A 3CTTA 4GY1A 3S5OA 4WGHA 1O12A 1ISZA 4TX6A 1UZ1A 4ZQMA 4AH7A 4M6PA 3MCMA 4YWSA 1B9ZA 2R8WA 5K9XA 1E71M 4LQ1A 3AIWA 1FOBA 4WIWA 2CLKA 4WDXA 3OZOA 3WF4A 3MP3A 4XVDA 4OQVA 4BA0A 2X1UA 3SSZA 1G6CA 4PMRA 3W71A 2J6VA 2PGFA 3LB0A 1VBRA 1F2JA 4L4LA 4DYJA 1H2JA 1NFBA 2F7FA 2Y4SA 1ZTVA 3VXGA 1O7AA 2O7SA 1UD5A 4I90A 1GVRA 2W4XA 1Z48A 1MRQA 3L68A 1XSJA 3O6CA 1V7AA 4UB9A 1GWJA 1SQ7A 3H4GA 4JKLA 3BG3A 1FWEC 1J5TA 3LQGA 1VYRA 2VWTA 1UCWA 2OLHA 1AJ0A 2XJ7A 5C7HA 5BW6A 4PSRA 4GY0A 1NU5A 3QMTA 3W22A 2PUZA 2B7QA 1KTCA 4JNZA 2CLOA 1WDSA 5DELA 3E1F1 1TPC1 4L6OA 1LLWA 3II1A 2YIHA 5C2XA 3CU2A 2B7OA 4Y9PA 4UNLA 2EPKX 2G41A 5MF5A 5CZJA 1MMFA 3CZKA 4MB5A 4IQDA 1UYQA 4BCEA 4PGLA 4C6MA 4ZGYA 3O05A 3N6JA 3CPGA 3W7PA 2PF8A 1W0MA 2QCHA 4ZO6A 4MM1A 4NZ3A 3EYPA 3LRLA 1UC4A 2VFHA 5JQ9A 3O2LA 3ARUA 1SM9A 2GLKA 3PSVA 2OOFA 3QY8A 2V67A 3KOYA 2YBUA 4WY0A 3L2LA 1W5PA 2VJXA 2XN1A 4R27A 2J9ZA 3N25A 4ML4A 5LXEA 2V3EA 3DEQA 2ZIDA 1AZ2A 3CWOX 3EDFA 4LBRA 3W1TA 2TAAA 3UPBA 1EO7A 2POTA 2VHLA 4M5PA 4MJ4A 1RLDA 4MSSA 1S2CA 3UJEA 5DRCA 3T1GA 1DIEA 1XYLA 2VCCA 1V6XA 3TN4A 4HMDA 5FF7A 4MNLA 3ITCA 4PMYA 3UU0A 4AVNA 3AHZA 3BW4A 5HDRA 4IP5A 1TV3A 4E2BA 4A35A 3WUGA 4JL2A 5CC7A 4EWND 3K4WA 1XLKA 3DG3A 1O60A 5LNVA 4S2CA 4AWUA 5CSUA 1FXPA 3KOXA 4DWSD 3K4AA 1L6WA 3KZSA 5HATA 2FHBA 3A9BA 3WLJA 2ACSA 4TVUA 4YTTA 1JUBA 1FFRA 3DI0A 4GIRA 2O92A 3QMRA 2GK1A 4QNEA 1CW2A 1L6FA 5D04C 3SR7A 3NG3A 4MPKA 3NYZA 4JHZA 2QF8A 2Y1HA 3BG9A 1HP5A 2J7DA 2PDUA 1ZRQA 2PDXA 2X09A 1TRIA 5FJIA 3RU6A 1XSIA 3A21A 4D1JA 4KF1A 2BY2A 1BVWA 3R0UA 3RR1A 4JY9A 2PRLA 5CGTA 2GQ9A 4IMEA 2HRWA 4IPIA 2WWDA 2CIPA 3AQUA 3DYOA 4M82A 5CGQA 2VO5A 3SAZA 2PA6A 1CLKA 1DXEA 4NAFA 3HV8A 3MO4A 2FZ9A 1NWTA 1PKMA 3G77A 1CLXA 1M7XA 1OX4A 4KCVA 4FAMA 1XBXA 2ZWZA 3MZ2A 3TSBA 1CGWA 3K13A 1FRBA 4ZO7A 3ARPA 3KCOA 3QYSA 1YTDA 4JTJA 2Y5EA 1ZL1A 2P8CA 3E2SA 2GDQA 5HPOA 5I3HA 3U0HA 4I6KA 5HMFA 5E5CA 3VGGA 1EA9C 4R7OA 1ITCA 2Y63A 4L61A 1AUSL 1KFKA 1IWAA 1SO4A 2FLIA 1WDPA 1RXOB 2JIEA 4M19A 2B31A 3CO8A 4HU4A 3USZA 2AMXA 1HKKA 4F9JA 4AEEA 4F4RA 2DVTA 2ACUA 3BK0A 5K3VA 3P8IA 3GNNA 5DFAA 4HT3A 3V35A 3BPWA 3NO1A 1S1RA 2O0TA 3B9AA 3HGJA 3DHDA 2QLYA 2Y8UA 2HDJA 3HG5A 2WMKA 1LWHA 3LI0A 3FN9A 1LQAA 2YCJA 1UR9A 3TNOA 5F7UA 4RK8A 4AZ5A 5C9UA 2E6AA 3VNKA 8A3HA 1T0OA 3W74A 2XVNA 1M01A 5C9WA 4JTKA 1ML1A 2OSXA 5KZDA 1Q6CA 1GOWA 2ZC1A 2I9EA 2DZUA 4JTQA 4FR6A 3PS7A 4HNTA 4Y6GA 3T0TA 1R3VA 2XIJA 3EOSA 3XIMA 3EWXA 4OV9A 3UQNA 2DU2A 4PMUA 2PP3A 1EJRC 4W85A 2FDMA 3TXVA 1REQB 1QNSA 3GQYA 1HO4A 4PSPA 2GUYA 3WEMA 1QNVA 4NP7A 4DF1A 3GXFA 1XQKA 2ZTKA 5T9BG 3MCOA 3VIIA 2NT0A 4DZ5A 1TZ7A 2NVCA 4US6A 4Y9MA 4R3UA 1EGZA 2QCNA 1W9VA 3AIRA 4UNKA 1RQHA 3TWBA 2GQAA 1JJKA 3W86A 5F2GA 1PCWA 3MYOA 1PSCA 1XR2A 1JFXA 1KRBC 4TMCA 5LHFA 3NZGA 4O10A 1DPMA 3LD5A 1TV8A 1VFOA 3LNPA 3TR9A 4B5TA 2PLMA 3AWOA 3W7GA 3BLOA 3Q4DA 2GVEA 1AD1A 1FDJA 2ZZ6A 4O54A 3CK5A 2FB3A 3Q58A 1N2VA 3ZYZA 1MW3A 3GHUA 3UA3A 4UMBA 2VDHA 1MSSA 5H6HA 2GSJA 3WH5A 3BLEA 4JXCA 2JBMA 3GNRA 2CESA 3NL6A 4QCEA 1JCJA 1GVEA 5FJRA 1VD6A 5H8MA 3TTSA 5D8WA 3D3FA 5ABGA 4B91A 2OQLA 4DAIA 2ZDSA 3S6DA 2UWFA 3PAOA 6PTDA 2YCEA 3QR3A 1T99A 2TYSA 2WVSA 1XLLA 5SWUA 3L4UA 2PDPA 3MUXA 5IBXA 3N9SA 3PULA 4JNMA 3GDLA 3PZTA 1MXSA 1QNQA 3COTA 1M03A 4C7GA 3V75A 1KD0A 3BLFA 1VBUA 3NNTA 5F2IA 3URAA 4K1WA 3R12A 3R13A 1VFSA 2ZUTA 1XICA 4UZUA 2VD8A 1EPXA 1F8IA 4WRHA 4ZENA 2EKGA 1H09A 2IKIA 2NX1A 2DZTA 2QS8A 3BCFA 2QDEA 4BZYA 5AC4A 3WIJA 1V77A 3G1VA 1WKDA 2Y89A 4DLFA 1OIFA 1KW1A 3WD4A 4U2ZA 3NTYA 2Q09A 3DFYA 4KGLA 2PE4A 2YZRA 1LUCA 1W91A 3WUBA 1KFLA 3UJRA 5KETA 4MAZA 4AHPA 3PWGA 3H4XA 2VQUA 4P8UA 2V3FA 1R9ZA 3B04A 3VOHA 1YIXA 3C2EA 3GKFA 3NGFA 2R94A 4IPPA 1WBHA 1ADDA 1IT0A 4N9CA 1G4SA 3CJPA 1A49A 3B97A 3L2MA 2QXWA 1G7VA 3TTOA 4EANA 5FAGA 3WQVA 4RE3A 5DCEA 1QATA 1QCWA 3O1NA 4FHAA 3QR1A 2NV2A 3DFNA 1PTGA 5BCAA 2YCKX 2OWWA 4FOKA 1UQYA 1ODUA 5CPNA 1S2TA 2WMJA 4GY7A 4XSMA 2YA1A 1GOXA 5HWMA 3AYVA 1Y5XA 2ZOXA 3DUGA 2QVNA 3UCCA 1KWKA 3NSMA 4C6LA 3NSNA 4O4WA 5IHSA 1EIBA 3BTNA 5I2UA 2VR2A 3WO8A 3KEHA 1CGTA 3MMDA 2VC5A 3MYPA 3QYQA 1ITQA 3CNYA 6A3HA 1GZGA 5FOOA 1ME8A 3OEXA 4OJYA 5KTLA 1OD8A 4K2SA 2GJXA 4KEUA 5FKYA 4QCFA 1E4MM 1AH4A 3W84A 1WAWA 1XHGA 3U2CA 4MKSA 4RZBA 3BURA 4CQAA 1Q5MA 1I2NA 2VGIA 4X9SA 5BXPA 3HV9A 3PBVA 1BGGA 5I7GA 4XD3A 4PB5A 1MWOA 4ECLA 3R25A 4W88A 4G8TA 1XC6A 3FW6A 4FO4A 3VK5A 2J24A 3KP0A 3A4JA 4ZA0A 4NZFA 1JD7A 4QR6A 2XGIA 1DORA 4IL2A 3S4TA 2PDIA 1E4NA 3G8EA 4CD6A 2WJDA 2WNNA 3UPMA 2FFCA 1TV2A 3QM3A 2OLSA 5DQPA 4KBXA 2A7PA 4NT0A 3VI2A 1J9YA 1MQRA 1M65A 4L6DA 1DEDA 3AIQA 2AQWA 4JEQA 7REQB 4GZIA 1RP9A 2YXOA 3NDYA 1DJHA 4K39A 1ZNNA 5LSMA 4IL0A 3GZ3A 1S3TC 2W79A 3DFOA 2YPIA 4A3UA 1ONXA 3SZ8A 4B2DD 5FJUA 3EX3A 2W61A 1TWZA 1OINA 4FS9A 4TX8A 4XTIA 2QCDA 2WC7A 3M7WA 5DMMA 4EPEC 5AYYA 1C8VA 2Z00A 3AJXA 5AYXA 3NQEA 1Z8AA 4JTDA 2FPYA 3TYUA 3PSWA 4MUPA 4O4VA 4O8RA 2ZUWA 3BCJA 4IGNA 2FHFA 4ZSUA 3KX6A 3HPSA 4PCNA 1TR1A 5FJOA 5FSEC 2ATMA 1FUYA 4M6QA 3MP5A 5IDIA 3ECQA 4XUYA 4JIHA 3S6OA 1EDGA 2G3NA 5REQB 1E56A 4I9AA 3WUEA 4HZ6A 4H8UA 4L7ZA 2OX1A 1QOQA 4E4UA 4C60A 1W2PA 2D3NA 3A47A 2ZUVA 1QWKA 3UA4A 3T81A 1IV8A 3QN3A 2ZZ7A 2DP3A 3ICJA 4MLRA 1E72M 2YX0A 4WZHA 4BS0A 2V68A 3C2VA 3HGRA 1QI3A 3GNDA 5HPCA 5LA1A 4H83A 3R8GA 2D2GA 3TNBA 3QRHA 4FLQA 2EG6A 3SM0A 3AHXA 2GUUA 3GH7A 3CAQA 3RCMA 4ZO9A 1OX6A 4FNTA 1R7OA 1PYFA 3U7BA 3SEPA 2B81A 3WL0A 3KVKA 1DE5A 2PDHA 2BMBA 3WMLA 2OEMA 3E0IA 4ZQCA 1C93A 2IKJA 1LORA 4LEQA 2DT3A 3VNDA 3MWAA 3WLKX 3W23A 3MI6A 3H7UA 1BF2A 4WJ8A 3DX5A 1EC8A 2A3LA 4AZCA 1A0DA 1AH0A 2IKGA 4LS2A 2DSWA 2F2HA 3L21A 4AY8A 3E96A 4Y90A 1TWDA 2ABBA 2PDWA 4CD4A 3VABA 3MMTA 1E43A 2CKRA 1SR0A 2NQLA 3ZR6A 1L0PA 4RDWA 1I75A 2PBGA 4B5WA 1UWRA 1WOBA 4DBEA 3KWSA 1VCFA 2J62A 4MY1A 4WY0B 3V5CA 4JCLA 4S3DA 5AY7A 6TAAA 4DM2A 3VNYA 1RCQA 1E1CA 1IHIA 1HKMA 3VNIA 4PRWA 9RUBA 3T2OA 2PDKA 2IQ0A 4OUIA 1MNSA 1QPOA 4GJJA 3UCQA 5A2CA 1KCZA 1YNQA 4L1GA 3MJYA 3NDOA 1SFLA 1JQVA 3LGDA 4I8DA 4WX2A 1B0IA 2SFPA 5FL1A 3BARA 4GI9A 3Q2DA 3KWXA 4N0RA 1EOKA 1DJQA 4KGJA 1QI0A 2PGRA 4HK6A 1N55A 3UR7A 3MW7A 4ZXLA 4PUUA 3EMZA 2OJPA 5A2AA 1BYBA 2VYOA 3HQPA 1VAHA 3TC3A 3W70A 1BQGA 4RNJA 3UZYA 3EOUA 2INEA 3TW6A 2GGIA 3R0DA 4J35A 4MWAE 4I9JA 2DY3A 4F0LA 1R9XA 4POCA 2P50A 1XCWA 2NQHA 2R14A 1H5YA 5FA5A 5EMJA 3M64A 3GY1A 3HBLA 2J77A 1OSEA 2GK1B 1QO2A 1ICPA 3S1XA 1MEHA 4AYGA 3M44A 1XS2A 5JBEA 1KR1A 4A22A 2QUMA 3DBPA 5LKYA 2A3CA 1X38A 4KRTA 3IGSA 1JVNA 1RD6A 3ME3A 3E9AA 3BAIA 4MAVA 5GJPA 1SZRA 1QASA 1TA3A 2GUBA 4MF4A 3QW3A 3W2MA 1YW1A 5C9RA 4FNQA 2P1FA 3IGUA 3L0NA 2DIJA 4YTQA 2FYMA 4LRSA 1QW8A 1YTEA 4W84A 2VX6A 2A21A 1TJ1A 1Q2RA 1IZKA 1ZAHA 4NAFB 3S5YA 1C8XA 1JZ4A 3BGJA 5G2IA 5D9PA 2RGMA 3E74A 3O0FA 4GJ1A 1E5NA 4MLJA 1OX4B 5HANA 1OWQA 4N9EA 4ZOAA 1K6WA 4GYPC 4LYQA 2WLZA 4RR4A 4J3SA 5I3DA 2BGQA 3EWBX 4I9TA 3HGOA 1A5MC 4E2DA 5CJMA 3VKKA 5A6KA 3CB3A 1QHPA 3G1FA 2E5CA 3E12A 3B0UX 1R8LA 1P4CA 2QDHA 1BFNA 4R7JA 2OR2A 4AG0A 1YPFA 3SJ3A 2PC4A 1PAMA 4LRTA 3OODA 3FGCA 3LHWA 4JQAA 4PEKA 4JD4A 3O63A 1XISA 5I78A 3TOPA 2HBXA 4ENLA 2C79A 1RZMA 3S5ZA 1OT1A 1B3OA 1ADSA 4CNUA 4W7WA 1IR2A 2X1RA 2Y70A 5HUOA 5GNXA 4ZB0A 2J9XA 1LRQA 1XIHA 5AHMA 1VEPA 2CPUA 3C0QA 1QXLA 3M7SA 3EEZA 3BGAA 3OHIA 4W8AA 3M46A 3FDGA 3ZLFA 1PHWA 1GJPA 1LZOA 4RXGA 3SRFA 1F74A 1H60A 1XLHA 3D5HA 2REQA 3V1PA 3MVTA 4RX0A 4OVXA 1F3TA 3HPFA 1P0BA 3FEQA 1F3EA 4MWAD 4F8XA 1V79A 3W1PA 4XO7A 3UXLA 1KNWA 3G22A 3WQ4A 1UROA 4O12A 2Y0FA 2DVXA 3RK8A 5C6MA 1OGSA 2C14A 2QV4A 5C9XA 2INFA 2ZRZA 4CU8A 2Y7FA 4D6DA 1P0NA 5EU9A 3VD3A 3GH5A 1JGIA 3UGRA 3I3EA 3CLWA 3OVGA 4QLJA 3UBPC 2NXHA 3DENA 4EXAA 3I7QA 2DT1A 4AHQA 5ABTA 5I3JA 1Y5VA 3ANYA 2QCGA 1BYDA 1XRVA 2GDUA 4JN7A 3AMDA 3P6LA 1XV8A 1YRRA 2Z29A 1AL8A 3DYPA 1QT1A 2IMRA 4P7LA 1RY0A 1E9IA 1NH6A 4N2YA 5DBUA 2YFOA 4MPQA 1IGSA 3SB0A 4ZBCA 5D33A 1UD8A 3LXBA 1US2A 3DAQA 1NWRA 1NM9A 1FA2A 4GXWA 1QNOA 1IIHA 4PBFA 3TFXA 1W5NA 4PCSA 3AAMA 2P76A 3NM3A 5DT7A 1LLOA 3ANVA 3TJXA 2PP0A 2O4MA 4E5TA 5FF4A 2EGZA 1H62A 5D9OA 3V5FA 1VC4A 4GFIA 3HG3A 4RZ4A 5AHEA 4HA4A 2DW7A 3L9CA 1E6NA 1M5WA 4HPXA 1A4LA 4H9TA 3GTIA 1ZGDA 1TWWA 1M7PA 2OXNA 3WQ5A 2RUSA 3NFUA 1GEQA 3BAJA 1ZBKA 5DO8A 7A3HA 5EMLA 5K2ZA 3CL6A 4LUIA 4ROPA 4LYKA 4GC3A 4W87A 2NQJA 4GKTA 3MBFA 4QSFA 1WZLA 4PE8A 5A8MA 4HPHA 2Z2BA 2OO6A 3MBDA 2Z0IA 2VFFA 3AMKA 5H1WA 3CV1A 1DYSA 3CB8A 3PC0A 4OKDA 3NL2A 4HGXA 1UH2A 4CN4A 1E55A 1UWAA 4ASTA 2BOFX 1DJNA 3PUEA 1PHQA 3EA1A 1XC4A 4GGHA 3OLGA 2QCFA 3B0XA 1GW9A 3C2RA 3M0YA 3NVTA 5TIMA 3R7MA 3WF0A 1XGZA 1GW1A 1LUCB 1PJ9A 1EH9A 5HQLA 2YA2A 1IWBA 5G1TA 4K8EA 3VA8A 3VUPA 1I2RA 4FOJA 1V7YA 1ELSA 7TIMA 1D8CA 4I7WA 3THAA 3H53A 4KEMA 1UIOA 2QMJA 7XIMA 3NOYA 3KBNA 5F2LA 1HJWA 5CBBA 3VFLA 4ZQRA 4ZQPA 4UTMA 2ZA2A 4D6GA 1Y0EA 1E0TA 3NXLA 4IUGA 1H7OA 5D9MA 3L4TA 4N9BA 1PBGA 1JPIA 1WDRA 1CXKA 2IXVA 4F79A 1S5MA 1EEPA 3NWRA 3U2OA 4LUTA 4ONVA 1XLFA 4Q7NA 3VU2A 2AKZA 4H9VA 1YPIA 4WKHA 4O52A 4YS1A 1UD3A 3MDWA 1FH8A 4HJFA 4QAIA 5M2FX 4G6CA 3RXZA 3FAXA 1J79A 4MTVA 2Y24A 2A5HA 2J6XA 3EDKA 2WQDA 1A5UA 5AVHA 2QGHA 2UY3A 1F7BA 3BQ5A 2ZZ2A 1JRCA 2W66A 2A2IA 4A3HA 1QR7A 5TF0A 1V03A 4ZSTA 1DWIM 4AVFA 4GQQA 5L9FA 3PJUA 3GE7A 2GJXB 2QCLA 2XVPA 1IEXA 2C3ZA 4GIAA 4M24A 1X6LA 4IFKA 3JW7A 4QITA 3IRSA 1CENA 1LDCA 1OM0A 2PSNA 4S3JA 2NX3A 3RX2A 3L5LA 1TQJA 4IJCA 1GEHA 3WLLA 1HNYA 2VFIA 2OO0A 2OQYA 5AECA 1W17A 4AD1A 3LLXA 3NM1A 3QQ1A 4Q4PA 2A79A 4C91A 4DAFA 5JIWA 3QFWA 3N15A 3BJSA 3QV9A 4DBWA 3FKRA 2J4GA 1XINA 2FGBA 4IX0A 4UQCA 4B9YA 2J8FA 1W3TA 3GAYA 2GVGA 2PS2A 1PO9A 4F2BA 1XFBA 1EJVC 1HKWA 4J27A 3WELA 1SFSA 3R4IA 3E6EA 4CN6A 2WLYA 1EGMA 4LEFA 3ABSA 4UR9A 3PZMA 4H6KA 1V93A 1MI3A 1W1IE 3BH4A 3N3TA 4JR5A 4ATLA 1SW7A 4FIQA 3BOXA 1IR1A 3L4WA 3B40A 4KWUA 1T8QA 4NJGA 3ARWA 3IWPA 4BF9A 2BS9A 3M16A 1V6UA 3ARQA 4A05A 4E4FA 2WM1A 1BVZA 1MFVA 4GNJA 4DBDA 1EWDA 1ZHAA 4MUZA 1YDVA 3CM4A 2PDMA 1AK5A 3LGGA 3CEPA 3NQGA 4J3UA 3W07A 1RCXB 3PPFA 4XUGA 1O95A 4LAKA 2XWDA 4DUXA 1DXFA 2QPUA 1OD0A 2X40A 4WOZA 2QHAA 3NQBA 4LV9A 1G9HA 5HMSA 1XLJA 1ZY9A 2Y8VA 4ZQOA 4F2TA 1BQCA 5CZ0A 3RPTA 5BZAA 3LPPA 4LVBA 1HJUA 2WHKA 2RJHA 1FH9A 3IJDA 4C1NA 3ES8A 4G56A 4GYKA 4IIBA 3OP2A 3B0VC 1FCVA 3RG6A 4JPGA 4XAYA 5FEZA 3E0FA 3FSTA 1ISWA 2NW0A 1K7FA 2OKTA 1R3TA 1A47A 1HXJA 4MKNA 2AGTA 2O9OA 3S1UA 1ZU8A 1BHGA 4S3CA 4ORMA 2PRHA 3LCGA 3ZJ7A 3W1LA 5CPTA 4EF8A 2BHUA 2CNCA 4C5YA 1PZ3A 2P3EA 4JX5A 4NNAA 3MUAA 4B90A 4MY9A 3GFZA 1IZCA 3NEHA 2PWUA 3U9IA 4IICA 1SW3A 1E4LA 1G1YA 1YE6A 4CN1A 4LU0A 4C6EA 4B9ZA 2BOGX 3SIMA 4K68A 3B9EA 3M0MA 3VX0A 4A4AA 1CI1A 1V51A 1LYXA 4U2YA 1YXDA 3LEPA 2HJPA 4QDPA 2JFEX 5DCBA 2WHJA 1JPHA 6ENLA 4O1AA 1QNPA 2E25A 2PRMA 3S2LA 2QPXA 1XKJA 2A1YA 3W27A 1S1PA 1VHNA 5G4HC 1RALA 1DJZA 3GRIA 3QQ0A 1IZJA 4JTSA 3R8RA 4RNHA 3TLQA 3CHDA 1J2WA 5CZTA 4BF5A 2CHRA 3CUGA 3PHAA 3L5MA 3W1RA 2DDXA 1FY6A 5J04A 2RJGA 4TU1A 1QUMA 1E1CB 2FVMA 5DBTA 1TKKA 2WNZA 3AUJA 4R85A 1DIDA 4ZXOA 1W6TA 3LENA 3NCOA 3AFBA 4OE7A 4L5ZA 1FWAC 1JDFA 2AL2B 1XFCA 3V18A 1CGYA 4HA3A 3O16A 5CZSA 3ELFA 1FWTA 1W5OA 2J7BA 4GCXA 3CYJA 2D24A 3MTWA 3IVSA 1TIMA 1XBYA 3V3WA 4AIBA 3R8HA 1WA3A 3PPCA 5FEWA 3H2AA 4NI3A 1G7UA 1F76A 4RDZA 3UETA 1H1ZA 2CWNA 5D03A 1H51A 4BFAA 1UC5A 2YLAA 3QQWA 1EJTC 2YKKA 2AL1A 3DFTA 4WDTA 2W62A 4XSLA 2QPSA 1RPKA 4ZOEA 2GZXA 1RPXA 3HGSA 4U31A 2A6NA 4J2PA 4JNYA 2O9PA 3VIOA 5BXRA 1XI3A 1KM5A 2Y62A 2D22A 4CLMA 1TA3B 4H9YA 3H6OA 3DC8A 4RV3A 3CZEA 1FWSA 3WDQA 3UXAA 1UG6A 2XTKA 5E6YA 1NQKA 4V1XA 4JYDA 3JRKA 3KLKA 5CCZA 3GB6A 3YPIA 3V5OA 5HOSA 2D3LA 4CUCA 3GFXA 2G3MA 4B3KA 1X6NA 4WSKA 6CGTA 1JDDA 1UUMA 4BF7A 2VC6A 5DXXA 2GVJA 1A5CA 1OZMA 3M0LA 2QIIA 1RQBA 2AGKA 5IOBA 2C19A 4G2DA 1KRCC 1YMYA 2UY5A 3K2GA 8TIMA 5HULA 3SN1A 4LT9A 1OCQA 2J75A 2Z1KA 3ABRA 4Y96A 3OG2A 3SUSA 4ERIA 2DV0A 4HU0A 4Q8PA 3ZT6A 4GVHA 3LLFA 3MCNA 4JOMA 1ONEA 3BUVA 3BQ6A 3P14A 5HA7A 2C71A 1ZUAX 2EKCA 3WLMA 2BY0A 3FGCB 1IEQA 1P0KA 3V1HA 2Y61A 3VX1A 4MADA 4UTFA 1S2AA 3LHUA 5EMYA 4X2RA 5BXTA 4YTUA 3PJTA 1U33A 4KCTA 1F6PA 3G1AA 5BROA 5A8OA 2L5HA 4JQ1A 1WO2A 1A5KC 1J6OA 3TU9A 3QGAC 4GRSA 3L4YA 2BHZA 3IACA 3IUDA 4KH2A 4RV8A 4HVXA 3BO9A 4IP4A 5FJJA 4IH3A 4OV4A 2REQB 1RJQA 3CZLA 2QCEA 1SMDA 1VR6A 1X6UA 3STPA 5T26A 2OLAA 1P0DA 1CT5A 2NQ5A 1ZJHA 1Q85A 5LA0A 5DMLA 1KQZA 2WBKA 4HNNA 1QJWA 4MHBA 2QJIA 1YKWA 3IIXA 4D8LA 4D6HA 3GU2A 1O5QA 3WLHA 4XZHA 4MG4A 3TYBA 2R9RA 1GCYA 3C0SA 3G1DA 5LNUA 4HZMA 1YE4A 3QOMA 1ALDA 3E0LA 5I5RA 3FSUA 2NQ9A 3PANA 3KL5A 2A3AA 3AS2A 3OQEA 2HVOA 3BLLA 3SDOA 3ITXA 5KMYA 2ZQ0A 3KBMA 3OQ8A 1I0BA 3UXIA 3DZ1A 4IPLA 2GYIA 2PLJA 3OA5A 4PTMA 1V0MA 1TE6A 5BU6A 1XLAA 4QXIA 4F0RA 5IBXC 3KVLA 4GQRA 1H7RA 4C90A 1KGXA 4JTUA 3W01A 5ECVA 3ZVHA 3S9ZA 1KBKA 2BLEA 3S8HA 4HTBA 4J28A 3QZAA 1FKXA 2EJAA 5E0KA 3E49A 3VMOA 4YXGA 4LBUA 1L6GA 3TQKA 3QLLA 3KBWA 4A3QA 1FP9A 4FPSA 4J7RA 4TMBA 1U30A 1QBAA 1JCXA 1XD0A 1XIIA 2JALA 3APTA 3PPHA 3AU6A 2BNJA 4BI7A 1FKWA 2WKGA 3WDJA 3PR2A 5LA2A 1G67A 1GOQA 5AYBA 1TTPA 5AYZA 3FJ4A 1QW7A 3K1DA 2E8ZA 5A8NA 1TJ2A 3DH7A 4AY1A 1NFGA 1NTHA 4OBTA 3SN0A 3OYZA 5C71A 3E0VA 5DX7A 2XVLA 1XIMA 1I2OA 1XBVA 4ZE4A 2OYKA 3OGRA 4QE5A 1C3FA 5JVLA 2Z7GA 3W00A 2G3JA 1EL3A 2Y8KA 4DI9A 3A12A 3UR8A 2OZ8A 4GUIA 3DXIA 5H8UA 3GO2A 4O0KA 2I5QA 2WC3A 1VH7A 2ISFA 5E1QA 1O5KA 3NL3A 1AMKA 3TMLA 1VHCA 2YSWA 4RLIA 3WNNA 1DJGA 2PZNA 2WYSA 1OCBA 2JGQA 3DERA 5LNSA 3AZSA 3VCRA 1QOPA 3RJXA 2CBVA 5G4WA 1MYRA 6XIAA 4YCOA 3RX4A 1VJIA 4QISA 3NZ1A 3EA2A 1IGWA 1WCGA 1Z9AA 5XIAA 3RLUA 1TTIA 1S2WA 3B05A 3K1GA 1OHLA 3NQ2A 3RITA 5I07A 1QI5A 5AC7A 3VFCA 1VCVA 3WN6A 5A8QA 5IRPA 1H7WA 1NF7A 2ZXAA 4F0HA 2JKEA 1W56A 4HKPA 3WENA 1XF0A 1Y7VA 3DU0A 2KX9A 2WK2A 4I9MA 4GYJA 1E73M 1LL6A 3CIWA 4OBRA 4JDBA 3EKGA 1AODA 2IXUA 2F6KA 3NQMA 3GTHA 3BOFA 3RFAA 3GZAA 2ACRA 3BAKA 2DVUA 1S5WA 3M4HA 4QHRA 3TC7A 4GPNA 3B06A 3KOFA 1WUFA 3BMVA 1FCQA 3D46A 1BKHA 1SO5A 3IARA 4Y2WA 4ZFCA 3ORWA 3T2QA 3G5EA 4QNWA 1FCUA 5DMNA 2R1KA 3P7YA 1RSCA 3EXSA 4IFKB 1R47A 3TQ0A 3LCHA 4DO4A 1E6RA 1ONWA 3OLIA 4AIEA 2BXYA 5GNYA 4NL1A 1V4YA 2F6UA 4ILSA 4MFDA 3RM8A 3CMFA 3W7HA 1Q8JA 4U33A 2HEJA 2YOCA 2BXZA 1M53A 4JCMA 3LYEA 1RBLA 3G1RA 4MZ8A 2DEPA 1P48A 1N7KA 3PUDA 3UJ2A 5AHIA 4DO7A 2WZTA 1FHVA 5T91A 3PZNA 3CHFA 4KCUA 1BF6A 3AXKA 4M6UA 1G4EA 4ERGA 1LRNA 1GHRA 2P8BA 2ZKMX 1X39A 3W