1K3ZD

X-ray crystal structure of the ikbb/nf-kb p65 homodimer complex
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
258
structure length
221
Chain Sequence
b'GYVTEDGDTALHLAVIHQHEPFLDFLLGFSAGHEYLDLQNDLGQTALHLAAILGEASTVEKLYAAGAGVLVAERGGHTALHLACRVRAHTCACVLLQPRPSHPRDEDWRLQLEAENYDGHTPLHVAVIHKDAEMVRLLRDAGADLNKPEPTCGRTPLHLAVEAQAASVLELLLKAGADPTARMYGGRTPLGSALLRPNPILARLLRAHGAPEPEDGGDKLS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Transcription factor p65
publication title X-ray crystal structure of an IkappaBbeta x NF-kappaB p65 homodimer complex.
pubmed doi rcsb
source organism Mus musculus
molecule tags Transcription
total genus 65
structure length 221
sequence length 258
ec nomenclature
pdb deposition date 2001-10-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF00023 Ank Ankyrin repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.20 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Ankyrin repeat-containing domain 1k3zD00
5KBAA 3UTMA 5ENTD 2ETBA 4G8LA 5CBNA 3T9KA 2DZOA 4OAUC 1TR4A 3Q9UC 1MX2A 5ENRD 2QC9A 4U95D 4DX6D 1N11A 5HRYA 1MX6A 3DEPA 2DZNA 3V79K 1MX4A 1N0QA 5AQ7A 5AQBA 3TWVA 3W9FA 2P2CP 2FO1E 1IXVA 3V30A 3LJNA 5CECB 1BD8A 4HLLA 3V2OA 1OT8A 5BXUA 1BI8B 2JABA 2DVWA 3NOCD 5KNGA 4HRMB 1DC2A 5AQAA 3TWTA 3ZU7B 1OY3D 5FIOA 5CEDB 4CZ2D 4BERA 5AAOA 1QYMA 2BKKB 1D9SA 4QQIA 2ZGDA 2MYOA 1BI7B 4O1PA 5EIDA 5EIBE 3ZKJA 1DCQA 3EHQA 5EYPF 3NBNB 1YYHA 1MJ0A 5AQ9A 5EILA 4HRLA 1WG0A 4GMRA 4DRXE 4DX5D 4NIKA 5CBOA 3TWUA 4ZFHA 3T8KA 1IKND 1SW6A 2F37A 5KNHD 1IHBA 3HRAA 1YCSB 2Y1LE 1NFIE 4J8YA 2AJAA 3EHRA 2F8XK 3SO8A 3ZNGA 4OAVB 2XZDG 4N5QA 3V31A 4UUCA 2ETCA 4DX7D 3TWWA 4ATZD 4HQDA 1A5EA 4U96D 3KEAA 4F1PA 5HS0A 3HG0D 4O60A 2L6BA 4ZHBA 3UI2A 3AJIA 1BU9A 1WDYA 4K5CA 1K1AA 4J7WA 2KXPC 5HKPA 3J5QB 3W9GA 5ENQD 3TWSA 2XZTG 1AP7A 4HI9A 4BSZB 1YMPA 2XEEA 5KWDA 1UOHA 3F6QA 4O1OA 4HI8A 3NOGD 3V2XA 3ZUVB 3JXIA 4K5AB 3B7BA 4U8YD 5BXOA 3C5RA 4Z68A 5EN5D 2XENA 3Q9NC 1N0RA 1BLXB 2PNNA 2XEHA 5CERB 4G8KA 2NYJA 5ENPD 3TWXA 4C48B 3UXGA 2F8YA 3IXEA 4HB5A 4DUIA 2J8SD 2KBXA 2V5QC 5AN8A 2DWZA 5FINA 5EYLA 4LG6A 1AWCB 2ZGGA 3DEOA 5CEAA 1K1BA 2A5EA 3JUEA 2QYJA 4DX1A 2V4HC 3B95A 5D66A 3JXJA 5ENSD 3TWQA 4LNUD 4BETA 4CYMD 5JMND 3EU9A 4BEPA 1K3ZD 3AAAC 5JA4D 4TUMA 2RFAA 5ENOD 1G3NB 4GPMA 4JB8P 4HNAD 4LSZE 1SVXA 4F6RD 4HRNA 2VGEA 5AARA 4BESA 1MYOA 3TWRA 2B0OE 2BKGA 4YDYA 2RFMA 2Y0BG 4U8VD 5ITZF 4QFVA 2HE0A 4RLYA 4A63B 1S70B 4HBDA 4K5BA 3D9HA 3J5PA 4YDWA 2ETAA 4DX2A 4B93B
chains in the Genus database with same CATH superfamily
5KBAA 2UY1B 5CBNA 1KZPA 3T9KA 2H6FA 3JYSA 1MQSA 3HXEA 1HS6A 1N0QA 2VQ2A 4EZLA 2IOSA 1JPLA 2AXUA 4DJAA 3ZHEB 4KVMA 4E85A 5LFAA 3CVXA 3AG4E 4CCAA 1DNPA 2BKKB 3SFXA 1D9SA 4QQIA 3EIJA 4B89A 1TN7A 1DCQA 4EPZA 1UG3A 4J8SA 4NIKA 2GW1A 5G04C 4JD2G 4J8YA 4GYWA 2F8XK 1OCCE 3NZUA 5CMYA 2QFCA 1TJCA 3N71A 3LKUA 4UI9J 4EZJA 2VSNA 4TRQA 5C1DA 3E33A 5KWDA 4GTRA 3ASGA 4A1SA 3KEZA 2PNNA 4U0ZA 3UXGA 3CSTA 2LXLA 3RIBA 3DSSA 4DPRA 1K1BA 4ANXA 4DX1A 3FUEA 2OCCE 2AWIA 5JMND 1K3ZD 3ML9A 1H6KA 3FTVA 2VTBA 4JVSA 1HO8A 4A63B 3PZDA 1TNOA 5D2MC 4AJWA 4B93B 3UTMA 3CHMA 4ILGA 1HFAA 2CFZA 3CQCB 1B89A 2XPZA 5KJMA 3L16A 3UINC 3V30A 2L6JA 3DSWA 3V2OA 3O48A 2IQCA 3ZU7B 5E76A 2V8SE 4J6IA 1UW4B 4U7EB 3QWPA 3FU5A 3NAWA 4O1PA 5EIBE 4MLPA 3EU5A 3ULQA 5FQ4A 4CGWA 1EPUA 3QWWA 2XEVA 1JCRA 2XZDG 4I1AA 4N5QA 1HU3A 3TWWA 3C98A 3ESLA 2IJGX 4O60A 3Q7AA 1VDYA 1GW6A 1HX8A 5ENQD 2XZTG 4BT8A 4GA2A 1JUQA 2R5SA 4HI8A 3LEWA 2UY1A 2H6GA 3JXIA 4F53A 3OXLA 3AU4A 3IHYA 2WXMA 5E75A 3Q79A 2XS1A 3ZHEA 3LCAA 2FI7A 3CLJA 2V4HC 5D66A 1E8XA 4LNBA 4WWOA 4N3CA 4EQFA 3D9JA 4TUMA 5CMWA 4RG6A 4HORA 4N5CA 3FUNA 5EDSA 4IN3B 3IEGA 3TL5A 4CGVA 4RLYA 5LCWJ 4TXRA 2P9PG 2WB2A 3MCXA 4G8LA 4JHRA 1TNYA 4LRZA 1N94A 2P9LG 3L17A 3Q78A 4U63A 3UT7A 1IXVA 2B6CA 4J8DA 3APDA 5G2NA 2Y4TA 4GPKA 4HRMB 2IONA 4B8AA 1XNFA 1V55E 4GCNA 4AM9A 3T5XA 4PS7A 1ZB1A 2HYZA 3UUXA 2IOLA 4TV3A 4TXQA 5IY5E 4L1BA 1PC2A 3LVQE 3LXUX 3ZYQA 2J9QA 2PL2A 5T4YA 2Y1LE 3E37A 4G24A 3PRZA 4OAVB 4APFA 3RRUA 2PQNA 4JW1A 2Q7FA 2IFUA 4RVBA 2ZISA 5ENNA 3MKQB 3GZ1A 4J7WA 5T8IA 3FP3A 4FJYA 4E6HA 3F6QA 3DXMG 3L08A 3G2TA 5EN5D 2QZAA 5DIZA 1P5QA 1SA5A 2WXJA 4CDNA 2KC7A 3PZ2A 4HB5A 4URKA 2BF0X 4JEHA 4LG6A 3URZA 4KBQA 3CVYA 4P29A 3EU9A 5ENOD 3ASDA 1A17A 3HXFA 3TWRA 2I1JA 2IEJA 3O4ZA 3ZN3A 1X81A 4AIFA 3FUFA 2IO3C 3FHEA 3OAWA 1TR4A 1OWLA 1MX2A 4DX6D 3I4GA 4U0UA 3V79K 2MRIA 3LJNA 5CECB 4HLLA 2GROB 4OYSA 4AXHA 3AS8A 1OY3D 4ANVA 3CSFA 4RSYA 2ZGDA 3NBNB 2CFUA 3FWVA 4ANWA 1S0PA 1E90A 2CHWA 4GTSA 5DBKA 5KJKA 3WG7E 3BUAA 2L0TB 2P9SG 4EHMA 1WDYA 2GRMA 5CRVA 4ABNA 3EUVA 3MJWA 4GZCA 3MZLB 3PNLB 3CHPA 3VLFA 4WWPA 3AG1E 4HOUA 2J49A 3FH8A 3E32A 3Q15A 4FADA 3CIAA 1EF1C 2WXNA 4JPSA 5EX3A 3L22A 4CDRA 3C3RA 3C3QA 4LSZE 3RSEG 1O1TA 2GRPB 2RFMA 3QWVA 4YDWA 3L6AA 3DRAA 3Q47B 4WAFA 3PREA 3Q9UC 3MKQA 4XE0A 3CK9A 4Q69A 3QC1A 3MGBA 1H2TC 1IHGA 3CEQA 2DVWA 1LTXA 4K0RA 5AQAA 2WPVA 2ZIRA 4GTOA 1N4RA 1K8KG 5BUZA 3KS2A 4AY5A 5LP0A 4HRLA 5CBOA 1O1RA 2DBAA 3I4RB 3T8KA 2F37A 4I6GA 1FCHA 3RO2A 2CHXA 2AJAA 4GMLA 4PS8A 1WAO1 3SO8A 4ATZD 5H7PA 3ZYKA 2P58C 3KEAA 3FTWA 5FQ7A 3FU3A 3S7DA 1RW2A 5JJTA 3Q4AB 4FHKA 3LYAA 4J0UA 3CR3A 3TG4A 3QJZA 1TJFA 3DBSA 5A6CA 2F8YA 2KBXA 4KVOA 1NP7A 3RAUA 2DWZA 3PZ4A 5G05J 3RRMB 1LF8A 4NACA 3UIPC 1E8WA 2EIJE 3UM1A 5CEAA 2A5EA 3ZW3A 3G2SA 1S64A 4BETA 2C2LA 4RQIA 3PZ1A 2RFAA 3FUMA 2J4DA 4F6RD 4GB9A 3ASNE 5AARA 2JEKA 5CCLA 2AXVA 2HE0A 1NA0A 4K5BA 1LD7A 4DX2A 5AJDA 4KMOA 4N2QA 2IU1A 1E7VA 4G2VA 5ENRD 4YNDA 1Q2ZA 3ZXSA 3W9FA 1IYGA 1TEZA 1BD8A 3G2WA 2J07A 2UWJG 5FZQA 3KSQA 1N4PA 3ZYMA 1RZ4A 4DI4A 5A7DB 3ABME 3UPVA 5ARFA 4XI9A 1H2VC 3R9AB 4XKBA 3QK0A 3CGHA 2I1KA 4M7CA 3B7SA 2IO2C 2KCKA 1FVHA 1X5BA 2X38A 3EHRA 3ZNGA 4NRHB 3Q49B 2XRZA 2GRQB 2AW6A 3ONLA 3QAQA 3AJIA 3VTYA 3TXMA 3S7BA 2XGSA 4JHJA 4XEIG 4D10C 4EBAG 5FZSA 3B7BA 4OVVA 4BY6A 3SNXA 4DLOA 3Q5MA 2VJ8A 3FDHA 2OOEA 5BW8C 5ARGA 4DK5A 5JA4D 3CQGB 1G3NB 3HXBA 2BUGA 3VLEA 2B0OE 1U3CA 4HLEA 4YDYA 3NQPA 4XI0A 2QY7A 5BPPA 2GRNB 1SZ9A 1E8YA 4N3AA 4JZYA 2I6HA 2Y3AA 4N2SA 2KCVA 3HYMB 3RJVA 3D9LA 2X3MA 4IRUA 3FUDA 5B1BE 4FJZA 2WMNA 1KZOA 5AAOA 3EDTB 4I43A 1YYHA 5EILA 3D3MA 3QKYA 1MZCA 3D9KA 4FLBA 4WNDA 3B13A 1H19A 2FBNA 2R02A 1INZA 4F1PA 3L13A 2PM6A 1O5MA 4ILIA 2XCBA 3ZXPA 5HKPA 4PS3A 3W9GA 2R59A 3U3WA 4WNEA 3UIOC 4BT9A 2WXFA 2XENA 5CERB 2FULA 4JL0A 1LD8A 4PUCA 1ZBPA 3CVLA 1KT1A 2HR2A 1TYQG 3MA5A 2LAHA 2VGYA 4WWNA 1Y6IA 5JJ6A 2OEWA 2Y0BG 4Q94A 4HBDA 2R03A 3CVPA 5FTPA 2ETBA 2WXGA 3ABKE 2OEVA 2ZXWE 5HRYA 3QDNA 2DCPA 3OXFA 3HXDA 2M63A 5KNGA 4JEUA 5CEDB 2OVFA 1HG2A 4I9CA 4LERA 4HOQA 3KAEA 3IHVA 3FH7A 4HOTA 4L2LA 3DWLG 4HS2A 1NFIE 3ZVVA 1UJKA 4HQDA 4TXPA 3U66A 3UI2A 1BU9A 4Y6CA 1NI1A 4G11A 4GA0A 4GCOA 1K1AA 3S7FA 1WY6A 3EIQC 2NC9A 2WXKA 1IQUA 2YQ8A 1TN8A 4BTBA 1N0RA 4I2WA 1JCSA 1OCOE 1HH8A 1FT1A 4ACLA 3U64A 3VLDA 3BEEA 3JXJA 2WQHA 1O1SA 4GA1A 5D0QD 2OVBA 1HF8A 4KZCA 4HRNA 3D9HA 2ETAA 1WM5A 4I1OB 3CHRA 5JHBA 3B7TA 3C3OA 4TUUA 2DZNA 5FQ6A 1MX4A 2ZU6B 2VSXE 3L82A 2XPYA 5ANRA 3I5PA 4G25A 4CZ2D 5AYWD 3L54A 1H6OA 3SFZA 5EYPF 3DSUA 4CT0A 1WG0A 4GMRA 4YVQC 3QOUA 2E0IA 1D8EA 5KNHD 3FY4A 4FLHA 2H6IA 4UWLA 4BX8A 5AJLA 1N4QA 4K5CA 5G55A 2LSUA 3G2VA 4AEZC 2WQ7A 3NZSA 3LDZA 3ISMC 3FU0A 3HHMA 2WXRA 4FULA 2XEHA 4C48B 3FUKA 4UWHA 5D0OD 3UKRG 3X2QE 3B95A 1YA0A 4BEPA 4IULA 3GZ2A 4BFRA 1SVXA 2EINE 3QB2A 3CK8A 4LEUA 4QFVA 2DYRE 4KXKB 2XCCA 1Z5SC 2QC9A 4AY6A 3ZPJA 1SZAA 2Y4UA 2JLBA 5BXUA 3EHNA 4I17A 4HFGA 3RK6A 1E7UA 3TGOA 2CHZA 4H7XA 1DCEA 3UM3A 1QYMA 3MKRA 3D9NA 1EYHA 2NXPA 3IKOB 5ANLA 3ULYA 3ZIMA 2VGXB 4G1TA 5KJLA 3TJPA 3KSLA 1TNBA 1HG5A 3Q7FA 3DSXA 4ATGA 2IY0C 4RG9A 5CCMA 2LSVA 3LVRE 4FHJA 2KZTB 4HI9A 3GZSA 1UOHA 3V2XA 4UI9C 5BXOA 2WXQA 4UI9K 3Q9NC 1FPPA 1UN8A 3JCKC 1W3BA 4DI3A 3IXEA 4APOA 3PEVB 3UM2A 2EILE 4B94A 3CHQA 3GYZA 3JUEA 3R7QA 3HIZA 3JUIA 3UQ3A 1NL4A 4JC8A 3FU6A 4HNAD 1Z3XA 2OV8A 4PH4B 2VSYA 3CVNA 1ELKA 4U8VD 2WXLA 5T3RA 4GU5A 3OXGA 1S70B 3IBEA 2YINA 3K9IA 5ENTD 4O6FA 3TXNA 3DPYA 4R7LA 4YVOA 3PZ3A 3DEPA 2XS8A 4CEMA 1ELWA 3PUKA 2JABA 2GGFA 1PAQA 3PH0C 4GYYA 2FF4A 4BERA 4G26A 4L9PA 4XKCA 1HZ4A 1MHQA 3FTXA 1S63A 4KYOB 1MJ0A 1Z3YA 3LJ3A 4WUYA 4DRXE 4U0SA 1SW6A 4MRUA 3SQVA 3ABLE 3V31A 1HXIA 5BV1A 1D8DA 1KLXA 3PVLA 3AU5A 4BSXA 4UWKA 2X6JA 2P9KG 3BQOA 5B1AE 5HI7A 4X8QA 3FUIA 1OWMA 1QBQA 4AV7A 4GZDA 4WNGA 3FTSA 4MKTA 5AENA 3HVEB 3FUJA 1OCZE 3SF4A 2PZIA 5EYLA 2ZGGA 3DEOA 4YDOA 2J09A 3PUJA 2GRRB 5AIJA 3BU8A 1UN9A 3TAXA 4I1MA 2FEZA 3LY8A 4GZ3A 3PNTB 2VGEA 3FH5A 5JHAA 1TNUA 2LO6A 3ASFA 1XGWA 2L9BA 2VGXA 4A1GA 4GTVA 2Y69E 1TN6A 2WVIA 3PDNA 2RKKA 4U95D 5LCWC 2KZTA 3ZFWA 2A5UA 5AQBA 2WXHA 2P2CP 4JA7A 5BT1A 4GZ6A 1H6PA 3SFYA 1OT8A 2LAIA 4XZ4A 2FO7A 2XHEA 3CK7A 5FIOA 3EJNA 5HQ8A 3CKCA 1OXJA 1L5JA 2RD0A 3ZKJA 5AQ9A 4C9BB 5KCMA 4UWGA 1Z6TA 4A55A 5BV0A 1KT0A 1YCSB 1TNZA 4M3OA 2HO1A 4ME2A 2XQ0A 2XGOA 4EBAA 2L6BA 1U3DA 3SBSA 2R2LA 2KXPC 3TWSA 1YMPA 2XEEA 3FFLA 3NB2A 3CVUA 4Q96A 2AXZA 3AG3E 3VTXA 2ILRA 5FINA 1HE8A 4J8EA 4HXIA 5EX0A 2P9UG 2LNIA 5J90A 5J08A 1ELRA 4J8FA 4JB8P 1N95A 2WQ6A 3WXXA 3CVVA 4KT6B 4JA9A 1MYOA 4F3VA 5CHEE 4I6JA 3J5PA 3FTYA 4LNGA 3SBTB 4HVBA 3BG1B 2DZOA 4LCTA 3UM0A 3E30A 4CDMA 4XX5A 1MX6A 4NQ0A 3Q75A 1OWOA 2X6HA 4ANUA 2WXPA 2FO1E 4KZ0A 1NZNA 3FTUA 4UQZA 4L7TA 4BTAA 3AS4A 2XPIA 4N3BA 3NOCD 1DC2A 4B8CB 3KD7A 3R9MA 4AP2A 5CRUA 1QNFA 1JCQA 3PE4A 3PS6A 3HVEA 3EHQA 4F7AA 3JQ0A 1JWFA 4DX5D 3TWUA 4OVUA 2V5FA 3AS5A 1IHBA 4AVXA 3ASHA 4U07A 2IF4A 1OCRE 4UUCA 2ETCA 3E4BA 4ZHBA 2DIWA 4NURA 5G04J 2XRYA 4FP7A 3LY7A 3DSTA 4ACKA 3CKBA 4C0MA 4O1OA 4W9RA 2P9IG 3RU0A 2WMOA 3G2UA 3UKUG 4U8YD 2CG2A 3CVWA 1U2VG 4I6EA 2P9NG 2NYJA 4G8KA 5ENPD 3ZGQA 3U4TA 5C2YA 2J8SD 3PEUB 4GZ5A 3SY2A 3I3NA 3TWQA 4N39A 4LNUD 4CRWA 5EKQD 2LXMA 3ONKA 4GTPA 3LPZA 3BG0B 3P2BA 5ITZF 4AOFA 1N52A 3ENEA 4LUNU 3SGHA 1DVPA 1V54E 3DXKG 3E34A 2BEDA 1NA3A 3APCA 3MYVA 4L2YA 3D9MA 1BI8B 2H6HA 1E8ZA 4A3VA 2DYSE 1ZU2A 1H2UA 2MYOA 2EQXA 2RG8A 3APFA 1KPSB 4FC8A 4Y6WA 3QNKA 4MBGA 1QQEA 3IV0A 5A23A 2MOWA 4GAAA 2YHCA 3CV0A 4HOSA 4CT4A 1JWGA 3J5QB 3D9OA 1AP7A 2EIME 4BSZB 3JQ1A 1OWPA 3RO3A 3UMVA 3ZUVB 4EECA 3FULA 3ZRHA 3HDXA 1N4SA 1UJJA 4F1SA 1BPOA 5AN8A 1PY1A 4FU3A 4GTMA 2F0YA 1N54A 4JHKA 4GPMA 5G05C 3CHSA 4BESA 5FWQA 1Y8MA 2I9CA 3FEYA 4GTQA 3C72A 2L0IA 3RKVA 4H7YA 1EDUA 4UQXA 3UT8A 1OUVA 2HM8A 2YHEA 4MS6A 2R17C 2X6IA 1OWNA 5LOZA 3FTZA 3TWTA 4L23A 2CG3A 3SZ7A 3AG2E 2C0LA 2AVPA 1SA4A 4ILHB 2MHKA 5M72A 3B7UX 3NF1A 2GRLA 3RRNB 3HRAA 4U8HA 4C0EA 3D9PA 3UT4A 2R05A 2J08A 3S2AA 5HS0A 3HG0D 3DSVA 2X6FA 4BWRA 3UX4A 3CHOA 4U04A 3ML8A 3LS8A 3GW4A 4K5AB 1FVFA 2A4ZA 3PE3A 2WM9A 3C5RA 3MX3A 1H0AA 4Z68A 3L9TA 3ESKA 4DUIA 4FA6A 2V5QC 1SQMA 3QARA 1AWCB 3D9IA 3LY9A 3MV2B 4EZKA 3ZYLA 4I2ZA 2VYIA 3TG5A 4I9EA 2J4BA 3OTNA 2PQRA 2X6KA 4WNFA 4DLQA 2C0MA 3FEXA 5KJNA 4OAUC 1E96B 2E2EA 4YDEA 1N11A 5AQ7A 3TWVA 4JXTA 3SHFA 1IQRA 1QZ2A 5FT9A 3FUHA 3U9WA 5JJ7A 5LX8A 4PDXA 1BI7B 5EIDA 2YNQA 4XIFA 4B0ZA 5B3SE 2V0PA 2V4LA 2VTBB 3S7JA 2WXIA 2LUHA 2QYUA 3MEKA 4ZFHA 1IKND 4GMJA 1N9AA 3T8MA 3R7RA 5FQ8A 3SD5A 4DX7D 3EHMA 1A5EA 4U96D 4A3TA 3CVQA 2NSZA 2PM7A 3HXCA 4BX9A 3DPDA 3NOGD 3ASOE 1FT2A 4IYPA 2WXOA 2I2OA 2XGMA 1BLXB 3TWXA 2KM4A 5FJYA 4UQYA 4G23A 4K03A 2KCLA 3ULEG 3Q73A 3ZEFA 3SI5A 2BTDA 2ONDA 4GYOA 2QYJA 5FZRA 4CYMD 5ENSD 3AAAC 3T5VA 4UWFA 3MV3B 2KATA 4GTTA 5BNWA 2BKGA 4V3IA 3P1UA 3B7RL 2VSOE 2EIKE
chains in the Genus database with same CATH topology
5KBAA 3UTMA 5ENTD 2ETBA 4G8LA 5CBNA 3T9KA 2DZOA 4OAUC 1TR4A 3Q9UC 1MX2A 5ENRD 2QC9A 4U95D 4DX6D 1N11A 5HRYA 1MX6A 3DEPA 2DZNA 3V79K 1MX4A 1N0QA 5AQ7A 5AQBA 3TWVA 3W9FA 2P2CP 2FO1E 1IXVA 3V30A 3LJNA 5CECB 1BD8A 4HLLA 3V2OA 1OT8A 5BXUA 1BI8B 2JABA 2DVWA 3NOCD 5KNGA 4HRMB 1DC2A 5AQAA 3TWTA 3ZU7B 1OY3D 5FIOA 5CEDB 4CZ2D 4BERA 5AAOA 1QYMA 2BKKB 1D9SA 4QQIA 2ZGDA 2MYOA 1BI7B 4O1PA 5EIDA 5EIBE 3ZKJA 1DCQA 3EHQA 5EYPF 3NBNB 1YYHA 1MJ0A 5AQ9A 5EILA 4HRLA 1WG0A 4GMRA 4DRXE 4DX5D 4NIKA 5CBOA 3TWUA 4ZFHA 3T8KA 1IKND 1SW6A 2F37A 5KNHD 1IHBA 3HRAA 1YCSB 2Y1LE 1NFIE 4J8YA 2AJAA 3EHRA 2F8XK 3SO8A 3ZNGA 4OAVB 2XZDG 4N5QA 3V31A 4UUCA 2ETCA 4DX7D 3TWWA 4ATZD 4HQDA 1A5EA 4U96D 3KEAA 4F1PA 5HS0A 3HG0D 4O60A 2L6BA 4ZHBA 3UI2A 3AJIA 1BU9A 1WDYA 4K5CA 1K1AA 4J7WA 2KXPC 5HKPA 3J5QB 3W9GA 5ENQD 3TWSA 2XZTG 1AP7A 4HI9A 4BSZB 1YMPA 2XEEA 5KWDA 1UOHA 3F6QA 4O1OA 4HI8A 3NOGD 3V2XA 3ZUVB 3JXIA 4K5AB 3B7BA 4U8YD 5BXOA 3C5RA 4Z68A 5EN5D 2XENA 3Q9NC 1N0RA 1BLXB 2PNNA 2XEHA 5CERB 4G8KA 2NYJA 5ENPD 3TWXA 4C48B 3UXGA 2F8YA 3IXEA 4HB5A 4DUIA 2J8SD 2KBXA 2V5QC 5AN8A 2DWZA 5FINA 5EYLA 4LG6A 1AWCB 2ZGGA 3DEOA 5CEAA 1K1BA 2A5EA 3JUEA 2QYJA 4DX1A 2V4HC 3B95A 5D66A 3JXJA 5ENSD 3TWQA 4LNUD 4BETA 4CYMD 5JMND 3EU9A 4BEPA 1K3ZD 3AAAC 5JA4D 4TUMA 2RFAA 5ENOD 1G3NB 4GPMA 4JB8P 4HNAD 4LSZE 1SVXA 4F6RD 4HRNA 2VGEA 5AARA 4BESA 1MYOA 3TWRA 2B0OE 2BKGA 4YDYA 2RFMA 2Y0BG 4U8VD 5ITZF 4QFVA 2HE0A 4RLYA 4A63B 1S70B 4HBDA 4K5BA 3D9HA 3J5PA 4YDWA 2ETAA 4DX2A 4B93B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5KBA A;  3UTM A;  5ENT D;  2ETB A;  4G8L A;  5CBN A;  3T9K A;  2DZO A;  4OAU C;  1TR4 A;  3Q9U C;  1MX2 A;  5ENR D;  2QC9 A;  4U95 D;  4DX6 D;  1N11 A;  5HRY A;  1MX6 A;  3DEP A;  2DZN A;  3V79 K;  1MX4 A;  1N0Q A;  5AQ7 A;  5AQB A;  3TWV A;  3W9F A;  2P2C P;  2FO1 E;  1IXV A;  3V30 A;  3LJN A;  5CEC B;  1BD8 A;  4HLL A;  3V2O A;  1OT8 A;  5BXU A;  1BI8 B;  2JAB A;  2DVW A;  3NOC D;  5KNG A;  4HRM B;  1DC2 A;  5AQA A;  3TWT A;  3ZU7 B;  1OY3 D;  5FIO A;  5CED B;  4CZ2 D;  4BER A;  5AAO A;  1QYM A;  2BKK B;  1D9S A;  4QQI A;  2ZGD A;  2MYO A;  1BI7 B;  4O1P A;  5EID A;  5EIB E;  3ZKJ A;  1DCQ A;  3EHQ A;  5EYP F;  3NBN B;  1YYH A;  1MJ0 A;  5AQ9 A;  5EIL A;  4HRL A;  1WG0 A;  4GMR A;  4DRX E;  4DX5 D;  4NIK A;  5CBO A;  3TWU A;  4ZFH A;  3T8K A;  1IKN D;  1SW6 A;  2F37 A;  5KNH D;  1IHB A;  3HRA A;  1YCS B;  2Y1L E;  1NFI E;  4J8Y A;  2AJA A;  3EHR A;  2F8X K;  3SO8 A;  3ZNG A;  4OAV B;  2XZD G;  4N5Q A;  3V31 A;  4UUC A;  2ETC A;  4DX7 D;  3TWW A;  4ATZ D;  4HQD A;  1A5E A;  4U96 D;  3KEA A;  4F1P A;  5HS0 A;  3HG0 D;  4O60 A;  2L6B A;  4ZHB A;  3UI2 A;  3AJI A;  1BU9 A;  1WDY A;  4K5C A;  1K1A A;  4J7W A;  2KXP C;  5HKP A;  3J5Q B;  3W9G A;  5ENQ D;  3TWS A;  2XZT G;  1AP7 A;  4HI9 A;  4BSZ B;  1YMP A;  2XEE A;  5KWD A;  1UOH A;  3F6Q A;  4O1O A;  4HI8 A;  3NOG D;  3V2X A;  3ZUV B;  3JXI A;  4K5A B;  3B7B A;  4U8Y D;  5BXO A;  3C5R A;  4Z68 A;  5EN5 D;  2XEN A;  3Q9N C;  1N0R A;  1BLX B;  2PNN A;  2XEH A;  5CER B;  4G8K A;  2NYJ A;  5ENP D;  3TWX A;  4C48 B;  3UXG A;  2F8Y A;  3IXE A;  4HB5 A;  4DUI A;  2J8S D;  2KBX A;  2V5Q C;  5AN8 A;  2DWZ A;  5FIN A;  5EYL A;  4LG6 A;  1AWC B;  2ZGG A;  3DEO A;  5CEA A;  1K1B A;  2A5E A;  3JUE A;  2QYJ A;  4DX1 A;  2V4H C;  3B95 A;  5D66 A;  3JXJ A;  5ENS D;  3TWQ A;  4LNU D;  4BET A;  4CYM D;  5JMN D;  3EU9 A;  4BEP A;  1K3Z D;  3AAA C;  5JA4 D;  4TUM A;  2RFA A;  5ENO D;  1G3N B;  4GPM A;  4JB8 P;  4HNA D;  4LSZ E;  1SVX A;  4F6R D;  4HRN A;  2VGE A;  5AAR A;  4BES A;  1MYO A;  3TWR A;  2B0O E;  2BKG A;  4YDY A;  2RFM A;  2Y0B G;  4U8V D;  5ITZ F;  4QFV A;  2HE0 A;  4RLY A;  4A63 B;  1S70 B;  4HBD A;  4K5B A;  3D9H A;  3J5P A;  4YDW A;  2ETA A;  4DX2 A;  4B93 B; 
#chains in the Genus database with same CATH topology
 5KBA A;  2UY1 B;  5CBN A;  1KZP A;  3T9K A;  2H6F A;  3JYS A;  1MQS A;  3HXE A;  1HS6 A;  1N0Q A;  2VQ2 A;  4EZL A;  2IOS A;  1JPL A;  2AXU A;  4DJA A;  3ZHE B;  4KVM A;  4E85 A;  5LFA A;  3CVX A;  3AG4 E;  4CCA A;  1DNP A;  2BKK B;  3SFX A;  1D9S A;  4QQI A;  3EIJ A;  4B89 A;  1TN7 A;  1DCQ A;  4EPZ A;  1UG3 A;  4J8S A;  4NIK A;  2GW1 A;  5G04 C;  4JD2 G;  4J8Y A;  4GYW A;  2F8X K;  1OCC E;  3NZU A;  5CMY A;  2QFC A;  1TJC A;  3N71 A;  3LKU A;  4UI9 J;  4EZJ A;  2VSN A;  4TRQ A;  5C1D A;  3E33 A;  5KWD A;  4GTR A;  3ASG A;  4A1S A;  3KEZ A;  2PNN A;  4U0Z A;  3UXG A;  3CST A;  2LXL A;  3RIB A;  3DSS A;  4DPR A;  1K1B A;  4ANX A;  4DX1 A;  3FUE A;  2OCC E;  2AWI A;  5JMN D;  1K3Z D;  3ML9 A;  1H6K A;  3FTV A;  2VTB A;  4JVS A;  1HO8 A;  4A63 B;  3PZD A;  1TNO A;  5D2M C;  4AJW A;  4B93 B;  3UTM A;  3CHM A;  4ILG A;  1HFA A;  2CFZ A;  3CQC B;  1B89 A;  2XPZ A;  5KJM A;  3L16 A;  3UIN C;  3V30 A;  2L6J A;  3DSW A;  3V2O A;  3O48 A;  2IQC A;  3ZU7 B;  5E76 A;  2V8S E;  4J6I A;  1UW4 B;  4U7E B;  3QWP A;  3FU5 A;  3NAW A;  4O1P A;  5EIB E;  4MLP A;  3EU5 A;  3ULQ A;  5FQ4 A;  4CGW A;  1EPU A;  3QWW A;  2XEV A;  1JCR A;  2XZD G;  4I1A A;  4N5Q A;  1HU3 A;  3TWW A;  3C98 A;  3ESL A;  2IJG X;  4O60 A;  3Q7A A;  1VDY A;  1GW6 A;  1HX8 A;  5ENQ D;  2XZT G;  4BT8 A;  4GA2 A;  1JUQ A;  2R5S A;  4HI8 A;  3LEW A;  2UY1 A;  2H6G A;  3JXI A;  4F53 A;  3OXL A;  3AU4 A;  3IHY A;  2WXM A;  5E75 A;  3Q79 A;  2XS1 A;  3ZHE A;  3LCA A;  2FI7 A;  3CLJ A;  2V4H C;  5D66 A;  1E8X A;  4LNB A;  4WWO A;  4N3C A;  4EQF A;  3D9J A;  4TUM A;  5CMW A;  4RG6 A;  4HOR A;  4N5C A;  3FUN A;  5EDS A;  4IN3 B;  3IEG A;  3TL5 A;  4CGV A;  4RLY A;  5LCW J;  4TXR A;  2P9P G;  2WB2 A;  3MCX A;  4G8L A;  4JHR A;  1TNY A;  4LRZ A;  1N94 A;  2P9L G;  3L17 A;  3Q78 A;  4U63 A;  3UT7 A;  1IXV A;  2B6C A;  4J8D A;  3APD A;  5G2N A;  2Y4T A;  4GPK A;  4HRM B;  2ION A;  4B8A A;  1XNF A;  1V55 E;  4GCN A;  4AM9 A;  3T5X A;  4PS7 A;  1ZB1 A;  2HYZ A;  3UUX A;  2IOL A;  4TV3 A;  4TXQ A;  5IY5 E;  4L1B A;  1PC2 A;  3LVQ E;  3LXU X;  3ZYQ A;  2J9Q A;  2PL2 A;  5T4Y A;  2Y1L E;  3E37 A;  4G24 A;  3PRZ A;  4OAV B;  4APF A;  3RRU A;  2PQN A;  4JW1 A;  2Q7F A;  2IFU A;  4RVB A;  2ZIS A;  5ENN A;  3MKQ B;  3GZ1 A;  4J7W A;  5T8I A;  3FP3 A;  4FJY A;  4E6H A;  3F6Q A;  3DXM G;  3L08 A;  3G2T A;  5EN5 D;  2QZA A;  5DIZ A;  1P5Q A;  1SA5 A;  2WXJ A;  4CDN A;  2KC7 A;  3PZ2 A;  4HB5 A;  4URK A;  2BF0 X;  4JEH A;  4LG6 A;  3URZ A;  4KBQ A;  3CVY A;  4P29 A;  3EU9 A;  5ENO D;  3ASD A;  1A17 A;  3HXF A;  3TWR A;  2I1J A;  2IEJ A;  3O4Z A;  3ZN3 A;  1X81 A;  4AIF A;  3FUF A;  2IO3 C;  3FHE A;  3OAW A;  1TR4 A;  1OWL A;  1MX2 A;  4DX6 D;  3I4G A;  4U0U A;  3V79 K;  2MRI A;  3LJN A;  5CEC B;  4HLL A;  2GRO B;  4OYS A;  4AXH A;  3AS8 A;  1OY3 D;  4ANV A;  3CSF A;  4RSY A;  2ZGD A;  3NBN B;  2CFU A;  3FWV A;  4ANW A;  1S0P A;  1E90 A;  2CHW A;  4GTS A;  5DBK A;  5KJK A;  3WG7 E;  3BUA A;  2L0T B;  2P9S G;  4EHM A;  1WDY A;  2GRM A;  5CRV A;  4ABN A;  3EUV A;  3MJW A;  4GZC A;  3MZL B;  3PNL B;  3CHP A;  3VLF A;  4WWP A;  3AG1 E;  4HOU A;  2J49 A;  3FH8 A;  3E32 A;  3Q15 A;  4FAD A;  3CIA A;  1EF1 C;  2WXN A;  4JPS A;  5EX3 A;  3L22 A;  4CDR A;  3C3R A;  3C3Q A;  4LSZ E;  3RSE G;  1O1T A;  2GRP B;  2RFM A;  3QWV A;  4YDW A;  3L6A A;  3DRA A;  3Q47 B;  4WAF A;  3PRE A;  3Q9U C;  3MKQ A;  4XE0 A;  3CK9 A;  4Q69 A;  3QC1 A;  3MGB A;  1H2T C;  1IHG A;  3CEQ A;  2DVW A;  1LTX A;  4K0R A;  5AQA A;  2WPV A;  2ZIR A;  4GTO A;  1N4R A;  1K8K G;  5BUZ A;  3KS2 A;  4AY5 A;  5LP0 A;  4HRL A;  5CBO A;  1O1R A;  2DBA A;  3I4R B;  3T8K A;  2F37 A;  4I6G A;  1FCH A;  3RO2 A;  2CHX A;  2AJA A;  4GML A;  4PS8 A;  1WAO 1;  3SO8 A;  4ATZ D;  5H7P A;  3ZYK A;  2P58 C;  3KEA A;  3FTW A;  5FQ7 A;  3FU3 A;  3S7D A;  1RW2 A;  5JJT A;  3Q4A B;  4FHK A;  3LYA A;  4J0U A;  3CR3 A;  3TG4 A;  3QJZ A;  1TJF A;  3DBS A;  5A6C A;  2F8Y A;  2KBX A;  4KVO A;  1NP7 A;  3RAU A;  2DWZ A;  3PZ4 A;  5G05 J;  3RRM B;  1LF8 A;  4NAC A;  3UIP C;  1E8W A;  2EIJ E;  3UM1 A;  5CEA A;  2A5E A;  3ZW3 A;  3G2S A;  1S64 A;  4BET A;  2C2L A;  4RQI A;  3PZ1 A;  2RFA A;  3FUM A;  2J4D A;  4F6R D;  4GB9 A;  3ASN E;  5AAR A;  2JEK A;  5CCL A;  2AXV A;  2HE0 A;  1NA0 A;  4K5B A;  1LD7 A;  4DX2 A;  5AJD A;  4KMO A;  4N2Q A;  2IU1 A;  1E7V A;  4G2V A;  5ENR D;  4YND A;  1Q2Z A;  3ZXS A;  3W9F A;  1IYG A;  1TEZ A;  1BD8 A;  3G2W A;  2J07 A;  2UWJ G;  5FZQ A;  3KSQ A;  1N4P A;  3ZYM A;  1RZ4 A;  4DI4 A;  5A7D B;  3ABM E;  3UPV A;  5ARF A;  4XI9 A;  1H2V C;  3R9A B;  4XKB A;  3QK0 A;  3CGH A;  2I1K A;  4M7C A;  3B7S A;  2IO2 C;  2KCK A;  1FVH A;  1X5B A;  2X38 A;  3EHR A;  3ZNG A;  4NRH B;  3Q49 B;  2XRZ A;  2GRQ B;  2AW6 A;  3ONL A;  3QAQ A;  3AJI A;  3VTY A;  3TXM A;  3S7B A;  2XGS A;  4JHJ A;  4XEI G;  4D10 C;  4EBA G;  5FZS A;  3B7B A;  4OVV A;  4BY6 A;  3SNX A;  4DLO A;  3Q5M A;  2VJ8 A;  3FDH A;  2OOE A;  5BW8 C;  5ARG A;  4DK5 A;  5JA4 D;  3CQG B;  1G3N B;  3HXB A;  2BUG A;  3VLE A;  2B0O E;  1U3C A;  4HLE A;  4YDY A;  3NQP A;  4XI0 A;  2QY7 A;  5BPP A;  2GRN B;  1SZ9 A;  1E8Y A;  4N3A A;  4JZY A;  2I6H A;  2Y3A A;  4N2S A;  2KCV A;  3HYM B;  3RJV A;  3D9L A;  2X3M A;  4IRU A;  3FUD A;  5B1B E;  4FJZ A;  2WMN A;  1KZO A;  5AAO A;  3EDT B;  4I43 A;  1YYH A;  5EIL A;  3D3M A;  3QKY A;  1MZC A;  3D9K A;  4FLB A;  4WND A;  3B13 A;  1H19 A;  2FBN A;  2R02 A;  1INZ A;  4F1P A;  3L13 A;  2PM6 A;  1O5M A;  4ILI A;  2XCB A;  3ZXP A;  5HKP A;  4PS3 A;  3W9G A;  2R59 A;  3U3W A;  4WNE A;  3UIO C;  4BT9 A;  2WXF A;  2XEN A;  5CER B;  2FUL A;  4JL0 A;  1LD8 A;  4PUC A;  1ZBP A;  3CVL A;  1KT1 A;  2HR2 A;  1TYQ G;  3MA5 A;  2LAH A;  2VGY A;  4WWN A;  1Y6I A;  5JJ6 A;  2OEW A;  2Y0B G;  4Q94 A;  4HBD A;  2R03 A;  3CVP A;  5FTP A;  2ETB A;  2WXG A;  3ABK E;  2OEV A;  2ZXW E;  5HRY A;  3QDN A;  2DCP A;  3OXF A;  3HXD A;  2M63 A;  5KNG A;  4JEU A;  5CED B;  2OVF A;  1HG2 A;  4I9C A;  4LER A;  4HOQ A;  3KAE A;  3IHV A;  3FH7 A;  4HOT A;  4L2L A;  3DWL G;  4HS2 A;  1NFI E;  3ZVV A;  1UJK A;  4HQD A;  4TXP A;  3U66 A;  3UI2 A;  1BU9 A;  4Y6C A;  1NI1 A;  4G11 A;  4GA0 A;  4GCO A;  1K1A A;  3S7F A;  1WY6 A;  3EIQ C;  2NC9 A;  2WXK A;  1IQU A;  2YQ8 A;  1TN8 A;  4BTB A;  1N0R A;  4I2W A;  1JCS A;  1OCO E;  1HH8 A;  1FT1 A;  4ACL A;  3U64 A;  3VLD A;  3BEE A;  3JXJ A;  2WQH A;  1O1S A;  4GA1 A;  5D0Q D;  2OVB A;  1HF8 A;  4KZC A;  4HRN A;  3D9H A;  2ETA A;  1WM5 A;  4I1O B;  3CHR A;  5JHB A;  3B7T A;  3C3O A;  4TUU A;  2DZN A;  5FQ6 A;  1MX4 A;  2ZU6 B;  2VSX E;  3L82 A;  2XPY A;  5ANR A;  3I5P A;  4G25 A;  4CZ2 D;  5AYW D;  3L54 A;  1H6O A;  3SFZ A;  5EYP F;  3DSU A;  4CT0 A;  1WG0 A;  4GMR A;  4YVQ C;  3QOU A;  2E0I A;  1D8E A;  5KNH D;  3FY4 A;  4FLH A;  2H6I A;  4UWL A;  4BX8 A;  5AJL A;  1N4Q A;  4K5C A;  5G55 A;  2LSU A;  3G2V A;  4AEZ C;  2WQ7 A;  3NZS A;  3LDZ A;  3ISM C;  3FU0 A;  3HHM A;  2WXR A;  4FUL A;  2XEH A;  4C48 B;  3FUK A;  4UWH A;  5D0O D;  3UKR G;  3X2Q E;  3B95 A;  1YA0 A;  4BEP A;  4IUL A;  3GZ2 A;  4BFR A;  1SVX A;  2EIN E;  3QB2 A;  3CK8 A;  4LEU A;  4QFV A;  2DYR E;  4KXK B;  2XCC A;  1Z5S C;  2QC9 A;  4AY6 A;  3ZPJ A;  1SZA A;  2Y4U A;  2JLB A;  5BXU A;  3EHN A;  4I17 A;  4HFG A;  3RK6 A;  1E7U A;  3TGO A;  2CHZ A;  4H7X A;  1DCE A;  3UM3 A;  1QYM A;  3MKR A;  3D9N A;  1EYH A;  2NXP A;  3IKO B;  5ANL A;  3ULY A;  3ZIM A;  2VGX B;  4G1T A;  5KJL A;  3TJP A;  3KSL A;  1TNB A;  1HG5 A;  3Q7F A;  3DSX A;  4ATG A;  2IY0 C;  4RG9 A;  5CCM A;  2LSV A;  3LVR E;  4FHJ A;  2KZT B;  4HI9 A;  3GZS A;  1UOH A;  3V2X A;  4UI9 C;  5BXO A;  2WXQ A;  4UI9 K;  3Q9N C;  1FPP A;  1UN8 A;  3JCK C;  1W3B A;  4DI3 A;  3IXE A;  4APO A;  3PEV B;  3UM2 A;  2EIL E;  4B94 A;  3CHQ A;  3GYZ A;  3JUE A;  3R7Q A;  3HIZ A;  3JUI A;  3UQ3 A;  1NL4 A;  4JC8 A;  3FU6 A;  4HNA D;  1Z3X A;  2OV8 A;  4PH4 B;  2VSY A;  3CVN A;  1ELK A;  4U8V D;  2WXL A;  5T3R A;  4GU5 A;  3OXG A;  1S70 B;  3IBE A;  2YIN A;  3K9I A;  5ENT D;  4O6F A;  3TXN A;  3DPY A;  4R7L A;  4YVO A;  3PZ3 A;  3DEP A;  2XS8 A;  4CEM A;  1ELW A;  3PUK A;  2JAB A;  2GGF A;  1PAQ A;  3PH0 C;  4GYY A;  2FF4 A;  4BER A;  4G26 A;  4L9P A;  4XKC A;  1HZ4 A;  1MHQ A;  3FTX A;  1S63 A;  4KYO B;  1MJ0 A;  1Z3Y A;  3LJ3 A;  4WUY A;  4DRX E;  4U0S A;  1SW6 A;  4MRU A;  3SQV A;  3ABL E;  3V31 A;  1HXI A;  5BV1 A;  1D8D A;  1KLX A;  3PVL A;  3AU5 A;  4BSX A;  4UWK A;  2X6J A;  2P9K G;  3BQO A;  5B1A E;  5HI7 A;  4X8Q A;  3FUI A;  1OWM A;  1QBQ A;  4AV7 A;  4GZD A;  4WNG A;  3FTS A;  4MKT A;  5AEN A;  3HVE B;  3FUJ A;  1OCZ E;  3SF4 A;  2PZI A;  5EYL A;  2ZGG A;  3DEO A;  4YDO A;  2J09 A;  3PUJ A;  2GRR B;  5AIJ A;  3BU8 A;  1UN9 A;  3TAX A;  4I1M A;  2FEZ A;  3LY8 A;  4GZ3 A;  3PNT B;  2VGE A;  3FH5 A;  5JHA A;  1TNU A;  2LO6 A;  3ASF A;  1XGW A;  2L9B A;  2VGX A;  4A1G A;  4GTV A;  2Y69 E;  1TN6 A;  2WVI A;  3PDN A;  2RKK A;  4U95 D;  5LCW C;  2KZT A;  3ZFW A;  2A5U A;  5AQB A;  2WXH A;  2P2C P;  4JA7 A;  5BT1 A;  4GZ6 A;  1H6P A;  3SFY A;  1OT8 A;  2LAI A;  4XZ4 A;  2FO7 A;  2XHE A;  3CK7 A;  5FIO A;  3EJN A;  5HQ8 A;  3CKC A;  1OXJ A;  1L5J A;  2RD0 A;  3ZKJ A;  5AQ9 A;  4C9B B;  5KCM A;  4UWG A;  1Z6T A;  4A55 A;  5BV0 A;  1KT0 A;  1YCS B;  1TNZ A;  4M3O A;  2HO1 A;  4ME2 A;  2XQ0 A;  2XGO A;  4EBA A;  2L6B A;  1U3D A;  3SBS A;  2R2L A;  2KXP C;  3TWS A;  1YMP A;  2XEE A;  3FFL A;  3NB2 A;  3CVU A;  4Q96 A;  2AXZ A;  3AG3 E;  3VTX A;  2ILR A;  5FIN A;  1HE8 A;  4J8E A;  4HXI A;  5EX0 A;  2P9U G;  2LNI A;  5J90 A;  5J08 A;  1ELR A;  4J8F A;  4JB8 P;  1N95 A;  2WQ6 A;  3WXX A;  3CVV A;  4KT6 B;  4JA9 A;  1MYO A;  4F3V A;  5CHE E;  4I6J A;  3J5P A;  3FTY A;  4LNG A;  3SBT B;  4HVB A;  3BG1 B;  2DZO A;  4LCT A;  3UM0 A;  3E30 A;  4CDM A;  4XX5 A;  1MX6 A;  4NQ0 A;  3Q75 A;  1OWO A;  2X6H A;  4ANU A;  2WXP A;  2FO1 E;  4KZ0 A;  1NZN A;  3FTU A;  4UQZ A;  4L7T A;  4BTA A;  3AS4 A;  2XPI A;  4N3B A;  3NOC D;  1DC2 A;  4B8C B;  3KD7 A;  3R9M A;  4AP2 A;  5CRU A;  1QNF A;  1JCQ A;  3PE4 A;  3PS6 A;  3HVE A;  3EHQ A;  4F7A A;  3JQ0 A;  1JWF A;  4DX5 D;  3TWU A;  4OVU A;  2V5F A;  3AS5 A;  1IHB A;  4AVX A;  3ASH A;  4U07 A;  2IF4 A;  1OCR E;  4UUC A;  2ETC A;  3E4B A;  4ZHB A;  2DIW A;  4NUR A;  5G04 J;  2XRY A;  4FP7 A;  3LY7 A;  3DST A;  4ACK A;  3CKB A;  4C0M A;  4O1O A;  4W9R A;  2P9I G;  3RU0 A;  2WMO A;  3G2U A;  3UKU G;  4U8Y D;  2CG2 A;  3CVW A;  1U2V G;  4I6E A;  2P9N G;  2NYJ A;  4G8K A;  5ENP D;  3ZGQ A;  3U4T A;  5C2Y A;  2J8S D;  3PEU B;  4GZ5 A;  3SY2 A;  3I3N A;  3TWQ A;  4N39 A;  4LNU D;  4CRW A;  5EKQ D;  2LXM A;  3ONK A;  4GTP A;  3LPZ A;  3BG0 B;  3P2B A;  5ITZ F;  4AOF A;  1N52 A;  3ENE A;  4LUN U;  3SGH A;  1DVP A;  1V54 E;  3DXK G;  3E34 A;  2BED A;  1NA3 A;  3APC A;  3MYV A;  4L2Y A;  3D9M A;  1BI8 B;  2H6H A;  1E8Z A;  4A3V A;  2DYS E;  1ZU2 A;  1H2U A;  2MYO A;  2EQX A;  2RG8 A;  3APF A;  1KPS B;  4FC8 A;  4Y6W A;  3QNK A;  4MBG A;  1QQE A;  3IV0 A;  5A23 A;  2MOW A;  4GAA A;  2YHC A;  3CV0 A;  4HOS A;  4CT4 A;  1JWG A;  3J5Q B;  3D9O A;  1AP7 A;  2EIM E;  4BSZ B;  3JQ1 A;  1OWP A;  3RO3 A;  3UMV A;  3ZUV B;  4EEC A;  3FUL A;  3ZRH A;  3HDX A;  1N4S A;  1UJJ A;  4F1S A;  1BPO A;  5AN8 A;  1PY1 A;  4FU3 A;  4GTM A;  2F0Y A;  1N54 A;  4JHK A;  4GPM A;  5G05 C;  3CHS A;  4BES A;  5FWQ A;  1Y8M A;  2I9C A;  3FEY A;  4GTQ A;  3C72 A;  2L0I A;  3RKV A;  4H7Y A;  1EDU A;  4UQX A;  3UT8 A;  1OUV A;  2HM8 A;  2YHE A;  4MS6 A;  2R17 C;  2X6I A;  1OWN A;  5LOZ A;  3FTZ A;  3TWT A;  4L23 A;  2CG3 A;  3SZ7 A;  3AG2 E;  2C0L A;  2AVP A;  1SA4 A;  4ILH B;  2MHK A;  5M72 A;  3B7U X;  3NF1 A;  2GRL A;  3RRN B;  3HRA A;  4U8H A;  4C0E A;  3D9P A;  3UT4 A;  2R05 A;  2J08 A;  3S2A A;  5HS0 A;  3HG0 D;  3DSV A;  2X6F A;  4BWR A;  3UX4 A;  3CHO A;  4U04 A;  3ML8 A;  3LS8 A;  3GW4 A;  4K5A B;  1FVF A;  2A4Z A;  3PE3 A;  2WM9 A;  3C5R A;  3MX3 A;  1H0A A;  4Z68 A;  3L9T A;  3ESK A;  4DUI A;  4FA6 A;  2V5Q C;  1SQM A;  3QAR A;  1AWC B;  3D9I A;  3LY9 A;  3MV2 B;  4EZK A;  3ZYL A;  4I2Z A;  2VYI A;  3TG5 A;  4I9E A;  2J4B A;  3OTN A;  2PQR A;  2X6K A;  4WNF A;  4DLQ A;  2C0M A;  3FEX A;  5KJN A;  4OAU C;  1E96 B;  2E2E A;  4YDE A;  1N11 A;  5AQ7 A;  3TWV A;  4JXT A;  3SHF A;  1IQR A;  1QZ2 A;  5FT9 A;  3FUH A;  3U9W A;  5JJ7 A;  5LX8 A;  4PDX A;  1BI7 B;  5EID A;  2YNQ A;  4XIF A;  4B0Z A;  5B3S E;  2V0P A;  2V4L A;  2VTB B;  3S7J A;  2WXI A;  2LUH A;  2QYU A;  3MEK A;  4ZFH A;  1IKN D;  4GMJ A;  1N9A A;  3T8M A;  3R7R A;  5FQ8 A;  3SD5 A;  4DX7 D;  3EHM A;  1A5E A;  4U96 D;  4A3T A;  3CVQ A;  2NSZ A;  2PM7 A;  3HXC A;  4BX9 A;  3DPD A;  3NOG D;  3ASO E;  1FT2 A;  4IYP A;  2WXO A;  2I2O A;  2XGM A;  1BLX B;  3TWX A;  2KM4 A;  5FJY A;  4UQY A;  4G23 A;  4K03 A;  2KCL A;  3ULE G;  3Q73 A;  3ZEF A;  3SI5 A;  2BTD A;  2OND A;  4GYO A;  2QYJ A;  5FZR A;  4CYM D;  5ENS D;  3AAA C;  3T5V A;  4UWF A;  3MV3 B;  2KAT A;  4GTT A;  5BNW A;  2BKG A;  4V3I A;  3P1U A;  3B7R L;  2VSO E;  2EIK E; 
#chains in the Genus database with same CATH homology
 5KBA A;  3UTM A;  5ENT D;  2ETB A;  4G8L A;  5CBN A;  3T9K A;  2DZO A;  4OAU C;  1TR4 A;  3Q9U C;  1MX2 A;  5ENR D;  2QC9 A;  4U95 D;  4DX6 D;  1N11 A;  5HRY A;  1MX6 A;  3DEP A;  2DZN A;  3V79 K;  1MX4 A;  1N0Q A;  5AQ7 A;  5AQB A;  3TWV A;  3W9F A;  2P2C P;  2FO1 E;  1IXV A;  3V30 A;  3LJN A;  5CEC B;  1BD8 A;  4HLL A;  3V2O A;  1OT8 A;  5BXU A;  1BI8 B;  2JAB A;  2DVW A;  3NOC D;  5KNG A;  4HRM B;  1DC2 A;  5AQA A;  3TWT A;  3ZU7 B;  1OY3 D;  5FIO A;  5CED B;  4CZ2 D;  4BER A;  5AAO A;  1QYM A;  2BKK B;  1D9S A;  4QQI A;  2ZGD A;  2MYO A;  1BI7 B;  4O1P A;  5EID A;  5EIB E;  3ZKJ A;  1DCQ A;  3EHQ A;  5EYP F;  3NBN B;  1YYH A;  1MJ0 A;  5AQ9 A;  5EIL A;  4HRL A;  1WG0 A;  4GMR A;  4DRX E;  4DX5 D;  4NIK A;  5CBO A;  3TWU A;  4ZFH A;  3T8K A;  1IKN D;  1SW6 A;  2F37 A;  5KNH D;  1IHB A;  3HRA A;  1YCS B;  2Y1L E;  1NFI E;  4J8Y A;  2AJA A;  3EHR A;  2F8X K;  3SO8 A;  3ZNG A;  4OAV B;  2XZD G;  4N5Q A;  3V31 A;  4UUC A;  2ETC A;  4DX7 D;  3TWW A;  4ATZ D;  4HQD A;  1A5E A;  4U96 D;  3KEA A;  4F1P A;  5HS0 A;  3HG0 D;  4O60 A;  2L6B A;  4ZHB A;  3UI2 A;  3AJI A;  1BU9 A;  1WDY A;  4K5C A;  1K1A A;  4J7W A;  2KXP C;  5HKP A;  3J5Q B;  3W9G A;  5ENQ D;  3TWS A;  2XZT G;  1AP7 A;  4HI9 A;  4BSZ B;  1YMP A;  2XEE A;  5KWD A;  1UOH A;  3F6Q A;  4O1O A;  4HI8 A;  3NOG D;  3V2X A;  3ZUV B;  3JXI A;  4K5A B;  3B7B A;  4U8Y D;  5BXO A;  3C5R A;  4Z68 A;  5EN5 D;  2XEN A;  3Q9N C;  1N0R A;  1BLX B;  2PNN A;  2XEH A;  5CER B;  4G8K A;  2NYJ A;  5ENP D;  3TWX A;  4C48 B;  3UXG A;  2F8Y A;  3IXE A;  4HB5 A;  4DUI A;  2J8S D;  2KBX A;  2V5Q C;  5AN8 A;  2DWZ A;  5FIN A;  5EYL A;  4LG6 A;  1AWC B;  2ZGG A;  3DEO A;  5CEA A;  1K1B A;  2A5E A;  3JUE A;  2QYJ A;  4DX1 A;  2V4H C;  3B95 A;  5D66 A;  3JXJ A;  5ENS D;  3TWQ A;  4LNU D;  4BET A;  4CYM D;  5JMN D;  3EU9 A;  4BEP A;  1K3Z D;  3AAA C;  5JA4 D;  4TUM A;  2RFA A;  5ENO D;  1G3N B;  4GPM A;  4JB8 P;  4HNA D;  4LSZ E;  1SVX A;  4F6R D;  4HRN A;  2VGE A;  5AAR A;  4BES A;  1MYO A;  3TWR A;  2B0O E;  2BKG A;  4YDY A;  2RFM A;  2Y0B G;  4U8V D;  5ITZ F;  4QFV A;  2HE0 A;  4RLY A;  4A63 B;  1S70 B;  4HBD A;  4K5B A;  3D9H A;  3J5P A;  4YDW A;  2ETA A;  4DX2 A;  4B93 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...