1K3ZD

X-ray crystal structure of the ikbb/nf-kb p65 homodimer complex
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
258
structure length
221
Chain Sequence
GYVTEDGDTALHLAVIHQHEPFLDFLLGFSAGHEYLDLQNDLGQTALHLAAILGEASTVEKLYAAGAGVLVAERGGHTALHLACRVRAHTCACVLLQPRPSHPRDEDWRLQLEAENYDGHTPLHVAVIHKDAEMVRLLRDAGADLNKPEPTCGRTPLHLAVEAQAASVLELLLKAGADPTARMYGGRTPLGSALLRPNPILARLLRAHGAPEPEDGGDKLS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Transcription factor p65
publication title X-ray crystal structure of an IkappaBbeta x NF-kappaB p65 homodimer complex.
pubmed doi rcsb
source organism Mus musculus
molecule tags Transcription
total genus 65
structure length 221
sequence length 258
ec nomenclature
pdb deposition date 2001-10-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF00023 Ank Ankyrin repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.20 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Ankyrin repeat-containing domain 1k3zD00
1SW6A 2KBXA 1N0RA 5AQ9A 4N5QA 4DX5D 5KNHD 3DEPA 4Z68A 5ENSD 5AN8A 4UUCA 1AWCB 4ZFHA 4J8YA 2XEHA 2DZNA 4U8YD 4QFVA 2V4HC 5CEDB 5AAOA 4HRLA 3EHQA 4O60A 2J8SD 3TWSA 4K5AB 2F8YA 4G8KA 3V2XA 1DCQA 2ETBA 2RFMA 3NOCD 5HS0A 1BD8A 5ENQD 4DX2A 2QC9A 2PNNA 4HRMB 3HRAA 4OAUC 5CBOA 4HQDA 3UI2A 5CECB 5KNGA 5EYLA 5HKPA 5HRYA 1NFIE 5AQBA 4O1OA 5ENOD 2Y0BG 5JA4D 1MJ0A 4J7WA 1UOHA 1N0QA 4DUIA 4U96D 3D9HA 4HBDA 4U8VD 2QYJA 1SVXA 4QQIA 3Q9UC 1N11A 3V79K 2HE0A 4F1PA 2L6BA 2V5QC 3ZNGA 1YCSB 3AJIA 2F8XK 2ZGGA 1WDYA 1IXVA 3W9GA 1K1BA 3TWXA 1DC2A 1OY3D 1BU9A 3TWRA 5ENRD 4GMRA 3W9FA 4BERA 5AARA 3B7BA 5EILA 4BETA 3F6QA 1MX4A 4BSZB 1YMPA 3J5QB 3KEAA 3NOGD 3UXGA 4LNUD 5EYPF 3SO8A 4DRXE 1OT8A 5BXOA 3HG0D 4HNAD 3Q9NC 2FO1E 3B95A 4HLLA 2BKKB 3ZKJA 2ETAA 2JABA 2KXPC 4RLYA 1MX6A 3JXJA 4YDYA 5FIOA 1WG0A 4O1PA 4BESA 5CBNA 1QYMA 1YYHA 2P2CP 5EIBE 4CYMD 4HB5A 4DX7D 5ITZF 1S70B 4NIKA 4U95D 3T9KA 5KBAA 4OAVB 1K3ZD 2XZDG 3JUEA 1IKND 3LJNA 2Y1LE 3TWUA 5KWDA 2ZGDA 3EHRA 3J5PA 3C5RA 2ETCA 4K5CA 4LG6A 5CEAA 2DWZA 4DX6D 3NBNB 4HI9A 2XENA 5ENTD 3ZUVB 5EN5D 4F6RD 1MX2A 4HRNA 4ZHBA 3TWQA 3ZU7B 3UTMA 2DVWA 1MYOA 2F37A 5FINA 2A5EA 1BI7B 1TR4A 4TUMA 2DZOA 5D66A 1K1AA 3EU9A 1AP7A 2AJAA 3DEOA 3TWWA 4ATZD 2VGEA 5ENPD 5EIDA 3V30A 3AAAC 3TWTA 1BI8B 3IXEA 2NYJA 5JMND 4A63B 1G3NB 2B0OE 3V2OA 5AQAA 2RFAA 4K5BA 2BKGA 5AQ7A 1A5EA 4CZ2D 4C48B 4LSZE 4JB8P 4HI8A 4YDWA 1IHBA 1BLXB 5BXUA 1D9SA 2XEEA 3T8KA 2MYOA 4G8LA 4B93B 4BEPA 3TWVA 5CERB 3V31A 2XZTG 4GPMA 4DX1A 3JXIA
chains in the Genus database with same CATH superfamily
5CRVA 5DIZA 4UUCA 3L6AA 4PS8A 3FU3A 1OWLA 2YHEA 1LF8A 4O60A 2GW1A 2IO2C 3CVLA 2X6HA 3B7TA 2VQ2A 5KNGA 2OVFA 4GPKA 2WM9A 3VLEA 5JA4D 1HFAA 3DSXA 4PDXA 1HZ4A 1TN7A 4XZ4A 3ULEG 1O5MA 3EIJA 2OEWA 3ISMC 1WY6A 3DWLG 4CGWA 1ZB1A 2XQ0A 3PUJA 1TN6A 4YDEA 1O1SA 4G24A 4MS6A 3MYVA 3HVEB 5BNWA 5FIOA 2MOWA 3FTVA 5J08A 4BTAA 3VTXA 5ITZF 3T9KA 3FTXA 5B1BE 4JHJA 3JQ0A 5KJLA 5FJYA 2EIJE 3HXDA 3ESLA 1FVFA 1WAO1 1HS6A 3CVYA 1PY1A 3CVQA 1JCSA 4KMOA 4GTSA 4JVSA 3D9IA 4BTBA 1BI8B 5E76A 5AQAA 3R7QA 3CHPA 4AEZC 4RQIA 1BLXB 2IEJA 3CSFA 3TWVA 1XGWA 3Q75A 1N94A 3JXIA 3ZGQA 3S7JA 2XEHA 4U8YD 3UT7A 2V4HC 3TG5A 2XPZA 1HE8A 4K5AB 1N95A 4I43A 5B3SE 4DX2A 2FBNA 4JEUA 3FTSA 2C2LA 4N5CA 3ZXPA 4EHMA 4I1MA 3C3RA 2AXZA 3EJNA 4UQZA 4M7CA 4FU3A 2J49A 4NURA 1YCSB 4N3AA 4AVXA 3ZYKA 5AARA 5EILA 1YMPA 3KEAA 5HI7A 3MCXA 3B95A 4GCNA 5IY5E 1EYHA 4NIKA 3TAXA 4AP2A 2KCLA 2P9UG 4ACKA 3ENEA 2V5FA 1JUQA 4K5CA 4GYOA 4TRQA 5CEAA 5JHAA 4DX6D 3CV0A 2XGOA 5EDSA 2LSUA 2VSOE 1TR4A 2PZIA 3D9KA 2RKKA 4MBGA 4WWNA 1TEZA 4XKBA 5EIDA 3CK8A 5FTPA 4UWKA 2RFAA 3MV2B 2KCVA 3CGHA 4AXHA 4L1BA 4J8EA 4GPMA 1HU3A 3IHYA 4GAAA 4ZFHA 3R9MA 2JLBA 1E7UA 2DZNA 3Q73A 4EECA 4ILIA 2WXFA 3OXFA 2J8SD 4U0SA 1JWFA 2RFMA 1N4QA 3QAQA 4WWPA 3HRAA 3UMVA 1JCRA 1LTXA 4HOQA 4AV7A 3UT4A 3FHEA 2Y4TA 3MJWA 4F1PA 1IQUA 2ONDA 3PS6A 2F8XK 3W9FA 2FULA 2CFUA 5LCWJ 3J5QB 3NOGD 3RO3A 2FO1E 2VSXE 3C98A 2XPIA 2EIME 4YDYA 2FI7A 3FULA 5EIBE 4GA2A 2WXKA 3JUEA 4HS2A 3LJNA 2GROB 3EU5A 4Y6CA 2KZTA 4UQYA 3X2QE 3SFZA 5KCMA 2X6KA 4FLHA 4UI9C 3MX3A 4PS7A 4ANXA 2F37A 3GZ1A 1EF1C 4EBAG 3ZYLA 4ATZD 1UG3A 3DEOA 2WMNA 4U7EB 3ZRHA 1G3NB 2VYIA 5H7PA 2BKGA 5LX8A 4HI8A 2ZXWE 1NI1A 4U0UA 4ILGA 3DXKG 3GZSA 3FH7A 4HOTA 3Q7FA 3FU6A 4YVQC 4DJAA 3LDZA 3V2XA 3UQ3A 4JHKA 3ULQA 2CHWA 4A1GA 1KZOA 4GTVA 3D3MA 2WXNA 3LY7A 3FUMA 3C72A 2AWIA 4QQIA 3O4ZA 2FEZA 5T3RA 4DLOA 3HXFA 4BFRA 3ZN3A 3CVVA 1HH8A 4GTPA 3ZKJA 2BKKB 4L23A 1EPUA 1FVHA 4DPRA 4BESA 4GMJA 5D0OD 1S70B 4TV3A 3JYSA 1U3DA 1Z3XA 4D10C 5CCLA 2Y1LE 2R5SA 3EHRA 2ETCA 2YINA 4LG6A 4F1SA 4NRHB 4A3VA 2GRQB 3MKQB 2EILE 4CEMA 3MGBA 4GTQA 3LYAA 3IXEA 1TNBA 2PQNA 3NAWA 4PUCA 3DSUA 1N4RA 3T8KA 3ZPJA 2XS1A 4N2SA 1N0RA 4N5QA 5ANRA 5AN8A 2XCCA 2OCCE 3D9MA 3SFXA 3FEXA 3PZ1A 2BUGA 4G8KA 5A23A 1HO8A 2WQ7A 3SFYA 2KM4A 4GB9A 4JD2G 4XX5A 3SBTB 4A3TA 2I1KA 4CDNA 3L22A 2WXMA 4AOFA 2XEVA 3I4GA 1QQEA 3PDNA 4GZDA 1IXVA 1TJFA 2KATA 4UWGA 4LRZA 4BWRA 1BPOA 4HLEA 3CLJA 5BXOA 4LNUD 1OT8A 4I9EA 5CMWA 4BY6A 3LY8A 4JC8A 3DRAA 3BEEA 5JJ6A 3JXJA 1NP7A 3PZDA 2EIKE 2P2CP 1Y8MA 2KCKA 3CSTA 1H0AA 3QB2A 1PC2A 3CHRA 4KVOA 1DNPA 3HYMB 4HI9A 4J8FA 2CG2A 1RW2A 3ZU7B 5JJ7A 2CFZA 2WXJA 3AU5A 4L9PA 4C9BB 3UM2A 2LNIA 3LPZA 5BV0A 3SZ7A 3S7DA 3FTWA 1E7VA 4AM9A 2ZIRA 3E33A 3E32A 4G8LA 5FQ6A 1SQMA 3V31A 4F3VA 5CCMA 3U9WA 4EZLA 5AQ9A 3DEPA 1MHQA 2VGXB 3TXMA 3SGHA 2WMOA 3ZEFA 3ONLA 1OCCE 2P9PG 2ETBA 4XI0A 2P9KG 5ARFA 1S0PA 4B94A 3LVRE 5EYLA 3MEKA 3EUVA 1NFIE 2X6IA 4G11A 2FO7A 1N0QA 4DUIA 2H6FA 4WNGA 1OWPA 4Q69A 1N11A 3UPVA 3AG4E 2J9QA 1E8XA 4GZ3A 3R7RA 2QY7A 3ABLE 3ZW3A 1YA0A 3HG0D 3D9JA 4EQFA 3C3OA 1UW4B 1WG0A 4MLPA 2IY0C 2LAHA 3URZA 3GZ2A 1K3ZD 4XKCA 2P9LG 2XZDG 3RSEG 3T5VA 3J5PA 2V8SE 3CHQA 3KS2A 4GMLA 4B0ZA 2RG8A 2VTBA 2GRMA 4I9CA 1AP7A 3CK9A 3FFLA 3PRZA 4MRUA 4UQXA 5C2YA 3ML9A 3HIZA 3Q15A 3TJPA 2XS8A 4WWOA 4XE0A 1H19A 3L16A 4U04A 1FT2A 3CIAA 3FUHA 2R05A 3LKUA 5CEDB 1UJJA 2A5UA 3U66A 2QC9A 3UM1A 2AVPA 5AJLA 3QK0A 3UI2A 3ZXSA 3ZIMA 3PE4A 1RZ4A 2LSVA 4UI9J 4URKA 5G04C 2CG3A 4KBQA 3SD5A 1UOHA 4HXIA 1TNZA 4HBDA 4U8VD 5FZSA 5FQ8A 2WQ6A 2X38A 3DSVA 3CR3A 3ML8A 5AYWD 3G2TA 4BERA 3JQ1A 1SA4A 1LD7A 2ETAA 1A17A 3CKCA 2BTDA 1TYQG 1PAQA 3AG3E 5KJMA 3OTNA 4U0ZA 3NZSA 4JPSA 2WXQA 2ZGDA 3HXBA 3C5RA 2XGSA 5ARGA 1KT0A 2VSNA 4AJWA 1QZ2A 5E75A 4K0RA 3HXEA 3PEUB 2VGEA 2UY1A 1DCEA 3AAAC 5FWQA 3TWTA 5AQ7A 3CVPA 1A5EA 4NQ0A 3PZ3A 4CDMA 3ASHA 1INZA 2KBXA 5ENSD 3IBEA 4AIFA 3VLDA 4EPZA 4QFVA 3PE3A 2IJGX 4LNGA 4J8DA 3NOCD 3RU0A 3UM0A 2PNNA 4HQDA 3QNKA 4DK5A 4LCTA 5AJDA 5LOZA 1KPSB 3FTUA 3DXMG 3RRMB 3RO2A 4M3OA 4UWLA 4YNDA 5AIJA 2I2OA 2V5QC 3ZNGA 2MHKA 3GYZA 2ZGGA 1WDYA 4B89A 1OY3D 2H6GA 3HVEA 2PM6A 3BG1B 4BSZB 1D8DA 3UXGA 3SO8A 2Y3AA 2H6IA 3JCKC 3Q9NC 1N9AA 3ZHEB 2JABA 3FTZA 1H2TC 4GZ6A 5CBNA 2V0PA 2R2LA 4CYMD 5CHEE 4YVOA 5KBAA 3IV0A 1NL4A 3MA5A 3S7FA 3APCA 4H7XA 3PUKA 3QWWA 2OOEA 4BT9A 5BUZA 1ZU2A 3QC1A 5EN5D 4FLBA 3N71A 1OWOA 3ZYQA 3ESKA 2BEDA 2P9NG 1MQSA 3OAWA 2NYJA 3ASOE 4K5BA 2I9CA 1XNFA 2XEEA 3OXGA 4DX5D 4R7LA 5KNHD 5LFAA 2AXVA 4JXTA 5AENA 2XRZA 3FU5A 3EHQA 5G05J 5A6CA 1Z5SC 4I6EA 2LXLA 5LP0A 3SBSA 4N2QA 1N54A 4GTTA 3PVLA 4U63A 4XIFA 5HRYA 4FA6A 4GTMA 2Y0BG 5EX3A 1E8WA 5C1DA 1E90A 4E85A 1LD8A 3ZVVA 2I6HA 2X3MA 3SY2A 2IFUA 2PL2A 4RG6A 1DC2A 1MX4A 3G2UA 3UIOC 2GRLA 2DCPA 3CVWA 1IYGA 2F0YA 3RKVA 5HQ8A 1Y6IA 1QYMA 1U2VG 3I4RB 2R02A 3FP3A 4U95D 3EHNA 3UM3A 3KSLA 4DI4A 4JA7A 1U3CA 3TGOA 3LCAA 3FH8A 1MX2A 3QDNA 4J8SA 1SA5A 1ELWA 3AS4A 1Z3YA 3JUIA 4G23A 3KEZA 5FQ4A 1HG2A 4WAFA 5CMYA 4CZ2D 4C48B 5BXUA 2YHCA 3BQOA 3RRUA 4HOUA 3UUXA 3MZLB 2J4BA 4ME2A 1O1TA 4EBAA 4CGVA 2AW6A 4APFA 2HR2A 2F8YA 3O48A 1DCQA 3LXUX 1BD8A 3AS5A 5ENQD 4HRMB 3UKUG 5CBOA 1KLXA 3SQVA 3P1UA 2M63A 3Q9UC 2CHZA 3IKOB 2PQRA 3W9GA 3CQGB 2J08A 3ASFA 5D0QD 2CHXA 5EYPF 4L7TA 2WQHA 3HDXA 3LY9A 3NQPA 3AG1E 3FDHA 4JEHA 1HF8A 3L08A 1ELKA 2OEVA 2JEKA 3E4BA 3UX4A 1IKND 4KZCA 1TJCA 3S7BA 5LCWC 4UWHA 4GYYA 4JL0A 2WVIA 4HRNA 4CT4A 4PH4B 3Q4AB 4HFGA 3QKYA 4KVMA 3D9OA 2IONA 3KD7A 5JMND 2P9SG 3B7UX 4C0MA 4BX9A 1FT1A 4LUNU 1IHBA 2Q7FA 2IQCA 3HXCA 4B93B 1OWMA 3RK6A 2I1JA 1SW6A 2VGYA 5FZRA 3P2BA 3WG7E 1E8YA 2Y69E 2R17C 4GTRA 2ILRA 3TWSA 2WB2A 4N3BA 4U8HA 4F7AA 4U07A 4L2YA 4G26A 4I2ZA 2DIWA 3ABME 4GZCA 4TUUA 3VLFA 3LJ3A 3SF4A 3D9HA 1VDYA 4O6FA 3CHMA 4ANWA 2C0LA 1QNFA 3FH5A 4FULA 4DI3A 2DYSE 3B7BA 4IRUA 3EIQC 2DYRE 4A55A 4IYPA 4HNAD 4I1AA 1TN8A 3CQCB 1E8ZA 2NC9A 4RSYA 3NB2A 3PZ2A 4A1SA 3PEVB 3ABKE 2NSZA 3DSTA 5KWDA 3MKQA 2UY1B 3PNTB 2LUHA 3S2AA 3B7RL 1BI7B 5D66A 3D9LA 2AXUA 1S64A 1MZCA 4I6JA 2XCBA 4A63B 3U3WA 3C3QA 2B0OE 2WXIA 3QOUA 1GW6A 1X81A 4W9RA 4GTOA 4WNEA 2PM7A 1V54E 2XZTG 1X5BA 3ZYMA 5BW8C 3FTYA 4X8QA 4J8YA 4Q94A 2A4ZA 3RRNB 3ASNE 4HRLA 3CHSA 2WXGA 2L9BA 3FUJA 5J90A 4OYSA 3FUFA 5KJKA 2FF4A 3CK7A 3UINC 3RJVA 3FEYA 2WXHA 3DPYA 3EHMA 3Q5MA 2L6BA 2V4LA 1H6KA 4YDOA 2GRRB 3E34A 3CVUA 2OV8A 3CKBA 5M72A 1P5QA 4AY6A 1OCZE 4NACA 1E96B 3L13A 5G2NA 2X6JA 4I1OB 4UI9K 5FQ7A 2VJ8A 2KXPC 2BF0X 4G25A 3DSWA 3HHMA 1SZAA 4I6GA 3T5XA 3L17A 1O1RA 3TWUA 2R03A 3TWQA 4ABNA 3FY4A 4ACLA 3SHFA 2E0IA 2UWJG 2KZTB 1V55E 1OUVA 5JJTA 2VGXA 4BEPA 2QZAA 3AU4A 4Z68A 2WXPA 5ANLA 5DBKA 1AWCB 4GU5A 4WUYA 2ZISA 4V3IA 4FADA 2HO1A 1H6OA 2L0IA 4KXKB 3G2VA 5HS0A 2Y4UA 3NF1A 2YQ8A 4Y6WA 1ZBPA 4FP7A 1JCQA 1EDUA 3K9IA 5EKQD 4U96D 1DVPA 4RVBA 2QYJA 1JWGA 4CRWA 4N3CA 2HE0A 5FZQA 3BG0B 1K1BA 4IN3B 5ENRD 4GMRA 4K03A 2P58C 4BETA 3CVNA 5ENNA 3D9PA 1NZNA 4KYOB 4RLYA 1MX6A 4CT0A 4CCAA 3MV3B 5B1AE 2LO6A 2XPYA 2IF4A 4EZKA 3DBSA 1IQRA 1W3BA 1OXJA 2HM8A 3FUIA 2EQXA 2XENA 4F6RD 3LEWA 4GA0A 3UTMA 2DVWA 4TUMA 1UN8A 2DZOA 4DLQA 3GW4A 2L6JA 3V30A 4B8AA 3V2OA 3ASDA 4HOSA 5D2MC 2MYOA 3ULYA 5CERB 1NA3A 3PZ4A 3I5PA 1QBQA 3Q7AA 2GRPB 4H7YA 1Z6TA 3FUNA 4UWFA 4LNBA 3SI5A 1OWNA 2KC7A 2MRIA 5AAOA 5BT1A 2L0TB 3UIPC 4KT6B 3RIBA 4BX8A 3UT8A 4OAUC 4JHRA 5CECB 1FPPA 5AQBA 4O1OA 1SZ9A 2QYUA 3V79K 3B7SA 4OVVA 1NA0A 1WM5A 2B6CA 3TWRA 4N39A 2J07A 3FWVA 2J4DA 1ELRA 4TXRA 3CVXA 1IHGA 2DBAA 2WPVA 4JZYA 3CHOA 1S63A 3PH0C 3B13A 4APOA 2IU1A 1OCRE 1YYHA 4HB5A 2IOLA 1B89A 2XGMA 3NZUA 2WXOA 1Q2ZA 2H6HA 3QWPA 3QARA 2IO3C 3AG2E 1FCHA 3NBNB 3ZUVB 2WXRA 4PS3A 2HYZA 1H6PA 1H2VC 1K1AA 2AJAA 1UN9A 2NXPA 3E37A 3VTYA 1KZPA 3QJZA 3R9AB 3TL5A 4YDWA 5A7DB 3PNLB 4FJZA 4L2LA 4BT8A 4LEUA 3LS8A 4DX1A 5BV1A 4P29A 2VSYA 4WNFA 5CRUA 3CEQA 1TNUA 1L5JA 4GCOA 2XHEA 4JA9A 1KT1A 4JW1A 2ZU6B 3DSSA 1HXIA 3Q49B 3FUEA 3BU8A 1JPLA 5HKPA 2C0MA 5ENOD 2X6FA 3U4TA 2QFCA 3AS8A 3AJIA 1TNOA 1BU9A 3ZHEA 3G2SA 3F6QA 1D8EA 1OCOE 4GA1A 3DPDA 4DRXE 5T8IA 1N52A 2GRNB 5FT9A 3IHVA 1K8KG 4E6HA 4GYWA 4O1PA 4DX7D 2IOSA 4G2VA 2RD0A 3BUAA 4AY5A 3WXXA 4OVUA 3UKRG 2DWZA 4ANUA 4TXQA 5ENTD 3ONKA 1HG5A 5FINA 2A5EA 3APFA 3U64A 3EU9A 3TWWA 3FUKA 1N4PA 4RG9A 5ENPD 4HVBA 3QWVA 2VTBB 3T8MA 3Q79A 1UJKA 4JB8P 4J0UA 4ATGA 3TG4A 2XRYA 5G04J 4I17A 5T4YA 4GZ5A 3L54A 3OXLA 4ANVA 4FJYA 2WXLA 3L82A 3Q47B 3TXNA 2P9IG 3ZFWA 2E2EA 3ASGA 3FU0A 3E30A 4B8CB 3FUDA 4BSXA 3SNXA 3MKRA 3EDTB 4G1TA 1MJ0A 4J7WA 5KJNA 2EINE 1SVXA 4FHKA 5BPPA 5G05C 3G2WA 4XI9A 3TWXA 4FC8A 3RAUA 2OVBA 2LXMA 4IULA 3LVQE 4CDRA 1N4SA 1TNYA 3D9NA 4WNDA 4I2WA 4HLLA 3I3NA 4KZ0A 5G55A 4J6IA 2R59A 4MKTA 4OAVB 3KAEA 4FHJA 2GGFA 3KSQA 1HX8A 4Q96A 3IEGA 4LERA 3APDA 4ZHBA 2LAIA 1MYOA 3PREA 3L9TA 4EZJA 3Q78A 4F53A 4XEIG 5EX0A 4C0EA 2YNQA 4TXPA 5JHBA 4LSZE 2J09A 1D9SA 4ILHB 1H2UA 4HORA
chains in the Genus database with same CATH topology
1SW6A 2KBXA 1N0RA 5AQ9A 4N5QA 4DX5D 5KNHD 3DEPA 4Z68A 5ENSD 5AN8A 4UUCA 1AWCB 4ZFHA 4J8YA 2XEHA 2DZNA 4U8YD 4QFVA 2V4HC 5CEDB 5AAOA 4HRLA 3EHQA 4O60A 2J8SD 3TWSA 4K5AB 2F8YA 4G8KA 3V2XA 1DCQA 2ETBA 2RFMA 3NOCD 5HS0A 1BD8A 5ENQD 4DX2A 2QC9A 2PNNA 4HRMB 3HRAA 4OAUC 5CBOA 4HQDA 3UI2A 5CECB 5KNGA 5EYLA 5HKPA 5HRYA 1NFIE 5AQBA 4O1OA 5ENOD 2Y0BG 5JA4D 1MJ0A 4J7WA 1UOHA 1N0QA 4DUIA 4U96D 3D9HA 4HBDA 4U8VD 2QYJA 1SVXA 4QQIA 3Q9UC 1N11A 3V79K 2HE0A 4F1PA 2L6BA 2V5QC 3ZNGA 1YCSB 3AJIA 2F8XK 2ZGGA 1WDYA 1IXVA 3W9GA 1K1BA 3TWXA 1DC2A 1OY3D 1BU9A 3TWRA 5ENRD 4GMRA 3W9FA 4BERA 5AARA 3B7BA 5EILA 4BETA 3F6QA 1MX4A 4BSZB 1YMPA 3J5QB 3KEAA 3NOGD 3UXGA 4LNUD 5EYPF 3SO8A 4DRXE 1OT8A 5BXOA 3HG0D 4HNAD 3Q9NC 2FO1E 3B95A 4HLLA 2BKKB 3ZKJA 2ETAA 2JABA 2KXPC 4RLYA 1MX6A 3JXJA 4YDYA 5FIOA 1WG0A 4O1PA 4BESA 5CBNA 1QYMA 1YYHA 2P2CP 5EIBE 4CYMD 4HB5A 4DX7D 5ITZF 1S70B 4NIKA 4U95D 3T9KA 5KBAA 4OAVB 1K3ZD 2XZDG 3JUEA 1IKND 3LJNA 2Y1LE 3TWUA 5KWDA 2ZGDA 3EHRA 3J5PA 3C5RA 2ETCA 4K5CA 4LG6A 5CEAA 2DWZA 4DX6D 3NBNB 4HI9A 2XENA 5ENTD 3ZUVB 5EN5D 4F6RD 1MX2A 4HRNA 4ZHBA 3TWQA 3ZU7B 3UTMA 2DVWA 1MYOA 2F37A 5FINA 2A5EA 1BI7B 1TR4A 4TUMA 2DZOA 5D66A 1K1AA 3EU9A 1AP7A 2AJAA 3DEOA 3TWWA 4ATZD 2VGEA 5ENPD 5EIDA 3V30A 3AAAC 3TWTA 1BI8B 3IXEA 2NYJA 5JMND 4A63B 1G3NB 2B0OE 3V2OA 5AQAA 2RFAA 4K5BA 2BKGA 5AQ7A 1A5EA 4CZ2D 4C48B 4LSZE 4JB8P 4HI8A 4YDWA 1IHBA 1BLXB 5BXUA 1D9SA 2XEEA 3T8KA 2MYOA 4G8LA 4B93B 4BEPA 3TWVA 5CERB 3V31A 2XZTG 4GPMA 4DX1A 3JXIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1SW6 A;  2KBX A;  1N0R A;  5AQ9 A;  4N5Q A;  4DX5 D;  5KNH D;  3DEP A;  4Z68 A;  5ENS D;  5AN8 A;  4UUC A;  1AWC B;  4ZFH A;  4J8Y A;  2XEH A;  2DZN A;  4U8Y D;  4QFV A;  2V4H C;  5CED B;  5AAO A;  4HRL A;  3EHQ A;  4O60 A;  2J8S D;  3TWS A;  4K5A B;  2F8Y A;  4G8K A;  3V2X A;  1DCQ A;  2ETB A;  2RFM A;  3NOC D;  5HS0 A;  1BD8 A;  5ENQ D;  4DX2 A;  2QC9 A;  2PNN A;  4HRM B;  3HRA A;  4OAU C;  5CBO A;  4HQD A;  3UI2 A;  5CEC B;  5KNG A;  5EYL A;  5HKP A;  5HRY A;  1NFI E;  5AQB A;  4O1O A;  5ENO D;  2Y0B G;  5JA4 D;  1MJ0 A;  4J7W A;  1UOH A;  1N0Q A;  4DUI A;  4U96 D;  3D9H A;  4HBD A;  4U8V D;  2QYJ A;  1SVX A;  4QQI A;  3Q9U C;  1N11 A;  3V79 K;  2HE0 A;  4F1P A;  2L6B A;  2V5Q C;  3ZNG A;  1YCS B;  3AJI A;  2F8X K;  2ZGG A;  1WDY A;  1IXV A;  3W9G A;  1K1B A;  3TWX A;  1DC2 A;  1OY3 D;  1BU9 A;  3TWR A;  5ENR D;  4GMR A;  3W9F A;  4BER A;  5AAR A;  3B7B A;  5EIL A;  4BET A;  3F6Q A;  1MX4 A;  4BSZ B;  1YMP A;  3J5Q B;  3KEA A;  3NOG D;  3UXG A;  4LNU D;  5EYP F;  3SO8 A;  4DRX E;  1OT8 A;  5BXO A;  3HG0 D;  4HNA D;  3Q9N C;  2FO1 E;  3B95 A;  4HLL A;  2BKK B;  3ZKJ A;  2ETA A;  2JAB A;  2KXP C;  4RLY A;  1MX6 A;  3JXJ A;  4YDY A;  5FIO A;  1WG0 A;  4O1P A;  4BES A;  5CBN A;  1QYM A;  1YYH A;  2P2C P;  5EIB E;  4CYM D;  4HB5 A;  4DX7 D;  5ITZ F;  1S70 B;  4NIK A;  4U95 D;  3T9K A;  5KBA A;  4OAV B;  1K3Z D;  2XZD G;  3JUE A;  1IKN D;  3LJN A;  2Y1L E;  3TWU A;  5KWD A;  2ZGD A;  3EHR A;  3J5P A;  3C5R A;  2ETC A;  4K5C A;  4LG6 A;  5CEA A;  2DWZ A;  4DX6 D;  3NBN B;  4HI9 A;  2XEN A;  5ENT D;  3ZUV B;  5EN5 D;  4F6R D;  1MX2 A;  4HRN A;  4ZHB A;  3TWQ A;  3ZU7 B;  3UTM A;  2DVW A;  1MYO A;  2F37 A;  5FIN A;  2A5E A;  1BI7 B;  1TR4 A;  4TUM A;  2DZO A;  5D66 A;  1K1A A;  3EU9 A;  1AP7 A;  2AJA A;  3DEO A;  3TWW A;  4ATZ D;  2VGE A;  5ENP D;  5EID A;  3V30 A;  3AAA C;  3TWT A;  1BI8 B;  3IXE A;  2NYJ A;  5JMN D;  4A63 B;  1G3N B;  2B0O E;  3V2O A;  5AQA A;  2RFA A;  4K5B A;  2BKG A;  5AQ7 A;  1A5E A;  4CZ2 D;  4C48 B;  4LSZ E;  4JB8 P;  4HI8 A;  4YDW A;  1IHB A;  1BLX B;  5BXU A;  1D9S A;  2XEE A;  3T8K A;  2MYO A;  4G8L A;  4B93 B;  4BEP A;  3TWV A;  5CER B;  3V31 A;  2XZT G;  4GPM A;  4DX1 A;  3JXI A; 
#chains in the Genus database with same CATH topology
 5CRV A;  5DIZ A;  4UUC A;  3L6A A;  4PS8 A;  3FU3 A;  1OWL A;  2YHE A;  1LF8 A;  4O60 A;  2GW1 A;  2IO2 C;  3CVL A;  2X6H A;  3B7T A;  2VQ2 A;  5KNG A;  2OVF A;  4GPK A;  2WM9 A;  3VLE A;  5JA4 D;  1HFA A;  3DSX A;  4PDX A;  1HZ4 A;  1TN7 A;  4XZ4 A;  3ULE G;  1O5M A;  3EIJ A;  2OEW A;  3ISM C;  1WY6 A;  3DWL G;  4CGW A;  1ZB1 A;  2XQ0 A;  3PUJ A;  1TN6 A;  4YDE A;  1O1S A;  4G24 A;  4MS6 A;  3MYV A;  3HVE B;  5BNW A;  5FIO A;  2MOW A;  3FTV A;  5J08 A;  4BTA A;  3VTX A;  5ITZ F;  3T9K A;  3FTX A;  5B1B E;  4JHJ A;  3JQ0 A;  5KJL A;  5FJY A;  2EIJ E;  3HXD A;  3ESL A;  1FVF A;  1WAO 1;  1HS6 A;  3CVY A;  1PY1 A;  3CVQ A;  1JCS A;  4KMO A;  4GTS A;  4JVS A;  3D9I A;  4BTB A;  1BI8 B;  5E76 A;  5AQA A;  3R7Q A;  3CHP A;  4AEZ C;  4RQI A;  1BLX B;  2IEJ A;  3CSF A;  3TWV A;  1XGW A;  3Q75 A;  1N94 A;  3JXI A;  3ZGQ A;  3S7J A;  2XEH A;  4U8Y D;  3UT7 A;  2V4H C;  3TG5 A;  2XPZ A;  1HE8 A;  4K5A B;  1N95 A;  4I43 A;  5B3S E;  4DX2 A;  2FBN A;  4JEU A;  3FTS A;  2C2L A;  4N5C A;  3ZXP A;  4EHM A;  4I1M A;  3C3R A;  2AXZ A;  3EJN A;  4UQZ A;  4M7C A;  4FU3 A;  2J49 A;  4NUR A;  1YCS B;  4N3A A;  4AVX A;  3ZYK A;  5AAR A;  5EIL A;  1YMP A;  3KEA A;  5HI7 A;  3MCX A;  3B95 A;  4GCN A;  5IY5 E;  1EYH A;  4NIK A;  3TAX A;  4AP2 A;  2KCL A;  2P9U G;  4ACK A;  3ENE A;  2V5F A;  1JUQ A;  4K5C A;  4GYO A;  4TRQ A;  5CEA A;  5JHA A;  4DX6 D;  3CV0 A;  2XGO A;  5EDS A;  2LSU A;  2VSO E;  1TR4 A;  2PZI A;  3D9K A;  2RKK A;  4MBG A;  4WWN A;  1TEZ A;  4XKB A;  5EID A;  3CK8 A;  5FTP A;  4UWK A;  2RFA A;  3MV2 B;  2KCV A;  3CGH A;  4AXH A;  4L1B A;  4J8E A;  4GPM A;  1HU3 A;  3IHY A;  4GAA A;  4ZFH A;  3R9M A;  2JLB A;  1E7U A;  2DZN A;  3Q73 A;  4EEC A;  4ILI A;  2WXF A;  3OXF A;  2J8S D;  4U0S A;  1JWF A;  2RFM A;  1N4Q A;  3QAQ A;  4WWP A;  3HRA A;  3UMV A;  1JCR A;  1LTX A;  4HOQ A;  4AV7 A;  3UT4 A;  3FHE A;  2Y4T A;  3MJW A;  4F1P A;  1IQU A;  2OND A;  3PS6 A;  2F8X K;  3W9F A;  2FUL A;  2CFU A;  5LCW J;  3J5Q B;  3NOG D;  3RO3 A;  2FO1 E;  2VSX E;  3C98 A;  2XPI A;  2EIM E;  4YDY A;  2FI7 A;  3FUL A;  5EIB E;  4GA2 A;  2WXK A;  3JUE A;  4HS2 A;  3LJN A;  2GRO B;  3EU5 A;  4Y6C A;  2KZT A;  4UQY A;  3X2Q E;  3SFZ A;  5KCM A;  2X6K A;  4FLH A;  4UI9 C;  3MX3 A;  4PS7 A;  4ANX A;  2F37 A;  3GZ1 A;  1EF1 C;  4EBA G;  3ZYL A;  4ATZ D;  1UG3 A;  3DEO A;  2WMN A;  4U7E B;  3ZRH A;  1G3N B;  2VYI A;  5H7P A;  2BKG A;  5LX8 A;  4HI8 A;  2ZXW E;  1NI1 A;  4U0U A;  4ILG A;  3DXK G;  3GZS A;  3FH7 A;  4HOT A;  3Q7F A;  3FU6 A;  4YVQ C;  4DJA A;  3LDZ A;  3V2X A;  3UQ3 A;  4JHK A;  3ULQ A;  2CHW A;  4A1G A;  1KZO A;  4GTV A;  3D3M A;  2WXN A;  3LY7 A;  3FUM A;  3C72 A;  2AWI A;  4QQI A;  3O4Z A;  2FEZ A;  5T3R A;  4DLO A;  3HXF A;  4BFR A;  3ZN3 A;  3CVV A;  1HH8 A;  4GTP A;  3ZKJ A;  2BKK B;  4L23 A;  1EPU A;  1FVH A;  4DPR A;  4BES A;  4GMJ A;  5D0O D;  1S70 B;  4TV3 A;  3JYS A;  1U3D A;  1Z3X A;  4D10 C;  5CCL A;  2Y1L E;  2R5S A;  3EHR A;  2ETC A;  2YIN A;  4LG6 A;  4F1S A;  4NRH B;  4A3V A;  2GRQ B;  3MKQ B;  2EIL E;  4CEM A;  3MGB A;  4GTQ A;  3LYA A;  3IXE A;  1TNB A;  2PQN A;  3NAW A;  4PUC A;  3DSU A;  1N4R A;  3T8K A;  3ZPJ A;  2XS1 A;  4N2S A;  1N0R A;  4N5Q A;  5ANR A;  5AN8 A;  2XCC A;  2OCC E;  3D9M A;  3SFX A;  3FEX A;  3PZ1 A;  2BUG A;  4G8K A;  5A23 A;  1HO8 A;  2WQ7 A;  3SFY A;  2KM4 A;  4GB9 A;  4JD2 G;  4XX5 A;  3SBT B;  4A3T A;  2I1K A;  4CDN A;  3L22 A;  2WXM A;  4AOF A;  2XEV A;  3I4G A;  1QQE A;  3PDN A;  4GZD A;  1IXV A;  1TJF A;  2KAT A;  4UWG A;  4LRZ A;  4BWR A;  1BPO A;  4HLE A;  3CLJ A;  5BXO A;  4LNU D;  1OT8 A;  4I9E A;  5CMW A;  4BY6 A;  3LY8 A;  4JC8 A;  3DRA A;  3BEE A;  5JJ6 A;  3JXJ A;  1NP7 A;  3PZD A;  2EIK E;  2P2C P;  1Y8M A;  2KCK A;  3CST A;  1H0A A;  3QB2 A;  1PC2 A;  3CHR A;  4KVO A;  1DNP A;  3HYM B;  4HI9 A;  4J8F A;  2CG2 A;  1RW2 A;  3ZU7 B;  5JJ7 A;  2CFZ A;  2WXJ A;  3AU5 A;  4L9P A;  4C9B B;  3UM2 A;  2LNI A;  3LPZ A;  5BV0 A;  3SZ7 A;  3S7D A;  3FTW A;  1E7V A;  4AM9 A;  2ZIR A;  3E33 A;  3E32 A;  4G8L A;  5FQ6 A;  1SQM A;  3V31 A;  4F3V A;  5CCM A;  3U9W A;  4EZL A;  5AQ9 A;  3DEP A;  1MHQ A;  2VGX B;  3TXM A;  3SGH A;  2WMO A;  3ZEF A;  3ONL A;  1OCC E;  2P9P G;  2ETB A;  4XI0 A;  2P9K G;  5ARF A;  1S0P A;  4B94 A;  3LVR E;  5EYL A;  3MEK A;  3EUV A;  1NFI E;  2X6I A;  4G11 A;  2FO7 A;  1N0Q A;  4DUI A;  2H6F A;  4WNG A;  1OWP A;  4Q69 A;  1N11 A;  3UPV A;  3AG4 E;  2J9Q A;  1E8X A;  4GZ3 A;  3R7R A;  2QY7 A;  3ABL E;  3ZW3 A;  1YA0 A;  3HG0 D;  3D9J A;  4EQF A;  3C3O A;  1UW4 B;  1WG0 A;  4MLP A;  2IY0 C;  2LAH A;  3URZ A;  3GZ2 A;  1K3Z D;  4XKC A;  2P9L G;  2XZD G;  3RSE G;  3T5V A;  3J5P A;  2V8S E;  3CHQ A;  3KS2 A;  4GML A;  4B0Z A;  2RG8 A;  2VTB A;  2GRM A;  4I9C A;  1AP7 A;  3CK9 A;  3FFL A;  3PRZ A;  4MRU A;  4UQX A;  5C2Y A;  3ML9 A;  3HIZ A;  3Q15 A;  3TJP A;  2XS8 A;  4WWO A;  4XE0 A;  1H19 A;  3L16 A;  4U04 A;  1FT2 A;  3CIA A;  3FUH A;  2R05 A;  3LKU A;  5CED B;  1UJJ A;  2A5U A;  3U66 A;  2QC9 A;  3UM1 A;  2AVP A;  5AJL A;  3QK0 A;  3UI2 A;  3ZXS A;  3ZIM A;  3PE4 A;  1RZ4 A;  2LSV A;  4UI9 J;  4URK A;  5G04 C;  2CG3 A;  4KBQ A;  3SD5 A;  1UOH A;  4HXI A;  1TNZ A;  4HBD A;  4U8V D;  5FZS A;  5FQ8 A;  2WQ6 A;  2X38 A;  3DSV A;  3CR3 A;  3ML8 A;  5AYW D;  3G2T A;  4BER A;  3JQ1 A;  1SA4 A;  1LD7 A;  2ETA A;  1A17 A;  3CKC A;  2BTD A;  1TYQ G;  1PAQ A;  3AG3 E;  5KJM A;  3OTN A;  4U0Z A;  3NZS A;  4JPS A;  2WXQ A;  2ZGD A;  3HXB A;  3C5R A;  2XGS A;  5ARG A;  1KT0 A;  2VSN A;  4AJW A;  1QZ2 A;  5E75 A;  4K0R A;  3HXE A;  3PEU B;  2VGE A;  2UY1 A;  1DCE A;  3AAA C;  5FWQ A;  3TWT A;  5AQ7 A;  3CVP A;  1A5E A;  4NQ0 A;  3PZ3 A;  4CDM A;  3ASH A;  1INZ A;  2KBX A;  5ENS D;  3IBE A;  4AIF A;  3VLD A;  4EPZ A;  4QFV A;  3PE3 A;  2IJG X;  4LNG A;  4J8D A;  3NOC D;  3RU0 A;  3UM0 A;  2PNN A;  4HQD A;  3QNK A;  4DK5 A;  4LCT A;  5AJD A;  5LOZ A;  1KPS B;  3FTU A;  3DXM G;  3RRM B;  3RO2 A;  4M3O A;  4UWL A;  4YND A;  5AIJ A;  2I2O A;  2V5Q C;  3ZNG A;  2MHK A;  3GYZ A;  2ZGG A;  1WDY A;  4B89 A;  1OY3 D;  2H6G A;  3HVE A;  2PM6 A;  3BG1 B;  4BSZ B;  1D8D A;  3UXG A;  3SO8 A;  2Y3A A;  2H6I A;  3JCK C;  3Q9N C;  1N9A A;  3ZHE B;  2JAB A;  3FTZ A;  1H2T C;  4GZ6 A;  5CBN A;  2V0P A;  2R2L A;  4CYM D;  5CHE E;  4YVO A;  5KBA A;  3IV0 A;  1NL4 A;  3MA5 A;  3S7F A;  3APC A;  4H7X A;  3PUK A;  3QWW A;  2OOE A;  4BT9 A;  5BUZ A;  1ZU2 A;  3QC1 A;  5EN5 D;  4FLB A;  3N71 A;  1OWO A;  3ZYQ A;  3ESK A;  2BED A;  2P9N G;  1MQS A;  3OAW A;  2NYJ A;  3ASO E;  4K5B A;  2I9C A;  1XNF A;  2XEE A;  3OXG A;  4DX5 D;  4R7L A;  5KNH D;  5LFA A;  2AXV A;  4JXT A;  5AEN A;  2XRZ A;  3FU5 A;  3EHQ A;  5G05 J;  5A6C A;  1Z5S C;  4I6E A;  2LXL A;  5LP0 A;  3SBS A;  4N2Q A;  1N54 A;  4GTT A;  3PVL A;  4U63 A;  4XIF A;  5HRY A;  4FA6 A;  4GTM A;  2Y0B G;  5EX3 A;  1E8W A;  5C1D A;  1E90 A;  4E85 A;  1LD8 A;  3ZVV A;  2I6H A;  2X3M A;  3SY2 A;  2IFU A;  2PL2 A;  4RG6 A;  1DC2 A;  1MX4 A;  3G2U A;  3UIO C;  2GRL A;  2DCP A;  3CVW A;  1IYG A;  2F0Y A;  3RKV A;  5HQ8 A;  1Y6I A;  1QYM A;  1U2V G;  3I4R B;  2R02 A;  3FP3 A;  4U95 D;  3EHN A;  3UM3 A;  3KSL A;  4DI4 A;  4JA7 A;  1U3C A;  3TGO A;  3LCA A;  3FH8 A;  1MX2 A;  3QDN A;  4J8S A;  1SA5 A;  1ELW A;  3AS4 A;  1Z3Y A;  3JUI A;  4G23 A;  3KEZ A;  5FQ4 A;  1HG2 A;  4WAF A;  5CMY A;  4CZ2 D;  4C48 B;  5BXU A;  2YHC A;  3BQO A;  3RRU A;  4HOU A;  3UUX A;  3MZL B;  2J4B A;  4ME2 A;  1O1T A;  4EBA A;  4CGV A;  2AW6 A;  4APF A;  2HR2 A;  2F8Y A;  3O48 A;  1DCQ A;  3LXU X;  1BD8 A;  3AS5 A;  5ENQ D;  4HRM B;  3UKU G;  5CBO A;  1KLX A;  3SQV A;  3P1U A;  2M63 A;  3Q9U C;  2CHZ A;  3IKO B;  2PQR A;  3W9G A;  3CQG B;  2J08 A;  3ASF A;  5D0Q D;  2CHX A;  5EYP F;  4L7T A;  2WQH A;  3HDX A;  3LY9 A;  3NQP A;  3AG1 E;  3FDH A;  4JEH A;  1HF8 A;  3L08 A;  1ELK A;  2OEV A;  2JEK A;  3E4B A;  3UX4 A;  1IKN D;  4KZC A;  1TJC A;  3S7B A;  5LCW C;  4UWH A;  4GYY A;  4JL0 A;  2WVI A;  4HRN A;  4CT4 A;  4PH4 B;  3Q4A B;  4HFG A;  3QKY A;  4KVM A;  3D9O A;  2ION A;  3KD7 A;  5JMN D;  2P9S G;  3B7U X;  4C0M A;  4BX9 A;  1FT1 A;  4LUN U;  1IHB A;  2Q7F A;  2IQC A;  3HXC A;  4B93 B;  1OWM A;  3RK6 A;  2I1J A;  1SW6 A;  2VGY A;  5FZR A;  3P2B A;  3WG7 E;  1E8Y A;  2Y69 E;  2R17 C;  4GTR A;  2ILR A;  3TWS A;  2WB2 A;  4N3B A;  4U8H A;  4F7A A;  4U07 A;  4L2Y A;  4G26 A;  4I2Z A;  2DIW A;  3ABM E;  4GZC A;  4TUU A;  3VLF A;  3LJ3 A;  3SF4 A;  3D9H A;  1VDY A;  4O6F A;  3CHM A;  4ANW A;  2C0L A;  1QNF A;  3FH5 A;  4FUL A;  4DI3 A;  2DYS E;  3B7B A;  4IRU A;  3EIQ C;  2DYR E;  4A55 A;  4IYP A;  4HNA D;  4I1A A;  1TN8 A;  3CQC B;  1E8Z A;  2NC9 A;  4RSY A;  3NB2 A;  3PZ2 A;  4A1S A;  3PEV B;  3ABK E;  2NSZ A;  3DST A;  5KWD A;  3MKQ A;  2UY1 B;  3PNT B;  2LUH A;  3S2A A;  3B7R L;  1BI7 B;  5D66 A;  3D9L A;  2AXU A;  1S64 A;  1MZC A;  4I6J A;  2XCB A;  4A63 B;  3U3W A;  3C3Q A;  2B0O E;  2WXI A;  3QOU A;  1GW6 A;  1X81 A;  4W9R A;  4GTO A;  4WNE A;  2PM7 A;  1V54 E;  2XZT G;  1X5B A;  3ZYM A;  5BW8 C;  3FTY A;  4X8Q A;  4J8Y A;  4Q94 A;  2A4Z A;  3RRN B;  3ASN E;  4HRL A;  3CHS A;  2WXG A;  2L9B A;  3FUJ A;  5J90 A;  4OYS A;  3FUF A;  5KJK A;  2FF4 A;  3CK7 A;  3UIN C;  3RJV A;  3FEY A;  2WXH A;  3DPY A;  3EHM A;  3Q5M A;  2L6B A;  2V4L A;  1H6K A;  4YDO A;  2GRR B;  3E34 A;  3CVU A;  2OV8 A;  3CKB A;  5M72 A;  1P5Q A;  4AY6 A;  1OCZ E;  4NAC A;  1E96 B;  3L13 A;  5G2N A;  2X6J A;  4I1O B;  4UI9 K;  5FQ7 A;  2VJ8 A;  2KXP C;  2BF0 X;  4G25 A;  3DSW A;  3HHM A;  1SZA A;  4I6G A;  3T5X A;  3L17 A;  1O1R A;  3TWU A;  2R03 A;  3TWQ A;  4ABN A;  3FY4 A;  4ACL A;  3SHF A;  2E0I A;  2UWJ G;  2KZT B;  1V55 E;  1OUV A;  5JJT A;  2VGX A;  4BEP A;  2QZA A;  3AU4 A;  4Z68 A;  2WXP A;  5ANL A;  5DBK A;  1AWC B;  4GU5 A;  4WUY A;  2ZIS A;  4V3I A;  4FAD A;  2HO1 A;  1H6O A;  2L0I A;  4KXK B;  3G2V A;  5HS0 A;  2Y4U A;  3NF1 A;  2YQ8 A;  4Y6W A;  1ZBP A;  4FP7 A;  1JCQ A;  1EDU A;  3K9I A;  5EKQ D;  4U96 D;  1DVP A;  4RVB A;  2QYJ A;  1JWG A;  4CRW A;  4N3C A;  2HE0 A;  5FZQ A;  3BG0 B;  1K1B A;  4IN3 B;  5ENR D;  4GMR A;  4K03 A;  2P58 C;  4BET A;  3CVN A;  5ENN A;  3D9P A;  1NZN A;  4KYO B;  4RLY A;  1MX6 A;  4CT0 A;  4CCA A;  3MV3 B;  5B1A E;  2LO6 A;  2XPY A;  2IF4 A;  4EZK A;  3DBS A;  1IQR A;  1W3B A;  1OXJ A;  2HM8 A;  3FUI A;  2EQX A;  2XEN A;  4F6R D;  3LEW A;  4GA0 A;  3UTM A;  2DVW A;  4TUM A;  1UN8 A;  2DZO A;  4DLQ A;  3GW4 A;  2L6J A;  3V30 A;  4B8A A;  3V2O A;  3ASD A;  4HOS A;  5D2M C;  2MYO A;  3ULY A;  5CER B;  1NA3 A;  3PZ4 A;  3I5P A;  1QBQ A;  3Q7A A;  2GRP B;  4H7Y A;  1Z6T A;  3FUN A;  4UWF A;  4LNB A;  3SI5 A;  1OWN A;  2KC7 A;  2MRI A;  5AAO A;  5BT1 A;  2L0T B;  3UIP C;  4KT6 B;  3RIB A;  4BX8 A;  3UT8 A;  4OAU C;  4JHR A;  5CEC B;  1FPP A;  5AQB A;  4O1O A;  1SZ9 A;  2QYU A;  3V79 K;  3B7S A;  4OVV A;  1NA0 A;  1WM5 A;  2B6C A;  3TWR A;  4N39 A;  2J07 A;  3FWV A;  2J4D A;  1ELR A;  4TXR A;  3CVX A;  1IHG A;  2DBA A;  2WPV A;  4JZY A;  3CHO A;  1S63 A;  3PH0 C;  3B13 A;  4APO A;  2IU1 A;  1OCR E;  1YYH A;  4HB5 A;  2IOL A;  1B89 A;  2XGM A;  3NZU A;  2WXO A;  1Q2Z A;  2H6H A;  3QWP A;  3QAR A;  2IO3 C;  3AG2 E;  1FCH A;  3NBN B;  3ZUV B;  2WXR A;  4PS3 A;  2HYZ A;  1H6P A;  1H2V C;  1K1A A;  2AJA A;  1UN9 A;  2NXP A;  3E37 A;  3VTY A;  1KZP A;  3QJZ A;  3R9A B;  3TL5 A;  4YDW A;  5A7D B;  3PNL B;  4FJZ A;  4L2L A;  4BT8 A;  4LEU A;  3LS8 A;  4DX1 A;  5BV1 A;  4P29 A;  2VSY A;  4WNF A;  5CRU A;  3CEQ A;  1TNU A;  1L5J A;  4GCO A;  2XHE A;  4JA9 A;  1KT1 A;  4JW1 A;  2ZU6 B;  3DSS A;  1HXI A;  3Q49 B;  3FUE A;  3BU8 A;  1JPL A;  5HKP A;  2C0M A;  5ENO D;  2X6F A;  3U4T A;  2QFC A;  3AS8 A;  3AJI A;  1TNO A;  1BU9 A;  3ZHE A;  3G2S A;  3F6Q A;  1D8E A;  1OCO E;  4GA1 A;  3DPD A;  4DRX E;  5T8I A;  1N52 A;  2GRN B;  5FT9 A;  3IHV A;  1K8K G;  4E6H A;  4GYW A;  4O1P A;  4DX7 D;  2IOS A;  4G2V A;  2RD0 A;  3BUA A;  4AY5 A;  3WXX A;  4OVU A;  3UKR G;  2DWZ A;  4ANU A;  4TXQ A;  5ENT D;  3ONK A;  1HG5 A;  5FIN A;  2A5E A;  3APF A;  3U64 A;  3EU9 A;  3TWW A;  3FUK A;  1N4P A;  4RG9 A;  5ENP D;  4HVB A;  3QWV A;  2VTB B;  3T8M A;  3Q79 A;  1UJK A;  4JB8 P;  4J0U A;  4ATG A;  3TG4 A;  2XRY A;  5G04 J;  4I17 A;  5T4Y A;  4GZ5 A;  3L54 A;  3OXL A;  4ANV A;  4FJY A;  2WXL A;  3L82 A;  3Q47 B;  3TXN A;  2P9I G;  3ZFW A;  2E2E A;  3ASG A;  3FU0 A;  3E30 A;  4B8C B;  3FUD A;  4BSX A;  3SNX A;  3MKR A;  3EDT B;  4G1T A;  1MJ0 A;  4J7W A;  5KJN A;  2EIN E;  1SVX A;  4FHK A;  5BPP A;  5G05 C;  3G2W A;  4XI9 A;  3TWX A;  4FC8 A;  3RAU A;  2OVB A;  2LXM A;  4IUL A;  3LVQ E;  4CDR A;  1N4S A;  1TNY A;  3D9N A;  4WND A;  4I2W A;  4HLL A;  3I3N A;  4KZ0 A;  5G55 A;  4J6I A;  2R59 A;  4MKT A;  4OAV B;  3KAE A;  4FHJ A;  2GGF A;  3KSQ A;  1HX8 A;  4Q96 A;  3IEG A;  4LER A;  3APD A;  4ZHB A;  2LAI A;  1MYO A;  3PRE A;  3L9T A;  4EZJ A;  3Q78 A;  4F53 A;  4XEI G;  5EX0 A;  4C0E A;  2YNQ A;  4TXP A;  5JHB A;  4LSZ E;  2J09 A;  1D9S A;  4ILH B;  1H2U A;  4HOR A; 
#chains in the Genus database with same CATH homology
 1SW6 A;  2KBX A;  1N0R A;  5AQ9 A;  4N5Q A;  4DX5 D;  5KNH D;  3DEP A;  4Z68 A;  5ENS D;  5AN8 A;  4UUC A;  1AWC B;  4ZFH A;  4J8Y A;  2XEH A;  2DZN A;  4U8Y D;  4QFV A;  2V4H C;  5CED B;  5AAO A;  4HRL A;  3EHQ A;  4O60 A;  2J8S D;  3TWS A;  4K5A B;  2F8Y A;  4G8K A;  3V2X A;  1DCQ A;  2ETB A;  2RFM A;  3NOC D;  5HS0 A;  1BD8 A;  5ENQ D;  4DX2 A;  2QC9 A;  2PNN A;  4HRM B;  3HRA A;  4OAU C;  5CBO A;  4HQD A;  3UI2 A;  5CEC B;  5KNG A;  5EYL A;  5HKP A;  5HRY A;  1NFI E;  5AQB A;  4O1O A;  5ENO D;  2Y0B G;  5JA4 D;  1MJ0 A;  4J7W A;  1UOH A;  1N0Q A;  4DUI A;  4U96 D;  3D9H A;  4HBD A;  4U8V D;  2QYJ A;  1SVX A;  4QQI A;  3Q9U C;  1N11 A;  3V79 K;  2HE0 A;  4F1P A;  2L6B A;  2V5Q C;  3ZNG A;  1YCS B;  3AJI A;  2F8X K;  2ZGG A;  1WDY A;  1IXV A;  3W9G A;  1K1B A;  3TWX A;  1DC2 A;  1OY3 D;  1BU9 A;  3TWR A;  5ENR D;  4GMR A;  3W9F A;  4BER A;  5AAR A;  3B7B A;  5EIL A;  4BET A;  3F6Q A;  1MX4 A;  4BSZ B;  1YMP A;  3J5Q B;  3KEA A;  3NOG D;  3UXG A;  4LNU D;  5EYP F;  3SO8 A;  4DRX E;  1OT8 A;  5BXO A;  3HG0 D;  4HNA D;  3Q9N C;  2FO1 E;  3B95 A;  4HLL A;  2BKK B;  3ZKJ A;  2ETA A;  2JAB A;  2KXP C;  4RLY A;  1MX6 A;  3JXJ A;  4YDY A;  5FIO A;  1WG0 A;  4O1P A;  4BES A;  5CBN A;  1QYM A;  1YYH A;  2P2C P;  5EIB E;  4CYM D;  4HB5 A;  4DX7 D;  5ITZ F;  1S70 B;  4NIK A;  4U95 D;  3T9K A;  5KBA A;  4OAV B;  1K3Z D;  2XZD G;  3JUE A;  1IKN D;  3LJN A;  2Y1L E;  3TWU A;  5KWD A;  2ZGD A;  3EHR A;  3J5P A;  3C5R A;  2ETC A;  4K5C A;  4LG6 A;  5CEA A;  2DWZ A;  4DX6 D;  3NBN B;  4HI9 A;  2XEN A;  5ENT D;  3ZUV B;  5EN5 D;  4F6R D;  1MX2 A;  4HRN A;  4ZHB A;  3TWQ A;  3ZU7 B;  3UTM A;  2DVW A;  1MYO A;  2F37 A;  5FIN A;  2A5E A;  1BI7 B;  1TR4 A;  4TUM A;  2DZO A;  5D66 A;  1K1A A;  3EU9 A;  1AP7 A;  2AJA A;  3DEO A;  3TWW A;  4ATZ D;  2VGE A;  5ENP D;  5EID A;  3V30 A;  3AAA C;  3TWT A;  1BI8 B;  3IXE A;  2NYJ A;  5JMN D;  4A63 B;  1G3N B;  2B0O E;  3V2O A;  5AQA A;  2RFA A;  4K5B A;  2BKG A;  5AQ7 A;  1A5E A;  4CZ2 D;  4C48 B;  4LSZ E;  4JB8 P;  4HI8 A;  4YDW A;  1IHB A;  1BLX B;  5BXU A;  1D9S A;  2XEE A;  3T8K A;  2MYO A;  4G8L A;  4B93 B;  4BEP A;  3TWV A;  5CER B;  3V31 A;  2XZT G;  4GPM A;  4DX1 A;  3JXI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...