1K40A

Crystal structure of the fat domain of focal adhesion kinase
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
126
structure length
126
Chain Sequence
b'NDKVYENVTGLVKAVIEMSSKIQPAPPEEYVPMVKEVGLALRTLLATVDETIPALPASTHREIEMAQKLLNSDLGELISKMKLAQQYVMTSLQQEYKKQMLTAAHALAVDAKNLLDVIDQARLKML'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords adhesion kinase
publication title The focal adhesion targeting (FAT) region of focal adhesion kinase is a four-helix bundle that binds paxillin
pubmed doi rcsb
source organism Mus musculus
molecule tags Transferase
total genus 52
structure length 126
sequence length 126
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 2001-10-04
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.330 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Nucleotidyltransferases domain 2 1k40A00
1OW7A 3RQEA 4EBJA 4XEFA 1ZZPA 3U3FA 1WTYA 3B71A 3GM3A 3GM2A 2LK4A 1K05A 2L6HA 2Q00A 1K04A 3BRJA 3JZ0A 3S9OA 3MFNA 2KK1A 1JOGA 1V4AA 2HSBA 3O10A 3C18A 2JX0A 3RQFA 1WOLA 3RQGA 1KTMA 1OW6A 1QVXA 3AJMA 4R32A 5F28E 1UFBA 2JPUA 3JYYA 1PV3A 1OW8A 2PBEA 2L6GA 4XEKA 4NQFA 2L6FA 3C8GA 3C8GD 3U0CA 3L8JA 1KNYA 3K7DA 1K40A 1O3UA 2YWAA 3L8IA 3TULA 4XEVA 3GM1A 4EBKA 3C8GB 1WWPA
chains in the Genus database with same CATH superfamily
1YYXA 2YL0A 4U9EA 4BJ6C 1EKYA 3EGDB 1WTYA 3GM2A 4AE4A 3QVYA 3RKOF 4G7HF 4Z9HA 1V55C 3QTHA 3EHMA 4GQHA 1H9GA 1B68A 2R7UA 1YZAA 5COFA 1T6QA 2BL2A 3RQFA 1LI7A 5JUAA 4E18A 4MQ9F 4OIQF 5F28E 256BA 1DOVA 4N6HA 1OW8A 1TWHA 4LACB 2ASRA 3MLGA 4MVRA 1ZU4A 3ASNC 1OXBA 4JVSA 1LPEA 2Q9CA 2DYSC 2HUJA 1ZHXA 2H7BA 3LUTB 5DS4A 1QKRA 3TOMA 3W2WA 3KH2A 2J0WA 4P6IC 5A6BD 2QNLA 3T9OA 3RH3A 5DS5A 3HNKA 3EHNA 1HW2A 3KL4A 3POVA 5E33A 5CI9A 5A6JA 1Q0FA 3W4YA 3PMRA 2EPNA 1E85A 3ZQYA 4MTGA 4AK9A 4FX5A 1BDJB 2KNHA 2M4EA 3CAXA 1SMYF 3DD7A 3FXHA 2XLVA 3WODF 2LCHA 1TWGA 4C3BA 4YL1A 2A68F 3ABLC 4JE9A 2M64A 1M57C 3S84A 5BUOA 5A6AA 3LEOA 5CIVA 2KQ9A 4J7YA 4XEKA 1HMOA 4C3DA 2NUTA 1NFNA 3I5PA 1Z6AA 1JPNA 3PDMP 1T9KA 3NMIA 3NYLA 4M63A 3FVYA 3AQCA 4LDKA 4C7OA 1Q0MA 1T6IA 3KKBA 4EKWA 4MVOA 4I1MA 4BJTA 3TULA 2AWCA 2Z15A 4PACA 4EBKA 3I4UA 1A0BA 3RVYA 2R7OA 1M2VB 1LVKA 1MMGA 1LS1A 3HJCA 1MNEA 3LAYA 3R7CA 3WHNA 4YT4A 1CGOA 4U5EE 1NG1A 2CW0F 4K0DA 3U8PA 2J7PA 4N6CA 1RCPA 1YZCA 2YL3A 3QZCA 3U2MA 3F46A 4HEAJ 2OG2A 1C17M 3NG1A 1D1BA 1H7IA 3JRTA 3UMKA 2ZXRA 3EH2A 1J8MF 4BEMJ 2R9RB 2YRFA 2W9YA 3EG9B 3IPMO 4LDQA 2P0NA 2PNOA 5JLIA 1XZPA 3S27A 2CYDA 2WZFA 4O6NA 3AGUA 4DRIB 5B3IA 2L7AA 3EGDA 1Z63A 3TQOA 4BG0A 3A11A 1O87A 4CJOA 4JTAB 2HKVA 1D0YA 1RKCA 1W2WA 1YYJA 2L9JA 4L6RA 5KYWA 3HTKC 3ATPA 2BC5A 2KJGA 1E2XA 3SXKA 1SZIA 5FZTA 2NPUA 2EIKC 4WGZA 3OWTA 4FESA 1RJ9A 3GWLA 3GEEA 1GS9A 1Z7Qc 2HV7A 4KC9A 4MS2A 4E17A 2ETSA 2R7XA 3EGXB 2FAPB 5L0CA 3RIPA 2MYSA 3KYJA 3AG2C 1A7VA 1KTMA 2YEVA 2IXPA 2YZSA 5TJ5E 4DBRA 4R32A 5D92A 2XM4A 5KYYA 1ZW2A 4YJWA 4ZLCA 4EIYA 5D91A 5L0IA 1GM5A 1DOWA 4U5DE 2LQGA 5B1BC 1BZ4A 3C8ZA 3MYFA 2VC9A 3QW1A 4JZAA 2LFFA 4MW8A 3Q6NA 4DRHB 1TWAA 4MNDA 5GPGB 2CNWA 3SNHA 4CS8C 3S90A 2EPOA 4DRJB 1Y6DA 4K7BA 5DLJA 4XQ1A 3H65A 3AG1C 3M15A 3Q7GA 3N2ZB 1HW1A 1CGNA 3AQBA 2J46A 4E7SA 5KYUB 1EQ1A 2AP3A 2OJED 3DAFA 2X51A 3F47A 3LJBA 5AC4A 4JW1A 3FHDA 4U5BE 3SXZA 3FAJA 4CDAA 1VOMA 4U5CE 2LFDA 2ICWG 2OEXA 4G78A 4MVZA 2XLDA 3NYJA 3ABKC 3S28A 1YDIA 5L0JA 3DJUB 3KPHA 2RD9A 1EI7A 3C8GD 3K66A 4JIOA 1M2VA 4LLCA 3ZIBA 4YN0B 2OJQA 4JTDB 1ZHZA 3DI5A 3HKKA 4I44A 2XLMA 4Z9IA 1BR1A 4E7ZA 3IQCA 1OQCA 5L0HA 4NTFA 5JT4A 1C02A 5KYNA 2P61A 3TD7A 3U9MA 1TQGA 1XZQA 1Q0DA 2PX3A 2R7SA 1MMNA 2IBFA 4F4BA 1YA9A 3EZIA 3BEHA 3NYMA 5L0GA 5L0DA 1NZEA 2V26A 1APCA 2D4UA 3EG9A 2I15A 3LESA 4OINF 2R7VA 2XLOA 5HV9A 1HE9A 2IXMA 2P1AA 4NCQA 3US6A 2MHRA 2G3VA 5EK0A 4NTBA 4DOZA 3W2VA 4GYTA 3JYYA 5DQTA 4MTFA 3ZDLA 2VASA 4NQFA 2YLGA 2NUPB 2GDCA 2LP4A 2WVOA 1MQVA 5JP7A 5L3QA 2XXAB 5CI8A 4XPWA 1TFOB 2HJ3A 2Q4FA 1FAPB 4DVYP 1PCXA 5AGFA 1I4ZA 1E84A 1QQ3A 4PJNA 2R25A 4CS9A 2R7RA 4PR9A 2P6VA 4Q7CA 2J45A 1ORJA 3DM9B 4CS9C 3EGXA 3NMJA 1OCOC 1BBHA 2LSEA 1TWCA 3U3FA 4YT5A 4GEHA 2BE5F 2EILC 4YL3A 2QUPA 1K04A 4P9TA 1NSGB 2A0UA 3JZ0A 4JEBA 2VCAA 3ZG1A 4CS7A 3MFNA 2FFHA 2EPMX 1OCZC 2DI3A 2EIJC 4EBBA 5K0IA 3WAQA 1MMAA 4NY3A 4N4WA 1IW7F 2P7VA 4A2NB 2XM0A 2YLIA 3DE9A 3MX3A 3T6GB 5E3CA 4RD9A 4XLPF 2XS1A 1PV3A 3NKDA 5T3WA 3ITFA 1JAFA 3DJNB 4CIHA 3S29A 2IXOA 2PF4E 1Q0GA 2A6HF 1D0ZA 4PK4A 3L8JA 4EUKB 2QE9A 3K33A 2VCBA 2WVQA 5EGYA 5COGA 3SYNA 3TOLA 1OKKA 1YARO 3DKAA 2GA0A 1D0XA 1AUEA 4MTOA 1CPRA 1LI5A 3GORA 4XEFA 2XLWA 3EQLF 1D1CA 3CEXA 1ZYRF 2L6HA 4NC3A 3S9OA 2MWQA 2I8BA 3U3BA 2OQMA 2ZXPA 5E2QA 3M1CB 2ZD9A 2EIMC 3UMIA 3V5XA 1TFKB 2W4MA 2Y3HA 1YJGA 4QDLA 3L1MA 5A6KA 4JEAA 4CIPA 3FAPB 3ABMC 3IQ5A 4W8PA 4AX2A 3VF0A 5A69A 5FCLA 2R03A 4E0IA 3UGPA 2HMQA 2L6GA 4HFFB 1Z23A 4J7TA 3H2VA 4OD4A 3V5ZA 1JPJA 2IYLD 4BJ1A 4D4NA 2R7WA 2NSGA 2NSFA 1KNYA 2DB4A 3B9QA 3EFOB 1U0BB 2NG1A 5T3TA 3C63A 1MMDA 2YQYA 3DM5A 4XPXA 4HE8D 4PFOA 4MW3A 3DAGA 3JSZA 4XPYA 4CJGA 5DS6A 1RMVA 2O9XA 3K1IA 5DQZA 2H8AA 3K1IC 2R02A 2YLDA 1RXQA 3M4BA 5AC5A 1IZMA 4JJFA 2Q3TA 2GWWA 2LIGA 1VTMP 4QI0A 4RDAA 2J7PD 3UMHA 3ZWIA 2B0HA 1KU2A 2WZLA 3B0PA 3CZ6A 3AGTA 4DXWA 2UUHA 4JKVA 4WJ0A 2X0CA 2KC3A 1R4TA 1OCCC 2XL6A 3SZRA 2F22A 4G0HA 3EJNA 1T01A 3G4ZA 4ULVA 3GODA 1GQAA 1ZHWA 1VLTA 4WGYA 4A4AA 4CS8A 1HY5A 1PD0A 3LNRA 2OKUA 4C3EA 1T5OA 3AG3C 3B0VC 4KNWA 4LERA 2L81A 4W8KA 2G3KA 4XTKA 3G50A 1OW7A 2CCYA 2H7OA 3RW0A 4ANJA 4WABA 3GWNA 4ULWA 1K05A 1UG7A 1LIHA 3SP1A 3X1OA 2H7VC 1NLXA 1D1AA 3I5QA 2WVNA 1AVOB 4YL0A 4DJ9A 3FOPA 3C18A 2OEVA 1WOLA 3OEOA 3KMIA 5COMA 1SR2A 2LD6A 2ZXOA 3MYIA 2OOCA 3JSEO 1Y4CA 3VM6A 2V3CC 3U2LA 2R7TA 1FFHA 4P9FA 2C04A 3KYIA 3Q6MA 4U5HA 3E9VA 1C03A 5BQGA 4G7OF 5JRAA 2IXNA 1SF8A 3JCUQ 4G7ZF 3NRHA 3C7JA 2NUTB 3LS1A 2ZPAA 4IJJA 2CNWD 4IRUA 2C03A 1XWJA 5KYXB 4I3MA 2HMZA 3RQEA 1JRAA 1VYKA 4IAQA 1ST6A 2Q9AA 2E87A 4ONSA 4O79A 5HSWA 1ZHTA 3H2UA 3SEOA 2VB6A 1JOGA 4K1OA 1V4AA 2Q7RA 3E70C 3UGOA 3HLZA 1G4US 4QI2A 4CDYA 5B3SC 2W4BA 1S05A 1UFBA 1NU7D 4OIRF 3EFOA 2FGYA 2PBEA 2XSEA 3M79A 4FWVA 4PJLA 4PFPA 4OIOF 3U9JA 4YWQA 1I5NA 2Y3GA 3VYWA 4ER9A 1Z5ZA 4MVSA 3FMSA 3FDQA 5BQIA 1VLSA 4MVQA 2Y69C 4JURI 5A6BA 2DGJA 1M56C 3DZAA 4IGGA 4D4XA 5IY5C 2KW3C 3AOUA 3U8VA 2XRHA 3IHUA 3ZTMA 2YL1A 2KYHA 2XLHA 4YT8A 3IEEA 3RYLA 5KYWB 3ASOC 2G62A 3MBGA 4PJJA 2HSBA 1JR8A 2XS8A 1BR4A 3AG4C 3O10A 1OR2A 3B29A 2J9UA 2JX0A 1ORSC 2AWYA 1OW6A 1QVXA 1LKXA 1RJ9B 2WL8A 3K6BA 3V7OA 3PHF2 2D5RB 3N0TA 1J8YF 2PX0A 4OD5A 1QPUA 1SYQA 2HSQA 5F5HA 2AU5A 3SXYA 3ECSA 2J8WA 3S0XA 4OIPF 3C62A 4CSAA 3NDBB 2R7QA 2YKZA 4KBLA 4CSAC 1OXKA 4FAPB 4IB4A 2RSEB 1F1MA 1T6UA 1LS4A 2J9VA 5KYUA 3SXMA 4DVZA 4CX9A 2YWAA 1U6HA 3NKEA 1QSPA 3EH1A 1YVIA 3C8GB 4JRZA 3GEHA 4BEJA 4J32B 4LLEA 2HJMA 1VMAA 3R2PA 2UUIA 2QLAA 2IOQA 1WGWA 1FTSA 4PJMA 2YVKA 3QVZA 1U89A 3BRJA 3RF3A 3UNGC 4H4KC 4BJ5A 1EA8A 3HNIA 1RKEB 3O6XA 3L34A 4BJ5C 1YLMA 4JCZA 1VK5A 2VH3A 4KNVA 5EHHA 2CGEA 1NFOA 1Q0KA 4IAOA 1G4WR 3W8HA 4MVUA 3RQGA 3V5YA 3LLKA 3TJ5A 2YHSA 1A7EA 1OR3A 2AVKA 2QY9A 2PFDA 2IM8A 5KYXA 1WATA 3PCVA 2WB7A 4HFKB 1I4YA 4ZLDA 1LE4A 2Y39A 2XLEA 5BQHA 1BR2A 3J06A 3QW0A 4XEVA 1TR2A 1OKKD 1QZXA 2HFIA 3GM1A 3X2QC 1CGME 1L7CA 1FR0A 1K40A 2JD3A 2A0BA 2OU6A 1FMWA 1TKNA 4XLNF 3ZC4A 4Q4ZF 2J0XA 2LK4A 1FFTC 2EINC 3K1HA 2Q00A 1YAUO 3DE8A 4U5FE 3W8IA 1H9TA 2KK1A 1ZU5A 4O6MA 2A1DD 2KSFA 2XL8A 3IQTA 5KYYB 4U9DA 1H6GA 1GGQA 3N24A 4AE4B 3O55A 2NUPA 3JYHA 4CBEA 4DBQA 1LE2A 3ZVRA 4RBNA 2XXAA 2JPUA 1CPQA 3OA1A 4AL0A 4Q5SF 2OCCC 3LS0A 3VRCA 2Y3DA 3DWWA 2L6FA 4Z9JA 3B0UX 4B6IA 3O39A 4JC7A 1QLEC 3U0CA 4YT2A 3HNLA 3ZTZA 5B1AC 3JTLO 4IWBA 2EPLX 3EPVA 2XL4A 1A41A 1G5ZA 5L3VA 1A7DA 1AEPA 3G4XA 2J9BA 2WZGA 2VCCA 4O6YA 4YK5A 2ZXWC 3T6BA 1ORYA 4EBJA 4U5GA 1ZZPA 2HS5A 3B71A 3U5SA 2KGOA 3TJ6A 4BPMA 3RVZA 1E86A 3UR3C 1PD1A 3GEIA 3CQZA 4JTCB 4N06A 1N1CA 1NBBA 3IQ6A 4I1OB 4O7GA 1V74B 3WG7C 1V54C 5T1DB 3L0IA 1E83A 2TMVP 2B0JA 4XWJA 1M6TA 1OCRC 2A6EF 1ZVZA 3LNMB 4X0RA 5DVWA 5L0FA 1YA7O 1VB5A 2Q9BA 3C8GA 3TK0A 3RFYA 4E0HA 1Z3IX 1L3PA 2DYRC 3K7DA 4MVMA 1S7ZA 3A9CA 2GAQA 2CDQA 1RKEA 2Y3BA 1FMVA 3VAYA 4IARA 2HV6A 4EWCA 3GM3A 2R05A 4H54A 3HNJA 5JSLA 2J9WA 5E3AA 1NU9C 3M4CA 5JS5A 1O5HA 3DXJF 3EZHA 4C7OB 1JMWA 3JRMO 4CDVA 1G8XA 1ZW3A 1WASA 1VYIA 2PP4A 3CSKA 3JT1A 1MNDA 4J30B 1LM3B 3GANA 3LLIA 4EHPA 3FOOA 5JVEA 3T4RA 3AJMA 4KI2A 2HZ8A 3DMDA 1R5ID 1FNTc 1ZHYA 3NMKA 2GFHA 4JCHA 4NTAA 4JJGA 2YL7A 1HE1A 2EPKX 2W45A 2A69F 5F5FA 3QMKA 3T6JA 3ZQVA 1O3UA 4UDVA 3L8IA 4LDRA 1HMDA 3ZSUA 4AL1A 1WN0A 3Q7LA 1M2OA 3LEVA 4BJ6A 1WWPA 2QTVA
chains in the Genus database with same CATH topology
1OW7A 3RQEA 4EBJA 4XEFA 1ZZPA 3U3FA 1WTYA 3B71A 3GM3A 3GM2A 2LK4A 1K05A 2L6HA 2Q00A 1K04A 3BRJA 3JZ0A 3S9OA 3MFNA 2KK1A 1JOGA 1V4AA 2HSBA 3O10A 3C18A 2JX0A 3RQFA 1WOLA 3RQGA 1KTMA 1OW6A 1QVXA 3AJMA 4R32A 5F28E 1UFBA 2JPUA 3JYYA 1PV3A 1OW8A 2PBEA 2L6GA 4XEKA 4NQFA 2L6FA 3C8GA 3C8GD 3U0CA 3L8JA 1KNYA 3K7DA 1K40A 1O3UA 2YWAA 3L8IA 3TULA 4XEVA 3GM1A 4EBKA 3C8GB 1WWPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1OW7 A;  3RQE A;  4EBJ A;  4XEF A;  1ZZP A;  3U3F A;  1WTY A;  3B71 A;  3GM3 A;  3GM2 A;  2LK4 A;  1K05 A;  2L6H A;  2Q00 A;  1K04 A;  3BRJ A;  3JZ0 A;  3S9O A;  3MFN A;  2KK1 A;  1JOG A;  1V4A A;  2HSB A;  3O10 A;  3C18 A;  2JX0 A;  3RQF A;  1WOL A;  3RQG A;  1KTM A;  1OW6 A;  1QVX A;  3AJM A;  4R32 A;  5F28 E;  1UFB A;  2JPU A;  3JYY A;  1PV3 A;  1OW8 A;  2PBE A;  2L6G A;  4XEK A;  4NQF A;  2L6F A;  3C8G A;  3C8G D;  3U0C A;  3L8J A;  1KNY A;  3K7D A;  1K40 A;  1O3U A;  2YWA A;  3L8I A;  3TUL A;  4XEV A;  3GM1 A;  4EBK A;  3C8G B;  1WWP A; 
#chains in the Genus database with same CATH topology
 1YYX A;  2YL0 A;  4U9E A;  4BJ6 C;  1EKY A;  3EGD B;  1WTY A;  3GM2 A;  4AE4 A;  3QVY A;  3RKO F;  4G7H F;  4Z9H A;  1V55 C;  3QTH A;  3EHM A;  4GQH A;  1H9G A;  1B68 A;  2R7U A;  1YZA A;  5COF A;  1T6Q A;  2BL2 A;  3RQF A;  1LI7 A;  5JUA A;  4E18 A;  4MQ9 F;  4OIQ F;  5F28 E;  256B A;  1DOV A;  4N6H A;  1OW8 A;  1TWH A;  4LAC B;  2ASR A;  3MLG A;  4MVR A;  1ZU4 A;  3ASN C;  1OXB A;  4JVS A;  1LPE A;  2Q9C A;  2DYS C;  2HUJ A;  1ZHX A;  2H7B A;  3LUT B;  5DS4 A;  1QKR A;  3TOM A;  3W2W A;  3KH2 A;  2J0W A;  4P6I C;  5A6B D;  2QNL A;  3T9O A;  3RH3 A;  5DS5 A;  3HNK A;  3EHN A;  1HW2 A;  3KL4 A;  3POV A;  5E33 A;  5CI9 A;  5A6J A;  1Q0F A;  3W4Y A;  3PMR A;  2EPN A;  1E85 A;  3ZQY A;  4MTG A;  4AK9 A;  4FX5 A;  1BDJ B;  2KNH A;  2M4E A;  3CAX A;  1SMY F;  3DD7 A;  3FXH A;  2XLV A;  3WOD F;  2LCH A;  1TWG A;  4C3B A;  4YL1 A;  2A68 F;  3ABL C;  4JE9 A;  2M64 A;  1M57 C;  3S84 A;  5BUO A;  5A6A A;  3LEO A;  5CIV A;  2KQ9 A;  4J7Y A;  4XEK A;  1HMO A;  4C3D A;  2NUT A;  1NFN A;  3I5P A;  1Z6A A;  1JPN A;  3PDM P;  1T9K A;  3NMI A;  3NYL A;  4M63 A;  3FVY A;  3AQC A;  4LDK A;  4C7O A;  1Q0M A;  1T6I A;  3KKB A;  4EKW A;  4MVO A;  4I1M A;  4BJT A;  3TUL A;  2AWC A;  2Z15 A;  4PAC A;  4EBK A;  3I4U A;  1A0B A;  3RVY A;  2R7O A;  1M2V B;  1LVK A;  1MMG A;  1LS1 A;  3HJC A;  1MNE A;  3LAY A;  3R7C A;  3WHN A;  4YT4 A;  1CGO A;  4U5E E;  1NG1 A;  2CW0 F;  4K0D A;  3U8P A;  2J7P A;  4N6C A;  1RCP A;  1YZC A;  2YL3 A;  3QZC A;  3U2M A;  3F46 A;  4HEA J;  2OG2 A;  1C17 M;  3NG1 A;  1D1B A;  1H7I A;  3JRT A;  3UMK A;  2ZXR A;  3EH2 A;  1J8M F;  4BEM J;  2R9R B;  2YRF A;  2W9Y A;  3EG9 B;  3IPM O;  4LDQ A;  2P0N A;  2PNO A;  5JLI A;  1XZP A;  3S27 A;  2CYD A;  2WZF A;  4O6N A;  3AGU A;  4DRI B;  5B3I A;  2L7A A;  3EGD A;  1Z63 A;  3TQO A;  4BG0 A;  3A11 A;  1O87 A;  4CJO A;  4JTA B;  2HKV A;  1D0Y A;  1RKC A;  1W2W A;  1YYJ A;  2L9J A;  4L6R A;  5KYW A;  3HTK C;  3ATP A;  2BC5 A;  2KJG A;  1E2X A;  3SXK A;  1SZI A;  5FZT A;  2NPU A;  2EIK C;  4WGZ A;  3OWT A;  4FES A;  1RJ9 A;  3GWL A;  3GEE A;  1GS9 A;  1Z7Q c;  2HV7 A;  4KC9 A;  4MS2 A;  4E17 A;  2ETS A;  2R7X A;  3EGX B;  2FAP B;  5L0C A;  3RIP A;  2MYS A;  3KYJ A;  3AG2 C;  1A7V A;  1KTM A;  2YEV A;  2IXP A;  2YZS A;  5TJ5 E;  4DBR A;  4R32 A;  5D92 A;  2XM4 A;  5KYY A;  1ZW2 A;  4YJW A;  4ZLC A;  4EIY A;  5D91 A;  5L0I A;  1GM5 A;  1DOW A;  4U5D E;  2LQG A;  5B1B C;  1BZ4 A;  3C8Z A;  3MYF A;  2VC9 A;  3QW1 A;  4JZA A;  2LFF A;  4MW8 A;  3Q6N A;  4DRH B;  1TWA A;  4MND A;  5GPG B;  2CNW A;  3SNH A;  4CS8 C;  3S90 A;  2EPO A;  4DRJ B;  1Y6D A;  4K7B A;  5DLJ A;  4XQ1 A;  3H65 A;  3AG1 C;  3M15 A;  3Q7G A;  3N2Z B;  1HW1 A;  1CGN A;  3AQB A;  2J46 A;  4E7S A;  5KYU B;  1EQ1 A;  2AP3 A;  2OJE D;  3DAF A;  2X51 A;  3F47 A;  3LJB A;  5AC4 A;  4JW1 A;  3FHD A;  4U5B E;  3SXZ A;  3FAJ A;  4CDA A;  1VOM A;  4U5C E;  2LFD A;  2ICW G;  2OEX A;  4G78 A;  4MVZ A;  2XLD A;  3NYJ A;  3ABK C;  3S28 A;  1YDI A;  5L0J A;  3DJU B;  3KPH A;  2RD9 A;  1EI7 A;  3C8G D;  3K66 A;  4JIO A;  1M2V A;  4LLC A;  3ZIB A;  4YN0 B;  2OJQ A;  4JTD B;  1ZHZ A;  3DI5 A;  3HKK A;  4I44 A;  2XLM A;  4Z9I A;  1BR1 A;  4E7Z A;  3IQC A;  1OQC A;  5L0H A;  4NTF A;  5JT4 A;  1C02 A;  5KYN A;  2P61 A;  3TD7 A;  3U9M A;  1TQG A;  1XZQ A;  1Q0D A;  2PX3 A;  2R7S A;  1MMN A;  2IBF A;  4F4B A;  1YA9 A;  3EZI A;  3BEH A;  3NYM A;  5L0G A;  5L0D A;  1NZE A;  2V26 A;  1APC A;  2D4U A;  3EG9 A;  2I15 A;  3LES A;  4OIN F;  2R7V A;  2XLO A;  5HV9 A;  1HE9 A;  2IXM A;  2P1A A;  4NCQ A;  3US6 A;  2MHR A;  2G3V A;  5EK0 A;  4NTB A;  4DOZ A;  3W2V A;  4GYT A;  3JYY A;  5DQT A;  4MTF A;  3ZDL A;  2VAS A;  4NQF A;  2YLG A;  2NUP B;  2GDC A;  2LP4 A;  2WVO A;  1MQV A;  5JP7 A;  5L3Q A;  2XXA B;  5CI8 A;  4XPW A;  1TFO B;  2HJ3 A;  2Q4F A;  1FAP B;  4DVY P;  1PCX A;  5AGF A;  1I4Z A;  1E84 A;  1QQ3 A;  4PJN A;  2R25 A;  4CS9 A;  2R7R A;  4PR9 A;  2P6V A;  4Q7C A;  2J45 A;  1ORJ A;  3DM9 B;  4CS9 C;  3EGX A;  3NMJ A;  1OCO C;  1BBH A;  2LSE A;  1TWC A;  3U3F A;  4YT5 A;  4GEH A;  2BE5 F;  2EIL C;  4YL3 A;  2QUP A;  1K04 A;  4P9T A;  1NSG B;  2A0U A;  3JZ0 A;  4JEB A;  2VCA A;  3ZG1 A;  4CS7 A;  3MFN A;  2FFH A;  2EPM X;  1OCZ C;  2DI3 A;  2EIJ C;  4EBB A;  5K0I A;  3WAQ A;  1MMA A;  4NY3 A;  4N4W A;  1IW7 F;  2P7V A;  4A2N B;  2XM0 A;  2YLI A;  3DE9 A;  3MX3 A;  3T6G B;  5E3C A;  4RD9 A;  4XLP F;  2XS1 A;  1PV3 A;  3NKD A;  5T3W A;  3ITF A;  1JAF A;  3DJN B;  4CIH A;  3S29 A;  2IXO A;  2PF4 E;  1Q0G A;  2A6H F;  1D0Z A;  4PK4 A;  3L8J A;  4EUK B;  2QE9 A;  3K33 A;  2VCB A;  2WVQ A;  5EGY A;  5COG A;  3SYN A;  3TOL A;  1OKK A;  1YAR O;  3DKA A;  2GA0 A;  1D0X A;  1AUE A;  4MTO A;  1CPR A;  1LI5 A;  3GOR A;  4XEF A;  2XLW A;  3EQL F;  1D1C A;  3CEX A;  1ZYR F;  2L6H A;  4NC3 A;  3S9O A;  2MWQ A;  2I8B A;  3U3B A;  2OQM A;  2ZXP A;  5E2Q A;  3M1C B;  2ZD9 A;  2EIM C;  3UMI A;  3V5X A;  1TFK B;  2W4M A;  2Y3H A;  1YJG A;  4QDL A;  3L1M A;  5A6K A;  4JEA A;  4CIP A;  3FAP B;  3ABM C;  3IQ5 A;  4W8P A;  4AX2 A;  3VF0 A;  5A69 A;  5FCL A;  2R03 A;  4E0I A;  3UGP A;  2HMQ A;  2L6G A;  4HFF B;  1Z23 A;  4J7T A;  3H2V A;  4OD4 A;  3V5Z A;  1JPJ A;  2IYL D;  4BJ1 A;  4D4N A;  2R7W A;  2NSG A;  2NSF A;  1KNY A;  2DB4 A;  3B9Q A;  3EFO B;  1U0B B;  2NG1 A;  5T3T A;  3C63 A;  1MMD A;  2YQY A;  3DM5 A;  4XPX A;  4HE8 D;  4PFO A;  4MW3 A;  3DAG A;  3JSZ A;  4XPY A;  4CJG A;  5DS6 A;  1RMV A;  2O9X A;  3K1I A;  5DQZ A;  2H8A A;  3K1I C;  2R02 A;  2YLD A;  1RXQ A;  3M4B A;  5AC5 A;  1IZM A;  4JJF A;  2Q3T A;  2GWW A;  2LIG A;  1VTM P;  4QI0 A;  4RDA A;  2J7P D;  3UMH A;  3ZWI A;  2B0H A;  1KU2 A;  2WZL A;  3B0P A;  3CZ6 A;  3AGT A;  4DXW A;  2UUH A;  4JKV A;  4WJ0 A;  2X0C A;  2KC3 A;  1R4T A;  1OCC C;  2XL6 A;  3SZR A;  2F22 A;  4G0H A;  3EJN A;  1T01 A;  3G4Z A;  4ULV A;  3GOD A;  1GQA A;  1ZHW A;  1VLT A;  4WGY A;  4A4A A;  4CS8 A;  1HY5 A;  1PD0 A;  3LNR A;  2OKU A;  4C3E A;  1T5O A;  3AG3 C;  3B0V C;  4KNW A;  4LER A;  2L81 A;  4W8K A;  2G3K A;  4XTK A;  3G50 A;  1OW7 A;  2CCY A;  2H7O A;  3RW0 A;  4ANJ A;  4WAB A;  3GWN A;  4ULW A;  1K05 A;  1UG7 A;  1LIH A;  3SP1 A;  3X1O A;  2H7V C;  1NLX A;  1D1A A;  3I5Q A;  2WVN A;  1AVO B;  4YL0 A;  4DJ9 A;  3FOP A;  3C18 A;  2OEV A;  1WOL A;  3OEO A;  3KMI A;  5COM A;  1SR2 A;  2LD6 A;  2ZXO A;  3MYI A;  2OOC A;  3JSE O;  1Y4C A;  3VM6 A;  2V3C C;  3U2L A;  2R7T A;  1FFH A;  4P9F A;  2C04 A;  3KYI A;  3Q6M A;  4U5H A;  3E9V A;  1C03 A;  5BQG A;  4G7O F;  5JRA A;  2IXN A;  1SF8 A;  3JCU Q;  4G7Z F;  3NRH A;  3C7J A;  2NUT B;  3LS1 A;  2ZPA A;  4IJJ A;  2CNW D;  4IRU A;  2C03 A;  1XWJ A;  5KYX B;  4I3M A;  2HMZ A;  3RQE A;  1JRA A;  1VYK A;  4IAQ A;  1ST6 A;  2Q9A A;  2E87 A;  4ONS A;  4O79 A;  5HSW A;  1ZHT A;  3H2U A;  3SEO A;  2VB6 A;  1JOG A;  4K1O A;  1V4A A;  2Q7R A;  3E70 C;  3UGO A;  3HLZ A;  1G4U S;  4QI2 A;  4CDY A;  5B3S C;  2W4B A;  1S05 A;  1UFB A;  1NU7 D;  4OIR F;  3EFO A;  2FGY A;  2PBE A;  2XSE A;  3M79 A;  4FWV A;  4PJL A;  4PFP A;  4OIO F;  3U9J A;  4YWQ A;  1I5N A;  2Y3G A;  3VYW A;  4ER9 A;  1Z5Z A;  4MVS A;  3FMS A;  3FDQ A;  5BQI A;  1VLS A;  4MVQ A;  2Y69 C;  4JUR I;  5A6B A;  2DGJ A;  1M56 C;  3DZA A;  4IGG A;  4D4X A;  5IY5 C;  2KW3 C;  3AOU A;  3U8V A;  2XRH A;  3IHU A;  3ZTM A;  2YL1 A;  2KYH A;  2XLH A;  4YT8 A;  3IEE A;  3RYL A;  5KYW B;  3ASO C;  2G62 A;  3MBG A;  4PJJ A;  2HSB A;  1JR8 A;  2XS8 A;  1BR4 A;  3AG4 C;  3O10 A;  1OR2 A;  3B29 A;  2J9U A;  2JX0 A;  1ORS C;  2AWY A;  1OW6 A;  1QVX A;  1LKX A;  1RJ9 B;  2WL8 A;  3K6B A;  3V7O A;  3PHF 2;  2D5R B;  3N0T A;  1J8Y F;  2PX0 A;  4OD5 A;  1QPU A;  1SYQ A;  2HSQ A;  5F5H A;  2AU5 A;  3SXY A;  3ECS A;  2J8W A;  3S0X A;  4OIP F;  3C62 A;  4CSA A;  3NDB B;  2R7Q A;  2YKZ A;  4KBL A;  4CSA C;  1OXK A;  4FAP B;  4IB4 A;  2RSE B;  1F1M A;  1T6U A;  1LS4 A;  2J9V A;  5KYU A;  3SXM A;  4DVZ A;  4CX9 A;  2YWA A;  1U6H A;  3NKE A;  1QSP A;  3EH1 A;  1YVI A;  3C8G B;  4JRZ A;  3GEH A;  4BEJ A;  4J32 B;  4LLE A;  2HJM A;  1VMA A;  3R2P A;  2UUI A;  2QLA A;  2IOQ A;  1WGW A;  1FTS A;  4PJM A;  2YVK A;  3QVZ A;  1U89 A;  3BRJ A;  3RF3 A;  3UNG C;  4H4K C;  4BJ5 A;  1EA8 A;  3HNI A;  1RKE B;  3O6X A;  3L34 A;  4BJ5 C;  1YLM A;  4JCZ A;  1VK5 A;  2VH3 A;  4KNV A;  5EHH A;  2CGE A;  1NFO A;  1Q0K A;  4IAO A;  1G4W R;  3W8H A;  4MVU A;  3RQG A;  3V5Y A;  3LLK A;  3TJ5 A;  2YHS A;  1A7E A;  1OR3 A;  2AVK A;  2QY9 A;  2PFD A;  2IM8 A;  5KYX A;  1WAT A;  3PCV A;  2WB7 A;  4HFK B;  1I4Y A;  4ZLD A;  1LE4 A;  2Y39 A;  2XLE A;  5BQH A;  1BR2 A;  3J06 A;  3QW0 A;  4XEV A;  1TR2 A;  1OKK D;  1QZX A;  2HFI A;  3GM1 A;  3X2Q C;  1CGM E;  1L7C A;  1FR0 A;  1K40 A;  2JD3 A;  2A0B A;  2OU6 A;  1FMW A;  1TKN A;  4XLN F;  3ZC4 A;  4Q4Z F;  2J0X A;  2LK4 A;  1FFT C;  2EIN C;  3K1H A;  2Q00 A;  1YAU O;  3DE8 A;  4U5F E;  3W8I A;  1H9T A;  2KK1 A;  1ZU5 A;  4O6M A;  2A1D D;  2KSF A;  2XL8 A;  3IQT A;  5KYY B;  4U9D A;  1H6G A;  1GGQ A;  3N24 A;  4AE4 B;  3O55 A;  2NUP A;  3JYH A;  4CBE A;  4DBQ A;  1LE2 A;  3ZVR A;  4RBN A;  2XXA A;  2JPU A;  1CPQ A;  3OA1 A;  4AL0 A;  4Q5S F;  2OCC C;  3LS0 A;  3VRC A;  2Y3D A;  3DWW A;  2L6F A;  4Z9J A;  3B0U X;  4B6I A;  3O39 A;  4JC7 A;  1QLE C;  3U0C A;  4YT2 A;  3HNL A;  3ZTZ A;  5B1A C;  3JTL O;  4IWB A;  2EPL X;  3EPV A;  2XL4 A;  1A41 A;  1G5Z A;  5L3V A;  1A7D A;  1AEP A;  3G4X A;  2J9B A;  2WZG A;  2VCC A;  4O6Y A;  4YK5 A;  2ZXW C;  3T6B A;  1ORY A;  4EBJ A;  4U5G A;  1ZZP A;  2HS5 A;  3B71 A;  3U5S A;  2KGO A;  3TJ6 A;  4BPM A;  3RVZ A;  1E86 A;  3UR3 C;  1PD1 A;  3GEI A;  3CQZ A;  4JTC B;  4N06 A;  1N1C A;  1NBB A;  3IQ6 A;  4I1O B;  4O7G A;  1V74 B;  3WG7 C;  1V54 C;  5T1D B;  3L0I A;  1E83 A;  2TMV P;  2B0J A;  4XWJ A;  1M6T A;  1OCR C;  2A6E F;  1ZVZ A;  3LNM B;  4X0R A;  5DVW A;  5L0F A;  1YA7 O;  1VB5 A;  2Q9B A;  3C8G A;  3TK0 A;  3RFY A;  4E0H A;  1Z3I X;  1L3P A;  2DYR C;  3K7D A;  4MVM A;  1S7Z A;  3A9C A;  2GAQ A;  2CDQ A;  1RKE A;  2Y3B A;  1FMV A;  3VAY A;  4IAR A;  2HV6 A;  4EWC A;  3GM3 A;  2R05 A;  4H54 A;  3HNJ A;  5JSL A;  2J9W A;  5E3A A;  1NU9 C;  3M4C A;  5JS5 A;  1O5H A;  3DXJ F;  3EZH A;  4C7O B;  1JMW A;  3JRM O;  4CDV A;  1G8X A;  1ZW3 A;  1WAS A;  1VYI A;  2PP4 A;  3CSK A;  3JT1 A;  1MND A;  4J30 B;  1LM3 B;  3GAN A;  3LLI A;  4EHP A;  3FOO A;  5JVE A;  3T4R A;  3AJM A;  4KI2 A;  2HZ8 A;  3DMD A;  1R5I D;  1FNT c;  1ZHY A;  3NMK A;  2GFH A;  4JCH A;  4NTA A;  4JJG A;  2YL7 A;  1HE1 A;  2EPK X;  2W45 A;  2A69 F;  5F5F A;  3QMK A;  3T6J A;  3ZQV A;  1O3U A;  4UDV A;  3L8I A;  4LDR A;  1HMD A;  3ZSU A;  4AL1 A;  1WN0 A;  3Q7L A;  1M2O A;  3LEV A;  4BJ6 A;  1WWP A;  2QTV A; 
#chains in the Genus database with same CATH homology
 1OW7 A;  3RQE A;  4EBJ A;  4XEF A;  1ZZP A;  3U3F A;  1WTY A;  3B71 A;  3GM3 A;  3GM2 A;  2LK4 A;  1K05 A;  2L6H A;  2Q00 A;  1K04 A;  3BRJ A;  3JZ0 A;  3S9O A;  3MFN A;  2KK1 A;  1JOG A;  1V4A A;  2HSB A;  3O10 A;  3C18 A;  2JX0 A;  3RQF A;  1WOL A;  3RQG A;  1KTM A;  1OW6 A;  1QVX A;  3AJM A;  4R32 A;  5F28 E;  1UFB A;  2JPU A;  3JYY A;  1PV3 A;  1OW8 A;  2PBE A;  2L6G A;  4XEK A;  4NQF A;  2L6F A;  3C8G A;  3C8G D;  3U0C A;  3L8J A;  1KNY A;  3K7D A;  1K40 A;  1O3U A;  2YWA A;  3L8I A;  3TUL A;  4XEV A;  3GM1 A;  4EBK A;  3C8G B;  1WWP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...