1K40A

Crystal structure of the fat domain of focal adhesion kinase
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
126
structure length
126
Chain Sequence
NDKVYENVTGLVKAVIEMSSKIQPAPPEEYVPMVKEVGLALRTLLATVDETIPALPASTHREIEMAQKLLNSDLGELISKMKLAQQYVMTSLQQEYKKQMLTAAHALAVDAKNLLDVIDQARLKML
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title The focal adhesion targeting (FAT) region of focal adhesion kinase is a four-helix bundle that binds paxillin
pubmed doi rcsb
source organism Mus musculus
molecule tags Transferase
molecule keywords adhesion kinase
total genus 52
structure length 126
sequence length 126
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 2001-10-04
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.330 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Nucleotidyltransferases domain 2 1k40A00
3B71A 3GM2A 3TULA 2L6FA 2KK1A 2L6GA 4EBKA 4XEFA 2L6HA 1JOGA 1O3UA 1K04A 3RQFA 2LK4A 3L8IA 2PBEA 4XEKA 1K40A 1OW7A 3L8JA 3O10A 3RQGA 1PV3A 3BRJA 3C8GD 3MFNA 4NQFA 1KTMA 2Q00A 3C8GA 1KNYA 3C18A 1V4AA 1OW8A 1WTYA 3GM1A 1QVXA 3GM3A 1K05A 3JZ0A 1WOLA 3RQEA 3S9OA 2JX0A 4XEVA 4R32A 3JYYA 1WWPA 2YWAA 1ZZPA 3AJMA 3C8GB 5F28E 1UFBA 2JPUA 3U0CA 4EBJA 1OW6A 3K7DA 2HSBA 3U3FA
chains in the Genus database with same CATH superfamily
4RDAA 3KKBA 5KYYA 1CPQA 1FFTC 1H9GA 1Z23A 2BC5A 2L6FA 4MTGA 3SZRA 3T6GB 3WG7C 4MW8A 1ZW2A 4P9TA 1VYKA 2V26A 3A9CA 3ZQVA 5DLJA 4EKWA 4XPYA 3DJUB 3EFOA 4JE9A 1QZXA 3EHMA 1HE9A 3IHUA 2HFIA 1KTMA 2YRFA 3DZAA 1XWJA 1L3PA 2YL3A 4G0HA 2O9XA 4I1OB 5A6BD 3AG2C 3NYMA 4WABA 3JRMO 2Q4FA 1E2XA 1NG1A 4PFOA 4X0RA 1MNEA 2AWYA 2ZXRA 4MNDA 3GEEA 2HJ3A 1ZHWA 4QI0A 1C02A 1NU7D 2HV6A 3N2ZB 2HSQA 3Q7GA 4CBEA 3LLIA 1EQ1A 3OWTA 2LCHA 1OW6A 3U9MA 3FVYA 1Q0FA 1M56C 1S7ZA 4AL0A 2MWQA 1RJ9B 2MYSA 4ZLCA 1BR2A 2P7VA 2DYSC 1A7EA 2P61A 4U5GA 3JSEO 1A41A 2DYRC 4MVMA 2LK4A 1DOWA 3GEHA 1O5HA 2OKUA 3IEEA 1T6IA 3O6XA 4N6CA 1PV3A 4E7SA 3IPMO 1BR1A 3C18A 2H8AA 5D92A 1V4AA 4XWJA 2XLEA 1NFNA 3NMIA 4U5EE 1T6UA 2W4BA 4BEMJ 4CDYA 4F4BA 2BE5F 3OEOA 4YJWA 2CNWD 2QLAA 2X51A 3DJNB 1JRAA 1M2VA 1YA7O 4MW3A 1E84A 4BJTA 3LLKA 3O55A 5FCLA 2IXPA 5EK0A 4OINF 4BJ1A 2IM8A 2Y3HA 4MVSA 1LS4A 2XL6A 3SP1A 4DRJB 4G7HF 1CGOA 1M6TA 3LESA 4Z9IA 1H9TA 2WL8A 1NFOA 3TJ6A 1A0BA 1BR4A 1MMGA 3RIPA 1HW2A 3L0IA 3HNJA 3TQOA 3FMSA 1JOGA 1JMWA 3JYHA 1I5NA 1ZHZA 4JW1A 2R7VA 1EKYA 1S05A 1TKNA 1OR2A 2W4MA 4LDQA 4U9EA 2YZSA 3JTLO 4JTDB 4RD9A 4YL3A 3SXZA 2YL7A 4DVYP 2CDQA 5CIVA 2R7UA 3DMDA 3HNIA 4MVZA 3S0XA 3HKKA 4UDVA 1M57C 2OU6A 3TOLA 2OCCC 4MVQA 4CS9C 2EPOA 3S28A 4CX9A 4C7OB 5CI9A 4ZLDA 4YK5A 3S90A 4NC3A 4MTOA 2NPUA 2OQMA 1CGNA 3QVYA 2WB7A 2EIJC 3B0UX 256BA 1WWPA 2ZXPA 4MVRA 1D1BA 3HLZA 1D0YA 4U9DA 4OIPF 3DD7A 1F1MA 4JCZA 2VCCA 4CS8A 2W9YA 4CS8C 1JPNA 1FMVA 4LDRA 4PR9A 2XLMA 1KU2A 2KYHA 4XEFA 1OXBA 2NSFA 2XLVA 1K04A 3EGXB 5DQZA 3PMRA 2A1DD 4C3EA 1FTSA 1LI5A 1ORJA 3M1CB 3T6JA 4IARA 1BBHA 4IJJA 4JJFA 2EIMC 4XLNF 1BZ4A 3LNMB 3LS1A 2ZXOA 2XS8A 1KNYA 3MBGA 2YL1A 3KYJA 4LDKA 3DAGA 3EG9A 4CDAA 3G50A 2EINC 1TFKB 2H7OA 1WGWA 2L81A 5DS6A 3G4XA 4J7TA 4EWCA 2LIGA 3SEOA 5AC4A 3HNKA 3MYFA 4EBBA 3ITFA 4EBJA 1NBBA 4U5CE 3LEOA 3UR3C 1ZHXA 2TMVP 1QSPA 5FZTA 3QVZA 1PD0A 2J46A 2J9VA 2H7VC 2J9UA 2LQGA 3RH3A 2AWCA 4QDLA 3M4BA 4YN0B 1YARO 2IXNA 3EPVA 4CIPA 1SYQA 2PFDA 4DBRA 2P6VA 4H54A 4MVOA 1K40A 2J9WA 2PP4A 3EGXA 3AG4C 2YL0A 1XZPA 3LUTB 3ECSA 3O10A 1QPUA 2IYLD 4PK4A 1FAPB 1ZHYA 4G78A 2LFFA 3ATPA 4I44A 3KYIA 4YL1A 4O79A 3H65A 1SR2A 2L7AA 3GM3A 3JZ0A 1WOLA 4LACB 4ULWA 4KNWA 5E2QA 4EIYA 1Y6DA 5JRAA 5JT4A 1A7VA 2JX0A 5L0GA 1U0BB 5E33A 2J0XA 1ZHTA 1HW1A 2EPMX 3DE9A 3I5QA 3OA1A 5L0FA 2PX0A 4O7GA 1YDIA 3Q6MA 4D4XA 1Z6AA 4PJMA 2V3CC 2I8BA 3HJCA 4A4AA 3POVA 1G4WR 4O6MA 2G3KA 2HMQA 3ABKC 1V55C 3EH1A 2KGOA 3U2LA 4C3BA 4PJLA 3V7OA 1QQ3A 2RD9A 2ZPAA 1OKKA 3F47A 2WZFA 4OD4A 3FAPB 3TK0A 4EUKB 4JURI 3ZTZA 1LVKA 2WVQA 2PNOA 3IQ5A 2KJGA 3ZQYA 3UGOA 2R7OA 4HE8D 2UUHA 2VH3A 2WVOA 5A69A 1J8YF 1U89A 5T3TA 3SXKA 4GQHA 1LE2A 4IWBA 2YWAA 3B29A 3C8GB 2C04A 3FDQA 2VASA 4U5FE 2XM4A 5KYXA 3SXMA 1YYJA 2H7BA 3K1HA 4MS2A 4NTFA 5COMA 3B71A 4DRIB 4CSAA 5IY5C 3DI5A 3EZIA 1OCCC 3C62A 2I15A 2P0NA 3LNRA 3MLGA 2VCBA 4XQ1A 4OIRF 3ZC4A 4DRHB 4H4KC 1OR3A 2PBEA 1NLXA 4J7YA 1GM5A 3M15A 2WZLA 4XPWA 1Y4CA 3SYNA 1AUEA 4YT5A 3SNHA 1O87A 3EJNA 1HMDA 3G4ZA 1WTYA 4HFKB 1VLSA 2XLWA 3LS0A 5L0IA 3AG1C 3VF0A 1ORSC 1OXKA 3S9OA 1ZU5A 3K33A 4MTFA 5EGYA 3H2UA 4M63A 3IQTA 5E3AA 1W2WA 1E85A 2JPUA 4JC7A 4CIHA 1D0ZA 2QE9A 3FXHA 1E86A 2Y39A 3U8PA 2XLOA 3SXYA 2LD6A 2IXMA 2XLHA 4XPXA 3TULA 2KNHA 3PHF2 5B3IA 2Q3TA 4KC9A 2QTVA 5JS5A 2BL2A 1G4US 3RQFA 1E83A 1WATA 3GEIA 4P6IC 5DQTA 4BJ5C 1RCPA 2R9RB 5BQIA 5A6JA 2HS5A 5L0JA 2NSGA 3I5PA 2QNLA 2WVNA 4B6IA 3BRJA 3U9JA 5DVWA 5A6AA 1H6GA 2IBFA 2NUTA 3T6BA 5L0DA 1K05A 1M2VB 4D4NA 1ORYA 2Y3GA 4E18A 2ASRA 4KI2A 1RMVA 3E70C 2B0JA 3NDBB 1YYXA 3DM5A 4O6NA 1ZYRF 4YL0A 3DAFA 3RW0A 2FGYA 4JTCB 2J45A 3AOUA 3VYWA 1LPEA 2Q9AA 1SMYF 5KYWA 4NTAA 3Q6NA 1FMWA 1MMDA 3NG1A 3GM2A 3K1IA 3RFYA 4Q4ZF 2KK1A 1OKKD 2GWWA 4AK9A 2XXAB 5L0HA 5L3VA 5COGA 2GDCA 3VRCA 2HJMA 3B0VC 5KYYB 3W4YA 4IAOA 3VAYA 2Z15A 3UMHA 4JJGA 4DXWA 4JEAA 1HY5A 3US6A 4BG0A 3K1IC 3V5XA 3ASOC 4MQ9F 3C8GA 4C3DA 1JR8A 1OW8A 3GM1A 3EFOB 3RVZA 3AGUA 3RYLA 5KYXB 4EHPA 4GEHA 1H7IA 4CSAC 3DWWA 3W8HA 2J7PD 5F5HA 3E9VA 5GPGB 4G7ZF 2VC9A 3C8ZA 3K6BA 3WODF 2R7SA 4BJ6A 4YT2A 3CQZA 2NUPB 1YLMA 5T1DB 3VM6A 3U0CA 4AX2A 2PF4E 4I1MA 2AVKA 2MHRA 4E17A 1Q0KA 3RKOF 4ONSA 3JT1A 3TJ5A 4FAPB 4JIOA 1SZIA 2JD3A 2L6GA 2OJED 4I3MA 2EIKC 4CDVA 3M79A 4E0IA 4BPMA 4EBKA 4PJNA 5JUAA 3ZDLA 1Q0GA 3GWLA 3U8VA 4E7ZA 2YKZA 1MMNA 1TFOB 3NMKA 2XLDA 4Z9HA 5KYWB 2FAPB 1AEPA 4U5DE 3T4RA 5A6KA 2HZ8A 3EHNA 2A0BA 3FOPA 3Q7LA 2Q9CA 4KBLA 1ZU4A 4W8PA 4PFPA 1QVXA 1ST6A 4K1OA 2G3VA 4YT8A 1LIHA 1NSGB 4FWVA 1EA8A 2R7WA 4XEVA 1G8XA 4XTKA 1D1CA 1NZEA 5KYUA 1J8MF 1ZZPA 2YLGA 1A7DA 5AGFA 1V54C 3S27A 1LM3B 1RKEA 1U6HA 2GA0A 2HSBA 3GANA 2HKVA 5A6BA 2R7XA 4O6YA 2DGJA 3C7JA 3AQBA 4NY3A 1VYIA 2AP3A 3F46A 2KSFA 1I4YA 3S84A 4NCQA 2E87A 3LEVA 3NMJA 1MQVA 5T3WA 5AC5A 2KW3C 3L8IA 4XEKA 4WGZA 5D91A 3I4UA 4PACA 3M4CA 4LLEA 1Q0MA 2HUJA 1LE4A 5L0CA 2Q9BA 2GAQA 3ASNC 4IGGA 4K0DA 2QY9A 4U5HA 1YAUO 3HTKC 4Z9JA 4CJGA 2VCAA 3EQLF 1AVOB 3RQEA 1OCOC 3A11A 2ETSA 1CPRA 3S29A 2CYDA 2A69F 2R02A 4PJJA 2Q7RA 1NU9C 3NYJA 1MMAA 3FAJA 2XM0A 3EZHA 2L9JA 3ABMC 3V5ZA 4A2NB 4CJOA 4DOZA 1T9KA 1ZVZA 3JRTA 1TWGA 1C03A 1IW7F 1T5OA 2LP4A 2Y69C 3FOOA 2M4EA 4JRZA 1RKEB 2J0WA 4Q7CA 1Z7Qc 3ZTMA 2NUPA 5B3SC 3TOMA 1PD1A 2ICWG 2YLDA 3C63A 4AE4A 3LJBA 1QKRA 1D0XA 1N1CA 1R4TA 4WGYA 3L8JA 3RQGA 2VB6A 4NQFA 2W45A 4N4WA 1BDJB 2YVKA 3TD7A 4G7OF 1XZQA 3NRHA 3W2VA 1YZAA 2J8WA 2OEXA 1ZW3A 1OCRC 1VOMA 2IXOA 5JVEA 5F5FA 1VLTA 4YWQA 3KPHA 2YQYA 3CAXA 1C17M 3MYIA 2KQ9A 3EH2A 2YLIA 4WJ0A 5F28E 3ZIBA 1Z5ZA 3AG3C 3BEHA 1HE1A 3NYLA 4OD5A 3UMIA 2R7RA 2R25A 5K0IA 4J30B 2CGEA 3UGPA 3PDMP 2L6HA 5BQGA 1O3UA 5JSLA 4ER9A 3FHDA 1G5ZA 3AGTA 2CW0F 1EI7A 4J32B 2CNWA 3GWNA 1FFHA 3N0TA 4P9FA 1GS9A 1MNDA 2XL8A 2NG1A 2EILC 4N6HA 5JLIA 2R7TA 3WAQA 5KYUB 4IAQA 1Z3IX 3KMIA 3CEXA 3NKEA 3QZCA 4K7BA 5CI8A 4DVZA 5DS5A 4C7OA 1FR0A 2F22A 1YA9A 3CSKA 3N24A 1YVIA 4FESA 1RKCA 1OCZC 1OQCA 4R32A 3U5SA 5COFA 3AJMA 3WHNA 1T6QA 1TR2A 1TWHA 3W2WA 1UFBA 4E0HA 2G62A 3L34A 4CS9A 5EHHA 2FFHA 3EGDB 2EPNA 2A68F 4DJ9A 2EPKX 1LI7A 1TWAA 4OIQF 3QTHA 3W8IA 3U3BA 3DKAA 3QMKA 4HFFB 2R05A 2XS1A 1RJ9A 2CCYA 4W8KA 1I4ZA 3UNGC 1FNTc 1IZMA 2A0UA 1B68A 1OW7A 3LAYA 2KC3A 3H2VA 5DS4A 2P1AA 2YEVA 4ANJA 2XRHA 3JCUQ 5BQHA 1M2OA 1T01A 2B0HA 4JVSA 2OOCA 4RBNA 4CS7A 5L3QA 2OG2A 4GYTA 3IQCA 2WZGA 3O39A 4L6RA 1Z63A 2DB4A 3EG9B 4JKVA 4NTBA 1PCXA 2UUIA 4BJ6C 2HMZA 3JYYA 3KL4A 3ZG1A 5HV9A 1VB5A 3IQ6A 2RSEB 4QI2A 4XLPF 4JEBA 3DXJF 1WN0A 2PX3A 4JCHA 1UG7A 4LERA 5TJ5E 3ABLC 2A6HF 2IOQA 4AE4B 3DE8A 1L7CA 3NKDA 4DBQA 3PCVA 1R5ID 2D5RB 3X2QC 2C03A 4LLCA 3ZWIA 1SF8A 1APCA 3EGDA 3ZSUA 1CGME 5E3CA 4JTAB 2XXAA 2LSEA 3QW0A 3C8GD 4MVUA 3MFNA 3MX3A 4OIOF 2R03A 4HEAJ 1GGQA 2GFHA 2ZXWC 1YJGA 1VK5A 3K66A 4JZAA 2X0CA 3ZVRA 2J9BA 2M64A 2J7PA 5JP7A 2DI3A 4FX5A 2OJQA 3KH2A 3RVYA 2EPLX 3RF3A 4AL1A 4BJ5A 1Q0DA 4BEJA 1VMAA 3GODA 1VTMP 5B1AC 3B9QA 3UMKA 3V5YA 5B1BC 3B0PA 2D4UA 3QW1A 1WASA 2ZD9A 3U2MA 3X1OA 1LKXA 3R2PA 2XL4A 2LFDA 4IB4A 1TWCA 3J06A 3DM9B 3L1MA 1YZCA 4N06A 1DOVA 3GORA 1TQGA 2Y3DA 2A6EF 2YHSA 2NUTB 2AU5A 1HMOA 1QLEC 5KYNA 3CZ6A 4U5BE 3AQCA 1GQAA 2Q00A 5HSWA 2HV7A 3R7CA 1JPJA 2QUPA 2R7QA 3HNLA 3JSZA 1D1AA 2Y3BA 1V74B 5BUOA 4IRUA 4YT4A 4Q5SF 4KNVA 2OEVA 2XSEA 1JAFA 3T9OA 4ULVA 1RXQA 3K7DA 1LS1A 3U3FA
chains in the Genus database with same CATH topology
3B71A 3GM2A 3TULA 2L6FA 2KK1A 2L6GA 4EBKA 4XEFA 2L6HA 1JOGA 1O3UA 1K04A 3RQFA 2LK4A 3L8IA 2PBEA 4XEKA 1K40A 1OW7A 3L8JA 3O10A 3RQGA 1PV3A 3BRJA 3C8GD 3MFNA 4NQFA 1KTMA 2Q00A 3C8GA 1KNYA 3C18A 1V4AA 1OW8A 1WTYA 3GM1A 1QVXA 3GM3A 1K05A 3JZ0A 1WOLA 3RQEA 3S9OA 2JX0A 4XEVA 4R32A 3JYYA 1WWPA 2YWAA 1ZZPA 3AJMA 3C8GB 5F28E 1UFBA 2JPUA 3U0CA 4EBJA 1OW6A 3K7DA 2HSBA 3U3FA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3B71 A;  3GM2 A;  3TUL A;  2L6F A;  2KK1 A;  2L6G A;  4EBK A;  4XEF A;  2L6H A;  1JOG A;  1O3U A;  1K04 A;  3RQF A;  2LK4 A;  3L8I A;  2PBE A;  4XEK A;  1K40 A;  1OW7 A;  3L8J A;  3O10 A;  3RQG A;  1PV3 A;  3BRJ A;  3C8G D;  3MFN A;  4NQF A;  1KTM A;  2Q00 A;  3C8G A;  1KNY A;  3C18 A;  1V4A A;  1OW8 A;  1WTY A;  3GM1 A;  1QVX A;  3GM3 A;  1K05 A;  3JZ0 A;  1WOL A;  3RQE A;  3S9O A;  2JX0 A;  4XEV A;  4R32 A;  3JYY A;  1WWP A;  2YWA A;  1ZZP A;  3AJM A;  3C8G B;  5F28 E;  1UFB A;  2JPU A;  3U0C A;  4EBJ A;  1OW6 A;  3K7D A;  2HSB A;  3U3F A; 
#chains in the Genus database with same CATH topology
 4RDA A;  3KKB A;  5KYY A;  1CPQ A;  1FFT C;  1H9G A;  1Z23 A;  2BC5 A;  2L6F A;  4MTG A;  3SZR A;  3T6G B;  3WG7 C;  4MW8 A;  1ZW2 A;  4P9T A;  1VYK A;  2V26 A;  3A9C A;  3ZQV A;  5DLJ A;  4EKW A;  4XPY A;  3DJU B;  3EFO A;  4JE9 A;  1QZX A;  3EHM A;  1HE9 A;  3IHU A;  2HFI A;  1KTM A;  2YRF A;  3DZA A;  1XWJ A;  1L3P A;  2YL3 A;  4G0H A;  2O9X A;  4I1O B;  5A6B D;  3AG2 C;  3NYM A;  4WAB A;  3JRM O;  2Q4F A;  1E2X A;  1NG1 A;  4PFO A;  4X0R A;  1MNE A;  2AWY A;  2ZXR A;  4MND A;  3GEE A;  2HJ3 A;  1ZHW A;  4QI0 A;  1C02 A;  1NU7 D;  2HV6 A;  3N2Z B;  2HSQ A;  3Q7G A;  4CBE A;  3LLI A;  1EQ1 A;  3OWT A;  2LCH A;  1OW6 A;  3U9M A;  3FVY A;  1Q0F A;  1M56 C;  1S7Z A;  4AL0 A;  2MWQ A;  1RJ9 B;  2MYS A;  4ZLC A;  1BR2 A;  2P7V A;  2DYS C;  1A7E A;  2P61 A;  4U5G A;  3JSE O;  1A41 A;  2DYR C;  4MVM A;  2LK4 A;  1DOW A;  3GEH A;  1O5H A;  2OKU A;  3IEE A;  1T6I A;  3O6X A;  4N6C A;  1PV3 A;  4E7S A;  3IPM O;  1BR1 A;  3C18 A;  2H8A A;  5D92 A;  1V4A A;  4XWJ A;  2XLE A;  1NFN A;  3NMI A;  4U5E E;  1T6U A;  2W4B A;  4BEM J;  4CDY A;  4F4B A;  2BE5 F;  3OEO A;  4YJW A;  2CNW D;  2QLA A;  2X51 A;  3DJN B;  1JRA A;  1M2V A;  1YA7 O;  4MW3 A;  1E84 A;  4BJT A;  3LLK A;  3O55 A;  5FCL A;  2IXP A;  5EK0 A;  4OIN F;  4BJ1 A;  2IM8 A;  2Y3H A;  4MVS A;  1LS4 A;  2XL6 A;  3SP1 A;  4DRJ B;  4G7H F;  1CGO A;  1M6T A;  3LES A;  4Z9I A;  1H9T A;  2WL8 A;  1NFO A;  3TJ6 A;  1A0B A;  1BR4 A;  1MMG A;  3RIP A;  1HW2 A;  3L0I A;  3HNJ A;  3TQO A;  3FMS A;  1JOG A;  1JMW A;  3JYH A;  1I5N A;  1ZHZ A;  4JW1 A;  2R7V A;  1EKY A;  1S05 A;  1TKN A;  1OR2 A;  2W4M A;  4LDQ A;  4U9E A;  2YZS A;  3JTL O;  4JTD B;  4RD9 A;  4YL3 A;  3SXZ A;  2YL7 A;  4DVY P;  2CDQ A;  5CIV A;  2R7U A;  3DMD A;  3HNI A;  4MVZ A;  3S0X A;  3HKK A;  4UDV A;  1M57 C;  2OU6 A;  3TOL A;  2OCC C;  4MVQ A;  4CS9 C;  2EPO A;  3S28 A;  4CX9 A;  4C7O B;  5CI9 A;  4ZLD A;  4YK5 A;  3S90 A;  4NC3 A;  4MTO A;  2NPU A;  2OQM A;  1CGN A;  3QVY A;  2WB7 A;  2EIJ C;  3B0U X;  256B A;  1WWP A;  2ZXP A;  4MVR A;  1D1B A;  3HLZ A;  1D0Y A;  4U9D A;  4OIP F;  3DD7 A;  1F1M A;  4JCZ A;  2VCC A;  4CS8 A;  2W9Y A;  4CS8 C;  1JPN A;  1FMV A;  4LDR A;  4PR9 A;  2XLM A;  1KU2 A;  2KYH A;  4XEF A;  1OXB A;  2NSF A;  2XLV A;  1K04 A;  3EGX B;  5DQZ A;  3PMR A;  2A1D D;  4C3E A;  1FTS A;  1LI5 A;  1ORJ A;  3M1C B;  3T6J A;  4IAR A;  1BBH A;  4IJJ A;  4JJF A;  2EIM C;  4XLN F;  1BZ4 A;  3LNM B;  3LS1 A;  2ZXO A;  2XS8 A;  1KNY A;  3MBG A;  2YL1 A;  3KYJ A;  4LDK A;  3DAG A;  3EG9 A;  4CDA A;  3G50 A;  2EIN C;  1TFK B;  2H7O A;  1WGW A;  2L81 A;  5DS6 A;  3G4X A;  4J7T A;  4EWC A;  2LIG A;  3SEO A;  5AC4 A;  3HNK A;  3MYF A;  4EBB A;  3ITF A;  4EBJ A;  1NBB A;  4U5C E;  3LEO A;  3UR3 C;  1ZHX A;  2TMV P;  1QSP A;  5FZT A;  3QVZ A;  1PD0 A;  2J46 A;  2J9V A;  2H7V C;  2J9U A;  2LQG A;  3RH3 A;  2AWC A;  4QDL A;  3M4B A;  4YN0 B;  1YAR O;  2IXN A;  3EPV A;  4CIP A;  1SYQ A;  2PFD A;  4DBR A;  2P6V A;  4H54 A;  4MVO A;  1K40 A;  2J9W A;  2PP4 A;  3EGX A;  3AG4 C;  2YL0 A;  1XZP A;  3LUT B;  3ECS A;  3O10 A;  1QPU A;  2IYL D;  4PK4 A;  1FAP B;  1ZHY A;  4G78 A;  2LFF A;  3ATP A;  4I44 A;  3KYI A;  4YL1 A;  4O79 A;  3H65 A;  1SR2 A;  2L7A A;  3GM3 A;  3JZ0 A;  1WOL A;  4LAC B;  4ULW A;  4KNW A;  5E2Q A;  4EIY A;  1Y6D A;  5JRA A;  5JT4 A;  1A7V A;  2JX0 A;  5L0G A;  1U0B B;  5E33 A;  2J0X A;  1ZHT A;  1HW1 A;  2EPM X;  3DE9 A;  3I5Q A;  3OA1 A;  5L0F A;  2PX0 A;  4O7G A;  1YDI A;  3Q6M A;  4D4X A;  1Z6A A;  4PJM A;  2V3C C;  2I8B A;  3HJC A;  4A4A A;  3POV A;  1G4W R;  4O6M A;  2G3K A;  2HMQ A;  3ABK C;  1V55 C;  3EH1 A;  2KGO A;  3U2L A;  4C3B A;  4PJL A;  3V7O A;  1QQ3 A;  2RD9 A;  2ZPA A;  1OKK A;  3F47 A;  2WZF A;  4OD4 A;  3FAP B;  3TK0 A;  4EUK B;  4JUR I;  3ZTZ A;  1LVK A;  2WVQ A;  2PNO A;  3IQ5 A;  2KJG A;  3ZQY A;  3UGO A;  2R7O A;  4HE8 D;  2UUH A;  2VH3 A;  2WVO A;  5A69 A;  1J8Y F;  1U89 A;  5T3T A;  3SXK A;  4GQH A;  1LE2 A;  4IWB A;  2YWA A;  3B29 A;  3C8G B;  2C04 A;  3FDQ A;  2VAS A;  4U5F E;  2XM4 A;  5KYX A;  3SXM A;  1YYJ A;  2H7B A;  3K1H A;  4MS2 A;  4NTF A;  5COM A;  3B71 A;  4DRI B;  4CSA A;  5IY5 C;  3DI5 A;  3EZI A;  1OCC C;  3C62 A;  2I15 A;  2P0N A;  3LNR A;  3MLG A;  2VCB A;  4XQ1 A;  4OIR F;  3ZC4 A;  4DRH B;  4H4K C;  1OR3 A;  2PBE A;  1NLX A;  4J7Y A;  1GM5 A;  3M15 A;  2WZL A;  4XPW A;  1Y4C A;  3SYN A;  1AUE A;  4YT5 A;  3SNH A;  1O87 A;  3EJN A;  1HMD A;  3G4Z A;  1WTY A;  4HFK B;  1VLS A;  2XLW A;  3LS0 A;  5L0I A;  3AG1 C;  3VF0 A;  1ORS C;  1OXK A;  3S9O A;  1ZU5 A;  3K33 A;  4MTF A;  5EGY A;  3H2U A;  4M63 A;  3IQT A;  5E3A A;  1W2W A;  1E85 A;  2JPU A;  4JC7 A;  4CIH A;  1D0Z A;  2QE9 A;  3FXH A;  1E86 A;  2Y39 A;  3U8P A;  2XLO A;  3SXY A;  2LD6 A;  2IXM A;  2XLH A;  4XPX A;  3TUL A;  2KNH A;  3PHF 2;  5B3I A;  2Q3T A;  4KC9 A;  2QTV A;  5JS5 A;  2BL2 A;  1G4U S;  3RQF A;  1E83 A;  1WAT A;  3GEI A;  4P6I C;  5DQT A;  4BJ5 C;  1RCP A;  2R9R B;  5BQI A;  5A6J A;  2HS5 A;  5L0J A;  2NSG A;  3I5P A;  2QNL A;  2WVN A;  4B6I A;  3BRJ A;  3U9J A;  5DVW A;  5A6A A;  1H6G A;  2IBF A;  2NUT A;  3T6B A;  5L0D A;  1K05 A;  1M2V B;  4D4N A;  1ORY A;  2Y3G A;  4E18 A;  2ASR A;  4KI2 A;  1RMV A;  3E70 C;  2B0J A;  3NDB B;  1YYX A;  3DM5 A;  4O6N A;  1ZYR F;  4YL0 A;  3DAF A;  3RW0 A;  2FGY A;  4JTC B;  2J45 A;  3AOU A;  3VYW A;  1LPE A;  2Q9A A;  1SMY F;  5KYW A;  4NTA A;  3Q6N A;  1FMW A;  1MMD A;  3NG1 A;  3GM2 A;  3K1I A;  3RFY A;  4Q4Z F;  2KK1 A;  1OKK D;  2GWW A;  4AK9 A;  2XXA B;  5L0H A;  5L3V A;  5COG A;  2GDC A;  3VRC A;  2HJM A;  3B0V C;  5KYY B;  3W4Y A;  4IAO A;  3VAY A;  2Z15 A;  3UMH A;  4JJG A;  4DXW A;  4JEA A;  1HY5 A;  3US6 A;  4BG0 A;  3K1I C;  3V5X A;  3ASO C;  4MQ9 F;  3C8G A;  4C3D A;  1JR8 A;  1OW8 A;  3GM1 A;  3EFO B;  3RVZ A;  3AGU A;  3RYL A;  5KYX B;  4EHP A;  4GEH A;  1H7I A;  4CSA C;  3DWW A;  3W8H A;  2J7P D;  5F5H A;  3E9V A;  5GPG B;  4G7Z F;  2VC9 A;  3C8Z A;  3K6B A;  3WOD F;  2R7S A;  4BJ6 A;  4YT2 A;  3CQZ A;  2NUP B;  1YLM A;  5T1D B;  3VM6 A;  3U0C A;  4AX2 A;  2PF4 E;  4I1M A;  2AVK A;  2MHR A;  4E17 A;  1Q0K A;  3RKO F;  4ONS A;  3JT1 A;  3TJ5 A;  4FAP B;  4JIO A;  1SZI A;  2JD3 A;  2L6G A;  2OJE D;  4I3M A;  2EIK C;  4CDV A;  3M79 A;  4E0I A;  4BPM A;  4EBK A;  4PJN A;  5JUA A;  3ZDL A;  1Q0G A;  3GWL A;  3U8V A;  4E7Z A;  2YKZ A;  1MMN A;  1TFO B;  3NMK A;  2XLD A;  4Z9H A;  5KYW B;  2FAP B;  1AEP A;  4U5D E;  3T4R A;  5A6K A;  2HZ8 A;  3EHN A;  2A0B A;  3FOP A;  3Q7L A;  2Q9C A;  4KBL A;  1ZU4 A;  4W8P A;  4PFP A;  1QVX A;  1ST6 A;  4K1O A;  2G3V A;  4YT8 A;  1LIH A;  1NSG B;  4FWV A;  1EA8 A;  2R7W A;  4XEV A;  1G8X A;  4XTK A;  1D1C A;  1NZE A;  5KYU A;  1J8M F;  1ZZP A;  2YLG A;  1A7D A;  5AGF A;  1V54 C;  3S27 A;  1LM3 B;  1RKE A;  1U6H A;  2GA0 A;  2HSB A;  3GAN A;  2HKV A;  5A6B A;  2R7X A;  4O6Y A;  2DGJ A;  3C7J A;  3AQB A;  4NY3 A;  1VYI A;  2AP3 A;  3F46 A;  2KSF A;  1I4Y A;  3S84 A;  4NCQ A;  2E87 A;  3LEV A;  3NMJ A;  1MQV A;  5T3W A;  5AC5 A;  2KW3 C;  3L8I A;  4XEK A;  4WGZ A;  5D91 A;  3I4U A;  4PAC A;  3M4C A;  4LLE A;  1Q0M A;  2HUJ A;  1LE4 A;  5L0C A;  2Q9B A;  2GAQ A;  3ASN C;  4IGG A;  4K0D A;  2QY9 A;  4U5H A;  1YAU O;  3HTK C;  4Z9J A;  4CJG A;  2VCA A;  3EQL F;  1AVO B;  3RQE A;  1OCO C;  3A11 A;  2ETS A;  1CPR A;  3S29 A;  2CYD A;  2A69 F;  2R02 A;  4PJJ A;  2Q7R A;  1NU9 C;  3NYJ A;  1MMA A;  3FAJ A;  2XM0 A;  3EZH A;  2L9J A;  3ABM C;  3V5Z A;  4A2N B;  4CJO A;  4DOZ A;  1T9K A;  1ZVZ A;  3JRT A;  1TWG A;  1C03 A;  1IW7 F;  1T5O A;  2LP4 A;  2Y69 C;  3FOO A;  2M4E A;  4JRZ A;  1RKE B;  2J0W A;  4Q7C A;  1Z7Q c;  3ZTM A;  2NUP A;  5B3S C;  3TOM A;  1PD1 A;  2ICW G;  2YLD A;  3C63 A;  4AE4 A;  3LJB A;  1QKR A;  1D0X A;  1N1C A;  1R4T A;  4WGY A;  3L8J A;  3RQG A;  2VB6 A;  4NQF A;  2W45 A;  4N4W A;  1BDJ B;  2YVK A;  3TD7 A;  4G7O F;  1XZQ A;  3NRH A;  3W2V A;  1YZA A;  2J8W A;  2OEX A;  1ZW3 A;  1OCR C;  1VOM A;  2IXO A;  5JVE A;  5F5F A;  1VLT A;  4YWQ A;  3KPH A;  2YQY A;  3CAX A;  1C17 M;  3MYI A;  2KQ9 A;  3EH2 A;  2YLI A;  4WJ0 A;  5F28 E;  3ZIB A;  1Z5Z A;  3AG3 C;  3BEH A;  1HE1 A;  3NYL A;  4OD5 A;  3UMI A;  2R7R A;  2R25 A;  5K0I A;  4J30 B;  2CGE A;  3UGP A;  3PDM P;  2L6H A;  5BQG A;  1O3U A;  5JSL A;  4ER9 A;  3FHD A;  1G5Z A;  3AGT A;  2CW0 F;  1EI7 A;  4J32 B;  2CNW A;  3GWN A;  1FFH A;  3N0T A;  4P9F A;  1GS9 A;  1MND A;  2XL8 A;  2NG1 A;  2EIL C;  4N6H A;  5JLI A;  2R7T A;  3WAQ A;  5KYU B;  4IAQ A;  1Z3I X;  3KMI A;  3CEX A;  3NKE A;  3QZC A;  4K7B A;  5CI8 A;  4DVZ A;  5DS5 A;  4C7O A;  1FR0 A;  2F22 A;  1YA9 A;  3CSK A;  3N24 A;  1YVI A;  4FES A;  1RKC A;  1OCZ C;  1OQC A;  4R32 A;  3U5S A;  5COF A;  3AJM A;  3WHN A;  1T6Q A;  1TR2 A;  1TWH A;  3W2W A;  1UFB A;  4E0H A;  2G62 A;  3L34 A;  4CS9 A;  5EHH A;  2FFH A;  3EGD B;  2EPN A;  2A68 F;  4DJ9 A;  2EPK X;  1LI7 A;  1TWA A;  4OIQ F;  3QTH A;  3W8I A;  3U3B A;  3DKA A;  3QMK A;  4HFF B;  2R05 A;  2XS1 A;  1RJ9 A;  2CCY A;  4W8K A;  1I4Z A;  3UNG C;  1FNT c;  1IZM A;  2A0U A;  1B68 A;  1OW7 A;  3LAY A;  2KC3 A;  3H2V A;  5DS4 A;  2P1A A;  2YEV A;  4ANJ A;  2XRH A;  3JCU Q;  5BQH A;  1M2O A;  1T01 A;  2B0H A;  4JVS A;  2OOC A;  4RBN A;  4CS7 A;  5L3Q A;  2OG2 A;  4GYT A;  3IQC A;  2WZG A;  3O39 A;  4L6R A;  1Z63 A;  2DB4 A;  3EG9 B;  4JKV A;  4NTB A;  1PCX A;  2UUI A;  4BJ6 C;  2HMZ A;  3JYY A;  3KL4 A;  3ZG1 A;  5HV9 A;  1VB5 A;  3IQ6 A;  2RSE B;  4QI2 A;  4XLP F;  4JEB A;  3DXJ F;  1WN0 A;  2PX3 A;  4JCH A;  1UG7 A;  4LER A;  5TJ5 E;  3ABL C;  2A6H F;  2IOQ A;  4AE4 B;  3DE8 A;  1L7C A;  3NKD A;  4DBQ A;  3PCV A;  1R5I D;  2D5R B;  3X2Q C;  2C03 A;  4LLC A;  3ZWI A;  1SF8 A;  1APC A;  3EGD A;  3ZSU A;  1CGM E;  5E3C A;  4JTA B;  2XXA A;  2LSE A;  3QW0 A;  3C8G D;  4MVU A;  3MFN A;  3MX3 A;  4OIO F;  2R03 A;  4HEA J;  1GGQ A;  2GFH A;  2ZXW C;  1YJG A;  1VK5 A;  3K66 A;  4JZA A;  2X0C A;  3ZVR A;  2J9B A;  2M64 A;  2J7P A;  5JP7 A;  2DI3 A;  4FX5 A;  2OJQ A;  3KH2 A;  3RVY A;  2EPL X;  3RF3 A;  4AL1 A;  4BJ5 A;  1Q0D A;  4BEJ A;  1VMA A;  3GOD A;  1VTM P;  5B1A C;  3B9Q A;  3UMK A;  3V5Y A;  5B1B C;  3B0P A;  2D4U A;  3QW1 A;  1WAS A;  2ZD9 A;  3U2M A;  3X1O A;  1LKX A;  3R2P A;  2XL4 A;  2LFD A;  4IB4 A;  1TWC A;  3J06 A;  3DM9 B;  3L1M A;  1YZC A;  4N06 A;  1DOV A;  3GOR A;  1TQG A;  2Y3D A;  2A6E F;  2YHS A;  2NUT B;  2AU5 A;  1HMO A;  1QLE C;  5KYN A;  3CZ6 A;  4U5B E;  3AQC A;  1GQA A;  2Q00 A;  5HSW A;  2HV7 A;  3R7C A;  1JPJ A;  2QUP A;  2R7Q A;  3HNL A;  3JSZ A;  1D1A A;  2Y3B A;  1V74 B;  5BUO A;  4IRU A;  4YT4 A;  4Q5S F;  4KNV A;  2OEV A;  2XSE A;  1JAF A;  3T9O A;  4ULV A;  1RXQ A;  3K7D A;  1LS1 A;  3U3F A; 
#chains in the Genus database with same CATH homology
 3B71 A;  3GM2 A;  3TUL A;  2L6F A;  2KK1 A;  2L6G A;  4EBK A;  4XEF A;  2L6H A;  1JOG A;  1O3U A;  1K04 A;  3RQF A;  2LK4 A;  3L8I A;  2PBE A;  4XEK A;  1K40 A;  1OW7 A;  3L8J A;  3O10 A;  3RQG A;  1PV3 A;  3BRJ A;  3C8G D;  3MFN A;  4NQF A;  1KTM A;  2Q00 A;  3C8G A;  1KNY A;  3C18 A;  1V4A A;  1OW8 A;  1WTY A;  3GM1 A;  1QVX A;  3GM3 A;  1K05 A;  3JZ0 A;  1WOL A;  3RQE A;  3S9O A;  2JX0 A;  4XEV A;  4R32 A;  3JYY A;  1WWP A;  2YWA A;  1ZZP A;  3AJM A;  3C8G B;  5F28 E;  1UFB A;  2JPU A;  3U0C A;  4EBJ A;  1OW6 A;  3K7D A;  2HSB A;  3U3F A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...