1K40A

Crystal structure of the fat domain of focal adhesion kinase
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
126
structure length
126
Chain Sequence
NDKVYENVTGLVKAVIEMSSKIQPAPPEEYVPMVKEVGLALRTLLATVDETIPALPASTHREIEMAQKLLNSDLGELISKMKLAQQYVMTSLQQEYKKQMLTAAHALAVDAKNLLDVIDQARLKML
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords adhesion kinase
publication title The focal adhesion targeting (FAT) region of focal adhesion kinase is a four-helix bundle that binds paxillin
pubmed doi rcsb
source organism Mus musculus
molecule tags Transferase
total genus 52
structure length 126
sequence length 126
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 2001-10-04
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.330 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Nucleotidyltransferases domain 2 1k40A00
3C8GB 3C18A 3RQEA 3U3FA 3AJMA 3JYYA 3GM2A 3JZ0A 3B71A 4R32A 4XEFA 3BRJA 3O10A 4XEKA 1JOGA 4XEVA 3RQFA 2KK1A 3L8IA 1K04A 4NQFA 1ZZPA 2L6FA 2L6HA 3L8JA 3TULA 2HSBA 1QVXA 1V4AA 2PBEA 3U0CA 1UFBA 1K05A 1OW6A 3MFNA 2YWAA 2JPUA 3S9OA 3GM3A 1WWPA 1K40A 1WOLA 2LK4A 2L6GA 1PV3A 1WTYA 5F28E 1KTMA 2Q00A 3K7DA 4EBJA 1OW7A 1OW8A 2JX0A 3C8GA 3C8GD 1KNYA 3RQGA 1O3UA 4EBKA 3GM1A
chains in the Genus database with same CATH superfamily
2Y39A 3QVYA 3R2PA 4HFKB 4LERA 2IXPA 2ASRA 3AJMA 4O6NA 3RQEA 3RVYA 1RKCA 3UNGC 1FNTc 3X2QC 5L0JA 2GFHA 1M6TA 4CIPA 4DRJB 1K04A 2IXMA 3G4ZA 4CDYA 1LM3B 4G7ZF 1SZIA 3F46A 4JEAA 3U2LA 1T5OA 2Q9BA 3LESA 3OWTA 3WG7C 4EIYA 3U0CA 4WJ0A 3FDQA 1FFTC 2XL8A 1OXBA 3EH1A 3HLZA 4XTKA 1Z7Qc 3S27A 3SEOA 1D0YA 1ZHXA 1ZU4A 4KC9A 3LS1A 1QZXA 5L3QA 3EJNA 5DS4A 4DVYP 2KQ9A 5L0DA 4OIPF 1OW7A 3SP1A 1LI5A 5DS6A 1YA9A 1C17M 2AU5A 3DJUB 3B0VC 3RH3A 3M4BA 4H4KC 4W8KA 3JCUQ 1HE1A 2A1DD 4XEFA 3GWNA 3ABLC 2EILC 3TOLA 4PJJA 3H65A 4JZAA 4XQ1A 3ZSUA 2BE5F 3MX3A 4DJ9A 5DLJA 1ZVZA 3DE9A 3F47A 2IYLD 3U2MA 1FAPB 2XM4A 4FESA 4J32B 3TD7A 2FGYA 2XLWA 4E0HA 2YL1A 2R02A 4X0RA 1QKRA 4XLPF 4U5GA 2WL8A 3WAQA 4EBBA 3AG2C 4PJMA 3ZTMA 1T01A 2XLVA 1DOVA 1WTYA 3N0TA 4JEBA 4XPXA 3QW1A 2W45A 2IXNA 4ULVA 1G5ZA 3WODF 3DMDA 2IBFA 2L7AA 1SR2A 1NSGB 5E3CA 3U8VA 1LS1A 1FTSA 3GEIA 3JT1A 5JS5A 1WATA 4R32A 5KYXA 4JJGA 4XWJA 3WHNA 1OCCC 2Q3TA 4MVRA 5AGFA 4CBEA 3S28A 2A69F 3NYMA 5L0FA 2IXOA 4XPWA 1WN0A 2RSEB 3JSEO 2Q4FA 4PACA 3AG4C 2B0HA 3IPMO 3US6A 1TKNA 2TMVP 3EZHA 4NCQA 2J8WA 2Y69C 3W8IA 3NYJA 3MFNA 2HZ8A 2XLMA 4MVMA 2EPOA 2XXAA 1V55C 3AG1C 3M15A 2EPLX 1K40A 1ORYA 2OQMA 3SZRA 1L7CA 4BJ5C 3N2ZB 2HUJA 4P9TA 4GEHA 2I15A 2R03A 2R7UA 4LDRA 2HMZA 3C8GB 1Y6DA 1MMGA 2Q9AA 3ZDLA 4RBNA 1NLXA 2XLOA 2WVNA 2OCCC 1A0BA 1M2OA 2MHRA 1B68A 3QVZA 1M57C 2KK1A 1BR1A 3VYWA 4CS8C 2NUPB 4ER9A 1BDJB 1KU2A 3M4CA 5E3AA 5A6BA 2DYRC 1T6QA 2CNWA 3L8JA 2G3KA 3NYLA 4YT8A 1QVXA 4LACB 1V4AA 1OXKA 4CDVA 2NSFA 3JRMO 4F4BA 1OCZC 3E9VA 3S0XA 1Z5ZA 1K05A 2XS1A 3C63A 3B9QA 1BR2A 3HNLA 3UGPA 1LS4A 1D0XA 2KYHA 3GEHA 4K7BA 4E0IA 3DM9B 1WOLA 2VCBA 4G0HA 4K0DA 2R7TA 3T6GB 4MS2A 4JC7A 5CI8A 3TJ6A 1T9KA 3LS0A 4PJLA 3TOMA 4CS9A 3R7CA 3T4RA 1TFOB 4Z9IA 3UMHA 4QI2A 1VOMA 1NU9C 4FX5A 2CYDA 2R7VA 3RF3A 2A6EF 3QMKA 5D91A 2ICWG 3JYYA 4MTGA 4XLNF 4KNVA 3W4YA 1EI7A 3M1CB 1ZW3A 3BRJA 2YEVA 4IARA 2WVQA 3O6XA 1W2WA 3DM5A 2LIGA 4NTFA 2HV6A 1OR3A 2AVKA 1JR8A 3G50A 2A6HF 2A0UA 5GPGB 2EPMX 5EHHA 1TWHA 2B0JA 2VC9A 1G4WR 3FAPB 4Q7CA 1UG7A 2ZXPA 3DXJF 1MQVA 4GYTA 3E70C 2A0BA 4OIQF 3ABMC 3EFOA 2R7SA 1APCA 3S29A 3S9OA 1GQAA 2KC3A 5AC5A 2QLAA 3AOUA 4ULWA 4OIOF 4YT4A 1R5ID 3IHUA 2ETSA 3K7DA 2Q7RA 4Z9HA 3KPHA 2YLDA 4PR9A 3AQCA 4B6IA 1ORJA 2AP3A 1ZHYA 3EGXB 3RFYA 4LDKA 4N06A 3ABKC 5BQHA 2J46A 2J0WA 2MWQA 4G7OF 1YLMA 3LEVA 4YK5A 4P6IC 2GA0A 4MVSA 4LDQA 4CS8A 4H54A 4O6YA 4AE4A 2OJED 5CI9A 4E18A 5JSLA 1TR2A 2XL4A 4N4WA 4J7YA 2JD3A 3EGDB 2X0CA 3LNRA 4E17A 1YYXA 2G62A 4JTCB 3ZTZA 2J9BA 3W8HA 2R25A 2YLIA 3UMIA 4AX2A 1YA7O 3PCVA 4RD9A 1RKEA 3JTLO 4EUKB 1WWPA 3V7OA 3KMIA 1EKYA 3GEEA 4AL0A 1NBBA 1CGOA 2LP4A 4I3MA 3U3BA 5BUOA 1M56C 4M63A 3U9MA 4C7OA 2XLEA 3TK0A 2IM8A 4NC3A 1QQ3A 1Q0GA 2QTVA 3AGTA 3C62A 2VASA 3AGUA 4BEMJ 4CDAA 2BL2A 4YL1A 2LD6A 3VF0A 3ZG1A 4ZLDA 3EG9A 4K1OA 4BPMA 2PFDA 5KYUB 4JKVA 2J9UA 2H8AA 2PP4A 1JRAA 2HFIA 1A7VA 1R4TA 4G7HF 5A6BD 1RJ9B 2J0XA 1ZHZA 2QY9A 3RYLA 2CNWD 5E33A 3ZIBA 3MYFA 3GODA 4IRUA 3NG1A 5L3VA 1CPRA 1F1MA 2EPKX 1GM5A 3MBGA 1OCRC 1ZU5A 3K66A 2NUTB 4EBJA 4DBQA 1J8MF 2OEXA 3Q6MA 1AEPA 4UDVA 1O3UA 2P1AA 2XM0A 1AUEA 5DVWA 5E2QA 4ANJA 3CSKA 5JUAA 4EKWA 4YL3A 4U9DA 2D5RB 2YKZA 4HEAJ 2KGOA 3S84A 3ASNC 4DBRA 1QPUA 4PJNA 4MVZA 1D1CA 2WB7A 1RCPA 5A6JA 5KYYA 2V3CC 2YVKA 4YJWA 4OD5A 3ASOC 1WGWA 3MLGA 5DS5A 2J7PA 1O5HA 5BQGA 3Q7LA 1OQCA 1E85A 2Y3HA 3RVZA 1LI7A 3LUTB 3S90A 1I5NA 1IW7F 3VRCA 2PX0A 2CGEA 4E7SA 2DI3A 4DXWA 5T1DB 3JYHA 4Z9JA 2WZFA 3UGOA 2I8BA 3HNIA 3PHF2 3C7JA 5TJ5E 2E87A 4WABA 3ZQVA 4U5CE 1KTMA 2GDCA 3GORA 3C8GD 2OKUA 2V26A 2YL0A 3DD7A 2XLHA 1LKXA 3G4XA 1YZAA 5F5FA 2VCAA 1H6GA 3JRTA 5COGA 4EBKA 4O79A 1S7ZA 1ST6A 2EIJC 2M4EA 3LEOA 4YWQA 2EPNA 1EQ1A 1PCXA 3CEXA 3GWLA 3JZ0A 3SXMA 1MMAA 3IQCA 1YAUO 4CIHA 3OA1A 1YZCA 1WASA 2OU6A 3NMIA 4PFPA 3NMKA 4U5DE 2UUHA 4PK4A 4BEJA 3U5SA 1AVOB 2F22A 1SF8A 2L9JA 2PBEA 1M2VA 2HMQA 2NPUA 4MTOA 4MVQA 3SYNA 5BQIA 1DOWA 1UFBA 1OW6A 1U89A 2C03A 2M64A 2YRFA 2YZSA 3K1IC 4XPYA 3RKOF 1LE4A 3EFOB 4JTAB 5A69A 2Y3DA 4U5FE 1LPEA 2LK4A 2EINC 2HKVA 4JE9A 4ONSA 2JX0A 3KKBA 1KNYA 3LNMB 4YN0B 3KYIA 2HV7A 4WGYA 3SXYA 1YDIA 1VLTA 1C03A 1HE9A 2VCCA 5B3IA 1T6IA 2HSQA 3W2VA 1HMDA 2J9WA 1XWJA 4LLEA 5B1BC 5AC4A 3LLIA 2R7RA 2LQGA 3LJBA 1Z23A 1U0BB 1L3PA 3H2VA 1E83A 4AL1A 1NFNA 3W2WA 1SYQA 2EIKC 2PF4E 2P61A 3T9OA 3T6JA 2H7VC 3UMKA 5COMA 1NU7D 4OIRF 3TQOA 1Z63A 1O87A 3BEHA 2YWAA 2JPUA 1A41A 2ZXOA 3NRHA 3CZ6A 3CAXA 2IOQA 2QUPA 4MW8A 2XSEA 5COFA 4BJ5A 3AQBA 2YQYA 3MYIA 1ORSC 3POVA 1OW8A 3C8GA 4ZLCA 1S05A 1VB5A 2AWYA 2Y3GA 4IJJA 3C8ZA 1ZHWA 1VTMP 3L1MA 1V54C 3C18A 2QE9A 2DB4A 1A7DA 2J45A 5L0IA 1PD1A 4YL0A 4NTAA 1VLSA 2QNLA 2P0NA 1YVIA 3EG9B 4Q5SF 1HY5A 1H9GA 2DGJA 1E84A 2J7PD 2R7XA 2KJGA 1YARO 3CQZA 2CDQA 3K1IA 4QDLA 4U5HA 2L81A 5B3SC 2EIMC 4OD4A 3FVYA 4IB4A 3QZCA 4N6HA 1MNDA 1YYJA 4NTBA 2NSGA 2XL6A 3SXZA 5KYNA 1VMAA 4CX9A 256BA 1Y4CA 3NKEA 3ZWIA 3GM1A 5CIVA 3PMRA 4IGGA 2Y3BA 4GQHA 1FMVA 1BR4A 1JPNA 1HMOA 3GM2A 4IAQA 2WZGA 5DQZA 5L0GA 2P6VA 5K0IA 1GGQA 2YLGA 3ITFA 1PD0A 1IZMA 3J06A 3FOPA 1RXQA 3DAFA 3HNJA 2KNHA 2H7OA 5KYXB 3T6BA 2W9YA 4NY3A 5KYYB 2CW0F 2L6HA 2X51A 3FHDA 1NFOA 2HSBA 4E7ZA 2P7VA 4G78A 4D4XA 4Q4ZF 4JJFA 1ZW2A 4CSAC 1U6HA 1EA8A 2XS8A 1HW1A 4WGZA 1MMNA 2LFFA 1MMDA 2LFDA 2LSEA 4A4AA 3EGXA 5JT4A 2XXAB 3B0UX 4MNDA 3EHNA 4MW3A 5KYWA 1ZYRF 3IQTA 4RDAA 1FR0A 3KL4A 1G4US 1ZHTA 2D4UA 2Z15A 5DQTA 5A6KA 4LLCA 3DZAA 3RIPA 2W4MA 4HE8D 4JVSA 2DYSC 3KH2A 3HKKA 1FFHA 4KNWA 3B71A 3SXKA 2Q9CA 2OEVA 1TFKB 2BC5A 1OKKD 3K33A 4W8PA 3V5XA 4I1MA 3EGDA 1E2XA 4YT5A 1A7EA 5JP7A 1VYIA 1Z6AA 4KBLA 3U9JA 1C02A 3B29A 5F5HA 1G8XA 1TQGA 3HTKC 1BBHA 5T3WA 2RD9A 3AG3C 4EHPA 4C3DA 1D1BA 1JAFA 1TWGA 3IEEA 3ECSA 4JIOA 3V5ZA 3VAYA 1M2VB 4JCZA 3QW0A 2R7QA 4IWBA 3LLKA 3FXHA 2WZLA 3IQ6A 5EK0A 4CJOA 3K1HA 2H7BA 2Q00A 1XZPA 2YL3A 1LIHA 3K6BA 3LAYA 4CS9C 4AK9A 1XZQA 3HNKA 1SMYF 1OCOC 4MVOA 4MQ9F 2XRHA 2MYSA 1E86A 1QSPA 5HSWA 5L0HA 4I44A 1YJGA 2OJQA 3IQ5A 4P9FA 2KW3C 3M79A 5KYUA 4U5EE 2HJMA 1N1CA 5FCLA 1RMVA 3UR3C 1OR2A 3O39A 4QI0A 1RJ9A 3I5QA 3RQFA 2KSFA 2R7OA 2WVOA 4BJ1A 4BJTA 2XLDA 1ZZPA 2L6FA 1VK5A 2CCYA 1TWCA 2VB6A 3FAJA 3JSZA 4FWVA 5FZTA 3HJCA 3TULA 3NKDA 3SNHA 3NMJA 3DI5A 4CSAA 1CPQA 4CS7A 3PDMP 5HV9A 1LVKA 2VH3A 3VM6A 5L0CA 1CGME 4CJGA 1Q0DA 3B0PA 3ZVRA 4MTFA 2NUTA 1BZ4A 1Q0MA 4O6MA 1H7IA 3DJNB 4OINF 1V74B 4BJ6C 2L6GA 1QLEC 2G3VA 4KI2A 2FFHA 4YT2A 1D0ZA 5JRAA 1GS9A 4MVUA 1NZEA 4DOZA 4JCHA 4FAPB 5T3TA 1LE2A 3Q6NA 2YHSA 3H2UA 2OOCA 2AWCA 1MNEA 4IAOA 3X1OA 4EWCA 4U5BE 1CGNA 4DRIB 5A6AA 3L34A 4I1OB 3DKAA 1OKKA 4J7TA 4C3BA 4NQFA 2OG2A 4DRHB 4J30B 2ZXWC 4JURI 2R9RB 5EGYA 1I4YA 1Q0FA 4DVZA 4AE4B 4C3EA 4BG0A 3ATPA 3TJ5A 3FOOA 3DAGA 4A2NB 4PFOA 1HW2A 4D4NA 3DE8A 3O55A 4O7GA 3ZC4A 1JMWA 3GM3A 2GWWA 3Q7GA 2ZXRA 4JW1A 1PV3A 5D92A 4HFFB 1RKEB 1T6UA 3EPVA 3L0IA 3I5PA 3RQGA 1TWAA 2FAPB 3V5YA 1VYKA 3FMSA 2PNOA 2C04A 2GAQA 3I4UA 2UUIA 5IY5C 1I4ZA 3U3FA 4C7OB 3QTHA 2R7WA 2J9VA 3U8PA 1JPJA 3O10A 2NUPA 3A9CA 1Q0KA 1JOGA 2O9XA 3A11A 3GANA 4XEVA 3KYJA 3L8IA 1NG1A 4XEKA 1J8YF 1H9TA 2NG1A 2A68F 4L6RA 3RW0A 4JRZA 4N6CA 2HS5A 2ZPAA 4JTDB 5JVEA 3EH2A 4U9EA 2HJ3A 3EQLF 3OEOA 4BJ6A 2LCHA 1FMWA 1D1AA 3EZIA 2W4BA 3EHMA 1Z3IX 5F28E 3DWWA 5B1AC 3N24A 3ZQYA 2ZD9A 5JLIA 5KYWB 2R05A 2YL7A 2PX3A 3NDBB
chains in the Genus database with same CATH topology
3C8GB 3C18A 3RQEA 3U3FA 3AJMA 3JYYA 3GM2A 3JZ0A 3B71A 4R32A 4XEFA 3BRJA 3O10A 4XEKA 1JOGA 4XEVA 3RQFA 2KK1A 3L8IA 1K04A 4NQFA 1ZZPA 2L6FA 2L6HA 3L8JA 3TULA 2HSBA 1QVXA 1V4AA 2PBEA 3U0CA 1UFBA 1K05A 1OW6A 3MFNA 2YWAA 2JPUA 3S9OA 3GM3A 1WWPA 1K40A 1WOLA 2LK4A 2L6GA 1PV3A 1WTYA 5F28E 1KTMA 2Q00A 3K7DA 4EBJA 1OW7A 1OW8A 2JX0A 3C8GA 3C8GD 1KNYA 3RQGA 1O3UA 4EBKA 3GM1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3C8G B;  3C18 A;  3RQE A;  3U3F A;  3AJM A;  3JYY A;  3GM2 A;  3JZ0 A;  3B71 A;  4R32 A;  4XEF A;  3BRJ A;  3O10 A;  4XEK A;  1JOG A;  4XEV A;  3RQF A;  2KK1 A;  3L8I A;  1K04 A;  4NQF A;  1ZZP A;  2L6F A;  2L6H A;  3L8J A;  3TUL A;  2HSB A;  1QVX A;  1V4A A;  2PBE A;  3U0C A;  1UFB A;  1K05 A;  1OW6 A;  3MFN A;  2YWA A;  2JPU A;  3S9O A;  3GM3 A;  1WWP A;  1K40 A;  1WOL A;  2LK4 A;  2L6G A;  1PV3 A;  1WTY A;  5F28 E;  1KTM A;  2Q00 A;  3K7D A;  4EBJ A;  1OW7 A;  1OW8 A;  2JX0 A;  3C8G A;  3C8G D;  1KNY A;  3RQG A;  1O3U A;  4EBK A;  3GM1 A; 
#chains in the Genus database with same CATH topology
 2Y39 A;  3QVY A;  3R2P A;  4HFK B;  4LER A;  2IXP A;  2ASR A;  3AJM A;  4O6N A;  3RQE A;  3RVY A;  1RKC A;  3UNG C;  1FNT c;  3X2Q C;  5L0J A;  2GFH A;  1M6T A;  4CIP A;  4DRJ B;  1K04 A;  2IXM A;  3G4Z A;  4CDY A;  1LM3 B;  4G7Z F;  1SZI A;  3F46 A;  4JEA A;  3U2L A;  1T5O A;  2Q9B A;  3LES A;  3OWT A;  3WG7 C;  4EIY A;  3U0C A;  4WJ0 A;  3FDQ A;  1FFT C;  2XL8 A;  1OXB A;  3EH1 A;  3HLZ A;  4XTK A;  1Z7Q c;  3S27 A;  3SEO A;  1D0Y A;  1ZHX A;  1ZU4 A;  4KC9 A;  3LS1 A;  1QZX A;  5L3Q A;  3EJN A;  5DS4 A;  4DVY P;  2KQ9 A;  5L0D A;  4OIP F;  1OW7 A;  3SP1 A;  1LI5 A;  5DS6 A;  1YA9 A;  1C17 M;  2AU5 A;  3DJU B;  3B0V C;  3RH3 A;  3M4B A;  4H4K C;  4W8K A;  3JCU Q;  1HE1 A;  2A1D D;  4XEF A;  3GWN A;  3ABL C;  2EIL C;  3TOL A;  4PJJ A;  3H65 A;  4JZA A;  4XQ1 A;  3ZSU A;  2BE5 F;  3MX3 A;  4DJ9 A;  5DLJ A;  1ZVZ A;  3DE9 A;  3F47 A;  2IYL D;  3U2M A;  1FAP B;  2XM4 A;  4FES A;  4J32 B;  3TD7 A;  2FGY A;  2XLW A;  4E0H A;  2YL1 A;  2R02 A;  4X0R A;  1QKR A;  4XLP F;  4U5G A;  2WL8 A;  3WAQ A;  4EBB A;  3AG2 C;  4PJM A;  3ZTM A;  1T01 A;  2XLV A;  1DOV A;  1WTY A;  3N0T A;  4JEB A;  4XPX A;  3QW1 A;  2W45 A;  2IXN A;  4ULV A;  1G5Z A;  3WOD F;  3DMD A;  2IBF A;  2L7A A;  1SR2 A;  1NSG B;  5E3C A;  3U8V A;  1LS1 A;  1FTS A;  3GEI A;  3JT1 A;  5JS5 A;  1WAT A;  4R32 A;  5KYX A;  4JJG A;  4XWJ A;  3WHN A;  1OCC C;  2Q3T A;  4MVR A;  5AGF A;  4CBE A;  3S28 A;  2A69 F;  3NYM A;  5L0F A;  2IXO A;  4XPW A;  1WN0 A;  2RSE B;  3JSE O;  2Q4F A;  4PAC A;  3AG4 C;  2B0H A;  3IPM O;  3US6 A;  1TKN A;  2TMV P;  3EZH A;  4NCQ A;  2J8W A;  2Y69 C;  3W8I A;  3NYJ A;  3MFN A;  2HZ8 A;  2XLM A;  4MVM A;  2EPO A;  2XXA A;  1V55 C;  3AG1 C;  3M15 A;  2EPL X;  1K40 A;  1ORY A;  2OQM A;  3SZR A;  1L7C A;  4BJ5 C;  3N2Z B;  2HUJ A;  4P9T A;  4GEH A;  2I15 A;  2R03 A;  2R7U A;  4LDR A;  2HMZ A;  3C8G B;  1Y6D A;  1MMG A;  2Q9A A;  3ZDL A;  4RBN A;  1NLX A;  2XLO A;  2WVN A;  2OCC C;  1A0B A;  1M2O A;  2MHR A;  1B68 A;  3QVZ A;  1M57 C;  2KK1 A;  1BR1 A;  3VYW A;  4CS8 C;  2NUP B;  4ER9 A;  1BDJ B;  1KU2 A;  3M4C A;  5E3A A;  5A6B A;  2DYR C;  1T6Q A;  2CNW A;  3L8J A;  2G3K A;  3NYL A;  4YT8 A;  1QVX A;  4LAC B;  1V4A A;  1OXK A;  4CDV A;  2NSF A;  3JRM O;  4F4B A;  1OCZ C;  3E9V A;  3S0X A;  1Z5Z A;  1K05 A;  2XS1 A;  3C63 A;  3B9Q A;  1BR2 A;  3HNL A;  3UGP A;  1LS4 A;  1D0X A;  2KYH A;  3GEH A;  4K7B A;  4E0I A;  3DM9 B;  1WOL A;  2VCB A;  4G0H A;  4K0D A;  2R7T A;  3T6G B;  4MS2 A;  4JC7 A;  5CI8 A;  3TJ6 A;  1T9K A;  3LS0 A;  4PJL A;  3TOM A;  4CS9 A;  3R7C A;  3T4R A;  1TFO B;  4Z9I A;  3UMH A;  4QI2 A;  1VOM A;  1NU9 C;  4FX5 A;  2CYD A;  2R7V A;  3RF3 A;  2A6E F;  3QMK A;  5D91 A;  2ICW G;  3JYY A;  4MTG A;  4XLN F;  4KNV A;  3W4Y A;  1EI7 A;  3M1C B;  1ZW3 A;  3BRJ A;  2YEV A;  4IAR A;  2WVQ A;  3O6X A;  1W2W A;  3DM5 A;  2LIG A;  4NTF A;  2HV6 A;  1OR3 A;  2AVK A;  1JR8 A;  3G50 A;  2A6H F;  2A0U A;  5GPG B;  2EPM X;  5EHH A;  1TWH A;  2B0J A;  2VC9 A;  1G4W R;  3FAP B;  4Q7C A;  1UG7 A;  2ZXP A;  3DXJ F;  1MQV A;  4GYT A;  3E70 C;  2A0B A;  4OIQ F;  3ABM C;  3EFO A;  2R7S A;  1APC A;  3S29 A;  3S9O A;  1GQA A;  2KC3 A;  5AC5 A;  2QLA A;  3AOU A;  4ULW A;  4OIO F;  4YT4 A;  1R5I D;  3IHU A;  2ETS A;  3K7D A;  2Q7R A;  4Z9H A;  3KPH A;  2YLD A;  4PR9 A;  3AQC A;  4B6I A;  1ORJ A;  2AP3 A;  1ZHY A;  3EGX B;  3RFY A;  4LDK A;  4N06 A;  3ABK C;  5BQH A;  2J46 A;  2J0W A;  2MWQ A;  4G7O F;  1YLM A;  3LEV A;  4YK5 A;  4P6I C;  2GA0 A;  4MVS A;  4LDQ A;  4CS8 A;  4H54 A;  4O6Y A;  4AE4 A;  2OJE D;  5CI9 A;  4E18 A;  5JSL A;  1TR2 A;  2XL4 A;  4N4W A;  4J7Y A;  2JD3 A;  3EGD B;  2X0C A;  3LNR A;  4E17 A;  1YYX A;  2G62 A;  4JTC B;  3ZTZ A;  2J9B A;  3W8H A;  2R25 A;  2YLI A;  3UMI A;  4AX2 A;  1YA7 O;  3PCV A;  4RD9 A;  1RKE A;  3JTL O;  4EUK B;  1WWP A;  3V7O A;  3KMI A;  1EKY A;  3GEE A;  4AL0 A;  1NBB A;  1CGO A;  2LP4 A;  4I3M A;  3U3B A;  5BUO A;  1M56 C;  4M63 A;  3U9M A;  4C7O A;  2XLE A;  3TK0 A;  2IM8 A;  4NC3 A;  1QQ3 A;  1Q0G A;  2QTV A;  3AGT A;  3C62 A;  2VAS A;  3AGU A;  4BEM J;  4CDA A;  2BL2 A;  4YL1 A;  2LD6 A;  3VF0 A;  3ZG1 A;  4ZLD A;  3EG9 A;  4K1O A;  4BPM A;  2PFD A;  5KYU B;  4JKV A;  2J9U A;  2H8A A;  2PP4 A;  1JRA A;  2HFI A;  1A7V A;  1R4T A;  4G7H F;  5A6B D;  1RJ9 B;  2J0X A;  1ZHZ A;  2QY9 A;  3RYL A;  2CNW D;  5E33 A;  3ZIB A;  3MYF A;  3GOD A;  4IRU A;  3NG1 A;  5L3V A;  1CPR A;  1F1M A;  2EPK X;  1GM5 A;  3MBG A;  1OCR C;  1ZU5 A;  3K66 A;  2NUT B;  4EBJ A;  4DBQ A;  1J8M F;  2OEX A;  3Q6M A;  1AEP A;  4UDV A;  1O3U A;  2P1A A;  2XM0 A;  1AUE A;  5DVW A;  5E2Q A;  4ANJ A;  3CSK A;  5JUA A;  4EKW A;  4YL3 A;  4U9D A;  2D5R B;  2YKZ A;  4HEA J;  2KGO A;  3S84 A;  3ASN C;  4DBR A;  1QPU A;  4PJN A;  4MVZ A;  1D1C A;  2WB7 A;  1RCP A;  5A6J A;  5KYY A;  2V3C C;  2YVK A;  4YJW A;  4OD5 A;  3ASO C;  1WGW A;  3MLG A;  5DS5 A;  2J7P A;  1O5H A;  5BQG A;  3Q7L A;  1OQC A;  1E85 A;  2Y3H A;  3RVZ A;  1LI7 A;  3LUT B;  3S90 A;  1I5N A;  1IW7 F;  3VRC A;  2PX0 A;  2CGE A;  4E7S A;  2DI3 A;  4DXW A;  5T1D B;  3JYH A;  4Z9J A;  2WZF A;  3UGO A;  2I8B A;  3HNI A;  3PHF 2;  3C7J A;  5TJ5 E;  2E87 A;  4WAB A;  3ZQV A;  4U5C E;  1KTM A;  2GDC A;  3GOR A;  3C8G D;  2OKU A;  2V26 A;  2YL0 A;  3DD7 A;  2XLH A;  1LKX A;  3G4X A;  1YZA A;  5F5F A;  2VCA A;  1H6G A;  3JRT A;  5COG A;  4EBK A;  4O79 A;  1S7Z A;  1ST6 A;  2EIJ C;  2M4E A;  3LEO A;  4YWQ A;  2EPN A;  1EQ1 A;  1PCX A;  3CEX A;  3GWL A;  3JZ0 A;  3SXM A;  1MMA A;  3IQC A;  1YAU O;  4CIH A;  3OA1 A;  1YZC A;  1WAS A;  2OU6 A;  3NMI A;  4PFP A;  3NMK A;  4U5D E;  2UUH A;  4PK4 A;  4BEJ A;  3U5S A;  1AVO B;  2F22 A;  1SF8 A;  2L9J A;  2PBE A;  1M2V A;  2HMQ A;  2NPU A;  4MTO A;  4MVQ A;  3SYN A;  5BQI A;  1DOW A;  1UFB A;  1OW6 A;  1U89 A;  2C03 A;  2M64 A;  2YRF A;  2YZS A;  3K1I C;  4XPY A;  3RKO F;  1LE4 A;  3EFO B;  4JTA B;  5A69 A;  2Y3D A;  4U5F E;  1LPE A;  2LK4 A;  2EIN C;  2HKV A;  4JE9 A;  4ONS A;  2JX0 A;  3KKB A;  1KNY A;  3LNM B;  4YN0 B;  3KYI A;  2HV7 A;  4WGY A;  3SXY A;  1YDI A;  1VLT A;  1C03 A;  1HE9 A;  2VCC A;  5B3I A;  1T6I A;  2HSQ A;  3W2V A;  1HMD A;  2J9W A;  1XWJ A;  4LLE A;  5B1B C;  5AC4 A;  3LLI A;  2R7R A;  2LQG A;  3LJB A;  1Z23 A;  1U0B B;  1L3P A;  3H2V A;  1E83 A;  4AL1 A;  1NFN A;  3W2W A;  1SYQ A;  2EIK C;  2PF4 E;  2P61 A;  3T9O A;  3T6J A;  2H7V C;  3UMK A;  5COM A;  1NU7 D;  4OIR F;  3TQO A;  1Z63 A;  1O87 A;  3BEH A;  2YWA A;  2JPU A;  1A41 A;  2ZXO A;  3NRH A;  3CZ6 A;  3CAX A;  2IOQ A;  2QUP A;  4MW8 A;  2XSE A;  5COF A;  4BJ5 A;  3AQB A;  2YQY A;  3MYI A;  1ORS C;  3POV A;  1OW8 A;  3C8G A;  4ZLC A;  1S05 A;  1VB5 A;  2AWY A;  2Y3G A;  4IJJ A;  3C8Z A;  1ZHW A;  1VTM P;  3L1M A;  1V54 C;  3C18 A;  2QE9 A;  2DB4 A;  1A7D A;  2J45 A;  5L0I A;  1PD1 A;  4YL0 A;  4NTA A;  1VLS A;  2QNL A;  2P0N A;  1YVI A;  3EG9 B;  4Q5S F;  1HY5 A;  1H9G A;  2DGJ A;  1E84 A;  2J7P D;  2R7X A;  2KJG A;  1YAR O;  3CQZ A;  2CDQ A;  3K1I A;  4QDL A;  4U5H A;  2L81 A;  5B3S C;  2EIM C;  4OD4 A;  3FVY A;  4IB4 A;  3QZC A;  4N6H A;  1MND A;  1YYJ A;  4NTB A;  2NSG A;  2XL6 A;  3SXZ A;  5KYN A;  1VMA A;  4CX9 A;  256B A;  1Y4C A;  3NKE A;  3ZWI A;  3GM1 A;  5CIV A;  3PMR A;  4IGG A;  2Y3B A;  4GQH A;  1FMV A;  1BR4 A;  1JPN A;  1HMO A;  3GM2 A;  4IAQ A;  2WZG A;  5DQZ A;  5L0G A;  2P6V A;  5K0I A;  1GGQ A;  2YLG A;  3ITF A;  1PD0 A;  1IZM A;  3J06 A;  3FOP A;  1RXQ A;  3DAF A;  3HNJ A;  2KNH A;  2H7O A;  5KYX B;  3T6B A;  2W9Y A;  4NY3 A;  5KYY B;  2CW0 F;  2L6H A;  2X51 A;  3FHD A;  1NFO A;  2HSB A;  4E7Z A;  2P7V A;  4G78 A;  4D4X A;  4Q4Z F;  4JJF A;  1ZW2 A;  4CSA C;  1U6H A;  1EA8 A;  2XS8 A;  1HW1 A;  4WGZ A;  1MMN A;  2LFF A;  1MMD A;  2LFD A;  2LSE A;  4A4A A;  3EGX A;  5JT4 A;  2XXA B;  3B0U X;  4MND A;  3EHN A;  4MW3 A;  5KYW A;  1ZYR F;  3IQT A;  4RDA A;  1FR0 A;  3KL4 A;  1G4U S;  1ZHT A;  2D4U A;  2Z15 A;  5DQT A;  5A6K A;  4LLC A;  3DZA A;  3RIP A;  2W4M A;  4HE8 D;  4JVS A;  2DYS C;  3KH2 A;  3HKK A;  1FFH A;  4KNW A;  3B71 A;  3SXK A;  2Q9C A;  2OEV A;  1TFK B;  2BC5 A;  1OKK D;  3K33 A;  4W8P A;  3V5X A;  4I1M A;  3EGD A;  1E2X A;  4YT5 A;  1A7E A;  5JP7 A;  1VYI A;  1Z6A A;  4KBL A;  3U9J A;  1C02 A;  3B29 A;  5F5H A;  1G8X A;  1TQG A;  3HTK C;  1BBH A;  5T3W A;  2RD9 A;  3AG3 C;  4EHP A;  4C3D A;  1D1B A;  1JAF A;  1TWG A;  3IEE A;  3ECS A;  4JIO A;  3V5Z A;  3VAY A;  1M2V B;  4JCZ A;  3QW0 A;  2R7Q A;  4IWB A;  3LLK A;  3FXH A;  2WZL A;  3IQ6 A;  5EK0 A;  4CJO A;  3K1H A;  2H7B A;  2Q00 A;  1XZP A;  2YL3 A;  1LIH A;  3K6B A;  3LAY A;  4CS9 C;  4AK9 A;  1XZQ A;  3HNK A;  1SMY F;  1OCO C;  4MVO A;  4MQ9 F;  2XRH A;  2MYS A;  1E86 A;  1QSP A;  5HSW A;  5L0H A;  4I44 A;  1YJG A;  2OJQ A;  3IQ5 A;  4P9F A;  2KW3 C;  3M79 A;  5KYU A;  4U5E E;  2HJM A;  1N1C A;  5FCL A;  1RMV A;  3UR3 C;  1OR2 A;  3O39 A;  4QI0 A;  1RJ9 A;  3I5Q A;  3RQF A;  2KSF A;  2R7O A;  2WVO A;  4BJ1 A;  4BJT A;  2XLD A;  1ZZP A;  2L6F A;  1VK5 A;  2CCY A;  1TWC A;  2VB6 A;  3FAJ A;  3JSZ A;  4FWV A;  5FZT A;  3HJC A;  3TUL A;  3NKD A;  3SNH A;  3NMJ A;  3DI5 A;  4CSA A;  1CPQ A;  4CS7 A;  3PDM P;  5HV9 A;  1LVK A;  2VH3 A;  3VM6 A;  5L0C A;  1CGM E;  4CJG A;  1Q0D A;  3B0P A;  3ZVR A;  4MTF A;  2NUT A;  1BZ4 A;  1Q0M A;  4O6M A;  1H7I A;  3DJN B;  4OIN F;  1V74 B;  4BJ6 C;  2L6G A;  1QLE C;  2G3V A;  4KI2 A;  2FFH A;  4YT2 A;  1D0Z A;  5JRA A;  1GS9 A;  4MVU A;  1NZE A;  4DOZ A;  4JCH A;  4FAP B;  5T3T A;  1LE2 A;  3Q6N A;  2YHS A;  3H2U A;  2OOC A;  2AWC A;  1MNE A;  4IAO A;  3X1O A;  4EWC A;  4U5B E;  1CGN A;  4DRI B;  5A6A A;  3L34 A;  4I1O B;  3DKA A;  1OKK A;  4J7T A;  4C3B A;  4NQF A;  2OG2 A;  4DRH B;  4J30 B;  2ZXW C;  4JUR I;  2R9R B;  5EGY A;  1I4Y A;  1Q0F A;  4DVZ A;  4AE4 B;  4C3E A;  4BG0 A;  3ATP A;  3TJ5 A;  3FOO A;  3DAG A;  4A2N B;  4PFO A;  1HW2 A;  4D4N A;  3DE8 A;  3O55 A;  4O7G A;  3ZC4 A;  1JMW A;  3GM3 A;  2GWW A;  3Q7G A;  2ZXR A;  4JW1 A;  1PV3 A;  5D92 A;  4HFF B;  1RKE B;  1T6U A;  3EPV A;  3L0I A;  3I5P A;  3RQG A;  1TWA A;  2FAP B;  3V5Y A;  1VYK A;  3FMS A;  2PNO A;  2C04 A;  2GAQ A;  3I4U A;  2UUI A;  5IY5 C;  1I4Z A;  3U3F A;  4C7O B;  3QTH A;  2R7W A;  2J9V A;  3U8P A;  1JPJ A;  3O10 A;  2NUP A;  3A9C A;  1Q0K A;  1JOG A;  2O9X A;  3A11 A;  3GAN A;  4XEV A;  3KYJ A;  3L8I A;  1NG1 A;  4XEK A;  1J8Y F;  1H9T A;  2NG1 A;  2A68 F;  4L6R A;  3RW0 A;  4JRZ A;  4N6C A;  2HS5 A;  2ZPA A;  4JTD B;  5JVE A;  3EH2 A;  4U9E A;  2HJ3 A;  3EQL F;  3OEO A;  4BJ6 A;  2LCH A;  1FMW A;  1D1A A;  3EZI A;  2W4B A;  3EHM A;  1Z3I X;  5F28 E;  3DWW A;  5B1A C;  3N24 A;  3ZQY A;  2ZD9 A;  5JLI A;  5KYW B;  2R05 A;  2YL7 A;  2PX3 A;  3NDB B; 
#chains in the Genus database with same CATH homology
 3C8G B;  3C18 A;  3RQE A;  3U3F A;  3AJM A;  3JYY A;  3GM2 A;  3JZ0 A;  3B71 A;  4R32 A;  4XEF A;  3BRJ A;  3O10 A;  4XEK A;  1JOG A;  4XEV A;  3RQF A;  2KK1 A;  3L8I A;  1K04 A;  4NQF A;  1ZZP A;  2L6F A;  2L6H A;  3L8J A;  3TUL A;  2HSB A;  1QVX A;  1V4A A;  2PBE A;  3U0C A;  1UFB A;  1K05 A;  1OW6 A;  3MFN A;  2YWA A;  2JPU A;  3S9O A;  3GM3 A;  1WWP A;  1K40 A;  1WOL A;  2LK4 A;  2L6G A;  1PV3 A;  1WTY A;  5F28 E;  1KTM A;  2Q00 A;  3K7D A;  4EBJ A;  1OW7 A;  1OW8 A;  2JX0 A;  3C8G A;  3C8G D;  1KNY A;  3RQG A;  1O3U A;  4EBK A;  3GM1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...