1K40A

Crystal structure of the fat domain of focal adhesion kinase
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
126
structure length
126
Chain Sequence
NDKVYENVTGLVKAVIEMSSKIQPAPPEEYVPMVKEVGLALRTLLATVDETIPALPASTHREIEMAQKLLNSDLGELISKMKLAQQYVMTSLQQEYKKQMLTAAHALAVDAKNLLDVIDQARLKML
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title The focal adhesion targeting (FAT) region of focal adhesion kinase is a four-helix bundle that binds paxillin
pubmed doi rcsb
source organism Mus musculus
molecule tags Transferase
molecule keywords adhesion kinase
total genus 52
structure length 126
sequence length 126
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 2001-10-04
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.330 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Nucleotidyltransferases domain 2 1k40A00
3O10A 4NQFA 3GM2A 2KK1A 2YWAA 2JPUA 2L6FA 1KTMA 3TULA 1WOLA 5F28E 1WTYA 2HSBA 3RQFA 1K04A 3B71A 1V4AA 1PV3A 3GM3A 1K05A 4XEVA 1JOGA 3S9OA 3GM1A 1OW6A 4R32A 3L8JA 3BRJA 3C18A 1O3UA 3U3FA 2PBEA 1QVXA 3JYYA 1UFBA 2L6GA 3C8GB 3C8GD 3AJMA 2LK4A 3JZ0A 2L6HA 3L8IA 4EBJA 1KNYA 1ZZPA 3U0CA 3C8GA 1K40A 1WWPA 1OW8A 2JX0A 2Q00A 4XEFA 4XEKA 3RQGA 3MFNA 4EBKA 3RQEA 3K7DA 1OW7A
chains in the Genus database with same CATH superfamily
3U9MA 4NTAA 1NU9C 3DM9B 2BL2A 1L7CA 2PFDA 3S27A 2DYRC 4PJLA 3DXJF 4YL0A 3ZTZA 5DQZA 4KI2A 3TOMA 2P6VA 2QNLA 1SMYF 3B71A 2IXOA 3DM5A 3ASNC 3DJNB 1JPJA 1K05A 3EH1A 3IEEA 4PJJA 3GM1A 1CPRA 5KYYB 4NTFA 5KYUB 3U5SA 3BRJA 4OINF 1NG1A 2L7AA 4WABA 3R7CA 2R02A 1GS9A 4AX2A 1TFKB 1V54C 2ICWG 4Q5SF 1FR0A 3AGUA 1ZZPA 4LDRA 4JTDB 4K0DA 4DBQA 2XLDA 2JX0A 4JJFA 4P9TA 2J46A 4N4WA 3MFNA 3W8HA 5KYUA 1MMDA 3VAYA 3B0UX 3L0IA 5K0IA 2MHRA 2HFIA 4N6CA 1H6GA 3ABKC 2G3KA 3T4RA 2QE9A 1BR2A 2UUIA 2P7VA 2YWAA 1JRAA 3KYJA 3SXZA 4E18A 4U5FE 2EPOA 4JRZA 3A9CA 2R7WA 1YZCA 3GODA 5EHHA 3EZHA 4D4NA 3AQBA 3ATPA 1OQCA 4U5BE 1K04A 4XEVA 4CDVA 2IXNA 3ZIBA 2H7OA 3VF0A 4XWJA 2R7QA 4LLCA 2XS1A 4EHPA 3RVZA 4MTOA 1NZEA 3CEXA 1UFBA 5KYWB 3TQOA 2XLEA 2G3VA 3NG1A 4ZLDA 1TFOB 3C8GA 4PFPA 5CI8A 1OR2A 1A7EA 2WZLA 3GWNA 3ZDLA 2KGOA 3SXYA 4BJ6C 3AG3C 3UMKA 2YLDA 4GEHA 3BEHA 5JT4A 1OW7A 3VM6A 2YVKA 2R25A 1MQVA 4O7GA 3IQ6A 4ER9A 4J32B 5DVWA 3KL4A 1NLXA 5A6BA 4CS8C 1PD0A 4IWBA 4Z9HA 1HW1A 5GPGB 4OIOF 4YT8A 2VC9A 4CS9A 3K1IC 3EH2A 4U5DE 2IXMA 2QUPA 4LLEA 3L34A 2A0UA 3DJUB 4BEMJ 1EKYA 2VCBA 4I44A 5A6AA 2ZXWC 1JPNA 3C8GB 2EPKX 3DD7A 4IGGA 4Z9IA 2R03A 2ZD9A 4PK4A 1XZQA 4XQ1A 1LM3B 5E2QA 5B1AC 3E9VA 2WVNA 4XEFA 1D0ZA 3SXKA 3T9OA 1HE1A 3C63A 4HEAJ 4I1OB 3RYLA 4AL1A 2ZXOA 4F4BA 1Q0MA 1QLEC 2Y3GA 5L0JA 3TOLA 5KYWA 4JKVA 4E0IA 1SR2A 3EPVA 3QMKA 1KTMA 2J9BA 2XLVA 2HMQA 3M4CA 1VOMA 4I1MA 4JIOA 3ITFA 4OD5A 4ULVA 4AE4B 4C7OA 3M4BA 2CGEA 4JCHA 1I5NA 1U6HA 1YYJA 3UMHA 3UGOA 1H7IA 4MTFA 3EGDA 1IW7F 1WATA 1E84A 2NUPA 3AG1C 1N1CA 3FHDA 4OD4A 3W2WA 1QZXA 1S7ZA 4PJNA 3Q7GA 2NG1A 4JEAA 3L1MA 1YARO 4DOZA 4MVSA 2J9UA 3OA1A 1VLTA 3EHMA 3JYYA 4NCQA 4DRJB 4EBKA 5BUOA 2UUHA 4CS8A 3DAGA 3AGTA 1Z3IX 3DWWA 1A41A 1RKEB 1T6QA 4KBLA 1G5ZA 4U9EA 4BJ1A 3GEEA 4CBEA 4DRHB 4EKWA 2BE5F 2KSFA 3NMIA 5L3QA 1RJ9B 3DE9A 2CNWD 2IXPA 3RIPA 2IBFA 2CNWA 2XLOA 3LJBA 5F28E 4AL0A 4X0RA 2A69F 2J45A 4C3BA 3A11A 2EPMX 3TJ5A 2J8WA 1APCA 2CDQA 3O39A 2O9XA 3LLIA 4MVZA 4PFOA 1M6TA 1RXQA 3SXMA 1OCZC 1O87A 3CQZA 1LI7A 1ZYRF 1ZHZA 3EZIA 2R7OA 3H2VA 3KYIA 3AG2C 3IHUA 2G62A 3B0VC 4CS7A 3POVA 3S28A 3JRTA 5A6BD 2L6HA 2RD9A 1VYKA 1YLMA 2LQGA 1OKKD 5FCLA 1NFNA 1WWPA 4J7YA 1BBHA 1S05A 2J9WA 2XM0A 3HNJA 3E70C 3LS1A 1D0YA 1RKEA 5B3SC 2FFHA 4FWVA 3R2PA 3EHNA 2OG2A 5AC5A 2PX0A 1LIHA 2L6FA 2CW0F 1PCXA 2IOQA 2Y69C 2OJED 2YHSA 2DGJA 4J30B 3LNRA 1ZW2A 2HV6A 2LFDA 4JZAA 4BPMA 3KPHA 3ZC4A 4MTGA 2YQYA 1V4AA 3IQ5A 4BJ6A 4XLNF 4CX9A 1JMWA 5DS4A 3F46A 3Q6NA 3AG4C 2NUTA 1OR3A 2H7VC 3K33A 1YDIA 2AP3A 2PNOA 4E7ZA 3S0XA 4N06A 4AE4A 4C7OB 2EINC 3HLZA 2A6HF 2XXAB 3S90A 3ZTMA 5HSWA 5JS5A 1EI7A 2OJQA 2R7VA 1ORJA 1Z6AA 2OEXA 1RMVA 1VMAA 1G8XA 1M2OA 3ZSUA 3IPMO 3NKDA 4IAOA 4O6YA 2HMZA 3ZWIA 4A4AA 3EFOB 3X1OA 1LS4A 2LSEA 2WB7A 4JCZA 4NC3A 3QW0A 1WOLA 1E83A 3V5ZA 1VYIA 2DI3A 4CDYA 1D1AA 4QI2A 3LS0A 4PJMA 2NUTB 1U0BB 4JEBA 1A7VA 5L0IA 1CGOA 1G4US 2C03A 2PBEA 2NSGA 4BG0A 4U5GA 3C8GD 1M2VB 2MYSA 2BC5A 3MBGA 5AGFA 2WVOA 4EWCA 2OOCA 2XXAA 1ZHWA 4AK9A 5EK0A 2Q7RA 2P1AA 4HFFB 3LEOA 1FMWA 1M56C 1G4WR 2LCHA 1FFHA 4XPYA 2JD3A 3AOUA 3DMDA 4ONSA 2EIMC 2MWQA 2OKUA 3EQLF 3SYNA 3OEOA 1TR2A 2XSEA 3ZQVA 3NYJA 1TQGA 1FMVA 4DXWA 4MW3A 5HV9A 4JW1A 2XL4A 5L0GA 1JOGA 4KNVA 2R7XA 1VTMP 3HNKA 3L8JA 2R7SA 2DYSC 3Q6MA 3MLGA 4MVQA 1AEPA 2R7UA 4QI0A 2WL8A 3EGXB 3JZ0A 3LLKA 3U9JA 3T6BA 1Y6DA 4U5HA 1W2WA 4BJ5A 4MQ9F 1R4TA 3QVZA 2Z15A 2F22A 4LDQA 1D1CA 1T9KA 4BEJA 4YT4A 4D4XA 5BQGA 5L3VA 1KU2A 3FXHA 3K1IA 4K1OA 4W8KA 2GWWA 3VRCA 4A2NB 3S29A 2PF4E 4JJGA 2VH3A 3SP1A 3U3FA 2LP4A 3KH2A 4DJ9A 2KW3C 1YYXA 3GM2A 4IB4A 2R7RA 2AU5A 4H4KC 1AVOB 3T6JA 1LE4A 3US6A 2R05A 3RH3A 4CIPA 1SF8A 3MYIA 5L0DA 1I4YA 3UGPA 1Q0GA 5E3AA 4IJJA 4LERA 3FAJA 2P61A 3FDQA 4U5CE 1ORYA 2A68F 2HV7A 5COMA 4RBNA 1GGQA 1DOVA 1QQ3A 3DKAA 2R9RB 1XWJA 4Q4ZF 2NSFA 3C7JA 1Y4CA 2H8AA 2KJGA 3EG9B 1ZW3A 2HZ8A 3QZCA 2LK4A 4KNWA 2HS5A 4BJ5C 4FESA 3U0CA 1BR1A 1MNEA 2Q9AA 3HJCA 4EBBA 2Y3DA 4U9DA 5E33A 3RVYA 4UDVA 1JR8A 256BA 3OWTA 3HTKC 3SEOA 3NRHA 4XPXA 1E2XA 3WAQA 3FMSA 2NPUA 4MW8A 3G4XA 1RJ9A 3I5QA 3JSZA 3J06A 2ZXRA 2AWYA 1WTYA 4KC9A 3TD7A 1LPEA 1OKKA 2HSBA 4E0HA 1R5ID 4K7BA 2J7PD 1I4ZA 4O6MA 1SZIA 2I8BA 3NDBB 4DVZA 2L81A 2RSEB 4N6HA 2WVQA 1OW6A 1YJGA 1MMAA 2X51A 1FFTC 2A6EF 3C18A 3MYFA 3LNMB 3N2ZB 4I3MA 2XRHA 4IAQA 2HJ3A 2Y3BA 3DE8A 5JSLA 2L6GA 2A0BA 3U3BA 4YWQA 3AJMA 1HE9A 1AUEA 2J9VA 4L6RA 1Z5ZA 1KNYA 3Q7LA 4EIYA 2LFFA 2D4UA 5BQIA 5CIVA 2QY9A 1D0XA 2J0WA 1RKCA 1MNDA 1F1MA 5D92A 3K66A 1ZVZA 2VB6A 3H65A 4HE8D 1C02A 2Q4FA 3M79A 2CCYA 2A1DD 2VCCA 3KKBA 3QTHA 1V74B 4W8PA 3DAFA 1NFOA 3U8PA 4G7ZF 2YL0A 1WGWA 2WZFA 1XZPA 4NY3A 1M2VA 2Q9CA 3RQFA 2D5RB 4YL3A 3UMIA 4NTBA 4WGYA 3NMJA 1PD1A 4XPWA 1Z23A 4MS2A 3T6GB 3V5XA 2GA0A 2VASA 3B9QA 1T01A 3LEVA 3FOPA 3ABMC 4RD9A 1HMOA 2YL1A 3TK0A 3UR3C 2V3CC 5CI9A 5DQTA 5DLJA 4OIQF 4U5EE 3N0TA 3W8IA 4G7OF 2KNHA 4YL1A 3CSKA 1IZMA 2QTVA 3JRMO 2HKVA 2FGYA 1YA9A 3K6BA 4IARA 2ASRA 1OCCC 4LDKA 3K7DA 3RQEA 1D1BA 2PP4A 3PMRA 4CSAC 1BZ4A 2ZXPA 1ZHXA 2AWCA 5T1DB 4PR9A 2Y3HA 3RFYA 3V5YA 4B6IA 2LD6A 1BR4A 1HY5A 2AVKA 2EPNA 2PX3A 4CJOA 1RCPA 1B68A 1WASA 5EGYA 3PDMP 1FTSA 3LAYA 2YZSA 2H7BA 3FOOA 4CDAA 3C62A 1MMGA 5KYNA 1PV3A 1CPQA 3GM3A 4IRUA 3WODF 5KYYA 1VK5A 2TMVP 2W4MA 1C17M 2L9JA 4R32A 4ANJA 2XLMA 5JVEA 4LACB 2R7TA 1LE2A 3F47A 1UG7A 1TWHA 2GAQA 5TJ5E 3U2MA 1FNTc 1ST6A 3O6XA 5IY5C 5L0FA 1J8MF 4JVSA 4MNDA 2XM4A 2CYDA 3ECSA 1OXBA 3ABLC 1Q0FA 3B0PA 4ZLCA 4YT5A 4O6NA 3W4YA 3NYMA 3O55A 4HFKB 2IYLD 3GEIA 3UNGC 4BJTA 1VLSA 3B29A 4P6IC 2JPUA 5COGA 5JUAA 5KYXB 4G0HA 1ZU4A 2XS8A 1OCOC 3EFOA 2YEVA 3GORA 2YKZA 2WZGA 3JT1A 4GYTA 1TWGA 2XL8A 4M63A 5JP7A 3WHNA 1E86A 4G7HF 2ZPAA 5T3TA 2C04A 4JC7A 2EIKC 2LIGA 3JTLO 4JTCB 1Z7Qc 3X2QC 1FAPB 2Q9BA 4E17A 1J8YF 1HMDA 3GWLA 3PHF2 3RW0A 1SYQA 2KYHA 2YLIA 3DI5A 1BDJB 1ZU5A 3HKKA 1H9GA 3W2VA 2XL6A 4E7SA 3FVYA 3I4UA 1K40A 1TKNA 1T5OA 4CIHA 3QW1A 2XLHA 5BQHA 1ORSC 3EGDB 3EGXA 5DS6A 2OEVA 3O10A 2P0NA 1Z63A 2QLAA 2KK1A 3ZG1A 4H54A 3TULA 2HUJA 2KQ9A 1OXKA 3CAXA 3K1HA 4Q7CA 1CGME 1MMNA 4J7TA 2Y39A 1M57C 4YJWA 2XLWA 1V55C 3G4ZA 2EIJC 5F5FA 4DRIB 5JRAA 1TWAA 2YRFA 5L0CA 1ZHYA 3EJNA 1EA8A 2KC3A 1JAFA 4YT2A 4EUKB 3IQTA 1O3UA 2NUPB 4MVMA 1QVXA 3M1CB 4YN0B 3VYWA 4DBRA 1QKRA 1LI5A 1YAUO 2J0XA 1HW2A 3WG7C 4FX5A 2W45A 3S84A 3QVYA 3RQGA 1E85A 1L3PA 4XEKA 3NYLA 3EG9A 1Q0DA 4XTKA 5F5HA 4CSAA 2V26A 3DZAA 4RDAA 1NBBA 2E87A 3GANA 1NU7D 5A6JA 2OQMA 2ETSA 3LESA 1LVKA 4WGZA 4PACA 4Z9JA 1YA7O 3MX3A 1Q0KA 4QDLA 1T6UA 5T3WA 3LUTB 4JE9A 5D91A 3HNLA 3HNIA 3CZ6A 4OIRF 1C03A 3U2LA 1TWCA 3N24A 5B1BC 1GQAA 5FZTA 2GDCA 4YK5A 4C3EA 2W4BA 5COFA 4WJ0A 3NMKA 1GM5A 2B0JA 4GQHA 4OIPF 1ZHTA 3L8IA 5B3IA 4XLPF 4EBJA 2YL3A 2X0CA 3RF3A 1OW8A 3RKOF 1QSPA 2J7PA 4MVRA 3H2UA 3SNHA 4CS9C 4DVYP 3TJ6A 1NSGB 4CJGA 3GEHA 4NQFA 1LS1A 5JLIA 1QPUA 1A7DA 3C8ZA 3NKEA 3PCVA 4G78A 4JURI 3U8VA 4C3DA 2EPLX 3JYHA 2Q3TA 1VB5A 2OCCC 1EQ1A 3V7OA 4P9FA 3ASOC 3AQCA 5E3CA 4ULWA 3G50A 3S9OA 1YZAA 2I15A 5DS5A 1U89A 2HJMA 2HSQA 3ZVRA 1LKXA 4FAPB 1A0BA 1OCRC 2M64A 2M4EA 2VCAA 2YLGA 2GFHA 2YL7A 3SZRA 1DOWA 3I5PA 5L0HA 2EILC 4MVUA 2DB4A 2W9YA 3FAPB 4MVOA 2IM8A 1WN0A 3JCUQ 4JTAB 2FAPB 4O79A 1H9TA 1T6IA 5A69A 1YVIA 3M15A 2Q00A 3ZQYA 5AC4A 2OU6A 5A6KA 1CGNA 2B0HA 3IQCA 5KYXA 3KMIA 1O5HA 3JSEO
chains in the Genus database with same CATH topology
3O10A 4NQFA 3GM2A 2KK1A 2YWAA 2JPUA 2L6FA 1KTMA 3TULA 1WOLA 5F28E 1WTYA 2HSBA 3RQFA 1K04A 3B71A 1V4AA 1PV3A 3GM3A 1K05A 4XEVA 1JOGA 3S9OA 3GM1A 1OW6A 4R32A 3L8JA 3BRJA 3C18A 1O3UA 3U3FA 2PBEA 1QVXA 3JYYA 1UFBA 2L6GA 3C8GB 3C8GD 3AJMA 2LK4A 3JZ0A 2L6HA 3L8IA 4EBJA 1KNYA 1ZZPA 3U0CA 3C8GA 1K40A 1WWPA 1OW8A 2JX0A 2Q00A 4XEFA 4XEKA 3RQGA 3MFNA 4EBKA 3RQEA 3K7DA 1OW7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3O10 A;  4NQF A;  3GM2 A;  2KK1 A;  2YWA A;  2JPU A;  2L6F A;  1KTM A;  3TUL A;  1WOL A;  5F28 E;  1WTY A;  2HSB A;  3RQF A;  1K04 A;  3B71 A;  1V4A A;  1PV3 A;  3GM3 A;  1K05 A;  4XEV A;  1JOG A;  3S9O A;  3GM1 A;  1OW6 A;  4R32 A;  3L8J A;  3BRJ A;  3C18 A;  1O3U A;  3U3F A;  2PBE A;  1QVX A;  3JYY A;  1UFB A;  2L6G A;  3C8G B;  3C8G D;  3AJM A;  2LK4 A;  3JZ0 A;  2L6H A;  3L8I A;  4EBJ A;  1KNY A;  1ZZP A;  3U0C A;  3C8G A;  1K40 A;  1WWP A;  1OW8 A;  2JX0 A;  2Q00 A;  4XEF A;  4XEK A;  3RQG A;  3MFN A;  4EBK A;  3RQE A;  3K7D A;  1OW7 A; 
#chains in the Genus database with same CATH topology
 3U9M A;  4NTA A;  1NU9 C;  3DM9 B;  2BL2 A;  1L7C A;  2PFD A;  3S27 A;  2DYR C;  4PJL A;  3DXJ F;  4YL0 A;  3ZTZ A;  5DQZ A;  4KI2 A;  3TOM A;  2P6V A;  2QNL A;  1SMY F;  3B71 A;  2IXO A;  3DM5 A;  3ASN C;  3DJN B;  1JPJ A;  1K05 A;  3EH1 A;  3IEE A;  4PJJ A;  3GM1 A;  1CPR A;  5KYY B;  4NTF A;  5KYU B;  3U5S A;  3BRJ A;  4OIN F;  1NG1 A;  2L7A A;  4WAB A;  3R7C A;  2R02 A;  1GS9 A;  4AX2 A;  1TFK B;  1V54 C;  2ICW G;  4Q5S F;  1FR0 A;  3AGU A;  1ZZP A;  4LDR A;  4JTD B;  4K0D A;  4DBQ A;  2XLD A;  2JX0 A;  4JJF A;  4P9T A;  2J46 A;  4N4W A;  3MFN A;  3W8H A;  5KYU A;  1MMD A;  3VAY A;  3B0U X;  3L0I A;  5K0I A;  2MHR A;  2HFI A;  4N6C A;  1H6G A;  3ABK C;  2G3K A;  3T4R A;  2QE9 A;  1BR2 A;  2UUI A;  2P7V A;  2YWA A;  1JRA A;  3KYJ A;  3SXZ A;  4E18 A;  4U5F E;  2EPO A;  4JRZ A;  3A9C A;  2R7W A;  1YZC A;  3GOD A;  5EHH A;  3EZH A;  4D4N A;  3AQB A;  3ATP A;  1OQC A;  4U5B E;  1K04 A;  4XEV A;  4CDV A;  2IXN A;  3ZIB A;  2H7O A;  3VF0 A;  4XWJ A;  2R7Q A;  4LLC A;  2XS1 A;  4EHP A;  3RVZ A;  4MTO A;  1NZE A;  3CEX A;  1UFB A;  5KYW B;  3TQO A;  2XLE A;  2G3V A;  3NG1 A;  4ZLD A;  1TFO B;  3C8G A;  4PFP A;  5CI8 A;  1OR2 A;  1A7E A;  2WZL A;  3GWN A;  3ZDL A;  2KGO A;  3SXY A;  4BJ6 C;  3AG3 C;  3UMK A;  2YLD A;  4GEH A;  3BEH A;  5JT4 A;  1OW7 A;  3VM6 A;  2YVK A;  2R25 A;  1MQV A;  4O7G A;  3IQ6 A;  4ER9 A;  4J32 B;  5DVW A;  3KL4 A;  1NLX A;  5A6B A;  4CS8 C;  1PD0 A;  4IWB A;  4Z9H A;  1HW1 A;  5GPG B;  4OIO F;  4YT8 A;  2VC9 A;  4CS9 A;  3K1I C;  3EH2 A;  4U5D E;  2IXM A;  2QUP A;  4LLE A;  3L34 A;  2A0U A;  3DJU B;  4BEM J;  1EKY A;  2VCB A;  4I44 A;  5A6A A;  2ZXW C;  1JPN A;  3C8G B;  2EPK X;  3DD7 A;  4IGG A;  4Z9I A;  2R03 A;  2ZD9 A;  4PK4 A;  1XZQ A;  4XQ1 A;  1LM3 B;  5E2Q A;  5B1A C;  3E9V A;  2WVN A;  4XEF A;  1D0Z A;  3SXK A;  3T9O A;  1HE1 A;  3C63 A;  4HEA J;  4I1O B;  3RYL A;  4AL1 A;  2ZXO A;  4F4B A;  1Q0M A;  1QLE C;  2Y3G A;  5L0J A;  3TOL A;  5KYW A;  4JKV A;  4E0I A;  1SR2 A;  3EPV A;  3QMK A;  1KTM A;  2J9B A;  2XLV A;  2HMQ A;  3M4C A;  1VOM A;  4I1M A;  4JIO A;  3ITF A;  4OD5 A;  4ULV A;  4AE4 B;  4C7O A;  3M4B A;  2CGE A;  4JCH A;  1I5N A;  1U6H A;  1YYJ A;  3UMH A;  3UGO A;  1H7I A;  4MTF A;  3EGD A;  1IW7 F;  1WAT A;  1E84 A;  2NUP A;  3AG1 C;  1N1C A;  3FHD A;  4OD4 A;  3W2W A;  1QZX A;  1S7Z A;  4PJN A;  3Q7G A;  2NG1 A;  4JEA A;  3L1M A;  1YAR O;  4DOZ A;  4MVS A;  2J9U A;  3OA1 A;  1VLT A;  3EHM A;  3JYY A;  4NCQ A;  4DRJ B;  4EBK A;  5BUO A;  2UUH A;  4CS8 A;  3DAG A;  3AGT A;  1Z3I X;  3DWW A;  1A41 A;  1RKE B;  1T6Q A;  4KBL A;  1G5Z A;  4U9E A;  4BJ1 A;  3GEE A;  4CBE A;  4DRH B;  4EKW A;  2BE5 F;  2KSF A;  3NMI A;  5L3Q A;  1RJ9 B;  3DE9 A;  2CNW D;  2IXP A;  3RIP A;  2IBF A;  2CNW A;  2XLO A;  3LJB A;  5F28 E;  4AL0 A;  4X0R A;  2A69 F;  2J45 A;  4C3B A;  3A11 A;  2EPM X;  3TJ5 A;  2J8W A;  1APC A;  2CDQ A;  3O39 A;  2O9X A;  3LLI A;  4MVZ A;  4PFO A;  1M6T A;  1RXQ A;  3SXM A;  1OCZ C;  1O87 A;  3CQZ A;  1LI7 A;  1ZYR F;  1ZHZ A;  3EZI A;  2R7O A;  3H2V A;  3KYI A;  3AG2 C;  3IHU A;  2G62 A;  3B0V C;  4CS7 A;  3POV A;  3S28 A;  3JRT A;  5A6B D;  2L6H A;  2RD9 A;  1VYK A;  1YLM A;  2LQG A;  1OKK D;  5FCL A;  1NFN A;  1WWP A;  4J7Y A;  1BBH A;  1S05 A;  2J9W A;  2XM0 A;  3HNJ A;  3E70 C;  3LS1 A;  1D0Y A;  1RKE A;  5B3S C;  2FFH A;  4FWV A;  3R2P A;  3EHN A;  2OG2 A;  5AC5 A;  2PX0 A;  1LIH A;  2L6F A;  2CW0 F;  1PCX A;  2IOQ A;  2Y69 C;  2OJE D;  2YHS A;  2DGJ A;  4J30 B;  3LNR A;  1ZW2 A;  2HV6 A;  2LFD A;  4JZA A;  4BPM A;  3KPH A;  3ZC4 A;  4MTG A;  2YQY A;  1V4A A;  3IQ5 A;  4BJ6 A;  4XLN F;  4CX9 A;  1JMW A;  5DS4 A;  3F46 A;  3Q6N A;  3AG4 C;  2NUT A;  1OR3 A;  2H7V C;  3K33 A;  1YDI A;  2AP3 A;  2PNO A;  4E7Z A;  3S0X A;  4N06 A;  4AE4 A;  4C7O B;  2EIN C;  3HLZ A;  2A6H F;  2XXA B;  3S90 A;  3ZTM A;  5HSW A;  5JS5 A;  1EI7 A;  2OJQ A;  2R7V A;  1ORJ A;  1Z6A A;  2OEX A;  1RMV A;  1VMA A;  1G8X A;  1M2O A;  3ZSU A;  3IPM O;  3NKD A;  4IAO A;  4O6Y A;  2HMZ A;  3ZWI A;  4A4A A;  3EFO B;  3X1O A;  1LS4 A;  2LSE A;  2WB7 A;  4JCZ A;  4NC3 A;  3QW0 A;  1WOL A;  1E83 A;  3V5Z A;  1VYI A;  2DI3 A;  4CDY A;  1D1A A;  4QI2 A;  3LS0 A;  4PJM A;  2NUT B;  1U0B B;  4JEB A;  1A7V A;  5L0I A;  1CGO A;  1G4U S;  2C03 A;  2PBE A;  2NSG A;  4BG0 A;  4U5G A;  3C8G D;  1M2V B;  2MYS A;  2BC5 A;  3MBG A;  5AGF A;  2WVO A;  4EWC A;  2OOC A;  2XXA A;  1ZHW A;  4AK9 A;  5EK0 A;  2Q7R A;  2P1A A;  4HFF B;  3LEO A;  1FMW A;  1M56 C;  1G4W R;  2LCH A;  1FFH A;  4XPY A;  2JD3 A;  3AOU A;  3DMD A;  4ONS A;  2EIM C;  2MWQ A;  2OKU A;  3EQL F;  3SYN A;  3OEO A;  1TR2 A;  2XSE A;  3ZQV A;  3NYJ A;  1TQG A;  1FMV A;  4DXW A;  4MW3 A;  5HV9 A;  4JW1 A;  2XL4 A;  5L0G A;  1JOG A;  4KNV A;  2R7X A;  1VTM P;  3HNK A;  3L8J A;  2R7S A;  2DYS C;  3Q6M A;  3MLG A;  4MVQ A;  1AEP A;  2R7U A;  4QI0 A;  2WL8 A;  3EGX B;  3JZ0 A;  3LLK A;  3U9J A;  3T6B A;  1Y6D A;  4U5H A;  1W2W A;  4BJ5 A;  4MQ9 F;  1R4T A;  3QVZ A;  2Z15 A;  2F22 A;  4LDQ A;  1D1C A;  1T9K A;  4BEJ A;  4YT4 A;  4D4X A;  5BQG A;  5L3V A;  1KU2 A;  3FXH A;  3K1I A;  4K1O A;  4W8K A;  2GWW A;  3VRC A;  4A2N B;  3S29 A;  2PF4 E;  4JJG A;  2VH3 A;  3SP1 A;  3U3F A;  2LP4 A;  3KH2 A;  4DJ9 A;  2KW3 C;  1YYX A;  3GM2 A;  4IB4 A;  2R7R A;  2AU5 A;  4H4K C;  1AVO B;  3T6J A;  1LE4 A;  3US6 A;  2R05 A;  3RH3 A;  4CIP A;  1SF8 A;  3MYI A;  5L0D A;  1I4Y A;  3UGP A;  1Q0G A;  5E3A A;  4IJJ A;  4LER A;  3FAJ A;  2P61 A;  3FDQ A;  4U5C E;  1ORY A;  2A68 F;  2HV7 A;  5COM A;  4RBN A;  1GGQ A;  1DOV A;  1QQ3 A;  3DKA A;  2R9R B;  1XWJ A;  4Q4Z F;  2NSF A;  3C7J A;  1Y4C A;  2H8A A;  2KJG A;  3EG9 B;  1ZW3 A;  2HZ8 A;  3QZC A;  2LK4 A;  4KNW A;  2HS5 A;  4BJ5 C;  4FES A;  3U0C A;  1BR1 A;  1MNE A;  2Q9A A;  3HJC A;  4EBB A;  2Y3D A;  4U9D A;  5E33 A;  3RVY A;  4UDV A;  1JR8 A;  256B A;  3OWT A;  3HTK C;  3SEO A;  3NRH A;  4XPX A;  1E2X A;  3WAQ A;  3FMS A;  2NPU A;  4MW8 A;  3G4X A;  1RJ9 A;  3I5Q A;  3JSZ A;  3J06 A;  2ZXR A;  2AWY A;  1WTY A;  4KC9 A;  3TD7 A;  1LPE A;  1OKK A;  2HSB A;  4E0H A;  1R5I D;  4K7B A;  2J7P D;  1I4Z A;  4O6M A;  1SZI A;  2I8B A;  3NDB B;  4DVZ A;  2L81 A;  2RSE B;  4N6H A;  2WVQ A;  1OW6 A;  1YJG A;  1MMA A;  2X51 A;  1FFT C;  2A6E F;  3C18 A;  3MYF A;  3LNM B;  3N2Z B;  4I3M A;  2XRH A;  4IAQ A;  2HJ3 A;  2Y3B A;  3DE8 A;  5JSL A;  2L6G A;  2A0B A;  3U3B A;  4YWQ A;  3AJM A;  1HE9 A;  1AUE A;  2J9V A;  4L6R A;  1Z5Z A;  1KNY A;  3Q7L A;  4EIY A;  2LFF A;  2D4U A;  5BQI A;  5CIV A;  2QY9 A;  1D0X A;  2J0W A;  1RKC A;  1MND A;  1F1M A;  5D92 A;  3K66 A;  1ZVZ A;  2VB6 A;  3H65 A;  4HE8 D;  1C02 A;  2Q4F A;  3M79 A;  2CCY A;  2A1D D;  2VCC A;  3KKB A;  3QTH A;  1V74 B;  4W8P A;  3DAF A;  1NFO A;  3U8P A;  4G7Z F;  2YL0 A;  1WGW A;  2WZF A;  1XZP A;  4NY3 A;  1M2V A;  2Q9C A;  3RQF A;  2D5R B;  4YL3 A;  3UMI A;  4NTB A;  4WGY A;  3NMJ A;  1PD1 A;  4XPW A;  1Z23 A;  4MS2 A;  3T6G B;  3V5X A;  2GA0 A;  2VAS A;  3B9Q A;  1T01 A;  3LEV A;  3FOP A;  3ABM C;  4RD9 A;  1HMO A;  2YL1 A;  3TK0 A;  3UR3 C;  2V3C C;  5CI9 A;  5DQT A;  5DLJ A;  4OIQ F;  4U5E E;  3N0T A;  3W8I A;  4G7O F;  2KNH A;  4YL1 A;  3CSK A;  1IZM A;  2QTV A;  3JRM O;  2HKV A;  2FGY A;  1YA9 A;  3K6B A;  4IAR A;  2ASR A;  1OCC C;  4LDK A;  3K7D A;  3RQE A;  1D1B A;  2PP4 A;  3PMR A;  4CSA C;  1BZ4 A;  2ZXP A;  1ZHX A;  2AWC A;  5T1D B;  4PR9 A;  2Y3H A;  3RFY A;  3V5Y A;  4B6I A;  2LD6 A;  1BR4 A;  1HY5 A;  2AVK A;  2EPN A;  2PX3 A;  4CJO A;  1RCP A;  1B68 A;  1WAS A;  5EGY A;  3PDM P;  1FTS A;  3LAY A;  2YZS A;  2H7B A;  3FOO A;  4CDA A;  3C62 A;  1MMG A;  5KYN A;  1PV3 A;  1CPQ A;  3GM3 A;  4IRU A;  3WOD F;  5KYY A;  1VK5 A;  2TMV P;  2W4M A;  1C17 M;  2L9J A;  4R32 A;  4ANJ A;  2XLM A;  5JVE A;  4LAC B;  2R7T A;  1LE2 A;  3F47 A;  1UG7 A;  1TWH A;  2GAQ A;  5TJ5 E;  3U2M A;  1FNT c;  1ST6 A;  3O6X A;  5IY5 C;  5L0F A;  1J8M F;  4JVS A;  4MND A;  2XM4 A;  2CYD A;  3ECS A;  1OXB A;  3ABL C;  1Q0F A;  3B0P A;  4ZLC A;  4YT5 A;  4O6N A;  3W4Y A;  3NYM A;  3O55 A;  4HFK B;  2IYL D;  3GEI A;  3UNG C;  4BJT A;  1VLS A;  3B29 A;  4P6I C;  2JPU A;  5COG A;  5JUA A;  5KYX B;  4G0H A;  1ZU4 A;  2XS8 A;  1OCO C;  3EFO A;  2YEV A;  3GOR A;  2YKZ A;  2WZG A;  3JT1 A;  4GYT A;  1TWG A;  2XL8 A;  4M63 A;  5JP7 A;  3WHN A;  1E86 A;  4G7H F;  2ZPA A;  5T3T A;  2C04 A;  4JC7 A;  2EIK C;  2LIG A;  3JTL O;  4JTC B;  1Z7Q c;  3X2Q C;  1FAP B;  2Q9B A;  4E17 A;  1J8Y F;  1HMD A;  3GWL A;  3PHF 2;  3RW0 A;  1SYQ A;  2KYH A;  2YLI A;  3DI5 A;  1BDJ B;  1ZU5 A;  3HKK A;  1H9G A;  3W2V A;  2XL6 A;  4E7S A;  3FVY A;  3I4U A;  1K40 A;  1TKN A;  1T5O A;  4CIH A;  3QW1 A;  2XLH A;  5BQH A;  1ORS C;  3EGD B;  3EGX A;  5DS6 A;  2OEV A;  3O10 A;  2P0N A;  1Z63 A;  2QLA A;  2KK1 A;  3ZG1 A;  4H54 A;  3TUL A;  2HUJ A;  2KQ9 A;  1OXK A;  3CAX A;  3K1H A;  4Q7C A;  1CGM E;  1MMN A;  4J7T A;  2Y39 A;  1M57 C;  4YJW A;  2XLW A;  1V55 C;  3G4Z A;  2EIJ C;  5F5F A;  4DRI B;  5JRA A;  1TWA A;  2YRF A;  5L0C A;  1ZHY A;  3EJN A;  1EA8 A;  2KC3 A;  1JAF A;  4YT2 A;  4EUK B;  3IQT A;  1O3U A;  2NUP B;  4MVM A;  1QVX A;  3M1C B;  4YN0 B;  3VYW A;  4DBR A;  1QKR A;  1LI5 A;  1YAU O;  2J0X A;  1HW2 A;  3WG7 C;  4FX5 A;  2W45 A;  3S84 A;  3QVY A;  3RQG A;  1E85 A;  1L3P A;  4XEK A;  3NYL A;  3EG9 A;  1Q0D A;  4XTK A;  5F5H A;  4CSA A;  2V26 A;  3DZA A;  4RDA A;  1NBB A;  2E87 A;  3GAN A;  1NU7 D;  5A6J A;  2OQM A;  2ETS A;  3LES A;  1LVK A;  4WGZ A;  4PAC A;  4Z9J A;  1YA7 O;  3MX3 A;  1Q0K A;  4QDL A;  1T6U A;  5T3W A;  3LUT B;  4JE9 A;  5D91 A;  3HNL A;  3HNI A;  3CZ6 A;  4OIR F;  1C03 A;  3U2L A;  1TWC A;  3N24 A;  5B1B C;  1GQA A;  5FZT A;  2GDC A;  4YK5 A;  4C3E A;  2W4B A;  5COF A;  4WJ0 A;  3NMK A;  1GM5 A;  2B0J A;  4GQH A;  4OIP F;  1ZHT A;  3L8I A;  5B3I A;  4XLP F;  4EBJ A;  2YL3 A;  2X0C A;  3RF3 A;  1OW8 A;  3RKO F;  1QSP A;  2J7P A;  4MVR A;  3H2U A;  3SNH A;  4CS9 C;  4DVY P;  3TJ6 A;  1NSG B;  4CJG A;  3GEH A;  4NQF A;  1LS1 A;  5JLI A;  1QPU A;  1A7D A;  3C8Z A;  3NKE A;  3PCV A;  4G78 A;  4JUR I;  3U8V A;  4C3D A;  2EPL X;  3JYH A;  2Q3T A;  1VB5 A;  2OCC C;  1EQ1 A;  3V7O A;  4P9F A;  3ASO C;  3AQC A;  5E3C A;  4ULW A;  3G50 A;  3S9O A;  1YZA A;  2I15 A;  5DS5 A;  1U89 A;  2HJM A;  2HSQ A;  3ZVR A;  1LKX A;  4FAP B;  1A0B A;  1OCR C;  2M64 A;  2M4E A;  2VCA A;  2YLG A;  2GFH A;  2YL7 A;  3SZR A;  1DOW A;  3I5P A;  5L0H A;  2EIL C;  4MVU A;  2DB4 A;  2W9Y A;  3FAP B;  4MVO A;  2IM8 A;  1WN0 A;  3JCU Q;  4JTA B;  2FAP B;  4O79 A;  1H9T A;  1T6I A;  5A69 A;  1YVI A;  3M15 A;  2Q00 A;  3ZQY A;  5AC4 A;  2OU6 A;  5A6K A;  1CGN A;  2B0H A;  3IQC A;  5KYX A;  3KMI A;  1O5H A;  3JSE O; 
#chains in the Genus database with same CATH homology
 3O10 A;  4NQF A;  3GM2 A;  2KK1 A;  2YWA A;  2JPU A;  2L6F A;  1KTM A;  3TUL A;  1WOL A;  5F28 E;  1WTY A;  2HSB A;  3RQF A;  1K04 A;  3B71 A;  1V4A A;  1PV3 A;  3GM3 A;  1K05 A;  4XEV A;  1JOG A;  3S9O A;  3GM1 A;  1OW6 A;  4R32 A;  3L8J A;  3BRJ A;  3C18 A;  1O3U A;  3U3F A;  2PBE A;  1QVX A;  3JYY A;  1UFB A;  2L6G A;  3C8G B;  3C8G D;  3AJM A;  2LK4 A;  3JZ0 A;  2L6H A;  3L8I A;  4EBJ A;  1KNY A;  1ZZP A;  3U0C A;  3C8G A;  1K40 A;  1WWP A;  1OW8 A;  2JX0 A;  2Q00 A;  4XEF A;  4XEK A;  3RQG A;  3MFN A;  4EBK A;  3RQE A;  3K7D A;  1OW7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...