1K40A

Crystal structure of the fat domain of focal adhesion kinase
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
126
structure length
126
Chain Sequence
b'NDKVYENVTGLVKAVIEMSSKIQPAPPEEYVPMVKEVGLALRTLLATVDETIPALPASTHREIEMAQKLLNSDLGELISKMKLAQQYVMTSLQQEYKKQMLTAAHALAVDAKNLLDVIDQARLKML'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords adhesion kinase
molecule tags Transferase
source organism Mus musculus
publication title The focal adhesion targeting (FAT) region of focal adhesion kinase is a four-helix bundle that binds paxillin
pubmed doi rcsb
total genus 52
structure length 126
sequence length 126
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 2001-10-04
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.330 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Nucleotidyltransferases domain 2 1k40A00
3L8IA 3GM1A 3O10A 4XEKA 4EBKA 2YWAA 3BRJA 3C8GD 2HSBA 3JYYA 3C8GA 4NQFA 3RQEA 2L6GA 1OW7A 2L6FA 3GM2A 3S9OA 1WWPA 1OW6A 3GM3A 2JPUA 2L6HA 1QVXA 2KK1A 2LK4A 2JX0A 1UFBA 3JZ0A 1K40A 3MFNA 1V4AA 1ZZPA 4R32A 1JOGA 3U3FA 4EBJA 5F28E 3K7DA 3C8GB 4XEVA 3RQGA 1OW8A 1KTMA 3RQFA 2Q00A 3C18A 1O3UA 2PBEA 1KNYA 3AJMA 3TULA 3U0CA 4XEFA 3B71A 1WTYA 3L8JA 1K04A 1PV3A 1WOLA 1K05A
chains in the Genus database with same CATH superfamily
1ORYA 4D4NA 2EPOA 5B1BC 2GDCA 3MBGA 3QVZA 1A7VA 2OEXA 3EQLF 5KYXA 1I4ZA 1Y6DA 5T1DB 4MQ9F 1RKEA 4YT4A 2EPNA 2XL4A 4IWBA 5L3VA 1CGOA 2HMZA 5DQZA 3NDBB 1T6IA 3H2UA 3M4CA 3HNIA 3FDQA 2GA0A 4ULVA 5E33A 3T6BA 1E83A 3RF3A 1D0XA 2J0WA 1RKCA 4CX9A 3A11A 5KYYA 5E3AA 4C7OA 4LERA 5IY5C 1ORSC 4QI0A 2PX0A 1I4YA 3FMSA 4JURI 1RJ9B 3JTLO 4XQ1A 1K05A 4P9FA 4U5FE 3UMHA 2YWAA 2NUTA 4CS8C 3I5PA 1OCRC 4N6HA 2XM0A 2LCHA 3AOUA 3HTKC 4MVRA 4NQFA 3Q7LA 3VAYA 3ZTMA 4ULWA 4U5CE 4K0DA 1J8MF 1G4WR 1OXBA 2BE5F 4QDLA 5L0GA 2VCAA 3I4UA 4XLPF 1YAUO 4Z9HA 4KBLA 4PR9A 4I44A 3SP1A 3ZSUA 1M2VB 1VYIA 2L7AA 1Z7Qc 3UGOA 3C8GB 2R7OA 4XEVA 3H65A 5GPGB 3C18A 3AG4C 1F1MA 5A6BA 2PBEA 3AJMA 1OCOC 3E70C 4N4WA 1Q0DA 3W2VA 4MW8A 1Z63A 1V54C 3A9CA 3AGUA 1H7IA 4NTFA 4YK5A 2ETSA 3T9OA 4BJ6C 2YLIA 1UG7A 5F5HA 4BPMA 1TKNA 3O39A 3C8GA 3CSKA 3JRTA 3RKOF 4E7SA 2A68F 2OOCA 5DLJA 2JPUA 3T6GB 5KYUA 3LS1A 3G50A 5DVWA 2L6HA 2A6HF 1EKYA 4EKWA 4B6IA 3OA1A 2NUPA 5KYWB 1VMAA 4JJGA 1BDJB 5BQGA 4CIHA 3V5ZA 5CIVA 4CS7A 1D0YA 2YZSA 2KSFA 5B3IA 1LM3B 1MMDA 4G78A 1T5OA 1OW8A 2XSEA 2Q9CA 4H54A 4YT2A 4Z9JA 1SR2A 1VYKA 4I1MA 3B0UX 4CS9A 4U5BE 1VB5A 4FAPB 3U8PA 2CNWD 1YLMA 4CDYA 4CSAA 1V74B 1NLXA 2Y39A 3DM9B 4JCHA 4NTAA 2GWWA 2OCCC 3M1CB 3TOMA 5KYNA 3L8IA 3ZVRA 2VH3A 4JC7A 1ZHYA 1WGWA 4JZAA 2NUTB 3T4RA 1H6GA 2J46A 2HJ3A 2KJGA 4Q5SF 1M2OA 4YN0B 2HMQA 3RW0A 4BJTA 2YLGA 4C3BA 3MYFA 4JTCB 3GEIA 4KC9A 2CYDA 3IQCA 3WAQA 1TWCA 2XLHA 2IXOA 2Q3TA 3I5QA 4Q7CA 4CIPA 2Z15A 3CZ6A 256BA 2C03A 2L9JA 2WVQA 3FOOA 2ZD9A 4HFFB 1A41A 4PJLA 1D1CA 2OJED 4J7TA 4DVZA 2NSGA 1LE4A 2R7UA 1XZPA 3OWTA 3E9VA 3RYLA 1D0ZA 3DE9A 1JMWA 2AU5A 5E3CA 3DJNB 3K6BA 3DM5A 3W2WA 4ANJA 2HSQA 3AG1C 2IM8A 1D1BA 5AC5A 1ZYRF 2J7PD 4XWJA 1CGME 3ITFA 2L6GA 3CAXA 5COFA 4U5DE 4IAOA 2FAPB 2QLAA 1PD0A 4KNWA 2R03A 5BQIA 3NKDA 5KYUB 2M64A 2BL2A 1FNTc 1VOMA 1BR2A 1H9GA 2ZXPA 3NG1A 4WABA 4FESA 1N1CA 3R7CA 3EJNA 4PJMA 3ECSA 4EIYA 1A0BA 4GQHA 3K7DA 1CPRA 1NFOA 2XS1A 3EH1A 4JTAB 2EPMX 4MNDA 5JSLA 3RFYA 3ZG1A 4RDAA 1H9TA 3U2MA 3U8VA 1O3UA 1KNYA 2FGYA 2HJMA 1OKKD 4IJJA 2OJQA 5E2QA 2H7BA 2J8WA 4JRZA 3DZAA 1GGQA 3F47A 1EQ1A 4DRJB 4DVYP 4XPYA 1BR1A 3FAJA 3KMIA 4C3EA 3C8GD 2A6EF 3JRMO 4IGGA 4JTDB 2EPLX 2CDQA 3RVYA 2D4UA 4XPWA 2QTVA 2G3KA 4UDVA 4MVMA 1ZU4A 1OW7A 4G7OF 1WWPA 3LEVA 3H2VA 3DMDA 3Q7GA 1HMDA 1HE1A 2ZPAA 2YRFA 2LK4A 3BEHA 4J7YA 3JSEO 3SZRA 2DGJA 2MWQA 3GEHA 1ZZPA 1YZAA 2P0NA 1YYXA 2Q4FA 3SXKA 4CDAA 2DYRC 3N24A 1QQ3A 3U9MA 1FTSA 2B0JA 4U5EE 3SXZA 2YVKA 3PDMP 4OIOF 3TULA 1VK5A 2CCYA 3U2LA 4XEFA 5JP7A 3U9JA 1JPNA 2ASRA 3L8JA 4NC3A 1OCCC 3M15A 3AG3C 1E2XA 3GM1A 2P1AA 4L6RA 2HZ8A 1Q0GA 5TJ5E 5D91A 2HSBA 4G0HA 3WHNA 2XRHA 4DXWA 3PHF2 4IRUA 4MW3A 3EPVA 1HMOA 3NYJA 3GORA 1S7ZA 1XZQA 3U5SA 3V5YA 3DAGA 2WZLA 3V5XA 1A7EA 2Q9BA 2Q7RA 3TJ6A 2ZXOA 3NYMA 2YL7A 4Q4ZF 2HKVA 2OQMA 3EGXB 1VLSA 3W8IA 1MNDA 1L3PA 1LIHA 1TWHA 5CI8A 2I8BA 1Z23A 2WVOA 2XLDA 3L34A 2Q9AA 1QZXA 1O87A 4JIOA 3AQCA 4BG0A 3RIPA 4J30B 2R7WA 2J9BA 4MVUA 5COGA 1DOVA 2HV6A 1Q0MA 2XL6A 1D1AA 1OR3A 1U89A 3Q6MA 5EHHA 2R05A 4E18A 5BQHA 3CEXA 2KC3A 3TQOA 3T6JA 4EWCA 4EBBA 2YKZA 1T6UA 3ZC4A 3CQZA 3N0TA 4AE4A 3B0PA 4YT8A 2EPKX 3FVYA 2L81A 4HFKB 3C8ZA 3JYYA 3K1IC 3MYIA 1S05A 5L0IA 4IB4A 2J9WA 4OINF 4P6IC 1AEPA 4HEAJ 1OW6A 5B1AC 2Y3HA 3DE8A 2QUPA 5JUAA 4GEHA 2KK1A 1HY5A 2P61A 2W9YA 3W4YA 2OEVA 2ZXRA 3DD7A 4YWQA 4M63A 1V55C 4BJ1A 3K66A 2UUIA 3NMIA 1LKXA 4K7BA 2D5RB 1KU2A 1LPEA 3KKBA 3ATPA 5A6AA 3K1HA 3DWWA 2Y3BA 3EHMA 2F22A 3EG9A 4JEBA 3HKKA 4MTOA 4MVOA 2TMVP 2E87A 2QNLA 3LS0A 4A2NB 2EIJC 2WVNA 1Q0FA 2J7PA 3IQTA 4YJWA 3UNGC 3B29A 4LACB 1MMNA 1Q0KA 2IXPA 4CS8A 2V3CC 3J06A 4WGZA 5F5FA 2XXAB 1OQCA 4IARA 1E86A 1G8XA 2IXMA 4G7HF 4OD5A 3M79A 1C03A 2L6FA 4NY3A 4MS2A 2YL1A 3LUTB 3SYNA 2NPUA 2GAQA 3ABMC 4HE8D 3ZIBA 1QVXA 2CW0F 2QY9A 4MTFA 1IZMA 1TFOB 1RKEB 4CJOA 2XLWA 2C04A 2R7QA 4E17A 5KYYB 1G4US 4KNVA 1JOGA 1B68A 2XLEA 1WN0A 3GANA 4MVSA 4J32B 5COMA 5JS5A 1RMVA 3JSZA 2XXAA 3Q6NA 5JT4A 1RJ9A 3ABKC 1LI5A 1NU9C 3LJBA 3O55A 3QTHA 2VCBA 4NTBA 3QW1A 5EK0A 4ER9A 5AC4A 3VF0A 2R25A 1AVOB 1ZHXA 3US6A 5L0DA 3FHDA 4MTGA 3EGDA 2CGEA 5A69A 4MVQA 4P9TA 4AL1A 1M6TA 1I5NA 4XEKA 2XLOA 1IW7F 1LS1A 3S28A 1WATA 4AE4B 2AVKA 3S90A 2J45A 1GS9A 1FAPB 2I15A 3PMRA 3RQEA 5KYWA 2R7XA 1CGNA 3LLKA 2Y69C 1ZHZA 1ZHWA 1PD1A 3U3BA 1SYQA 2GFHA 3ZTZA 5L0CA 3NMJA 1YARO 2AWCA 1RXQA 3HNJA 3B9QA 4WJ0A 3JZ0A 5A6BD 3IEEA 3GWLA 1OXKA 1HE9A 1ZVZA 3LNRA 4O6NA 5KYXB 3S84A 4QI2A 2A69F 4EHPA 3G4ZA 5JVEA 5A6JA 2J0XA 1ZU5A 4ONSA 4OD4A 4LLEA 3ZQYA 3UR3C 4DBRA 5DS5A 1YJGA 3IQ5A 4LDKA 1BR4A 1J8YF 2YEVA 2B0HA 4OIPF 2RSEB 4ZLDA 3SXYA 4JKVA 1W2WA 2H7VC 1WOLA 1R5ID 4C7OB 3EHNA 1TQGA 3POVA 4EBKA 3VM6A 2XM4A 2VCCA 5HSWA 2KNHA 2KQ9A 1TFKB 3X2QC 4DRIB 1BZ4A 4RBNA 4YT5A 4JCZA 2X0CA 2R02A 2YL0A 1OKKA 5L3QA 1ST6A 1ZW2A 1QSPA 2VASA 2WZFA 1VLTA 3FOPA 4U9EA 3HJCA 4JE9A 3VYWA 2HS5A 4JW1A 3U3FA 3RVZA 4JVSA 1MMAA 1JPJA 4O79A 4XLNF 2YQYA 4KI2A 2HUJA 1C02A 1NG1A 3LEOA 3IPMO 2YL3A 4F4BA 5D92A 3HNKA 1LE2A 4A4AA 1SMYF 4U5GA 2R7TA 2V26A 1Z3IX 4FWVA 3DXJF 2PP4A 2LFFA 2PNOA 2R7SA 2R7RA 3F46A 1E85A 2LD6A 3AQBA 2P6VA 4O6MA 4PJNA 3LESA 4YL1A 1T6QA 3EZIA 5DS6A 4IAQA 1A7DA 3VRCA 1APCA 2EILC 2EINC 2XS8A 3LLIA 1PCXA 3KYJA 3WG7C 4YL3A 1SZIA 1K40A 3HLZA 3G4XA 3KYIA 3L0IA 1FFTC 3EZHA 3L1MA 3WODF 3DKAA 1R4TA 1ZHTA 4CJGA 3TK0A 2LP4A 1FR0A 2DYSC 1G5ZA 3QMKA 2RD9A 2LFDA 5DQTA 2NUPB 3ASOC 3LAYA 4N6CA 3SNHA 3KPHA 2YLDA 3AGTA 2KGOA 3S27A 1YYJA 3IHUA 2A1DD 2VC9A 3K33A 1K04A 1SF8A 2IOQA 2OU6A 2Y3DA 4K1OA 4U9DA 3UMIA 5AGFA 3X1OA 1OR2A 1OCZC 5EGYA 1MNEA 2PFDA 4Z9IA 5FCLA 4EUKB 4N06A 1GM5A 4AK9A 4BJ5C 1Z5ZA 1JAFA 4CBEA 2P7VA 1M56C 4BEJA 1UFBA 5HV9A 2DI3A 4JEAA 3MFNA 2XLVA 4G7ZF 1YDIA 4CSAC 3O6XA 4E0HA 1TWAA 4R32A 4CS9C 1NBBA 4I3MA 2H8AA 5F28E 3SEOA 4WGYA 3GEEA 5L0FA 4O6YA 4X0RA 3C63A 2W4BA 3S29A 4NCQA 4CDVA 1JRAA 1C17M 2J9VA 2IXNA 3GWNA 1O5HA 3SXMA 3JCUQ 2NSFA 3PCVA 4W8KA 5T3WA 1ZW3A 3GODA 5K0IA 3BRJA 3LNMB 2W45A 2XLMA 2OKUA 1EA8A 4PFPA 1NFNA 3QW0A 3GM3A 2QE9A 1WASA 2VB6A 2XL8A 2JD3A 5BUOA 4MVZA 5L0HA 4AX2A 1T9KA 3B0VC 3QZCA 1U0BB 3C7JA 3NYLA 1VTMP 1YVIA 1ORJA 4JJFA 2EIMC 3OEOA 5CI9A 3FAPB 3RQGA 1KTMA 1AUEA 3TJ5A 1FMVA 1Y4CA 3RQFA 4C3DA 1BBHA 2A0BA 3TD7A 2AWYA 1FFHA 2NG1A 3B71A 2H7OA 4LDQA 4E0IA 4BJ6A 3DAFA 1LS4A 4YL0A 2WL8A 4LDRA 2PF4E 2MHRA 2BC5A 4U5HA 3QVYA 4ZLCA 2KW3C 2Y3GA 1JR8A 3KH2A 4DBQA 3HNLA 1QKRA 1LVKA 3GM2A 3NRHA 4PFOA 1YA7O 2ICWG 1RCPA 2LIGA 4O7GA 3UGPA 4LLCA 5JLIA 2M4EA 2UUHA 1XWJA 2MYSA 3JYHA 4GYTA 3W8HA 4AL0A 1HW2A 2FFHA 1L7CA 3ASNC 1V4AA 1FMWA 1YA9A 2A0UA 2PX3A 1TWGA 3EFOA 2AP3A 3DI5A 3EG9B 3V7OA 4XPXA 4EBJA 3KL4A 3MX3A 3NMKA 2Q00A 4XTKA 3ZWIA 3EGXA 1MMGA 2EIKC 5T3TA 3U0CA 2ZXWC 4BEMJ 1WTYA 3S0XA 1MQVA 4DJ9A 2YHSA 1CPQA 4H4KC 2WZGA 3ABLC 1PV3A 5A6KA 3K1IA 2O9XA 2HFIA 2KYHA 1Z6AA 3O10A 3RH3A 3TOLA 1NZEA 3N2ZB 4DOZA 3EFOB 3FXHA 4OIQF 1YZCA 5JRAA 5FZTA 1EI7A 2R7VA 3S9OA 2LQGA 4FX5A 1QLEC 4PJJA 3UMKA 1E84A 2LSEA 4PACA 2CNWA 1U6HA 3C62A 1GQAA 2JX0A 1M57C 2W4MA 2G3VA 1QPUA 1TR2A 2IBFA 3NKEA 1NSGB 2G62A 1M2VA 3IQ6A 2J9UA 4RD9A 1T01A 3ZDLA 2X51A 5L0JA 3MLGA 3EGDB 4W8PA 5B3SC 5DS4A 4DRHB 2R9RB 4D4XA 3ZQVA 3AG2C 2WB7A 3R2PA 2OG2A 4OIRF 2DB4A 4PK4A 2IYLD 1NU7D 1LI7A 1DOWA 3M4BA 4I1OB 1HW1A 3JT1A 4E7ZA 2HV7A 3DJUB 3EH2A 4BJ5A
chains in the Genus database with same CATH topology
3L8IA 3GM1A 3O10A 4XEKA 4EBKA 2YWAA 3BRJA 3C8GD 2HSBA 3JYYA 3C8GA 4NQFA 3RQEA 2L6GA 1OW7A 2L6FA 3GM2A 3S9OA 1WWPA 1OW6A 3GM3A 2JPUA 2L6HA 1QVXA 2KK1A 2LK4A 2JX0A 1UFBA 3JZ0A 1K40A 3MFNA 1V4AA 1ZZPA 4R32A 1JOGA 3U3FA 4EBJA 5F28E 3K7DA 3C8GB 4XEVA 3RQGA 1OW8A 1KTMA 3RQFA 2Q00A 3C18A 1O3UA 2PBEA 1KNYA 3AJMA 3TULA 3U0CA 4XEFA 3B71A 1WTYA 3L8JA 1K04A 1PV3A 1WOLA 1K05A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3L8I A;  3GM1 A;  3O10 A;  4XEK A;  4EBK A;  2YWA A;  3BRJ A;  3C8G D;  2HSB A;  3JYY A;  3C8G A;  4NQF A;  3RQE A;  2L6G A;  1OW7 A;  2L6F A;  3GM2 A;  3S9O A;  1WWP A;  1OW6 A;  3GM3 A;  2JPU A;  2L6H A;  1QVX A;  2KK1 A;  2LK4 A;  2JX0 A;  1UFB A;  3JZ0 A;  1K40 A;  3MFN A;  1V4A A;  1ZZP A;  4R32 A;  1JOG A;  3U3F A;  4EBJ A;  5F28 E;  3K7D A;  3C8G B;  4XEV A;  3RQG A;  1OW8 A;  1KTM A;  3RQF A;  2Q00 A;  3C18 A;  1O3U A;  2PBE A;  1KNY A;  3AJM A;  3TUL A;  3U0C A;  4XEF A;  3B71 A;  1WTY A;  3L8J A;  1K04 A;  1PV3 A;  1WOL A;  1K05 A; 
#chains in the Genus database with same CATH topology
 1ORY A;  4D4N A;  2EPO A;  5B1B C;  2GDC A;  3MBG A;  3QVZ A;  1A7V A;  2OEX A;  3EQL F;  5KYX A;  1I4Z A;  1Y6D A;  5T1D B;  4MQ9 F;  1RKE A;  4YT4 A;  2EPN A;  2XL4 A;  4IWB A;  5L3V A;  1CGO A;  2HMZ A;  5DQZ A;  3NDB B;  1T6I A;  3H2U A;  3M4C A;  3HNI A;  3FDQ A;  2GA0 A;  4ULV A;  5E33 A;  3T6B A;  1E83 A;  3RF3 A;  1D0X A;  2J0W A;  1RKC A;  4CX9 A;  3A11 A;  5KYY A;  5E3A A;  4C7O A;  4LER A;  5IY5 C;  1ORS C;  4QI0 A;  2PX0 A;  1I4Y A;  3FMS A;  4JUR I;  1RJ9 B;  3JTL O;  4XQ1 A;  1K05 A;  4P9F A;  4U5F E;  3UMH A;  2YWA A;  2NUT A;  4CS8 C;  3I5P A;  1OCR C;  4N6H A;  2XM0 A;  2LCH A;  3AOU A;  3HTK C;  4MVR A;  4NQF A;  3Q7L A;  3VAY A;  3ZTM A;  4ULW A;  4U5C E;  4K0D A;  1J8M F;  1G4W R;  1OXB A;  2BE5 F;  4QDL A;  5L0G A;  2VCA A;  3I4U A;  4XLP F;  1YAU O;  4Z9H A;  4KBL A;  4PR9 A;  4I44 A;  3SP1 A;  3ZSU A;  1M2V B;  1VYI A;  2L7A A;  1Z7Q c;  3UGO A;  3C8G B;  2R7O A;  4XEV A;  3H65 A;  5GPG B;  3C18 A;  3AG4 C;  1F1M A;  5A6B A;  2PBE A;  3AJM A;  1OCO C;  3E70 C;  4N4W A;  1Q0D A;  3W2V A;  4MW8 A;  1Z63 A;  1V54 C;  3A9C A;  3AGU A;  1H7I A;  4NTF A;  4YK5 A;  2ETS A;  3T9O A;  4BJ6 C;  2YLI A;  1UG7 A;  5F5H A;  4BPM A;  1TKN A;  3O39 A;  3C8G A;  3CSK A;  3JRT A;  3RKO F;  4E7S A;  2A68 F;  2OOC A;  5DLJ A;  2JPU A;  3T6G B;  5KYU A;  3LS1 A;  3G50 A;  5DVW A;  2L6H A;  2A6H F;  1EKY A;  4EKW A;  4B6I A;  3OA1 A;  2NUP A;  5KYW B;  1VMA A;  4JJG A;  1BDJ B;  5BQG A;  4CIH A;  3V5Z A;  5CIV A;  4CS7 A;  1D0Y A;  2YZS A;  2KSF A;  5B3I A;  1LM3 B;  1MMD A;  4G78 A;  1T5O A;  1OW8 A;  2XSE A;  2Q9C A;  4H54 A;  4YT2 A;  4Z9J A;  1SR2 A;  1VYK A;  4I1M A;  3B0U X;  4CS9 A;  4U5B E;  1VB5 A;  4FAP B;  3U8P A;  2CNW D;  1YLM A;  4CDY A;  4CSA A;  1V74 B;  1NLX A;  2Y39 A;  3DM9 B;  4JCH A;  4NTA A;  2GWW A;  2OCC C;  3M1C B;  3TOM A;  5KYN A;  3L8I A;  3ZVR A;  2VH3 A;  4JC7 A;  1ZHY A;  1WGW A;  4JZA A;  2NUT B;  3T4R A;  1H6G A;  2J46 A;  2HJ3 A;  2KJG A;  4Q5S F;  1M2O A;  4YN0 B;  2HMQ A;  3RW0 A;  4BJT A;  2YLG A;  4C3B A;  3MYF A;  4JTC B;  3GEI A;  4KC9 A;  2CYD A;  3IQC A;  3WAQ A;  1TWC A;  2XLH A;  2IXO A;  2Q3T A;  3I5Q A;  4Q7C A;  4CIP A;  2Z15 A;  3CZ6 A;  256B A;  2C03 A;  2L9J A;  2WVQ A;  3FOO A;  2ZD9 A;  4HFF B;  1A41 A;  4PJL A;  1D1C A;  2OJE D;  4J7T A;  4DVZ A;  2NSG A;  1LE4 A;  2R7U A;  1XZP A;  3OWT A;  3E9V A;  3RYL A;  1D0Z A;  3DE9 A;  1JMW A;  2AU5 A;  5E3C A;  3DJN B;  3K6B A;  3DM5 A;  3W2W A;  4ANJ A;  2HSQ A;  3AG1 C;  2IM8 A;  1D1B A;  5AC5 A;  1ZYR F;  2J7P D;  4XWJ A;  1CGM E;  3ITF A;  2L6G A;  3CAX A;  5COF A;  4U5D E;  4IAO A;  2FAP B;  2QLA A;  1PD0 A;  4KNW A;  2R03 A;  5BQI A;  3NKD A;  5KYU B;  2M64 A;  2BL2 A;  1FNT c;  1VOM A;  1BR2 A;  1H9G A;  2ZXP A;  3NG1 A;  4WAB A;  4FES A;  1N1C A;  3R7C A;  3EJN A;  4PJM A;  3ECS A;  4EIY A;  1A0B A;  4GQH A;  3K7D A;  1CPR A;  1NFO A;  2XS1 A;  3EH1 A;  4JTA B;  2EPM X;  4MND A;  5JSL A;  3RFY A;  3ZG1 A;  4RDA A;  1H9T A;  3U2M A;  3U8V A;  1O3U A;  1KNY A;  2FGY A;  2HJM A;  1OKK D;  4IJJ A;  2OJQ A;  5E2Q A;  2H7B A;  2J8W A;  4JRZ A;  3DZA A;  1GGQ A;  3F47 A;  1EQ1 A;  4DRJ B;  4DVY P;  4XPY A;  1BR1 A;  3FAJ A;  3KMI A;  4C3E A;  3C8G D;  2A6E F;  3JRM O;  4IGG A;  4JTD B;  2EPL X;  2CDQ A;  3RVY A;  2D4U A;  4XPW A;  2QTV A;  2G3K A;  4UDV A;  4MVM A;  1ZU4 A;  1OW7 A;  4G7O F;  1WWP A;  3LEV A;  3H2V A;  3DMD A;  3Q7G A;  1HMD A;  1HE1 A;  2ZPA A;  2YRF A;  2LK4 A;  3BEH A;  4J7Y A;  3JSE O;  3SZR A;  2DGJ A;  2MWQ A;  3GEH A;  1ZZP A;  1YZA A;  2P0N A;  1YYX A;  2Q4F A;  3SXK A;  4CDA A;  2DYR C;  3N24 A;  1QQ3 A;  3U9M A;  1FTS A;  2B0J A;  4U5E E;  3SXZ A;  2YVK A;  3PDM P;  4OIO F;  3TUL A;  1VK5 A;  2CCY A;  3U2L A;  4XEF A;  5JP7 A;  3U9J A;  1JPN A;  2ASR A;  3L8J A;  4NC3 A;  1OCC C;  3M15 A;  3AG3 C;  1E2X A;  3GM1 A;  2P1A A;  4L6R A;  2HZ8 A;  1Q0G A;  5TJ5 E;  5D91 A;  2HSB A;  4G0H A;  3WHN A;  2XRH A;  4DXW A;  3PHF 2;  4IRU A;  4MW3 A;  3EPV A;  1HMO A;  3NYJ A;  3GOR A;  1S7Z A;  1XZQ A;  3U5S A;  3V5Y A;  3DAG A;  2WZL A;  3V5X A;  1A7E A;  2Q9B A;  2Q7R A;  3TJ6 A;  2ZXO A;  3NYM A;  2YL7 A;  4Q4Z F;  2HKV A;  2OQM A;  3EGX B;  1VLS A;  3W8I A;  1MND A;  1L3P A;  1LIH A;  1TWH A;  5CI8 A;  2I8B A;  1Z23 A;  2WVO A;  2XLD A;  3L34 A;  2Q9A A;  1QZX A;  1O87 A;  4JIO A;  3AQC A;  4BG0 A;  3RIP A;  4J30 B;  2R7W A;  2J9B A;  4MVU A;  5COG A;  1DOV A;  2HV6 A;  1Q0M A;  2XL6 A;  1D1A A;  1OR3 A;  1U89 A;  3Q6M A;  5EHH A;  2R05 A;  4E18 A;  5BQH A;  3CEX A;  2KC3 A;  3TQO A;  3T6J A;  4EWC A;  4EBB A;  2YKZ A;  1T6U A;  3ZC4 A;  3CQZ A;  3N0T A;  4AE4 A;  3B0P A;  4YT8 A;  2EPK X;  3FVY A;  2L81 A;  4HFK B;  3C8Z A;  3JYY A;  3K1I C;  3MYI A;  1S05 A;  5L0I A;  4IB4 A;  2J9W A;  4OIN F;  4P6I C;  1AEP A;  4HEA J;  1OW6 A;  5B1A C;  2Y3H A;  3DE8 A;  2QUP A;  5JUA A;  4GEH A;  2KK1 A;  1HY5 A;  2P61 A;  2W9Y A;  3W4Y A;  2OEV A;  2ZXR A;  3DD7 A;  4YWQ A;  4M63 A;  1V55 C;  4BJ1 A;  3K66 A;  2UUI A;  3NMI A;  1LKX A;  4K7B A;  2D5R B;  1KU2 A;  1LPE A;  3KKB A;  3ATP A;  5A6A A;  3K1H A;  3DWW A;  2Y3B A;  3EHM A;  2F22 A;  3EG9 A;  4JEB A;  3HKK A;  4MTO A;  4MVO A;  2TMV P;  2E87 A;  2QNL A;  3LS0 A;  4A2N B;  2EIJ C;  2WVN A;  1Q0F A;  2J7P A;  3IQT A;  4YJW A;  3UNG C;  3B29 A;  4LAC B;  1MMN A;  1Q0K A;  2IXP A;  4CS8 A;  2V3C C;  3J06 A;  4WGZ A;  5F5F A;  2XXA B;  1OQC A;  4IAR A;  1E86 A;  1G8X A;  2IXM A;  4G7H F;  4OD5 A;  3M79 A;  1C03 A;  2L6F A;  4NY3 A;  4MS2 A;  2YL1 A;  3LUT B;  3SYN A;  2NPU A;  2GAQ A;  3ABM C;  4HE8 D;  3ZIB A;  1QVX A;  2CW0 F;  2QY9 A;  4MTF A;  1IZM A;  1TFO B;  1RKE B;  4CJO A;  2XLW A;  2C04 A;  2R7Q A;  4E17 A;  5KYY B;  1G4U S;  4KNV A;  1JOG A;  1B68 A;  2XLE A;  1WN0 A;  3GAN A;  4MVS A;  4J32 B;  5COM A;  5JS5 A;  1RMV A;  3JSZ A;  2XXA A;  3Q6N A;  5JT4 A;  1RJ9 A;  3ABK C;  1LI5 A;  1NU9 C;  3LJB A;  3O55 A;  3QTH A;  2VCB A;  4NTB A;  3QW1 A;  5EK0 A;  4ER9 A;  5AC4 A;  3VF0 A;  2R25 A;  1AVO B;  1ZHX A;  3US6 A;  5L0D A;  3FHD A;  4MTG A;  3EGD A;  2CGE A;  5A69 A;  4MVQ A;  4P9T A;  4AL1 A;  1M6T A;  1I5N A;  4XEK A;  2XLO A;  1IW7 F;  1LS1 A;  3S28 A;  1WAT A;  4AE4 B;  2AVK A;  3S90 A;  2J45 A;  1GS9 A;  1FAP B;  2I15 A;  3PMR A;  3RQE A;  5KYW A;  2R7X A;  1CGN A;  3LLK A;  2Y69 C;  1ZHZ A;  1ZHW A;  1PD1 A;  3U3B A;  1SYQ A;  2GFH A;  3ZTZ A;  5L0C A;  3NMJ A;  1YAR O;  2AWC A;  1RXQ A;  3HNJ A;  3B9Q A;  4WJ0 A;  3JZ0 A;  5A6B D;  3IEE A;  3GWL A;  1OXK A;  1HE9 A;  1ZVZ A;  3LNR A;  4O6N A;  5KYX B;  3S84 A;  4QI2 A;  2A69 F;  4EHP A;  3G4Z A;  5JVE A;  5A6J A;  2J0X A;  1ZU5 A;  4ONS A;  4OD4 A;  4LLE A;  3ZQY A;  3UR3 C;  4DBR A;  5DS5 A;  1YJG A;  3IQ5 A;  4LDK A;  1BR4 A;  1J8Y F;  2YEV A;  2B0H A;  4OIP F;  2RSE B;  4ZLD A;  3SXY A;  4JKV A;  1W2W A;  2H7V C;  1WOL A;  1R5I D;  4C7O B;  3EHN A;  1TQG A;  3POV A;  4EBK A;  3VM6 A;  2XM4 A;  2VCC A;  5HSW A;  2KNH A;  2KQ9 A;  1TFK B;  3X2Q C;  4DRI B;  1BZ4 A;  4RBN A;  4YT5 A;  4JCZ A;  2X0C A;  2R02 A;  2YL0 A;  1OKK A;  5L3Q A;  1ST6 A;  1ZW2 A;  1QSP A;  2VAS A;  2WZF A;  1VLT A;  3FOP A;  4U9E A;  3HJC A;  4JE9 A;  3VYW A;  2HS5 A;  4JW1 A;  3U3F A;  3RVZ A;  4JVS A;  1MMA A;  1JPJ A;  4O79 A;  4XLN F;  2YQY A;  4KI2 A;  2HUJ A;  1C02 A;  1NG1 A;  3LEO A;  3IPM O;  2YL3 A;  4F4B A;  5D92 A;  3HNK A;  1LE2 A;  4A4A A;  1SMY F;  4U5G A;  2R7T A;  2V26 A;  1Z3I X;  4FWV A;  3DXJ F;  2PP4 A;  2LFF A;  2PNO A;  2R7S A;  2R7R A;  3F46 A;  1E85 A;  2LD6 A;  3AQB A;  2P6V A;  4O6M A;  4PJN A;  3LES A;  4YL1 A;  1T6Q A;  3EZI A;  5DS6 A;  4IAQ A;  1A7D A;  3VRC A;  1APC A;  2EIL C;  2EIN C;  2XS8 A;  3LLI A;  1PCX A;  3KYJ A;  3WG7 C;  4YL3 A;  1SZI A;  1K40 A;  3HLZ A;  3G4X A;  3KYI A;  3L0I A;  1FFT C;  3EZH A;  3L1M A;  3WOD F;  3DKA A;  1R4T A;  1ZHT A;  4CJG A;  3TK0 A;  2LP4 A;  1FR0 A;  2DYS C;  1G5Z A;  3QMK A;  2RD9 A;  2LFD A;  5DQT A;  2NUP B;  3ASO C;  3LAY A;  4N6C A;  3SNH A;  3KPH A;  2YLD A;  3AGT A;  2KGO A;  3S27 A;  1YYJ A;  3IHU A;  2A1D D;  2VC9 A;  3K33 A;  1K04 A;  1SF8 A;  2IOQ A;  2OU6 A;  2Y3D A;  4K1O A;  4U9D A;  3UMI A;  5AGF A;  3X1O A;  1OR2 A;  1OCZ C;  5EGY A;  1MNE A;  2PFD A;  4Z9I A;  5FCL A;  4EUK B;  4N06 A;  1GM5 A;  4AK9 A;  4BJ5 C;  1Z5Z A;  1JAF A;  4CBE A;  2P7V A;  1M56 C;  4BEJ A;  1UFB A;  5HV9 A;  2DI3 A;  4JEA A;  3MFN A;  2XLV A;  4G7Z F;  1YDI A;  4CSA C;  3O6X A;  4E0H A;  1TWA A;  4R32 A;  4CS9 C;  1NBB A;  4I3M A;  2H8A A;  5F28 E;  3SEO A;  4WGY A;  3GEE A;  5L0F A;  4O6Y A;  4X0R A;  3C63 A;  2W4B A;  3S29 A;  4NCQ A;  4CDV A;  1JRA A;  1C17 M;  2J9V A;  2IXN A;  3GWN A;  1O5H A;  3SXM A;  3JCU Q;  2NSF A;  3PCV A;  4W8K A;  5T3W A;  1ZW3 A;  3GOD A;  5K0I A;  3BRJ A;  3LNM B;  2W45 A;  2XLM A;  2OKU A;  1EA8 A;  4PFP A;  1NFN A;  3QW0 A;  3GM3 A;  2QE9 A;  1WAS A;  2VB6 A;  2XL8 A;  2JD3 A;  5BUO A;  4MVZ A;  5L0H A;  4AX2 A;  1T9K A;  3B0V C;  3QZC A;  1U0B B;  3C7J A;  3NYL A;  1VTM P;  1YVI A;  1ORJ A;  4JJF A;  2EIM C;  3OEO A;  5CI9 A;  3FAP B;  3RQG A;  1KTM A;  1AUE A;  3TJ5 A;  1FMV A;  1Y4C A;  3RQF A;  4C3D A;  1BBH A;  2A0B A;  3TD7 A;  2AWY A;  1FFH A;  2NG1 A;  3B71 A;  2H7O A;  4LDQ A;  4E0I A;  4BJ6 A;  3DAF A;  1LS4 A;  4YL0 A;  2WL8 A;  4LDR A;  2PF4 E;  2MHR A;  2BC5 A;  4U5H A;  3QVY A;  4ZLC A;  2KW3 C;  2Y3G A;  1JR8 A;  3KH2 A;  4DBQ A;  3HNL A;  1QKR A;  1LVK A;  3GM2 A;  3NRH A;  4PFO A;  1YA7 O;  2ICW G;  1RCP A;  2LIG A;  4O7G A;  3UGP A;  4LLC A;  5JLI A;  2M4E A;  2UUH A;  1XWJ A;  2MYS A;  3JYH A;  4GYT A;  3W8H A;  4AL0 A;  1HW2 A;  2FFH A;  1L7C A;  3ASN C;  1V4A A;  1FMW A;  1YA9 A;  2A0U A;  2PX3 A;  1TWG A;  3EFO A;  2AP3 A;  3DI5 A;  3EG9 B;  3V7O A;  4XPX A;  4EBJ A;  3KL4 A;  3MX3 A;  3NMK A;  2Q00 A;  4XTK A;  3ZWI A;  3EGX A;  1MMG A;  2EIK C;  5T3T A;  3U0C A;  2ZXW C;  4BEM J;  1WTY A;  3S0X A;  1MQV A;  4DJ9 A;  2YHS A;  1CPQ A;  4H4K C;  2WZG A;  3ABL C;  1PV3 A;  5A6K A;  3K1I A;  2O9X A;  2HFI A;  2KYH A;  1Z6A A;  3O10 A;  3RH3 A;  3TOL A;  1NZE A;  3N2Z B;  4DOZ A;  3EFO B;  3FXH A;  4OIQ F;  1YZC A;  5JRA A;  5FZT A;  1EI7 A;  2R7V A;  3S9O A;  2LQG A;  4FX5 A;  1QLE C;  4PJJ A;  3UMK A;  1E84 A;  2LSE A;  4PAC A;  2CNW A;  1U6H A;  3C62 A;  1GQA A;  2JX0 A;  1M57 C;  2W4M A;  2G3V A;  1QPU A;  1TR2 A;  2IBF A;  3NKE A;  1NSG B;  2G62 A;  1M2V A;  3IQ6 A;  2J9U A;  4RD9 A;  1T01 A;  3ZDL A;  2X51 A;  5L0J A;  3MLG A;  3EGD B;  4W8P A;  5B3S C;  5DS4 A;  4DRH B;  2R9R B;  4D4X A;  3ZQV A;  3AG2 C;  2WB7 A;  3R2P A;  2OG2 A;  4OIR F;  2DB4 A;  4PK4 A;  2IYL D;  1NU7 D;  1LI7 A;  1DOW A;  3M4B A;  4I1O B;  1HW1 A;  3JT1 A;  4E7Z A;  2HV7 A;  3DJU B;  3EH2 A;  4BJ5 A; 
#chains in the Genus database with same CATH homology
 3L8I A;  3GM1 A;  3O10 A;  4XEK A;  4EBK A;  2YWA A;  3BRJ A;  3C8G D;  2HSB A;  3JYY A;  3C8G A;  4NQF A;  3RQE A;  2L6G A;  1OW7 A;  2L6F A;  3GM2 A;  3S9O A;  1WWP A;  1OW6 A;  3GM3 A;  2JPU A;  2L6H A;  1QVX A;  2KK1 A;  2LK4 A;  2JX0 A;  1UFB A;  3JZ0 A;  1K40 A;  3MFN A;  1V4A A;  1ZZP A;  4R32 A;  1JOG A;  3U3F A;  4EBJ A;  5F28 E;  3K7D A;  3C8G B;  4XEV A;  3RQG A;  1OW8 A;  1KTM A;  3RQF A;  2Q00 A;  3C18 A;  1O3U A;  2PBE A;  1KNY A;  3AJM A;  3TUL A;  3U0C A;  4XEF A;  3B71 A;  1WTY A;  3L8J A;  1K04 A;  1PV3 A;  1WOL A;  1K05 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...