1K41A

Crystal structure of ksi y57s mutant
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
125
structure length
121
Chain Sequence
NLPTAQEVQGLMARYIELVDVGDIEAIVQMYADDATVEDPFGQPPIHGREQIAAFSRQGKVRACLTGPVRASHNGCGAMPFRVEMVWNGQPCALDVIDVMRFDEHGRIQTMQAYWSEVNLS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ketosteroid Isomerase
publication title Maintenance of alpha-helical structures by phenyl rings in the active-site tyrosine triad contributes to catalysis and stability of ketosteroid isomerase from Pseudomonas putida biotype B
pubmed doi rcsb
source organism Pseudomonas putida
molecule tags Isomerase
total genus 31
structure length 121
sequence length 125
chains with identical sequence B
ec nomenclature ec 5.3.3.1: Steroid Delta-isomerase.
pdb deposition date 2001-10-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12680 SnoaL_2 SnoaL-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.50 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 1k41A00
1Z1SA 3CNXA 3OWYA 4LMIA 2CKFB 2CHCA 5BXQA 5AIFA 3T8NA 5FW5A 3VSYA 4XDWA 1TP6A 3OWSA 1JKGB 3FH1A 3GZXB 3EF8A 7STDA 3OX9A 1OH0A 1ASKA 3I0YA 4WWUC 3F7SA 3KE7A 1GY5A 1JB2A 3EN8A 1C7HA 1Q40B 3BB9A 1EG9B 2I9WA 2GXFA 1QMAA 1O7MB 3GRDA 1OCVA 3FGYA 1ULIB 4FCJA 1W01A 3MG2A 5JPUA 4HVNA 1S5AA 3DXOA 3FZWA 1A2KA 3KZTA 3VGNA 2HMLB 3G8ZA 3FF0A 3B4OA 1W02A 1UUVB 3JUNA 4HM2B 2RFRA 1W6YA 3GZRA 3FKAA 3F7XA 1ZX2A 1NDOB 2HMOB 3S5CA 1O7NB 2GBWB 4KVHA 5HGRA 4XB5A 2HMMB 2GEXA 5CK6A 5IG0A 4HM1B 4GB5A 5AEWB 2JQ5A 1JKGA 3EJVA 5KP1A 4XDVA 3EBYA 3NM2A 3GZBA 4J9AA 1GS3A 3BLZA 4HM4B 1OHPA 2RCDA 1IDPA 1U5OA 1ISKA 5AEUB 3DMCA 1GYBA 4R9KA 3MYTA 1Q40A 4LEHA 4HM3B 1DMQA 5CXOA 3Q90A 1OGXA 1O7PB 2BMOB 3JUPA 5IG3A 1GY7A 5EVHA 4HZBB 1OUNA 4HJLB 3CNMA 1ULJB 2F86B 3CPOA 2F98A 3NUVA 3K0ZA 1OF5B 3EHCA 1E3RA 3EQQB 5IG4A 3NBRA 5AIGA 3DM8A 4WYKA 5KP4A 3G0KA 1CQSA 3K7CA 1OPYA 5STDA 1Q42A 2YFJB 4HM0B 1JN5B 1SJWA 5AIIA 4PEJA 4HM5B 2XRXB 5AI1A 3KSPA 3ROBA 5D82A 3M8CA 4STDA 3SOYA 1QJGA 2GBXB 5TGNA 3WMDA 2B24B 2STDA 3T8UA 3OV4A 3B4PA 2Z77A 3OWUA 2RGQA 3MG1A 3SOAA 2GEYA 4Q53A 1JB5A 1OF5A 5AIHA 4J8TA 3HK4A 2IMJA 5JPPA 4H3UA 3D9RA 4XBXA 3NXJA 4R1KA 3F8HA 1O7WB 1WQLB 4U13A 4HM7B 1DMNA 1UUWB 1JN5A 4OVMA 3LYGA 3EX9A 3OXAA 2QIYA 3NV0B 4LGQA 1TUHA 4XM4A 4MJDA 4WP5A 1JB4A 1W00A 1OGZA 4OUQA 3DUKA 3JUMA 4FCMA 3CU3A 3EBTA 3FLJA 5DRVA 2INXA 5IG5A 3F14A 3HX8A 2HMNB 5IEOA 1NU3A 3E99A 3SEDA 1VZZA 3KKGA 1NWWA 2BMRB 2A15A 3JUOA 5KP3A 3RGAA 1E3VA 3F8XA 2XR8B 4L8PA 2OWPA 2R4IA 3DZLA 3LZAA 4RZMA 3F9SA 3MSOA 8CHOA 4ORLA 4L7KA 3EN1B 3F40A 5CF2A 1O7HB 3NHXA 2HMJB 3IPTA 2Z7AA 2Z76A 3FF2A 5D83A 3NV0A 2K54A 3B7CA 2YFLB 4K1VA 1ZO2A 2W2CA 1K41A 4XBYA 3B8LA 3MKIA 5CLKA 5DREA 5IF6A 1AR0A 4R9LA 3ECFA 4HM6B 1STDA 4IIAA 1O7GB 3GWRA 4HKVB 3ER7A 4I4KA 2HMKB 4L8OA 4WYKB 1DMMA 3EC9A 2BMQB 5IENA 4X2OA 3UJMA 3H51A 1HKXA 4HZ9B 3STDA 1OHOA 4N3VA 1E97A 5G2GA 2UX0A 5IEPA 2YFIB 4CDLA 3RGRA 5CF1A 6STDA 5BVBA 3MG3A 3MHEA 3G16A 3UNLA 1EA2A 2XSOB 2XSHB 2PZVA 1GY6A 2B1XB 3JUQA 3H3HA 2F99A 1BUQA 3FSDA 4K1UA 4XBTA 5D81A 3GZYB 3HZPA 1OHSA 2BNGA 3A76A 5IERA 4X2HA 4HM8B 2QGUA
chains in the Genus database with same CATH superfamily
1VQ53 1GMPA 2CFLA 4MMXB 3G6E3 1IT7A 1HZ1A 1Z1SA 1RN4A 1UDII 2FGTA 3CNXA 3OWYA 4LMIA 1TRPA 3NM7A 2CKFB 3N8BA 2O3OA 3RNTA 2CHCA 1BSCA 3KCHA 1W7CA 1VQ73 1A67A 3FG1A 5BXQA 1YIJ3 4LYLB 1FGRA 5AIFA 5GSPA 1N9JA 3FCSB 5FW5A 4XDWA 3T8NA 1TP6A 1I2EA 2UGIA 3OWSA 1JKGB 1KC84 1I8VA 3FH1A 1B2ZA 3CD63 1RDSA 3GZXB 2W03A 3EF8A 7STDA 3OX9A 3CXC2 1OH0A 3WA2X 1B21A 2W56A 3QRDA 3X3XA 1QVF2 1RKYA 1RGAA 1ASKA 3K63A 1YHQ3 2GU3A 3ALAA 2MC8A 1BNSA 3I0YA 1YIT3 4WWUC 5M1AA 1RJOA 1W6CA 1M1XB 1WMPA 1UCKA 2H0HA 1FGTA 2CFDA 3F7SA 3KE7A 5AYSC 3CME3 3D4AA 1GY5A 1FGMA 3WOEB 1JB2A 1HU9A 2OCTA 3AMOB 3EN8A 3X41A 3CCL3 2SBLA 2QA43 1BOXA 1C7HA 2Y73A 2OTL3 2ZA4A 3DGMA 1JJ22 2RNTA 3LTBA 1MOLA 4IPBA 2AAEA 1K734 1Q40B 2R41A 1LOWA 2Q07A 3BB9A 1BSDA 1EG9B 2I9WA 3K5TA 3PYJA 2WGOA 4FR9A 1TFOA 3HIIA 2GXFA 1IU7A 2E2UA 3JVCA 1QMAA 1O7MB 3BIRA 2XGNA 4QWTA 3S67A 3CCE3 3GRDA 3Q3FA 1VQM3 1OCVA 4O8SA 1N5HA 3IMAB 3FGYA 2F4YA 3URPA 1ULIB 3VSYA 4FCJA 2CC3A 2CIUA 1W01A 1UCLA 1IQYA 1FGQA 3MG2A 4I5QA 3PGBA 3LXUX 5JPUA 4HVNA 1S5AA 1TIJA 3DXOA 1A2KA 1BRGA 3FZWA 3KZTA 2HMLB 3VGNA 3CMA3 1IT8A 3G8ZA 3FF0A 3UL6A 3B4OA 1GD3A 1RCLA 4R4KA 1W02A 2K3DA 1UUVB 3CC23 1RRLA 3JUNA 4RNTA 3ZFZA 4HM2B 1W2B2 2Z6BA 2RFRA 4O2HA 5ELUA 1W6YA 3GZRA 2WO0A 3FKAA 1MWUA 3F7XA 3N54B 1ZX2A 2WOHA 1T2HA 1NDOB 1BAOA 2HMOB 3S5CA 3HOHA 2XFTA 1FA3A 2C11A 3RDEA 1BNGA 1TU5A 1O7NB 2GBWB 1M1K4 1F8NA 4KVHA 5G1KA 1D6UA 2CX0A 5HGRA 4XB5A 1LOXA 2OQEA 2XFSA 3KSED 1WTHA 1IQXA 1SIIA 1Q7HA 1T5YA 2W6JH 2HMMB 2GEXA 5CK6A 5IG0A 4HM1B 5AYRB 1BUJA 5HOHA 4GB5A 3T0UA 5AEWB 3A5EA 1IVXA 4GSPA 1RRHA 2JQ5A 1BNRA 2CG1A 1JBRA 1JKGA 5JBSA 1VQ43 3SYUA 3EJVA 3IJEB 5EQLA 2XGLA 1I2GA 3LOYA 5KP1A 4XDVA 3EBYA 1VQK3 3BNEA 2L4VA 3GZBA 3NM2A 3SXXA 2P05A 4J9AA 1GS3A 2CFWA 2D42A 3BLZA 3LT9A 4GL6A 4HAAA 4HM4B 1JBTA 1DETA 1DVCA 1RN7A 4RBNA 1RGKA 1L5GB 1OHPA 1WNHA 2RCDA 4R80A 2Y74A 1IDPA 5I97A 2QEX3 1U5OA 1JZDA 3AMOA 1ISKA 4KFFA 2KF6A 1RSNA 5AEUB 3DMCA 1GYBA 4R9KA 1I0XA 3MYTA 2IYJA 1Q40A 4LEHA 4HM3B 1UI8A 4NREA 5LC7A 1DMQA 4CJNA 5CXOA 4AKZA 3Q90A 2P0MA 1OGXA 2ML5A 1O7PB 2BMOB 1W6GA 3JUPA 1D6ZA 3WOFB 5IG3A 1W5ZA 2KXGA 4TX4A 1WMNA 1GY7A 5EVHA 4EBGA 4HZBB 3LMLA 3LTCA 1KWIA 1OUNA 2CWVA 6RNTA 4HJLB 1NJI4 1QALA 2XF3A 1ULJB 1FZUA 2F86B 3CNMA 3CPOA 2F98A 3NUVA 3I563 3K0ZA 1VQL3 2F5WA 1OF5B 1RGLA 1RMSA 2GSPA 3D5GA 1YJN3 4J5KA 1IVVA 4GHOA 4NPBA 2KRTA 4K90B 1BANA 3EHCA 4EV2A 1E3RA 3BNCA 3EQQB 9RNTA 4N6LA 4K61A 5IG4A 1AV4A 2CK3H 1FYSA 1B2SA 1N5PA 3NBRA 1A90A 2GU1A 1RTUA 1RN1A 1KSIA 1G96A 1OACA 3DM8A 5AIGA 1B27A 3FG3A 4WYKA 1DYUA 1EUIC 1TJDA 5KP4A 1BSBA 3G0KA 3LT8A 3CCV3 1SQWA 1GMQA 4H61A 1CQSA 3K7CA 2ZHXB 1N9EA 4ILFA 1LNIA 3DY5A 1I0VA 2LYXA 3CCM3 1OPYA 3BU4A 5STDA 1Q42A 2YFJB 4HM0B 1JN5B 1FW7A 1WMOA 1SJWA 3ZG0A 1R4YA 1X1YA 1VQ93 5AIIA 1IK3A 3EB8A 3D3LA 4PEJA 1SPUA 3WR2A 1LXEA 1VQN3 2XEPA 1UW1A 2PNCA 1VQ83 2W0QA 3X40A 1J2BA 3TDGA 3N9HA 4HM5B 4CPKA 3PZWA 1SIHA 1V57A 3K9MC 1B3SA 1ZGXA 2XRXB 1I3IA 1PY3A 2M7OA 5AI1A 3KSPA 3GAXA 1YGEA 3DH2A 3NBBA 4LSOA 3ROBA 5D82A 1JZOA 1MWSA 1JV2B 3M8CA 2QGUA 4CCVA 1G02A 4STDA 1JRQA 3NBJA 3SOYA 1QJGA 1BRNL 1LQMB 2GBXB 3HIGA 1IV7A 5EEOA 5TGNA 4WFOA 3WMDA 1JNQA 2B24B 2STDA 2J8XB 2RSXA 5M18A 1DE3A 3T8UA 3O8YA 3EE1A 2RGQA 3B4PA 2Z77A 3OV4A 3OWUA 3WA3A 1K8A4 1W2ZA 1LOVA 3MG1A 1YVSA 3SOAA 3AGNA 2W9PA 3AGOA 2AADA 2F56A 4KFEA 4FMAA 2O9UX 4N6UA 2KAAA 1ROAA 1BNIA 2GEYA 3WDGB 1AVKA 4Q53A 1BRIA 7RNTA 8RNTA 1JB5A 4N6NB 1NO3A 1OF5A 5AIHA 4BL3A 5A0OB 4KFDA 2L1SA 4BTYA 1B20A 2BT3A 1YJ93 1GSPA 4J8TA 4NHFA 3HK4A 5G1LA 1UGHI 1X1WA 2IMJA 1RGEA 4H3UA 1A2PA 3X42A 5JPPA 4AKYA 1GOVA 2C4BA 3SVAA 3D9RA 1Q9EA 1GOYA 2FNQA 1GD4A 3D79A 3CCJ3 1QVG2 4XBXA 3NXJA 4R1KA 4BIRA 4MMYB 1FUSA 3F8HA 1S723 1O7WB 1WQLB 2E2VA 3BNBA 4U13A 4EC6A 4HM7B 3S27A 3DGOA 2CFKA 1YNVX 1DMNA 1UUWB 1TTOA 1JN5A 1RNBA 3HI7A 1BSEA 4OVMA 3LYGA 3ZG5A 1FGOA 1BNEA 3EX9A 4LZIA 1PYLA 2QIYA 3OXAA 2K0MA 3GSPA 3NV0B 4LGQA 1QAFA 1BIRA 1VQ63 1TUHA 4XM4A 4MJDA 2XH9A 2ZDJA 3V92A 4WP5A 1MGRA 1JB4A 1OGZA 1UCIA 1MWTA 1V74A 1W00A 4OUQA 1Q7Y4 1G0TA 1M9GA 2IA7A 1BRHA 2JDIH 3DUKA 2BO9B 3JUMA 2OQEC 3S29A 3LTDA 4FCMA 5RNTA 3CU3A 3EBTA 2OTJ3 4MMZB 1UI7A 6GSPA 3DGLA 1CYVA 1R4CA 3FLJA 4JF8A 5DRVA 3CCS3 2D1WA 2INXA 5IG5A 1YI23 2W04A 2WOFA 3F14A 3HX8A 2HMNB 4FMBA 5IEOA 1NU3A 3NQZA 3E99A 1YVBI 3SEDA 1VZZA 3KKGA 1NWWA 2CWUA 3NQYA 1EQKA 3D5IA 3LTAA 2BMRB 1LVNA 2A15A 2CG0A 4J5GA 1I2FA 1I70A 2P09A 3JUOA 3G4S3 3CPW2 1I3FA 5KP3A 1UGIA 3RGAA 1IVWA 1E3VA 2KF5A 3I553 3NX0A 1BRKA 4RNYA 3F8XA 1N8QA 4FMCA 2OOVA 1K9M4 2BHMA 2XR8B 4L8PA 3X3YA 2OWPA 1MWRA 2R4IA 3LH4A 1YJW3 1X1XA 3DZLA 1BRJA 3LZAA 2KF3A 1IVUA 2YX9A 1BSAA 1LNHA 2HOHA 4HYZA 4N6OB 2IUJA 4RZMA 3F9SA 2H0GA 1EKMA 3MSOA 3U97A 2FXTA 3WODG 5BU4A 1SARA 4EW5A 1LQGC 1B2MA 1AQZA 1EEJA 1RCKA 2SARA 8CHOA 1RNTA 4ORLA 5IW9A 4L7KA 3PCSA 1CYUA 3EN1B 2RBIA 2KCDA 3F40A 2CW9A 5CF2A 1O7HB 3NHXA 4AEQA 1Y4KA 1QAKA 3SX1A 1KQS2 1U8CB 1BNFA 3DGNA 1BU4A 2HMJB 4EXRA 3IPTA 5FGOA 3CCR3 2Z7AA 1BRSA 2Z76A 3FF2A 5D83A 3NV0A 1B2UA 3BNDA 3UB1A 1RGGA 1FUTA 2K54A 3B7CA 3S28A 4RNZA 2CFGA 3V98A 1LOYA 1VQO3 1Q864 2WGQA 3L0RA 1X1UA 2YFLB 4WHAA 3DGYA 4OK0A 2V1LA 4K1VA 3PS8A 2BU4A 1ZO2A 2E2TA 3PCRA 3VF1A 5BIRA 1Q814 1C54A 1RHLA 2OOVC 2W2CA 1BGSA 1NB3I 1K41A 5M19A 4XBYA 3G713 2MF7A 3B8LA 5LC6A 2IY2A 1RGCA 3MKIA 2H0IA 1A2VA 5CLKA 1GOUA 4KT3B 4FCZA 1GMRA 5DREA 3CC43 1UUGB 5IF6A 1AVLA 1NB5I 1AR0A 1YGWA 1STFI 4R9LA 3SLUA 1DVDA 1T3BA 3ECFA 4HM6B 1STDA 2ZL8A 1T2IA 4N6V0 1HYFA 4HOHA 3Q2PA 4IIAA 1O7GB 1MGWA 3GWRA 4HKVB 2W56B 3ER7A 4I4KA 7GSPA 1KD14 2HMKB 4L8OA 1UCJA 4WYKB 1RLSA 4EV5A 1LRAA 2BIRA 3V99A 1DMMA 4MEIA 3FG4A 3EC9A 2BMQB 4BL2A 3AHWA 5IENA 1NNVA 1VQP3 4ZM8A 1RGHA 4X2OA 3UJMA 1PU4A 3H51A 1IYYA 1HKXA 4HZ9B 1N8R4 1VQQA 5ELJA 4G1MB 3STDA 2LQVA 1OHOA 4N3VA 1E97A 2CX1A 2P38A 2P0XA 4HBRA 3KFQC 5G2GA 3KN4A 2UX0A 2C10A 2YFIB 4KZ1A 4CDLA 3UL5A 3RGRA 5IEPA 3CC73 5CF1A 6STDA 3MWZA 4O02B 5BVBA 4IT7A 3J7Yd 3MG3A 1IV9A 3MHEA 3G16A 3UNLA 1K28A 1EA2A 1JBSA 2XSOB 2XSHB 3MPHA 1TFKA 2PZVA 4FMDA 3X3ZA 4BU4A 1CH0A 3QK9A 4JRFA 4BTXA 1PFPA 4DKIA 1GY6A 1AY7A 1MNLA 2B1XB 1BVIA 3JUQA 2CWTA 1B2XA 3H3HA 1BNJA 2KF4A 2F99A 4O3VA 3U1WA 1TRQA 1BUQA 3FSDA 4N6TA 3WHOA 3OW22 3AHSA 2CH9A 1V58A 4K1UA 4XBTA 1US1A 5D81A 4N6MA 3GZYB 1IQ8A 3HZPA 1W4NA 3KIIA 1OHSA 2BNGA 2ML6A 2UUGC 2W9QA 1CEWI 3CCQ3 1Q824 1M904 3PXMA 1FUWA 1D6YA 3A76A 2F5MA 1RGFA 4EYCA 5IERA 3Q1CA 2IUKA 4BTWA 1ROVA 3CCU3 4X2HA 4HM8B 1ZS7A
chains in the Genus database with same CATH topology
1VQ53 2CFLA 4MMXB 3G6E3 1IT7A 1Z1SA 2FGTA 3CNXA 3OWYA 4LMIA 3NM7A 2CKFB 3N8BA 2O3OA 2CHCA 1W7CA 1VQ73 1A67A 3FG1A 5BXQA 1YIJ3 1FGRA 5AIFA 1N9JA 3FCSB 5FW5A 4XDWA 3T8NA 1TP6A 3OWSA 3VSYA 1KC84 1JKGB 3FH1A 3CD63 3GZXB 2W03A 3EF8A 7STDA 3OX9A 3CXC2 1OH0A 3WA2X 2W56A 3QRDA 3X3XA 1QVF2 1RKYA 3K63A 1ASKA 1YHQ3 2GU3A 3ALAA 2MC8A 1YIT3 3I0YA 4WWUC 1RJOA 1W6CA 1M1XB 1WMPA 3F7SA 3CME3 1FGTA 2CFDA 3KE7A 5AYSC 1GY5A 1FGMA 3WOEB 1JB2A 1HU9A 2OCTA 3AMOB 3EN8A 3X41A 3CCL3 2SBLA 2QA43 1C7HA 2Y73A 2OTL3 3DGMA 1JJ22 3LTBA 4IPBA 1MOLA 1K734 1Q40B 2Q07A 3BB9A 1EG9B 2I9WA 3K5TA 3PYJA 2WGOA 4FR9A 1TFOA 3HIIA 2GXFA 1IU7A 2E2UA 3JVCA 1QMAA 1O7MB 4QWTA 2XGNA 3S67A 3CCE3 3GRDA 1VQM3 1OCVA 4O8SA 1N5HA 3IMAB 3FGYA 1ULIB 4FCJA 2CC3A 2CIUA 1W01A 1IQYA 1FGQA 3MG2A 3PGBA 3LXUX 5JPUA 4HVNA 1S5AA 1TIJA 3DXOA 1A2KA 3FZWA 3KZTA 3VGNA 2HMLB 3CMA3 1IT8A 3G8ZA 3FF0A 3UL6A 3B4OA 1GD3A 4R4KA 1W02A 1UUVB 3CC23 1RRLA 3JUNA 4HM2B 1W2B2 2Z6BA 2RFRA 4O2HA 5ELUA 1W6YA 3GZRA 2WO0A 3FKAA 3N54B 3F7XA 1ZX2A 2WOHA 1NDOB 2HMOB 3S5CA 2XFTA 1FA3A 2C11A 3RDEA 1TU5A 1O7NB 2GBWB 1M1K4 1F8NA 4KVHA 1D6UA 5HGRA 4XB5A 1LOXA 2OQEA 2XFSA 3KSED 1WTHA 1IQXA 1SIIA 1T5YA 2W6JH 2HMMB 2GEXA 5CK6A 5IG0A 4HM1B 5AYRB 4GB5A 3T0UA 5AEWB 1IVXA 1RRHA 2JQ5A 2CG1A 1JKGA 5JBSA 1VQ43 3EJVA 3IJEB 5EQLA 2XGLA 3LOYA 5KP1A 4XDVA 3EBYA 1VQK3 3BNEA 2L4VA 3GZBA 3NM2A 3SXXA 2P05A 4J9AA 1GS3A 2CFWA 2D42A 3BLZA 3LT9A 4GL6A 4HM4B 1RN7A 1DVCA 4RBNA 1L5GB 1OHPA 1WNHA 2RCDA 4R80A 2Y74A 1IDPA 5I97A 2QEX3 1U5OA 3AMOA 1ISKA 4KFFA 5AEUB 3DMCA 1GYBA 4R9KA 3MYTA 1Q40A 4LEHA 4HM3B 1UI8A 4NREA 5LC7A 1DMQA 5CXOA 4AKZA 3Q90A 2P0MA 1OGXA 2ML5A 1O7PB 2BMOB 1W6GA 3JUPA 1D6ZA 3WOFB 5IG3A 1W5ZA 2KXGA 4TX4A 1WMNA 1GY7A 5EVHA 4EBGA 4HZBB 3LMLA 3LTCA 1KWIA 1OUNA 2CWVA 4HJLB 1NJI4 1QALA 2XF3A 1ULJB 2F86B 3CNMA 3CPOA 2F98A 3NUVA 3I563 3K0ZA 1VQL3 1OF5B 1YJN3 1IVVA 2KRTA 4K90B 3EHCA 4EV2A 1E3RA 3BNCA 3EQQB 4N6LA 4K61A 5IG4A 1AV4A 2CK3H 3NBRA 1N5PA 1A90A 2GU1A 1KSIA 1G96A 1OACA 3DM8A 5AIGA 3FG3A 4WYKA 1DYUA 5KP4A 3G0KA 3LT8A 3CCV3 1SQWA 4H61A 1CQSA 3K7CA 1N9EA 3DY5A 3CCM3 2LYXA 1OPYA 5STDA 1Q42A 2YFJB 4HM0B 1JN5B 1WMOA 1SJWA 1VQ93 5AIIA 1IK3A 3EB8A 3D3LA 4PEJA 1SPUA 1LXEA 1VQN3 2XEPA 1UW1A 2PNCA 1VQ83 2W0QA 3X40A 1J2BA 3TDGA 3N9HA 4HM5B 3PZWA 1SIHA 3K9MC 2XRXB 5AI1A 2M7OA 3KSPA 3GAXA 1YGEA 3NBBA 4LSOA 3ROBA 5D82A 1JV2B 3M8CA 4CCVA 4STDA 1JRQA 3NBJA 3SOYA 1QJGA 2GBXB 3HIGA 1IV7A 5EEOA 5TGNA 4WFOA 3WMDA 1JNQA 2B24B 2STDA 2RSXA 3T8UA 3O8YA 3EE1A 2RGQA 3B4PA 2Z77A 3OV4A 3OWUA 3WA3A 1K8A4 1W2ZA 3MG1A 3SOAA 2W9PA 4KFEA 4FMAA 2O9UX 4N6UA 1ROAA 2GEYA 3WDGB 1AVKA 4Q53A 1JB5A 4N6NB 1NO3A 1OF5A 5AIHA 5A0OB 4KFDA 4BTYA 2BT3A 1YJ93 4J8TA 4NHFA 3HK4A 3X42A 2IMJA 5JPPA 4H3UA 4AKYA 3SVAA 3D9RA 2FNQA 1GD4A 3CCJ3 1QVG2 4XBXA 3NXJA 4R1KA 4MMYB 3F8HA 1S723 1O7WB 1WQLB 2E2VA 3BNBA 4U13A 4EC6A 4HM7B 3S27A 3DGOA 2CFKA 1DMNA 1UUWB 1JN5A 3HI7A 4OVMA 3LYGA 1FGOA 3EX9A 4LZIA 3OXAA 2QIYA 2K0MA 3NV0B 4LGQA 1QAFA 1VQ63 1TUHA 4XM4A 4MJDA 2XH9A 2ZDJA 3V92A 4WP5A 1Q7Y4 1JB4A 1OGZA 1V74A 1W00A 4OUQA 1M9GA 2IA7A 2JDIH 3DUKA 2BO9B 3JUMA 2OQEC 3S29A 3LTDA 4FCMA 3CU3A 3EBTA 2OTJ3 4MMZB 1UI7A 3DGLA 1CYVA 1R4CA 3FLJA 4JF8A 5DRVA 3CCS3 2D1WA 2INXA 5IG5A 1YI23 2W04A 2WOFA 3F14A 3HX8A 2HMNB 4FMBA 5IEOA 1NU3A 3NQZA 3E99A 1YVBI 3SEDA 1VZZA 3KKGA 1NWWA 2CWUA 3NQYA 1EQKA 3LTAA 2BMRB 1LVNA 2A15A 2CG0A 3G4S3 2P09A 3JUOA 3CPW2 5KP3A 3RGAA 1IVWA 1E3VA 3I553 3NX0A 4RNYA 3F8XA 1N8QA 4FMCA 2OOVA 1K9M4 2BHMA 2XR8B 4L8PA 3X3YA 2OWPA 3LH4A 2R4IA 1YJW3 3DZLA 3LZAA 1IVUA 2YX9A 1LNHA 4N6OB 2IUJA 4HYZA 4RZMA 3F9SA 1EKMA 3MSOA 3U97A 2FXTA 3WODG 8CHOA 4ORLA 5IW9A 4L7KA 3PCSA 1CYUA 3EN1B 2KCDA 3F40A 2CW9A 5CF2A 1O7HB 3NHXA 4AEQA 1Y4KA 1QAKA 3SX1A 1KQS2 1U8CB 3DGNA 2HMJB 4EXRA 3IPTA 5FGOA 3CCR3 2Z7AA 2Z76A 3FF2A 5D83A 3NV0A 3BNDA 3UB1A 2K54A 3B7CA 3S28A 4RNZA 2CFGA 3V98A 1VQO3 1Q864 2WGQA 3L0RA 2YFLB 4WHAA 4OK0A 2V1LA 4K1VA 3PS8A 1ZO2A 2E2TA 3PCRA 3VF1A 1Q814 2OOVC 2W2CA 1NB3I 1K41A 4XBYA 3G713 2MF7A 3B8LA 5LC6A 3MKIA 1A2VA 5CLKA 4FCZA 5DREA 3CC43 5IF6A 1NB5I 1AVLA 1AR0A 4R9LA 1STFI 3SLUA 1DVDA 3ECFA 4HM6B 1STDA 2ZL8A 4N6V0 4IIAA 3Q2PA 1O7GB 3GWRA 4HKVB 2W56B 3ER7A 4I4KA 1KD14 2HMKB 4L8OA 4WYKB 4EV5A 3V99A 1DMMA 4MEIA 3FG4A 3EC9A 2BMQB 5IENA 1VQP3 4ZM8A 4X2OA 3UJMA 1PU4A 3H51A 1HKXA 4HZ9B 1N8R4 5ELJA 4G1MB 3STDA 2LQVA 1OHOA 4N3VA 1E97A 2P38A 2P0XA 4HBRA 3KFQC 5G2GA 3KN4A 2UX0A 2C10A 2YFIB 4KZ1A 4CDLA 3UL5A 3RGRA 5IEPA 3CC73 5CF1A 6STDA 3MWZA 4O02B 5BVBA 4IT7A 3J7Yd 3MG3A 1IV9A 3MHEA 3G16A 3UNLA 1K28A 1EA2A 2XSOB 2XSHB 3MPHA 1TFKA 2PZVA 4FMDA 3X3ZA 3QK9A 4JRFA 4BTXA 1PFPA 1GY6A 1MNLA 2B1XB 3JUQA 2CWTA 3H3HA 4O3VA 2F99A 3U1WA 1BUQA 3FSDA 4N6TA 3OW22 2CH9A 4K1UA 4XBTA 1US1A 5D81A 4N6MA 3GZYB 1IQ8A 3HZPA 1W4NA 3KIIA 1OHSA 2BNGA 2ML6A 2W9QA 3CCQ3 1CEWI 1Q824 1M904 3PXMA 1FUWA 1D6YA 3A76A 4EYCA 5IERA 3Q1CA 2IUKA 4BTWA 1ROVA 3CCU3 4X2HA 4HM8B 2QGUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1Z1S A;  3CNX A;  3OWY A;  4LMI A;  2CKF B;  2CHC A;  5BXQ A;  5AIF A;  3T8N A;  5FW5 A;  3VSY A;  4XDW A;  1TP6 A;  3OWS A;  1JKG B;  3FH1 A;  3GZX B;  3EF8 A;  7STD A;  3OX9 A;  1OH0 A;  1ASK A;  3I0Y A;  4WWU C;  3F7S A;  3KE7 A;  1GY5 A;  1JB2 A;  3EN8 A;  1C7H A;  1Q40 B;  3BB9 A;  1EG9 B;  2I9W A;  2GXF A;  1QMA A;  1O7M B;  3GRD A;  1OCV A;  3FGY A;  1ULI B;  4FCJ A;  1W01 A;  3MG2 A;  5JPU A;  4HVN A;  1S5A A;  3DXO A;  3FZW A;  1A2K A;  3KZT A;  3VGN A;  2HML B;  3G8Z A;  3FF0 A;  3B4O A;  1W02 A;  1UUV B;  3JUN A;  4HM2 B;  2RFR A;  1W6Y A;  3GZR A;  3FKA A;  3F7X A;  1ZX2 A;  1NDO B;  2HMO B;  3S5C A;  1O7N B;  2GBW B;  4KVH A;  5HGR A;  4XB5 A;  2HMM B;  2GEX A;  5CK6 A;  5IG0 A;  4HM1 B;  4GB5 A;  5AEW B;  2JQ5 A;  1JKG A;  3EJV A;  5KP1 A;  4XDV A;  3EBY A;  3NM2 A;  3GZB A;  4J9A A;  1GS3 A;  3BLZ A;  4HM4 B;  1OHP A;  2RCD A;  1IDP A;  1U5O A;  1ISK A;  5AEU B;  3DMC A;  1GYB A;  4R9K A;  3MYT A;  1Q40 A;  4LEH A;  4HM3 B;  1DMQ A;  5CXO A;  3Q90 A;  1OGX A;  1O7P B;  2BMO B;  3JUP A;  5IG3 A;  1GY7 A;  5EVH A;  4HZB B;  1OUN A;  4HJL B;  3CNM A;  1ULJ B;  2F86 B;  3CPO A;  2F98 A;  3NUV A;  3K0Z A;  1OF5 B;  3EHC A;  1E3R A;  3EQQ B;  5IG4 A;  3NBR A;  5AIG A;  3DM8 A;  4WYK A;  5KP4 A;  3G0K A;  1CQS A;  3K7C A;  1OPY A;  5STD A;  1Q42 A;  2YFJ B;  4HM0 B;  1JN5 B;  1SJW A;  5AII A;  4PEJ A;  4HM5 B;  2XRX B;  5AI1 A;  3KSP A;  3ROB A;  5D82 A;  3M8C A;  4STD A;  3SOY A;  1QJG A;  2GBX B;  5TGN A;  3WMD A;  2B24 B;  2STD A;  3T8U A;  3OV4 A;  3B4P A;  2Z77 A;  3OWU A;  2RGQ A;  3MG1 A;  3SOA A;  2GEY A;  4Q53 A;  1JB5 A;  1OF5 A;  5AIH A;  4J8T A;  3HK4 A;  2IMJ A;  5JPP A;  4H3U A;  3D9R A;  4XBX A;  3NXJ A;  4R1K A;  3F8H A;  1O7W B;  1WQL B;  4U13 A;  4HM7 B;  1DMN A;  1UUW B;  1JN5 A;  4OVM A;  3LYG A;  3EX9 A;  3OXA A;  2QIY A;  3NV0 B;  4LGQ A;  1TUH A;  4XM4 A;  4MJD A;  4WP5 A;  1JB4 A;  1W00 A;  1OGZ A;  4OUQ A;  3DUK A;  3JUM A;  4FCM A;  3CU3 A;  3EBT A;  3FLJ A;  5DRV A;  2INX A;  5IG5 A;  3F14 A;  3HX8 A;  2HMN B;  5IEO A;  1NU3 A;  3E99 A;  3SED A;  1VZZ A;  3KKG A;  1NWW A;  2BMR B;  2A15 A;  3JUO A;  5KP3 A;  3RGA A;  1E3V A;  3F8X A;  2XR8 B;  4L8P A;  2OWP A;  2R4I A;  3DZL A;  3LZA A;  4RZM A;  3F9S A;  3MSO A;  8CHO A;  4ORL A;  4L7K A;  3EN1 B;  3F40 A;  5CF2 A;  1O7H B;  3NHX A;  2HMJ B;  3IPT A;  2Z7A A;  2Z76 A;  3FF2 A;  5D83 A;  3NV0 A;  2K54 A;  3B7C A;  2YFL B;  4K1V A;  1ZO2 A;  2W2C A;  1K41 A;  4XBY A;  3B8L A;  3MKI A;  5CLK A;  5DRE A;  5IF6 A;  1AR0 A;  4R9L A;  3ECF A;  4HM6 B;  1STD A;  4IIA A;  1O7G B;  3GWR A;  4HKV B;  3ER7 A;  4I4K A;  2HMK B;  4L8O A;  4WYK B;  1DMM A;  3EC9 A;  2BMQ B;  5IEN A;  4X2O A;  3UJM A;  3H51 A;  1HKX A;  4HZ9 B;  3STD A;  1OHO A;  4N3V A;  1E97 A;  5G2G A;  2UX0 A;  5IEP A;  2YFI B;  4CDL A;  3RGR A;  5CF1 A;  6STD A;  5BVB A;  3MG3 A;  3MHE A;  3G16 A;  3UNL A;  1EA2 A;  2XSO B;  2XSH B;  2PZV A;  1GY6 A;  2B1X B;  3JUQ A;  3H3H A;  2F99 A;  1BUQ A;  3FSD A;  4K1U A;  4XBT A;  5D81 A;  3GZY B;  3HZP A;  1OHS A;  2BNG A;  3A76 A;  5IER A;  4X2H A;  4HM8 B;  2QGU A; 
#chains in the Genus database with same CATH topology
 1VQ5 3;  1GMP A;  2CFL A;  4MMX B;  3G6E 3;  1IT7 A;  1HZ1 A;  1Z1S A;  1RN4 A;  1UDI I;  2FGT A;  3CNX A;  3OWY A;  4LMI A;  1TRP A;  3NM7 A;  2CKF B;  3N8B A;  2O3O A;  3RNT A;  2CHC A;  1BSC A;  3KCH A;  1W7C A;  1VQ7 3;  1A67 A;  3FG1 A;  5BXQ A;  1YIJ 3;  4LYL B;  1FGR A;  5AIF A;  5GSP A;  1N9J A;  3FCS B;  5FW5 A;  4XDW A;  3T8N A;  1TP6 A;  1I2E A;  2UGI A;  3OWS A;  1JKG B;  1KC8 4;  1I8V A;  3FH1 A;  1B2Z A;  3CD6 3;  1RDS A;  3GZX B;  2W03 A;  3EF8 A;  7STD A;  3OX9 A;  3CXC 2;  1OH0 A;  3WA2 X;  1B21 A;  2W56 A;  3QRD A;  3X3X A;  1QVF 2;  1RKY A;  1RGA A;  1ASK A;  3K63 A;  1YHQ 3;  2GU3 A;  3ALA A;  2MC8 A;  1BNS A;  3I0Y A;  1YIT 3;  4WWU C;  5M1A A;  1RJO A;  1W6C A;  1M1X B;  1WMP A;  1UCK A;  2H0H A;  1FGT A;  2CFD A;  3F7S A;  3KE7 A;  5AYS C;  3CME 3;  3D4A A;  1GY5 A;  1FGM A;  3WOE B;  1JB2 A;  1HU9 A;  2OCT A;  3AMO B;  3EN8 A;  3X41 A;  3CCL 3;  2SBL A;  2QA4 3;  1BOX A;  1C7H A;  2Y73 A;  2OTL 3;  2ZA4 A;  3DGM A;  1JJ2 2;  2RNT A;  3LTB A;  1MOL A;  4IPB A;  2AAE A;  1K73 4;  1Q40 B;  2R41 A;  1LOW A;  2Q07 A;  3BB9 A;  1BSD A;  1EG9 B;  2I9W A;  3K5T A;  3PYJ A;  2WGO A;  4FR9 A;  1TFO A;  3HII A;  2GXF A;  1IU7 A;  2E2U A;  3JVC A;  1QMA A;  1O7M B;  3BIR A;  2XGN A;  4QWT A;  3S67 A;  3CCE 3;  3GRD A;  3Q3F A;  1VQM 3;  1OCV A;  4O8S A;  1N5H A;  3IMA B;  3FGY A;  2F4Y A;  3URP A;  1ULI B;  3VSY A;  4FCJ A;  2CC3 A;  2CIU A;  1W01 A;  1UCL A;  1IQY A;  1FGQ A;  3MG2 A;  4I5Q A;  3PGB A;  3LXU X;  5JPU A;  4HVN A;  1S5A A;  1TIJ A;  3DXO A;  1A2K A;  1BRG A;  3FZW A;  3KZT A;  2HML B;  3VGN A;  3CMA 3;  1IT8 A;  3G8Z A;  3FF0 A;  3UL6 A;  3B4O A;  1GD3 A;  1RCL A;  4R4K A;  1W02 A;  2K3D A;  1UUV B;  3CC2 3;  1RRL A;  3JUN A;  4RNT A;  3ZFZ A;  4HM2 B;  1W2B 2;  2Z6B A;  2RFR A;  4O2H A;  5ELU A;  1W6Y A;  3GZR A;  2WO0 A;  3FKA A;  1MWU A;  3F7X A;  3N54 B;  1ZX2 A;  2WOH A;  1T2H A;  1NDO B;  1BAO A;  2HMO B;  3S5C A;  3HOH A;  2XFT A;  1FA3 A;  2C11 A;  3RDE A;  1BNG A;  1TU5 A;  1O7N B;  2GBW B;  1M1K 4;  1F8N A;  4KVH A;  5G1K A;  1D6U A;  2CX0 A;  5HGR A;  4XB5 A;  1LOX A;  2OQE A;  2XFS A;  3KSE D;  1WTH A;  1IQX A;  1SII A;  1Q7H A;  1T5Y A;  2W6J H;  2HMM B;  2GEX A;  5CK6 A;  5IG0 A;  4HM1 B;  5AYR B;  1BUJ A;  5HOH A;  4GB5 A;  3T0U A;  5AEW B;  3A5E A;  1IVX A;  4GSP A;  1RRH A;  2JQ5 A;  1BNR A;  2CG1 A;  1JBR A;  1JKG A;  5JBS A;  1VQ4 3;  3SYU A;  3EJV A;  3IJE B;  5EQL A;  2XGL A;  1I2G A;  3LOY A;  5KP1 A;  4XDV A;  3EBY A;  1VQK 3;  3BNE A;  2L4V A;  3GZB A;  3NM2 A;  3SXX A;  2P05 A;  4J9A A;  1GS3 A;  2CFW A;  2D42 A;  3BLZ A;  3LT9 A;  4GL6 A;  4HAA A;  4HM4 B;  1JBT A;  1DET A;  1DVC A;  1RN7 A;  4RBN A;  1RGK A;  1L5G B;  1OHP A;  1WNH A;  2RCD A;  4R80 A;  2Y74 A;  1IDP A;  5I97 A;  2QEX 3;  1U5O A;  1JZD A;  3AMO A;  1ISK A;  4KFF A;  2KF6 A;  1RSN A;  5AEU B;  3DMC A;  1GYB A;  4R9K A;  1I0X A;  3MYT A;  2IYJ A;  1Q40 A;  4LEH A;  4HM3 B;  1UI8 A;  4NRE A;  5LC7 A;  1DMQ A;  4CJN A;  5CXO A;  4AKZ A;  3Q90 A;  2P0M A;  1OGX A;  2ML5 A;  1O7P B;  2BMO B;  1W6G A;  3JUP A;  1D6Z A;  3WOF B;  5IG3 A;  1W5Z A;  2KXG A;  4TX4 A;  1WMN A;  1GY7 A;  5EVH A;  4EBG A;  4HZB B;  3LML A;  3LTC A;  1KWI A;  1OUN A;  2CWV A;  6RNT A;  4HJL B;  1NJI 4;  1QAL A;  2XF3 A;  1ULJ B;  1FZU A;  2F86 B;  3CNM A;  3CPO A;  2F98 A;  3NUV A;  3I56 3;  3K0Z A;  1VQL 3;  2F5W A;  1OF5 B;  1RGL A;  1RMS A;  2GSP A;  3D5G A;  1YJN 3;  4J5K A;  1IVV A;  4GHO A;  4NPB A;  2KRT A;  4K90 B;  1BAN A;  3EHC A;  4EV2 A;  1E3R A;  3BNC A;  3EQQ B;  9RNT A;  4N6L A;  4K61 A;  5IG4 A;  1AV4 A;  2CK3 H;  1FYS A;  1B2S A;  1N5P A;  3NBR A;  1A90 A;  2GU1 A;  1RTU A;  1RN1 A;  1KSI A;  1G96 A;  1OAC A;  3DM8 A;  5AIG A;  1B27 A;  3FG3 A;  4WYK A;  1DYU A;  1EUI C;  1TJD A;  5KP4 A;  1BSB A;  3G0K A;  3LT8 A;  3CCV 3;  1SQW A;  1GMQ A;  4H61 A;  1CQS A;  3K7C A;  2ZHX B;  1N9E A;  4ILF A;  1LNI A;  3DY5 A;  1I0V A;  2LYX A;  3CCM 3;  1OPY A;  3BU4 A;  5STD A;  1Q42 A;  2YFJ B;  4HM0 B;  1JN5 B;  1FW7 A;  1WMO A;  1SJW A;  3ZG0 A;  1R4Y A;  1X1Y A;  1VQ9 3;  5AII A;  1IK3 A;  3EB8 A;  3D3L A;  4PEJ A;  1SPU A;  3WR2 A;  1LXE A;  1VQN 3;  2XEP A;  1UW1 A;  2PNC A;  1VQ8 3;  2W0Q A;  3X40 A;  1J2B A;  3TDG A;  3N9H A;  4HM5 B;  4CPK A;  3PZW A;  1SIH A;  1V57 A;  3K9M C;  1B3S A;  1ZGX A;  2XRX B;  1I3I A;  1PY3 A;  2M7O A;  5AI1 A;  3KSP A;  3GAX A;  1YGE A;  3DH2 A;  3NBB A;  4LSO A;  3ROB A;  5D82 A;  1JZO A;  1MWS A;  1JV2 B;  3M8C A;  2QGU A;  4CCV A;  1G02 A;  4STD A;  1JRQ A;  3NBJ A;  3SOY A;  1QJG A;  1BRN L;  1LQM B;  2GBX B;  3HIG A;  1IV7 A;  5EEO A;  5TGN A;  4WFO A;  3WMD A;  1JNQ A;  2B24 B;  2STD A;  2J8X B;  2RSX A;  5M18 A;  1DE3 A;  3T8U A;  3O8Y A;  3EE1 A;  2RGQ A;  3B4P A;  2Z77 A;  3OV4 A;  3OWU A;  3WA3 A;  1K8A 4;  1W2Z A;  1LOV A;  3MG1 A;  1YVS A;  3SOA A;  3AGN A;  2W9P A;  3AGO A;  2AAD A;  2F56 A;  4KFE A;  4FMA A;  2O9U X;  4N6U A;  2KAA A;  1ROA A;  1BNI A;  2GEY A;  3WDG B;  1AVK A;  4Q53 A;  1BRI A;  7RNT A;  8RNT A;  1JB5 A;  4N6N B;  1NO3 A;  1OF5 A;  5AIH A;  4BL3 A;  5A0O B;  4KFD A;  2L1S A;  4BTY A;  1B20 A;  2BT3 A;  1YJ9 3;  1GSP A;  4J8T A;  4NHF A;  3HK4 A;  5G1L A;  1UGH I;  1X1W A;  2IMJ A;  1RGE A;  4H3U A;  1A2P A;  3X42 A;  5JPP A;  4AKY A;  1GOV A;  2C4B A;  3SVA A;  3D9R A;  1Q9E A;  1GOY A;  2FNQ A;  1GD4 A;  3D79 A;  3CCJ 3;  1QVG 2;  4XBX A;  3NXJ A;  4R1K A;  4BIR A;  4MMY B;  1FUS A;  3F8H A;  1S72 3;  1O7W B;  1WQL B;  2E2V A;  3BNB A;  4U13 A;  4EC6 A;  4HM7 B;  3S27 A;  3DGO A;  2CFK A;  1YNV X;  1DMN A;  1UUW B;  1TTO A;  1JN5 A;  1RNB A;  3HI7 A;  1BSE A;  4OVM A;  3LYG A;  3ZG5 A;  1FGO A;  1BNE A;  3EX9 A;  4LZI A;  1PYL A;  2QIY A;  3OXA A;  2K0M A;  3GSP A;  3NV0 B;  4LGQ A;  1QAF A;  1BIR A;  1VQ6 3;  1TUH A;  4XM4 A;  4MJD A;  2XH9 A;  2ZDJ A;  3V92 A;  4WP5 A;  1MGR A;  1JB4 A;  1OGZ A;  1UCI A;  1MWT A;  1V74 A;  1W00 A;  4OUQ A;  1Q7Y 4;  1G0T A;  1M9G A;  2IA7 A;  1BRH A;  2JDI H;  3DUK A;  2BO9 B;  3JUM A;  2OQE C;  3S29 A;  3LTD A;  4FCM A;  5RNT A;  3CU3 A;  3EBT A;  2OTJ 3;  4MMZ B;  1UI7 A;  6GSP A;  3DGL A;  1CYV A;  1R4C A;  3FLJ A;  4JF8 A;  5DRV A;  3CCS 3;  2D1W A;  2INX A;  5IG5 A;  1YI2 3;  2W04 A;  2WOF A;  3F14 A;  3HX8 A;  2HMN B;  4FMB A;  5IEO A;  1NU3 A;  3NQZ A;  3E99 A;  1YVB I;  3SED A;  1VZZ A;  3KKG A;  1NWW A;  2CWU A;  3NQY A;  1EQK A;  3D5I A;  3LTA A;  2BMR B;  1LVN A;  2A15 A;  2CG0 A;  4J5G A;  1I2F A;  1I70 A;  2P09 A;  3JUO A;  3G4S 3;  3CPW 2;  1I3F A;  5KP3 A;  1UGI A;  3RGA A;  1IVW A;  1E3V A;  2KF5 A;  3I55 3;  3NX0 A;  1BRK A;  4RNY A;  3F8X A;  1N8Q A;  4FMC A;  2OOV A;  1K9M 4;  2BHM A;  2XR8 B;  4L8P A;  3X3Y A;  2OWP A;  1MWR A;  2R4I A;  3LH4 A;  1YJW 3;  1X1X A;  3DZL A;  1BRJ A;  3LZA A;  2KF3 A;  1IVU A;  2YX9 A;  1BSA A;  1LNH A;  2HOH A;  4HYZ A;  4N6O B;  2IUJ A;  4RZM A;  3F9S A;  2H0G A;  1EKM A;  3MSO A;  3U97 A;  2FXT A;  3WOD G;  5BU4 A;  1SAR A;  4EW5 A;  1LQG C;  1B2M A;  1AQZ A;  1EEJ A;  1RCK A;  2SAR A;  8CHO A;  1RNT A;  4ORL A;  5IW9 A;  4L7K A;  3PCS A;  1CYU A;  3EN1 B;  2RBI A;  2KCD A;  3F40 A;  2CW9 A;  5CF2 A;  1O7H B;  3NHX A;  4AEQ A;  1Y4K A;  1QAK A;  3SX1 A;  1KQS 2;  1U8C B;  1BNF A;  3DGN A;  1BU4 A;  2HMJ B;  4EXR A;  3IPT A;  5FGO A;  3CCR 3;  2Z7A A;  1BRS A;  2Z76 A;  3FF2 A;  5D83 A;  3NV0 A;  1B2U A;  3BND A;  3UB1 A;  1RGG A;  1FUT A;  2K54 A;  3B7C A;  3S28 A;  4RNZ A;  2CFG A;  3V98 A;  1LOY A;  1VQO 3;  1Q86 4;  2WGQ A;  3L0R A;  1X1U A;  2YFL B;  4WHA A;  3DGY A;  4OK0 A;  2V1L A;  4K1V A;  3PS8 A;  2BU4 A;  1ZO2 A;  2E2T A;  3PCR A;  3VF1 A;  5BIR A;  1Q81 4;  1C54 A;  1RHL A;  2OOV C;  2W2C A;  1BGS A;  1NB3 I;  1K41 A;  5M19 A;  4XBY A;  3G71 3;  2MF7 A;  3B8L A;  5LC6 A;  2IY2 A;  1RGC A;  3MKI A;  2H0I A;  1A2V A;  5CLK A;  1GOU A;  4KT3 B;  4FCZ A;  1GMR A;  5DRE A;  3CC4 3;  1UUG B;  5IF6 A;  1AVL A;  1NB5 I;  1AR0 A;  1YGW A;  1STF I;  4R9L A;  3SLU A;  1DVD A;  1T3B A;  3ECF A;  4HM6 B;  1STD A;  2ZL8 A;  1T2I A;  4N6V 0;  1HYF A;  4HOH A;  3Q2P A;  4IIA A;  1O7G B;  1MGW A;  3GWR A;  4HKV B;  2W56 B;  3ER7 A;  4I4K A;  7GSP A;  1KD1 4;  2HMK B;  4L8O A;  1UCJ A;  4WYK B;  1RLS A;  4EV5 A;  1LRA A;  2BIR A;  3V99 A;  1DMM A;  4MEI A;  3FG4 A;  3EC9 A;  2BMQ B;  4BL2 A;  3AHW A;  5IEN A;  1NNV A;  1VQP 3;  4ZM8 A;  1RGH A;  4X2O A;  3UJM A;  1PU4 A;  3H51 A;  1IYY A;  1HKX A;  4HZ9 B;  1N8R 4;  1VQQ A;  5ELJ A;  4G1M B;  3STD A;  2LQV A;  1OHO A;  4N3V A;  1E97 A;  2CX1 A;  2P38 A;  2P0X A;  4HBR A;  3KFQ C;  5G2G A;  3KN4 A;  2UX0 A;  2C10 A;  2YFI B;  4KZ1 A;  4CDL A;  3UL5 A;  3RGR A;  5IEP A;  3CC7 3;  5CF1 A;  6STD A;  3MWZ A;  4O02 B;  5BVB A;  4IT7 A;  3J7Y d;  3MG3 A;  1IV9 A;  3MHE A;  3G16 A;  3UNL A;  1K28 A;  1EA2 A;  1JBS A;  2XSO B;  2XSH B;  3MPH A;  1TFK A;  2PZV A;  4FMD A;  3X3Z A;  4BU4 A;  1CH0 A;  3QK9 A;  4JRF A;  4BTX A;  1PFP A;  4DKI A;  1GY6 A;  1AY7 A;  1MNL A;  2B1X B;  1BVI A;  3JUQ A;  2CWT A;  1B2X A;  3H3H A;  1BNJ A;  2KF4 A;  2F99 A;  4O3V A;  3U1W A;  1TRQ A;  1BUQ A;  3FSD A;  4N6T A;  3WHO A;  3OW2 2;  3AHS A;  2CH9 A;  1V58 A;  4K1U A;  4XBT A;  1US1 A;  5D81 A;  4N6M A;  3GZY B;  1IQ8 A;  3HZP A;  1W4N A;  3KII A;  1OHS A;  2BNG A;  2ML6 A;  2UUG C;  2W9Q A;  1CEW I;  3CCQ 3;  1Q82 4;  1M90 4;  3PXM A;  1FUW A;  1D6Y A;  3A76 A;  2F5M A;  1RGF A;  4EYC A;  5IER A;  3Q1C A;  2IUK A;  4BTW A;  1ROV A;  3CCU 3;  4X2H A;  4HM8 B;  1ZS7 A; 
#chains in the Genus database with same CATH homology
 1VQ5 3;  2CFL A;  4MMX B;  3G6E 3;  1IT7 A;  1Z1S A;  2FGT A;  3CNX A;  3OWY A;  4LMI A;  3NM7 A;  2CKF B;  3N8B A;  2O3O A;  2CHC A;  1W7C A;  1VQ7 3;  1A67 A;  3FG1 A;  5BXQ A;  1YIJ 3;  1FGR A;  5AIF A;  1N9J A;  3FCS B;  5FW5 A;  4XDW A;  3T8N A;  1TP6 A;  3OWS A;  3VSY A;  1KC8 4;  1JKG B;  3FH1 A;  3CD6 3;  3GZX B;  2W03 A;  3EF8 A;  7STD A;  3OX9 A;  3CXC 2;  1OH0 A;  3WA2 X;  2W56 A;  3QRD A;  3X3X A;  1QVF 2;  1RKY A;  3K63 A;  1ASK A;  1YHQ 3;  2GU3 A;  3ALA A;  2MC8 A;  1YIT 3;  3I0Y A;  4WWU C;  1RJO A;  1W6C A;  1M1X B;  1WMP A;  3F7S A;  3CME 3;  1FGT A;  2CFD A;  3KE7 A;  5AYS C;  1GY5 A;  1FGM A;  3WOE B;  1JB2 A;  1HU9 A;  2OCT A;  3AMO B;  3EN8 A;  3X41 A;  3CCL 3;  2SBL A;  2QA4 3;  1C7H A;  2Y73 A;  2OTL 3;  3DGM A;  1JJ2 2;  3LTB A;  4IPB A;  1MOL A;  1K73 4;  1Q40 B;  2Q07 A;  3BB9 A;  1EG9 B;  2I9W A;  3K5T A;  3PYJ A;  2WGO A;  4FR9 A;  1TFO A;  3HII A;  2GXF A;  1IU7 A;  2E2U A;  3JVC A;  1QMA A;  1O7M B;  4QWT A;  2XGN A;  3S67 A;  3CCE 3;  3GRD A;  1VQM 3;  1OCV A;  4O8S A;  1N5H A;  3IMA B;  3FGY A;  1ULI B;  4FCJ A;  2CC3 A;  2CIU A;  1W01 A;  1IQY A;  1FGQ A;  3MG2 A;  3PGB A;  3LXU X;  5JPU A;  4HVN A;  1S5A A;  1TIJ A;  3DXO A;  1A2K A;  3FZW A;  3KZT A;  3VGN A;  2HML B;  3CMA 3;  1IT8 A;  3G8Z A;  3FF0 A;  3UL6 A;  3B4O A;  1GD3 A;  4R4K A;  1W02 A;  1UUV B;  3CC2 3;  1RRL A;  3JUN A;  4HM2 B;  1W2B 2;  2Z6B A;  2RFR A;  4O2H A;  5ELU A;  1W6Y A;  3GZR A;  2WO0 A;  3FKA A;  3N54 B;  3F7X A;  1ZX2 A;  2WOH A;  1NDO B;  2HMO B;  3S5C A;  2XFT A;  1FA3 A;  2C11 A;  3RDE A;  1TU5 A;  1O7N B;  2GBW B;  1M1K 4;  1F8N A;  4KVH A;  1D6U A;  5HGR A;  4XB5 A;  1LOX A;  2OQE A;  2XFS A;  3KSE D;  1WTH A;  1IQX A;  1SII A;  1T5Y A;  2W6J H;  2HMM B;  2GEX A;  5CK6 A;  5IG0 A;  4HM1 B;  5AYR B;  4GB5 A;  3T0U A;  5AEW B;  1IVX A;  1RRH A;  2JQ5 A;  2CG1 A;  1JKG A;  5JBS A;  1VQ4 3;  3EJV A;  3IJE B;  5EQL A;  2XGL A;  3LOY A;  5KP1 A;  4XDV A;  3EBY A;  1VQK 3;  3BNE A;  2L4V A;  3GZB A;  3NM2 A;  3SXX A;  2P05 A;  4J9A A;  1GS3 A;  2CFW A;  2D42 A;  3BLZ A;  3LT9 A;  4GL6 A;  4HM4 B;  1RN7 A;  1DVC A;  4RBN A;  1L5G B;  1OHP A;  1WNH A;  2RCD A;  4R80 A;  2Y74 A;  1IDP A;  5I97 A;  2QEX 3;  1U5O A;  3AMO A;  1ISK A;  4KFF A;  5AEU B;  3DMC A;  1GYB A;  4R9K A;  3MYT A;  1Q40 A;  4LEH A;  4HM3 B;  1UI8 A;  4NRE A;  5LC7 A;  1DMQ A;  5CXO A;  4AKZ A;  3Q90 A;  2P0M A;  1OGX A;  2ML5 A;  1O7P B;  2BMO B;  1W6G A;  3JUP A;  1D6Z A;  3WOF B;  5IG3 A;  1W5Z A;  2KXG A;  4TX4 A;  1WMN A;  1GY7 A;  5EVH A;  4EBG A;  4HZB B;  3LML A;  3LTC A;  1KWI A;  1OUN A;  2CWV A;  4HJL B;  1NJI 4;  1QAL A;  2XF3 A;  1ULJ B;  2F86 B;  3CNM A;  3CPO A;  2F98 A;  3NUV A;  3I56 3;  3K0Z A;  1VQL 3;  1OF5 B;  1YJN 3;  1IVV A;  2KRT A;  4K90 B;  3EHC A;  4EV2 A;  1E3R A;  3BNC A;  3EQQ B;  4N6L A;  4K61 A;  5IG4 A;  1AV4 A;  2CK3 H;  3NBR A;  1N5P A;  1A90 A;  2GU1 A;  1KSI A;  1G96 A;  1OAC A;  3DM8 A;  5AIG A;  3FG3 A;  4WYK A;  1DYU A;  5KP4 A;  3G0K A;  3LT8 A;  3CCV 3;  1SQW A;  4H61 A;  1CQS A;  3K7C A;  1N9E A;  3DY5 A;  3CCM 3;  2LYX A;  1OPY A;  5STD A;  1Q42 A;  2YFJ B;  4HM0 B;  1JN5 B;  1WMO A;  1SJW A;  1VQ9 3;  5AII A;  1IK3 A;  3EB8 A;  3D3L A;  4PEJ A;  1SPU A;  1LXE A;  1VQN 3;  2XEP A;  1UW1 A;  2PNC A;  1VQ8 3;  2W0Q A;  3X40 A;  1J2B A;  3TDG A;  3N9H A;  4HM5 B;  3PZW A;  1SIH A;  3K9M C;  2XRX B;  5AI1 A;  2M7O A;  3KSP A;  3GAX A;  1YGE A;  3NBB A;  4LSO A;  3ROB A;  5D82 A;  1JV2 B;  3M8C A;  4CCV A;  4STD A;  1JRQ A;  3NBJ A;  3SOY A;  1QJG A;  2GBX B;  3HIG A;  1IV7 A;  5EEO A;  5TGN A;  4WFO A;  3WMD A;  1JNQ A;  2B24 B;  2STD A;  2RSX A;  3T8U A;  3O8Y A;  3EE1 A;  2RGQ A;  3B4P A;  2Z77 A;  3OV4 A;  3OWU A;  3WA3 A;  1K8A 4;  1W2Z A;  3MG1 A;  3SOA A;  2W9P A;  4KFE A;  4FMA A;  2O9U X;  4N6U A;  1ROA A;  2GEY A;  3WDG B;  1AVK A;  4Q53 A;  1JB5 A;  4N6N B;  1NO3 A;  1OF5 A;  5AIH A;  5A0O B;  4KFD A;  4BTY A;  2BT3 A;  1YJ9 3;  4J8T A;  4NHF A;  3HK4 A;  3X42 A;  2IMJ A;  5JPP A;  4H3U A;  4AKY A;  3SVA A;  3D9R A;  2FNQ A;  1GD4 A;  3CCJ 3;  1QVG 2;  4XBX A;  3NXJ A;  4R1K A;  4MMY B;  3F8H A;  1S72 3;  1O7W B;  1WQL B;  2E2V A;  3BNB A;  4U13 A;  4EC6 A;  4HM7 B;  3S27 A;  3DGO A;  2CFK A;  1DMN A;  1UUW B;  1JN5 A;  3HI7 A;  4OVM A;  3LYG A;  1FGO A;  3EX9 A;  4LZI A;  3OXA A;  2QIY A;  2K0M A;  3NV0 B;  4LGQ A;  1QAF A;  1VQ6 3;  1TUH A;  4XM4 A;  4MJD A;  2XH9 A;  2ZDJ A;  3V92 A;  4WP5 A;  1Q7Y 4;  1JB4 A;  1OGZ A;  1V74 A;  1W00 A;  4OUQ A;  1M9G A;  2IA7 A;  2JDI H;  3DUK A;  2BO9 B;  3JUM A;  2OQE C;  3S29 A;  3LTD A;  4FCM A;  3CU3 A;  3EBT A;  2OTJ 3;  4MMZ B;  1UI7 A;  3DGL A;  1CYV A;  1R4C A;  3FLJ A;  4JF8 A;  5DRV A;  3CCS 3;  2D1W A;  2INX A;  5IG5 A;  1YI2 3;  2W04 A;  2WOF A;  3F14 A;  3HX8 A;  2HMN B;  4FMB A;  5IEO A;  1NU3 A;  3NQZ A;  3E99 A;  1YVB I;  3SED A;  1VZZ A;  3KKG A;  1NWW A;  2CWU A;  3NQY A;  1EQK A;  3LTA A;  2BMR B;  1LVN A;  2A15 A;  2CG0 A;  3G4S 3;  2P09 A;  3JUO A;  3CPW 2;  5KP3 A;  3RGA A;  1IVW A;  1E3V A;  3I55 3;  3NX0 A;  4RNY A;  3F8X A;  1N8Q A;  4FMC A;  2OOV A;  1K9M 4;  2BHM A;  2XR8 B;  4L8P A;  3X3Y A;  2OWP A;  3LH4 A;  2R4I A;  1YJW 3;  3DZL A;  3LZA A;  1IVU A;  2YX9 A;  1LNH A;  4N6O B;  2IUJ A;  4HYZ A;  4RZM A;  3F9S A;  1EKM A;  3MSO A;  3U97 A;  2FXT A;  3WOD G;  8CHO A;  4ORL A;  5IW9 A;  4L7K A;  3PCS A;  1CYU A;  3EN1 B;  2KCD A;  3F40 A;  2CW9 A;  5CF2 A;  1O7H B;  3NHX A;  4AEQ A;  1Y4K A;  1QAK A;  3SX1 A;  1KQS 2;  1U8C B;  3DGN A;  2HMJ B;  4EXR A;  3IPT A;  5FGO A;  3CCR 3;  2Z7A A;  2Z76 A;  3FF2 A;  5D83 A;  3NV0 A;  3BND A;  3UB1 A;  2K54 A;  3B7C A;  3S28 A;  4RNZ A;  2CFG A;  3V98 A;  1VQO 3;  1Q86 4;  2WGQ A;  3L0R A;  2YFL B;  4WHA A;  4OK0 A;  2V1L A;  4K1V A;  3PS8 A;  1ZO2 A;  2E2T A;  3PCR A;  3VF1 A;  1Q81 4;  2OOV C;  2W2C A;  1NB3 I;  1K41 A;  4XBY A;  3G71 3;  2MF7 A;  3B8L A;  5LC6 A;  3MKI A;  1A2V A;  5CLK A;  4FCZ A;  5DRE A;  3CC4 3;  5IF6 A;  1NB5 I;  1AVL A;  1AR0 A;  4R9L A;  1STF I;  3SLU A;  1DVD A;  3ECF A;  4HM6 B;  1STD A;  2ZL8 A;  4N6V 0;  4IIA A;  3Q2P A;  1O7G B;  3GWR A;  4HKV B;  2W56 B;  3ER7 A;  4I4K A;  1KD1 4;  2HMK B;  4L8O A;  4WYK B;  4EV5 A;  3V99 A;  1DMM A;  4MEI A;  3FG4 A;  3EC9 A;  2BMQ B;  5IEN A;  1VQP 3;  4ZM8 A;  4X2O A;  3UJM A;  1PU4 A;  3H51 A;  1HKX A;  4HZ9 B;  1N8R 4;  5ELJ A;  4G1M B;  3STD A;  2LQV A;  1OHO A;  4N3V A;  1E97 A;  2P38 A;  2P0X A;  4HBR A;  3KFQ C;  5G2G A;  3KN4 A;  2UX0 A;  2C10 A;  2YFI B;  4KZ1 A;  4CDL A;  3UL5 A;  3RGR A;  5IEP A;  3CC7 3;  5CF1 A;  6STD A;  3MWZ A;  4O02 B;  5BVB A;  4IT7 A;  3J7Y d;  3MG3 A;  1IV9 A;  3MHE A;  3G16 A;  3UNL A;  1K28 A;  1EA2 A;  2XSO B;  2XSH B;  3MPH A;  1TFK A;  2PZV A;  4FMD A;  3X3Z A;  3QK9 A;  4JRF A;  4BTX A;  1PFP A;  1GY6 A;  1MNL A;  2B1X B;  3JUQ A;  2CWT A;  3H3H A;  4O3V A;  2F99 A;  3U1W A;  1BUQ A;  3FSD A;  4N6T A;  3OW2 2;  2CH9 A;  4K1U A;  4XBT A;  1US1 A;  5D81 A;  4N6M A;  3GZY B;  1IQ8 A;  3HZP A;  1W4N A;  3KII A;  1OHS A;  2BNG A;  2ML6 A;  2W9Q A;  3CCQ 3;  1CEW I;  1Q82 4;  1M90 4;  3PXM A;  1FUW A;  1D6Y A;  3A76 A;  4EYC A;  5IER A;  3Q1C A;  2IUK A;  4BTW A;  1ROV A;  3CCU 3;  4X2H A;  4HM8 B;  2QGU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...