1K41A

Crystal structure of ksi y57s mutant
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
125
structure length
121
Chain Sequence
b'NLPTAQEVQGLMARYIELVDVGDIEAIVQMYADDATVEDPFGQPPIHGREQIAAFSRQGKVRACLTGPVRASHNGCGAMPFRVEMVWNGQPCALDVIDVMRFDEHGRIQTMQAYWSEVNLS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ketosteroid Isomerase
molecule tags Isomerase
source organism Pseudomonas putida
publication title Maintenance of alpha-helical structures by phenyl rings in the active-site tyrosine triad contributes to catalysis and stability of ketosteroid isomerase from Pseudomonas putida biotype B
pubmed doi rcsb
total genus 31
structure length 121
sequence length 125
chains with identical sequence B
ec nomenclature ec 5.3.3.1: Steroid Delta-isomerase.
pdb deposition date 2001-10-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12680 SnoaL_2 SnoaL-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.50 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 1k41A00
2K54A 2Z77A 4HKVB 2XSHB 2JQ5A 5STDA 1EA2A 1W02A 3I0YA 2XRXB 3OWSA 2A15A 4J9AA 1QMAA 5IERA 5KP4A 1E3RA 5DRVA 2GBWB 1JKGA 3FKAA 4HM5B 4K1VA 4H3UA 5JPPA 4OUQA 1QJGA 2GEYA 3FSDA 5EVHA 3H51A 3GRDA 3H3HA 1A2KA 5AEUB 3FH1A 1W01A 3JUPA 3K7CA 3JUMA 1OF5B 2GEXA 2R4IA 3F8HA 4XBTA 3OWUA 4OVMA 5HGRA 1TUHA 2RGQA 2B1XB 3DUKA 3NV0A 4HM2B 4LGQA 3G0KA 3F14A 4J8TA 1NDOB 5AIFA 2Z76A 1S5AA 4R1KA 3F7SA 3HX8A 4KVHA 5IG4A 2IMJA 4HM3B 4IIAA 3GZYB 2CHCA 4X2OA 1VZZA 1W00A 3ROBA 2YFLB 3WMDA 2UX0A 3E99A 3EF8A 5IF6A 5IEPA 3K0ZA 2GBXB 3FF2A 1JN5A 3ECFA 5AIIA 4FCMA 1BUQA 2I9WA 3IPTA 2W2CA 1STDA 3JUQA 1O7WB 1Z1SA 3DM8A 2F99A 3JUNA 3NM2A 5D83A 1O7PB 3KE7A 3CU3A 4WWUC 1JB2A 3F7XA 1GY5A 1OH0A 1Q40B 1OUNA 2RFRA 4GB5A 2B24B 4HJLB 4HVNA 2HMJB 4N3VA 5CLKA 3VSYA 1GS3A 3G8ZA 4HZ9B 4Q53A 4LEHA 3OV4A 4XB5A 5TGNA 1IDPA 2F86B 3FF0A 4WYKA 5AEWB 2BMOB 5KP1A 1GYBA 4XBXA 1JKGB 4HM6B 1K41A 2STDA 1EG9B 2YFJB 4WYKB 1E3VA 2F98A 3B8LA 3CPOA 4L7KA 3NBRA 4WP5A 1WQLB 3MG3A 3MYTA 4LMIA 1UUVB 5IG0A 3Q90A 3MHEA 3JUOA 3KSPA 3D9RA 5CXOA 3M8CA 3EX9A 1OHOA 5CF1A 5DREA 3FZWA 3KKGA 1Q42A 3F8XA 3SOYA 5IEOA 4CDLA 7STDA 2HMMB 3DMCA 3OXAA 5KP3A 3EN8A 3F9SA 3G16A 5G2GA 1GY7A 3LYGA 2BMRB 3RGRA 1TP6A 4HM0B 1CQSA 1DMQA 1NWWA 1O7NB 1ULJB 3EC9A 3FLJA 3NXJA 3GZXB 3HZPA 4HM7B 2HMNB 4ORLA 3UNLA 4L8PA 1DMNA 3STDA 1DMMA 2INXA 3GZBA 1O7HB 3NV0B 4R9LA 4STDA 3CNXA 3FGYA 5BVBA 3HK4A 4L8OA 1JB5A 2HMLB 5AIGA 5CF2A 4PEJA 3EQQB 3OWYA 1OHPA 4XM4A 3A76A 1C7HA 5BXQA 3EBYA 2QIYA 2QGUA 3KZTA 3MSOA 1OF5A 5AI1A 2XSOB 2OWPA 1ZX2A 1GY6A 4FCJA 4XDVA 4XDWA 1ULIB 3S5CA 1NU3A 1E97A 1ZO2A 1SJWA 3MG2A 5IG5A 3OX9A 1OGXA 1OPYA 3UJMA 2BMQB 1ISKA 3BLZA 4MJDA 3EN1B 8CHOA 3DXOA 4U13A 2PZVA 1OHSA 1JN5B 2RCDA 2YFIB 3ER7A 1O7MB 3MG1A 3B4PA 5IG3A 1OCVA 5IENA 1Q40A 3SEDA 4HM4B 1HKXA 4RZMA 2HMOB 1ASKA 1AR0A 3CNMA 3DZLA 3GZRA 3SOAA 1JB4A 1W6YA 4I4KA 2HMKB 3EBTA 3NUVA 3NHXA 2CKFB 2GXFA 1O7GB 1OGZA 3EHCA 4K1UA 4R9KA 4HM8B 3VGNA 6STDA 2XR8B 3BB9A 5JPUA 3B4OA 5AIHA 5D82A 3EJVA 4HM1B 4X2HA 3B7CA 5CK6A 5FW5A 3T8NA 1U5OA 3GWRA 3RGAA 2BNGA 2Z7AA 3T8UA 5D81A 1UUWB 3MKIA 4HZBB 3F40A 3LZAA 4XBYA
chains in the Genus database with same CATH superfamily
2K54A 2Z77A 5STDA 4OK0A 1EA2A 3DGYA 3I0YA 1RGGA 3OWSA 4O02B 1E3RA 2GBWB 1JKGA 4BIRA 4N6UA 3WDGB 4NHFA 4K1VA 4H3UA 3VF1A 3S28A 1MWSA 1FGTA 2GEYA 3FSDA 7GSPA 3H3HA 5AEUB 2CX1A 1QAKA 3JUPA 1BANA 3K7CA 4HYZA 1VQN3 2XGNA 4XBTA 3F8HA 3U1WA 5HGRA 5ELJA 1RRHA 5AYRB 4J5KA 3LMLA 3F14A 5AIFA 1VQ83 2Z76A 1S5AA 2M7OA 3ZG5A 4HM3B 1IYYA 5IF6A 1W6GA 3WMDA 2GBXB 3FF2A 1BSAA 1JN5A 2E2TA 3ECFA 4FCMA 3WHOA 2IY2A 1AY7A 2IUKA 5HOHA 1O7PB 2BT3A 2KRTA 2W9QA 3HIIA 1Q40B 4HVNA 5CLKA 1HYFA 3BNBA 3CPW2 3G8ZA 4XB5A 1IDPA 1F8NA 1B2ZA 1JKGB 1YJN3 2STDA 2YFJB 2KF5A 2P09A 1JRQA 4L7KA 2P0XA 1MWRA 3NBRA 2P05A 1RRLA 1WQLB 3V98A 1UUVB 4BTWA 3I563 5EQLA 2LYXA 1UCIA 1YJ93 3T0UA 5AYSC 2OOVC 1RNBA 3EX9A 1N8QA 1OHOA 5CF1A 1N9JA 1Q42A 4KFDA 1GMQA 1DVDA 7STDA 2HMMB 1W5ZA 5KP3A 3EN8A 3G16A 3BU4A 3RGRA 3CCQ3 1I0XA 4HM0B 3V92A 1CQSA 1DMQA 1FYSA 1BIRA 1O7NB 1ULJB 3FLJA 1PYLA 5M19A 2HMNB 1BNIA 2V1LA 3KSED 4L8PA 5G1KA 3I553 1B20A 4O8SA 1YGWA 1RGFA 1B27A 2CWTA 3FGYA 3HK4A 4L8OA 2HMLB 3AHSA 4RNZA 5AIGA 5CF2A 3O8YA 4AKZA 1DVCA 1UGHI 5FGOA 2J8XB 5BXQA 1KQS2 1OF5A 1BUJA 3DH2A 5ELUA 1ZX2A 4FCJA 3WR2A 3S29A 4N6V0 3U97A 1RDSA 3MG2A 5IW9A 1VQ53 3OX9A 3D5IA 4I5QA 1GOYA 1QALA 1UI8A 2BIRA 3ZG0A 2BMQB 1YHQ3 1N9EA 4K90B 2ZHXB 1ISKA 1MGRA 2O3OA 2SARA 4BL3A 3EN1B 4KZ1A 1QVF2 3K5TA 4G1MB 4MMXB 2RCDA 3NX0A 3NQZA 4N6MA 1CYUA 1YIJ3 3A5EA 4GL6A 7RNTA 1RCKA 4RZMA 3GZRA 1ASKA 1AR0A 1ZGXA 1US1A 4AEQA 5BU4A 1YJW3 4I4KA 3EBTA 3KN4A 1LOVA 1O7GB 1U8CB 4R9KA 4K61A 5G1LA 1B2UA 3PCRA 6STDA 2XR8B 5AIHA 3LH4A 1LQMB 1LVNA 3BNCA 4HM1B 2Z6BA 2D42A 4N6OB 5CK6A 3SYUA 1K734 5D81A 1BNRA 3J7Yd 4O2HA 4XBYA 4HKVB 4N6NB 1IQYA 1EEJA 1BVIA 3LTDA 1PY3A 1W02A 3K9MC 1G02A 4IPBA 4J9AA 3X42A 1BRGA 2WOFA 5IERA 1K9M4 1KWIA 2RNTA 1A2PA 1IV7A 3MWZA 1QJGA 1BGSA 1VQM3 4ZM8A 1GMRA 3CC23 2CX0A 1UW1A 1A2KA 1TFOA 1BSEA 1I0VA 3BNDA 3JUMA 2R4IA 2GEXA 4HAAA 4BTXA 3DUKA 4RNYA 2F5MA 1IV9A 2F56A 5JBSA 4HM2B 3G0KA 1TFKA 1TU5A 1MGWA 1RHLA 2XGLA 2CWUA 2IMJA 4KVHA 2RSXA 5M1AA 3D4AA 2CHCA 1NO3A 2C4BA 2H0IA 3ROBA 3EF8A 3E99A 5LC7A 1M1XB 2E2UA 2MF7A 4EV2A 2WOHA 1W7CA 2I9WA 1DE3A 1O7WB 3DM8A 1GMPA 4KFFA 3DY5A 3KE7A 1VQ93 1GY5A 1OH0A 1OUNA 2GSPA 1FGQA 1FGRA 2B24B 2IA7A 2YX9A 1AV4A 4HZ9B 4Q53A 5IEPA 3OV4A 3FG3A 1HU9A 1YNVX 3Q1CA 1B2XA 4LZIA 5RNTA 2BMOB 1YI23 1IT7A 1GYBA 3MPHA 1K41A 4CPKA 3B8LA 1X1WA 1JNQA 3CPOA 4FR9A 2BU4A 1WMNA 3MG3A 5IG0A 1IVUA 1C54A 3JUOA 3KSPA 4EC6A 2CWVA 2F5WA 4LYLB 1D6UA 1UUGB 2UUGC 4R4KA 5DREA 3SOYA 2ZL8A 3KKGA 3KIIA 1TTOA 3KCHA 1CH0A 3N54B 3OXAA 3SXXA 5G2GA 1WMOA 1GY7A 4QWTA 1KSIA 3T8NA 3G6E3 4HM7B 1RGKA 3GZXB 4ORLA 1JZOA 1JBRA 1DMNA 1GD4A 2INXA 5BVBA 2XF3A 2CW9A 2KF6A 3OWYA 1OHPA 4EW5A 3KZTA 4H61A 1BNJA 1DETA 5AI1A 1SIHA 1Q9EA 2XSOB 1B21A 4XDWA 2OQEA 1V74A 1TRQA 1ULIB 1PFPA 1V57A 1E97A 1ZO2A 1UI7A 1RGHA 3IJEB 2FNQA 4NPBA 1IVXA 1EUIC 2CFGA 1N8R4 4RNTA 3X3ZA 3DGLA 2JDIH 1GD3A 1LRAA 1OPYA 2SBLA 3GAXA 2W56B 1TJDA 1FUWA 1T2IA 1BNEA 4BTYA 3IMAB 2PZVA 1BSCA 2MC8A 2YFIB 2CG1A 9RNTA 3B4PA 5EEOA 2OTL3 1RMSA 4HOHA 3KFQC 1Q40A 3SEDA 2E2VA 4FCZA 4FMAA 2H0GA 2HMOB 1QVG2 1JBSA 3DZLA 6GSPA 3CCU3 3NUVA 2GXFA 4K1UA 1RGCA 4HM8B 1T3BA 4FMBA 1IT8A 2CC3A 3B4OA 1YIT3 1EKMA 3LTBA 4X2HA 3CCS3 3B7CA 2D1WA 2QA43 2FXTA 3GWRA 2BNGA 4MEIA 3RGAA 1MNLA 3WOEB 3AMOA 3LZAA 2CFWA 1G96A 2WGQA 2JQ5A 3FCSB 2XRXB 3AMOB 4MMZB 4NREA 1QMAA 2OOVA 5DRVA 1BSDA 4HM5B 2OQEC 1BNSA 3NM7A 4OUQA 1W2ZA 2HOHA 4N6LA 1FZUA 4EYCA 3H51A 3GRDA 2PNCA 1NJI4 1W01A 3PCSA 5I97A 2W03A 3HI7A 1SQWA 2ZDJA 1VQO3 1I8VA 2P0MA 3OWUA 4OVMA 2RGQA 1CYVA 1IQ8A 1M1K4 3NV0A 3CC73 4LGQA 1NDOB 3WODG 1NB5I 3HX8A 1RNTA 4IIAA 1K8A4 1VZZA 1W00A 1X1XA 2YFLB 4BU4A 2UX0A 3UL6A 3CCL3 2ML5A 3K0ZA 3CCV3 1YVSA 1I2FA 3EE1A 3JUQA 4FMDA 2R41A 1Z1SA 1LOWA 3N9HA 1BNFA 1ROVA 3NM2A 1RKYA 3UB1A 1IVVA 1VQQA 3BIRA 4WWUC 1JB2A 3F7XA 1D6YA 4GB5A 4HJLB 3X41A 1WTHA 1CEWI 1GS3A 1GOUA 4LEHA 1OACA 5TGNA 2CG0A 4AKYA 4EBGA 5AEWB 3QK9A 1UCKA 2XFSA 3PZWA 2CIUA 1RN1A 2LQVA 3HIGA 4XBXA 5KP1A 2XH9A 4MMYB 1R4YA 1BU4A 2KF3A 2ZA4A 4LMIA 1ZS7A 1AVLA 3D79A 5CXOA 3M8CA 1JJ22 3OW22 2P38A 4GHOA 1MOLA 3X3XA 3DMCA 3F9SA 1X1UA 1FW7A 1Y4KA 1IVWA 1TP6A 1FUTA 3URPA 1NWWA 1BUQA 3PYJA 3EC9A 3UNLA 3NXJA 2H0HA 1T5YA 4R80A 2O9UX 3STDA 1UGIA 1FUSA 3GZBA 3NV0B 4R9LA 4STDA 2RBIA 3CNXA 1GOVA 3LXUX 4ILFA 1UDII 1RGLA 4CCVA 1S723 3D3LA 3EQQB 1SPUA 3A76A 1C7HA 4TX4A 2QIYA 1B3SA 2QGUA 1B2SA 2OWPA 4XDVA 2WO0A 3S5CA 3SX1A 1SJWA 1M9GA 1JZDA 1STFI 2OCTA 2XEPA 1UCJA 4FMCA 1SIIA 4KFEA 3CMA3 3ALAA 2F4YA 1VQ73 2KXGA 1D6ZA 3PGBA 1VQL3 1BRJA 1LNIA 3BLZA 2KF4A 4MJDA 1I3IA 3DXOA 8CHOA 1OHSA 2XFTA 3G4S3 1TIJA 2W9PA 4JRFA 1O7MB 2Q07A 1NNVA 3MG1A 3S67A 3CCM3 1BRNL 1WNHA 5IG3A 2FGTA 3PS8A 2W04A 5A0OB 4HM4B 1WMPA 3AGOA 3LT8A 3CNMA 4JF8A 1BRIA 3SOAA 3V99A 1JB4A 1X1YA 2HMKB 2CKFB 3HOHA 3EHCA 2CH9A 3LT9A 4WHAA 1MWTA 3CCR3 3AGNA 1KC84 3BB9A 3CME3 1V58A 3Q3FA 1L5GB 3QRDA 3RNTA 5FW5A 4LSOA 1U5OA 1G0TA 2Z7AA 3T8UA 1LXEA 4HZBB 2K3DA 2Y74A 2XSHB 3UL5A 1IK3A 2BHMA 3DGOA 4HBRA 1PU4A 1BRSA 1B2MA 2A15A 2IYJA 5KP4A 3WA3A 2CFDA 2W6JH 3FKAA 2AAEA 3NBBA 4EV5A 5JPPA 5EVHA 1BRKA 1BNGA 3DGNA 3FH1A 1R4CA 4EXRA 1N5PA 1OF5B 3EB8A 1K28A 1TUHA 2B1XB 2W0QA 1AQZA 1RN7A 3FG4A 4J8TA 8RNTA 3L0RA 4R1KA 3K63A 2GU1A 3F7SA 1Q864 2L4VA 3CCE3 3N8BA 3GZYB 4X2OA 1AVKA 1N5HA 2W56A 3NBJA 1RLSA 1YVBI 3JVCA 2CK3H 5AIIA 2OTJ3 4N6TA 3LOYA 3IPTA 2W2CA 1STDA 1BSBA 1JV2B 5M18A 5IG4A 1BRHA 2F99A 3JUNA 2KAAA 1LOXA 1NB3I 3CU3A 2RFRA 3DGMA 5GSPA 4N3VA 5LC6A 1FGOA 2CFLA 2HMJB 1RGAA 3VSYA 2F86B 3FF0A 4WYKA 3WOFB 3SLUA 1LQGC 1RSNA 4CJNA 1W2B2 1VQ63 1A90A 3LTAA 4HM6B 1RGEA 5D83A 1EG9B 1RTUA 4WYKB 1E3VA 2F98A 2K0MA 4J5GA 4WP5A 1YGEA 3S27A 3CC43 1J2BA 3MYTA 3TDGA 2QEX3 1IU7A 1UCLA 2Y73A 3MHEA 3Q90A 4WFOA 3D9RA 3X40A 2UGIA 1RN4A 1JBTA 4KT3B 1HZ1A 3FZWA 3GSPA 3F8XA 3NQYA 4CDLA 5IEOA 1RCLA 3SVAA 1RJOA 3LYGA 2BMRB 2ML6A 3HZPA 3AHWA 1LOYA 3LTCA 1DMMA 1A67A 1EQKA 1O7HB 3CD63 3CXC2 2AADA 1JB5A 4O3VA 1LNHA 1I3FA 4PEJA 4XM4A 1Q824 1I2GA 3EBYA 1KD14 3MSOA 1FGMA 1T2HA 1GY6A 1W6CA 1QAFA 1NU3A 2BO9B 1FA3A 3RDEA 2C10A 5IG5A 2WGOA 2KCDA 3ZFZA 1OGXA 1IQXA 3UJMA 6RNTA 3CCJ3 1W4NA 1M904 4U13A 1JN5B 3X3YA 1I2EA 3ER7A 1VQ43 1VQP3 1BOXA 2L1SA 1BAOA 3FG1A 3Q2PA 1OCVA 4DKIA 5IENA 1Q7Y4 1HKXA 1Q7HA 2C11A 2GU3A 1W6YA 3NHXA 1OGZA 4IT7A 4RBNA 3PXMA 5BIRA 1Q814 1DYUA 1MWUA 3BNEA 2IUJA 4GSPA 3VGNA 5JPUA 3WA2X 3D5GA 5D82A 3EJVA 1SARA 1ROAA 4BL2A 3G713 1GSPA 1A2VA 1TRPA 1UUWB 3MKIA 2CFKA 3F40A 1VQK3 1I70A
chains in the Genus database with same CATH topology
2K54A 2Z77A 5STDA 4OK0A 1EA2A 4O02B 3I0YA 3OWSA 1E3RA 2GBWB 1JKGA 4N6UA 3WDGB 4NHFA 4K1VA 4H3UA 3VF1A 3S28A 1FGTA 2GEYA 3FSDA 3H3HA 5AEUB 1QAKA 3JUPA 4HYZA 3K7CA 1VQN3 2XGNA 4XBTA 3F8HA 3U1WA 5HGRA 5ELJA 1RRHA 5AYRB 3LMLA 3F14A 5AIFA 1VQ83 2Z76A 1S5AA 2M7OA 4HM3B 5IF6A 1W6GA 3WMDA 2GBXB 3FF2A 1JN5A 2E2TA 3ECFA 4FCMA 2IUKA 1O7PB 2BT3A 2KRTA 2W9QA 3HIIA 1Q40B 4HVNA 5CLKA 3BNBA 3CPW2 3G8ZA 4XB5A 1IDPA 1F8NA 1JKGB 1YJN3 2STDA 2YFJB 2P09A 1JRQA 4L7KA 2P0XA 3NBRA 2P05A 1RRLA 1WQLB 3V98A 1UUVB 4BTWA 3I563 5EQLA 2LYXA 1YJ93 3T0UA 5AYSC 2OOVC 3EX9A 1N8QA 1OHOA 5CF1A 1N9JA 1Q42A 4KFDA 1DVDA 7STDA 2HMMB 1W5ZA 5KP3A 3EN8A 3G16A 3CCQ3 3RGRA 4HM0B 3V92A 1CQSA 1DMQA 1O7NB 1ULJB 3FLJA 2HMNB 2V1LA 3KSED 4L8PA 3I553 4O8SA 2CWTA 3FGYA 3HK4A 4L8OA 2HMLB 4RNZA 5AIGA 5CF2A 3O8YA 4AKZA 1DVCA 5FGOA 5BXQA 1KQS2 1OF5A 5ELUA 1ZX2A 4FCJA 3S29A 4N6V0 3U97A 3MG2A 5IW9A 1VQ53 3OX9A 1QALA 1UI8A 2BMQB 1YHQ3 1N9EA 4K90B 1ISKA 2O3OA 3EN1B 4KZ1A 1QVF2 3K5TA 4G1MB 4MMXB 2RCDA 3NX0A 3NQZA 4N6MA 1CYUA 1YIJ3 4GL6A 4RZMA 3GZRA 1ASKA 1AR0A 4AEQA 1US1A 1YJW3 4I4KA 3EBTA 3KN4A 1U8CB 1O7GB 4R9KA 4K61A 3PCRA 6STDA 2XR8B 5AIHA 3LH4A 1LVNA 3BNCA 4HM1B 2Z6BA 2D42A 4N6OB 5CK6A 1K734 5D81A 3J7Yd 4O2HA 4XBYA 4HKVB 4N6NB 1IQYA 3LTDA 1W02A 3K9MC 4IPBA 3X42A 4J9AA 5IERA 2WOFA 1K9M4 1KWIA 1IV7A 3MWZA 1QJGA 1VQM3 4ZM8A 3CC23 1UW1A 1A2KA 1TFOA 3BNDA 3JUMA 2R4IA 2GEXA 4BTXA 3DUKA 4RNYA 1IV9A 5JBSA 4HM2B 3G0KA 1TFKA 1TU5A 2XGLA 2CWUA 2IMJA 4KVHA 2RSXA 5IG4A 2CHCA 1NO3A 3ROBA 3EF8A 3E99A 5LC7A 1M1XB 2E2UA 2MF7A 4EV2A 2WOHA 1W7CA 2I9WA 1O7WB 3DM8A 4KFFA 3DY5A 3KE7A 1VQ93 1GY5A 1OH0A 1OUNA 1FGQA 1FGRA 2B24B 2IA7A 2YX9A 1AV4A 4HZ9B 4Q53A 5IEPA 3OV4A 3FG3A 1HU9A 3Q1CA 4LZIA 2BMOB 1YI23 1IT7A 1GYBA 3MPHA 1K41A 3B8LA 1JNQA 3CPOA 4FR9A 1WMNA 3MG3A 5IG0A 1IVUA 3JUOA 3KSPA 4EC6A 2CWVA 1D6UA 4R4KA 5DREA 3SOYA 2ZL8A 3KKGA 3KIIA 3N54B 3OXAA 3SXXA 5G2GA 1WMOA 1GY7A 4QWTA 1KSIA 3T8NA 3G6E3 4HM7B 3GZXB 4ORLA 1DMNA 1GD4A 2INXA 5BVBA 2XF3A 2CW9A 3OWYA 1OHPA 3KZTA 4H61A 5AI1A 1SIHA 2XSOB 4XDWA 2OQEA 1V74A 1ULIB 1PFPA 1E97A 1UI7A 1ZO2A 3IJEB 2FNQA 1IVXA 2CFGA 1N8R4 3X3ZA 3DGLA 2JDIH 1GD3A 1OPYA 2SBLA 3GAXA 2W56B 1FUWA 4BTYA 3IMAB 2PZVA 2MC8A 2YFIB 2CG1A 3B4PA 5EEOA 2OTL3 3KFQC 1Q40A 3SEDA 2E2VA 4FCZA 4FMAA 2HMOB 1QVG2 3DZLA 3CCU3 3NUVA 2GXFA 4K1UA 4HM8B 4FMBA 1IT8A 2CC3A 3B4OA 1YIT3 1EKMA 3LTBA 4X2HA 3CCS3 3B7CA 2D1WA 2QA43 2FXTA 3GWRA 2BNGA 4MEIA 3RGAA 1MNLA 3WOEB 3AMOA 3LZAA 2CFWA 1G96A 2WGQA 2JQ5A 3FCSB 2XRXB 3AMOB 4MMZB 4NREA 1QMAA 2OOVA 5DRVA 4HM5B 2OQEC 3NM7A 4OUQA 1W2ZA 4N6LA 4EYCA 3H51A 3GRDA 2PNCA 1NJI4 1W01A 3PCSA 5I97A 2W03A 3HI7A 1SQWA 2ZDJA 1VQO3 3OWUA 2P0MA 4OVMA 1M1K4 2RGQA 1CYVA 1IQ8A 3NV0A 3CC73 4LGQA 1NDOB 3WODG 1NB5I 3HX8A 4IIAA 1K8A4 1VZZA 1W00A 2YFLB 2UX0A 3UL6A 3CCL3 2ML5A 3K0ZA 3CCV3 3EE1A 3JUQA 4FMDA 1Z1SA 3N9HA 3NM2A 1ROVA 1RKYA 3UB1A 1IVVA 4WWUC 1JB2A 3F7XA 1D6YA 4GB5A 4HJLB 3X41A 1WTHA 1CEWI 1GS3A 4LEHA 1OACA 5TGNA 2CG0A 4AKYA 4EBGA 5AEWB 3QK9A 2XFSA 3PZWA 2CIUA 2LQVA 3HIGA 4XBXA 5KP1A 2XH9A 4MMYB 4LMIA 1AVLA 5CXOA 3M8CA 1JJ22 3OW22 2P38A 1MOLA 3X3XA 3DMCA 3F9SA 1Y4KA 1IVWA 1TP6A 1NWWA 1BUQA 3PYJA 3EC9A 3UNLA 3NXJA 4R80A 1T5YA 2O9UX 3STDA 4R9LA 3GZBA 3NV0B 4STDA 3CNXA 3LXUX 4CCVA 1S723 3D3LA 3EQQB 1SPUA 3A76A 1C7HA 4TX4A 2QIYA 2QGUA 2OWPA 4XDVA 2WO0A 3S5CA 3SX1A 1SJWA 1M9GA 2XEPA 1STFI 2OCTA 4FMCA 4KFEA 1SIIA 3CMA3 3ALAA 1VQ73 2KXGA 1D6ZA 3PGBA 1VQL3 3BLZA 4MJDA 8CHOA 3DXOA 1OHSA 2XFTA 3G4S3 1TIJA 2W9PA 4JRFA 1O7MB 2Q07A 3MG1A 3S67A 3CCM3 1WNHA 5IG3A 2FGTA 3PS8A 2W04A 5A0OB 4HM4B 1WMPA 3LT8A 4JF8A 3CNMA 3SOAA 3V99A 1JB4A 2HMKB 2CKFB 3EHCA 2CH9A 3LT9A 4WHAA 3CCR3 1KC84 3BB9A 3CME3 1L5GB 3QRDA 5FW5A 4LSOA 1U5OA 2Z7AA 3T8UA 1LXEA 4HZBB 2Y74A 2XSHB 3UL5A 1IK3A 2BHMA 3DGOA 4HBRA 1PU4A 2A15A 5KP4A 3WA3A 2CFDA 2W6JH 3FKAA 3NBBA 4EV5A 5JPPA 5EVHA 3DGNA 3FH1A 1R4CA 4EXRA 1N5PA 1OF5B 3EB8A 1K28A 1TUHA 2B1XB 2W0QA 1RN7A 3FG4A 4J8TA 3L0RA 4R1KA 3K63A 2GU1A 3F7SA 1Q864 2L4VA 3CCE3 3N8BA 3GZYB 4X2OA 1AVKA 1N5HA 2W56A 3NBJA 1YVBI 3JVCA 2CK3H 5AIIA 2OTJ3 4N6TA 3LOYA 3IPTA 2W2CA 1STDA 1JV2B 3JUNA 2F99A 1LOXA 1NB3I 3CU3A 2RFRA 3DGMA 4N3VA 5LC6A 1FGOA 2CFLA 2HMJB 3VSYA 2F86B 3FF0A 4WYKA 3WOFB 3SLUA 1VQ63 1W2B2 1A90A 3LTAA 4HM6B 5D83A 1EG9B 4WYKB 1E3VA 2F98A 2K0MA 3S27A 4WP5A 1YGEA 3CC43 1J2BA 3MYTA 3TDGA 2QEX3 1IU7A 4WFOA 2Y73A 3MHEA 3Q90A 3D9RA 3X40A 3FZWA 3NQYA 3F8XA 4CDLA 5IEOA 3SVAA 1RJOA 3LYGA 2BMRB 3HZPA 3LTCA 1DMMA 1A67A 1EQKA 1O7HB 3CD63 3CXC2 1JB5A 4O3VA 1LNHA 4PEJA 4XM4A 1Q824 3EBYA 1KD14 3MSOA 1FGMA 1GY6A 1W6CA 1QAFA 1NU3A 2BO9B 1FA3A 3RDEA 2C10A 5IG5A 2WGOA 2KCDA 1OGXA 1IQXA 3UJMA 3CCJ3 1W4NA 1M904 4U13A 1JN5B 3X3YA 3ER7A 1VQ43 1VQP3 3FG1A 3Q2PA 1OCVA 5IENA 1Q7Y4 1HKXA 2C11A 2GU3A 1W6YA 3NHXA 1OGZA 4IT7A 4RBNA 3PXMA 1Q814 1DYUA 2IUJA 3BNEA 3VGNA 5JPUA 3WA2X 5D82A 3EJVA 1ROAA 3G713 1A2VA 1UUWB 2ML6A 3MKIA 2CFKA 3F40A 1VQK3
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2K54 A;  2Z77 A;  4HKV B;  2XSH B;  2JQ5 A;  5STD A;  1EA2 A;  1W02 A;  3I0Y A;  2XRX B;  3OWS A;  2A15 A;  4J9A A;  1QMA A;  5IER A;  5KP4 A;  1E3R A;  5DRV A;  2GBW B;  1JKG A;  3FKA A;  4HM5 B;  4K1V A;  4H3U A;  5JPP A;  4OUQ A;  1QJG A;  2GEY A;  3FSD A;  5EVH A;  3H51 A;  3GRD A;  3H3H A;  1A2K A;  5AEU B;  3FH1 A;  1W01 A;  3JUP A;  3K7C A;  3JUM A;  1OF5 B;  2GEX A;  2R4I A;  3F8H A;  4XBT A;  3OWU A;  4OVM A;  5HGR A;  1TUH A;  2RGQ A;  2B1X B;  3DUK A;  3NV0 A;  4HM2 B;  4LGQ A;  3G0K A;  3F14 A;  4J8T A;  1NDO B;  5AIF A;  2Z76 A;  1S5A A;  4R1K A;  3F7S A;  3HX8 A;  4KVH A;  5IG4 A;  2IMJ A;  4HM3 B;  4IIA A;  3GZY B;  2CHC A;  4X2O A;  1VZZ A;  1W00 A;  3ROB A;  2YFL B;  3WMD A;  2UX0 A;  3E99 A;  3EF8 A;  5IF6 A;  5IEP A;  3K0Z A;  2GBX B;  3FF2 A;  1JN5 A;  3ECF A;  5AII A;  4FCM A;  1BUQ A;  2I9W A;  3IPT A;  2W2C A;  1STD A;  3JUQ A;  1O7W B;  1Z1S A;  3DM8 A;  2F99 A;  3JUN A;  3NM2 A;  5D83 A;  1O7P B;  3KE7 A;  3CU3 A;  4WWU C;  1JB2 A;  3F7X A;  1GY5 A;  1OH0 A;  1Q40 B;  1OUN A;  2RFR A;  4GB5 A;  2B24 B;  4HJL B;  4HVN A;  2HMJ B;  4N3V A;  5CLK A;  3VSY A;  1GS3 A;  3G8Z A;  4HZ9 B;  4Q53 A;  4LEH A;  3OV4 A;  4XB5 A;  5TGN A;  1IDP A;  2F86 B;  3FF0 A;  4WYK A;  5AEW B;  2BMO B;  5KP1 A;  1GYB A;  4XBX A;  1JKG B;  4HM6 B;  1K41 A;  2STD A;  1EG9 B;  2YFJ B;  4WYK B;  1E3V A;  2F98 A;  3B8L A;  3CPO A;  4L7K A;  3NBR A;  4WP5 A;  1WQL B;  3MG3 A;  3MYT A;  4LMI A;  1UUV B;  5IG0 A;  3Q90 A;  3MHE A;  3JUO A;  3KSP A;  3D9R A;  5CXO A;  3M8C A;  3EX9 A;  1OHO A;  5CF1 A;  5DRE A;  3FZW A;  3KKG A;  1Q42 A;  3F8X A;  3SOY A;  5IEO A;  4CDL A;  7STD A;  2HMM B;  3DMC A;  3OXA A;  5KP3 A;  3EN8 A;  3F9S A;  3G16 A;  5G2G A;  1GY7 A;  3LYG A;  2BMR B;  3RGR A;  1TP6 A;  4HM0 B;  1CQS A;  1DMQ A;  1NWW A;  1O7N B;  1ULJ B;  3EC9 A;  3FLJ A;  3NXJ A;  3GZX B;  3HZP A;  4HM7 B;  2HMN B;  4ORL A;  3UNL A;  4L8P A;  1DMN A;  3STD A;  1DMM A;  2INX A;  3GZB A;  1O7H B;  3NV0 B;  4R9L A;  4STD A;  3CNX A;  3FGY A;  5BVB A;  3HK4 A;  4L8O A;  1JB5 A;  2HML B;  5AIG A;  5CF2 A;  4PEJ A;  3EQQ B;  3OWY A;  1OHP A;  4XM4 A;  3A76 A;  1C7H A;  5BXQ A;  3EBY A;  2QIY A;  2QGU A;  3KZT A;  3MSO A;  1OF5 A;  5AI1 A;  2XSO B;  2OWP A;  1ZX2 A;  1GY6 A;  4FCJ A;  4XDV A;  4XDW A;  1ULI B;  3S5C A;  1NU3 A;  1E97 A;  1ZO2 A;  1SJW A;  3MG2 A;  5IG5 A;  3OX9 A;  1OGX A;  1OPY A;  3UJM A;  2BMQ B;  1ISK A;  3BLZ A;  4MJD A;  3EN1 B;  8CHO A;  3DXO A;  4U13 A;  2PZV A;  1OHS A;  1JN5 B;  2RCD A;  2YFI B;  3ER7 A;  1O7M B;  3MG1 A;  3B4P A;  5IG3 A;  1OCV A;  5IEN A;  1Q40 A;  3SED A;  4HM4 B;  1HKX A;  4RZM A;  2HMO B;  1ASK A;  1AR0 A;  3CNM A;  3DZL A;  3GZR A;  3SOA A;  1JB4 A;  1W6Y A;  4I4K A;  2HMK B;  3EBT A;  3NUV A;  3NHX A;  2CKF B;  2GXF A;  1O7G B;  1OGZ A;  3EHC A;  4K1U A;  4R9K A;  4HM8 B;  3VGN A;  6STD A;  2XR8 B;  3BB9 A;  5JPU A;  3B4O A;  5AIH A;  5D82 A;  3EJV A;  4HM1 B;  4X2H A;  3B7C A;  5CK6 A;  5FW5 A;  3T8N A;  1U5O A;  3GWR A;  3RGA A;  2BNG A;  2Z7A A;  3T8U A;  5D81 A;  1UUW B;  3MKI A;  4HZB B;  3F40 A;  3LZA A;  4XBY A; 
#chains in the Genus database with same CATH topology
 2K54 A;  2Z77 A;  5STD A;  4OK0 A;  1EA2 A;  3DGY A;  3I0Y A;  1RGG A;  3OWS A;  4O02 B;  1E3R A;  2GBW B;  1JKG A;  4BIR A;  4N6U A;  3WDG B;  4NHF A;  4K1V A;  4H3U A;  3VF1 A;  3S28 A;  1MWS A;  1FGT A;  2GEY A;  3FSD A;  7GSP A;  3H3H A;  5AEU B;  2CX1 A;  1QAK A;  3JUP A;  1BAN A;  3K7C A;  4HYZ A;  1VQN 3;  2XGN A;  4XBT A;  3F8H A;  3U1W A;  5HGR A;  5ELJ A;  1RRH A;  5AYR B;  4J5K A;  3LML A;  3F14 A;  5AIF A;  1VQ8 3;  2Z76 A;  1S5A A;  2M7O A;  3ZG5 A;  4HM3 B;  1IYY A;  5IF6 A;  1W6G A;  3WMD A;  2GBX B;  3FF2 A;  1BSA A;  1JN5 A;  2E2T A;  3ECF A;  4FCM A;  3WHO A;  2IY2 A;  1AY7 A;  2IUK A;  5HOH A;  1O7P B;  2BT3 A;  2KRT A;  2W9Q A;  3HII A;  1Q40 B;  4HVN A;  5CLK A;  1HYF A;  3BNB A;  3CPW 2;  3G8Z A;  4XB5 A;  1IDP A;  1F8N A;  1B2Z A;  1JKG B;  1YJN 3;  2STD A;  2YFJ B;  2KF5 A;  2P09 A;  1JRQ A;  4L7K A;  2P0X A;  1MWR A;  3NBR A;  2P05 A;  1RRL A;  1WQL B;  3V98 A;  1UUV B;  4BTW A;  3I56 3;  5EQL A;  2LYX A;  1UCI A;  1YJ9 3;  3T0U A;  5AYS C;  2OOV C;  1RNB A;  3EX9 A;  1N8Q A;  1OHO A;  5CF1 A;  1N9J A;  1Q42 A;  4KFD A;  1GMQ A;  1DVD A;  7STD A;  2HMM B;  1W5Z A;  5KP3 A;  3EN8 A;  3G16 A;  3BU4 A;  3RGR A;  3CCQ 3;  1I0X A;  4HM0 B;  3V92 A;  1CQS A;  1DMQ A;  1FYS A;  1BIR A;  1O7N B;  1ULJ B;  3FLJ A;  1PYL A;  5M19 A;  2HMN B;  1BNI A;  2V1L A;  3KSE D;  4L8P A;  5G1K A;  3I55 3;  1B20 A;  4O8S A;  1YGW A;  1RGF A;  1B27 A;  2CWT A;  3FGY A;  3HK4 A;  4L8O A;  2HML B;  3AHS A;  4RNZ A;  5AIG A;  5CF2 A;  3O8Y A;  4AKZ A;  1DVC A;  1UGH I;  5FGO A;  2J8X B;  5BXQ A;  1KQS 2;  1OF5 A;  1BUJ A;  3DH2 A;  5ELU A;  1ZX2 A;  4FCJ A;  3WR2 A;  3S29 A;  4N6V 0;  3U97 A;  1RDS A;  3MG2 A;  5IW9 A;  1VQ5 3;  3OX9 A;  3D5I A;  4I5Q A;  1GOY A;  1QAL A;  1UI8 A;  2BIR A;  3ZG0 A;  2BMQ B;  1YHQ 3;  1N9E A;  4K90 B;  2ZHX B;  1ISK A;  1MGR A;  2O3O A;  2SAR A;  4BL3 A;  3EN1 B;  4KZ1 A;  1QVF 2;  3K5T A;  4G1M B;  4MMX B;  2RCD A;  3NX0 A;  3NQZ A;  4N6M A;  1CYU A;  1YIJ 3;  3A5E A;  4GL6 A;  7RNT A;  1RCK A;  4RZM A;  3GZR A;  1ASK A;  1AR0 A;  1ZGX A;  1US1 A;  4AEQ A;  5BU4 A;  1YJW 3;  4I4K A;  3EBT A;  3KN4 A;  1LOV A;  1O7G B;  1U8C B;  4R9K A;  4K61 A;  5G1L A;  1B2U A;  3PCR A;  6STD A;  2XR8 B;  5AIH A;  3LH4 A;  1LQM B;  1LVN A;  3BNC A;  4HM1 B;  2Z6B A;  2D42 A;  4N6O B;  5CK6 A;  3SYU A;  1K73 4;  5D81 A;  1BNR A;  3J7Y d;  4O2H A;  4XBY A;  4HKV B;  4N6N B;  1IQY A;  1EEJ A;  1BVI A;  3LTD A;  1PY3 A;  1W02 A;  3K9M C;  1G02 A;  4IPB A;  4J9A A;  3X42 A;  1BRG A;  2WOF A;  5IER A;  1K9M 4;  1KWI A;  2RNT A;  1A2P A;  1IV7 A;  3MWZ A;  1QJG A;  1BGS A;  1VQM 3;  4ZM8 A;  1GMR A;  3CC2 3;  2CX0 A;  1UW1 A;  1A2K A;  1TFO A;  1BSE A;  1I0V A;  3BND A;  3JUM A;  2R4I A;  2GEX A;  4HAA A;  4BTX A;  3DUK A;  4RNY A;  2F5M A;  1IV9 A;  2F56 A;  5JBS A;  4HM2 B;  3G0K A;  1TFK A;  1TU5 A;  1MGW A;  1RHL A;  2XGL A;  2CWU A;  2IMJ A;  4KVH A;  2RSX A;  5M1A A;  3D4A A;  2CHC A;  1NO3 A;  2C4B A;  2H0I A;  3ROB A;  3EF8 A;  3E99 A;  5LC7 A;  1M1X B;  2E2U A;  2MF7 A;  4EV2 A;  2WOH A;  1W7C A;  2I9W A;  1DE3 A;  1O7W B;  3DM8 A;  1GMP A;  4KFF A;  3DY5 A;  3KE7 A;  1VQ9 3;  1GY5 A;  1OH0 A;  1OUN A;  2GSP A;  1FGQ A;  1FGR A;  2B24 B;  2IA7 A;  2YX9 A;  1AV4 A;  4HZ9 B;  4Q53 A;  5IEP A;  3OV4 A;  3FG3 A;  1HU9 A;  1YNV X;  3Q1C A;  1B2X A;  4LZI A;  5RNT A;  2BMO B;  1YI2 3;  1IT7 A;  1GYB A;  3MPH A;  1K41 A;  4CPK A;  3B8L A;  1X1W A;  1JNQ A;  3CPO A;  4FR9 A;  2BU4 A;  1WMN A;  3MG3 A;  5IG0 A;  1IVU A;  1C54 A;  3JUO A;  3KSP A;  4EC6 A;  2CWV A;  2F5W A;  4LYL B;  1D6U A;  1UUG B;  2UUG C;  4R4K A;  5DRE A;  3SOY A;  2ZL8 A;  3KKG A;  3KII A;  1TTO A;  3KCH A;  1CH0 A;  3N54 B;  3OXA A;  3SXX A;  5G2G A;  1WMO A;  1GY7 A;  4QWT A;  1KSI A;  3T8N A;  3G6E 3;  4HM7 B;  1RGK A;  3GZX B;  4ORL A;  1JZO A;  1JBR A;  1DMN A;  1GD4 A;  2INX A;  5BVB A;  2XF3 A;  2CW9 A;  2KF6 A;  3OWY A;  1OHP A;  4EW5 A;  3KZT A;  4H61 A;  1BNJ A;  1DET A;  5AI1 A;  1SIH A;  1Q9E A;  2XSO B;  1B21 A;  4XDW A;  2OQE A;  1V74 A;  1TRQ A;  1ULI B;  1PFP A;  1V57 A;  1E97 A;  1ZO2 A;  1UI7 A;  1RGH A;  3IJE B;  2FNQ A;  4NPB A;  1IVX A;  1EUI C;  2CFG A;  1N8R 4;  4RNT A;  3X3Z A;  3DGL A;  2JDI H;  1GD3 A;  1LRA A;  1OPY A;  2SBL A;  3GAX A;  2W56 B;  1TJD A;  1FUW A;  1T2I A;  1BNE A;  4BTY A;  3IMA B;  2PZV A;  1BSC A;  2MC8 A;  2YFI B;  2CG1 A;  9RNT A;  3B4P A;  5EEO A;  2OTL 3;  1RMS A;  4HOH A;  3KFQ C;  1Q40 A;  3SED A;  2E2V A;  4FCZ A;  4FMA A;  2H0G A;  2HMO B;  1QVG 2;  1JBS A;  3DZL A;  6GSP A;  3CCU 3;  3NUV A;  2GXF A;  4K1U A;  1RGC A;  4HM8 B;  1T3B A;  4FMB A;  1IT8 A;  2CC3 A;  3B4O A;  1YIT 3;  1EKM A;  3LTB A;  4X2H A;  3CCS 3;  3B7C A;  2D1W A;  2QA4 3;  2FXT A;  3GWR A;  2BNG A;  4MEI A;  3RGA A;  1MNL A;  3WOE B;  3AMO A;  3LZA A;  2CFW A;  1G96 A;  2WGQ A;  2JQ5 A;  3FCS B;  2XRX B;  3AMO B;  4MMZ B;  4NRE A;  1QMA A;  2OOV A;  5DRV A;  1BSD A;  4HM5 B;  2OQE C;  1BNS A;  3NM7 A;  4OUQ A;  1W2Z A;  2HOH A;  4N6L A;  1FZU A;  4EYC A;  3H51 A;  3GRD A;  2PNC A;  1NJI 4;  1W01 A;  3PCS A;  5I97 A;  2W03 A;  3HI7 A;  1SQW A;  2ZDJ A;  1VQO 3;  1I8V A;  2P0M A;  3OWU A;  4OVM A;  2RGQ A;  1CYV A;  1IQ8 A;  1M1K 4;  3NV0 A;  3CC7 3;  4LGQ A;  1NDO B;  3WOD G;  1NB5 I;  3HX8 A;  1RNT A;  4IIA A;  1K8A 4;  1VZZ A;  1W00 A;  1X1X A;  2YFL B;  4BU4 A;  2UX0 A;  3UL6 A;  3CCL 3;  2ML5 A;  3K0Z A;  3CCV 3;  1YVS A;  1I2F A;  3EE1 A;  3JUQ A;  4FMD A;  2R41 A;  1Z1S A;  1LOW A;  3N9H A;  1BNF A;  1ROV A;  3NM2 A;  1RKY A;  3UB1 A;  1IVV A;  1VQQ A;  3BIR A;  4WWU C;  1JB2 A;  3F7X A;  1D6Y A;  4GB5 A;  4HJL B;  3X41 A;  1WTH A;  1CEW I;  1GS3 A;  1GOU A;  4LEH A;  1OAC A;  5TGN A;  2CG0 A;  4AKY A;  4EBG A;  5AEW B;  3QK9 A;  1UCK A;  2XFS A;  3PZW A;  2CIU A;  1RN1 A;  2LQV A;  3HIG A;  4XBX A;  5KP1 A;  2XH9 A;  4MMY B;  1R4Y A;  1BU4 A;  2KF3 A;  2ZA4 A;  4LMI A;  1ZS7 A;  1AVL A;  3D79 A;  5CXO A;  3M8C A;  1JJ2 2;  3OW2 2;  2P38 A;  4GHO A;  1MOL A;  3X3X A;  3DMC A;  3F9S A;  1X1U A;  1FW7 A;  1Y4K A;  1IVW A;  1TP6 A;  1FUT A;  3URP A;  1NWW A;  1BUQ A;  3PYJ A;  3EC9 A;  3UNL A;  3NXJ A;  2H0H A;  1T5Y A;  4R80 A;  2O9U X;  3STD A;  1UGI A;  1FUS A;  3GZB A;  3NV0 B;  4R9L A;  4STD A;  2RBI A;  3CNX A;  1GOV A;  3LXU X;  4ILF A;  1UDI I;  1RGL A;  4CCV A;  1S72 3;  3D3L A;  3EQQ B;  1SPU A;  3A76 A;  1C7H A;  4TX4 A;  2QIY A;  1B3S A;  2QGU A;  1B2S A;  2OWP A;  4XDV A;  2WO0 A;  3S5C A;  3SX1 A;  1SJW A;  1M9G A;  1JZD A;  1STF I;  2OCT A;  2XEP A;  1UCJ A;  4FMC A;  1SII A;  4KFE A;  3CMA 3;  3ALA A;  2F4Y A;  1VQ7 3;  2KXG A;  1D6Z A;  3PGB A;  1VQL 3;  1BRJ A;  1LNI A;  3BLZ A;  2KF4 A;  4MJD A;  1I3I A;  3DXO A;  8CHO A;  1OHS A;  2XFT A;  3G4S 3;  1TIJ A;  2W9P A;  4JRF A;  1O7M B;  2Q07 A;  1NNV A;  3MG1 A;  3S67 A;  3CCM 3;  1BRN L;  1WNH A;  5IG3 A;  2FGT A;  3PS8 A;  2W04 A;  5A0O B;  4HM4 B;  1WMP A;  3AGO A;  3LT8 A;  3CNM A;  4JF8 A;  1BRI A;  3SOA A;  3V99 A;  1JB4 A;  1X1Y A;  2HMK B;  2CKF B;  3HOH A;  3EHC A;  2CH9 A;  3LT9 A;  4WHA A;  1MWT A;  3CCR 3;  3AGN A;  1KC8 4;  3BB9 A;  3CME 3;  1V58 A;  3Q3F A;  1L5G B;  3QRD A;  3RNT A;  5FW5 A;  4LSO A;  1U5O A;  1G0T A;  2Z7A A;  3T8U A;  1LXE A;  4HZB B;  2K3D A;  2Y74 A;  2XSH B;  3UL5 A;  1IK3 A;  2BHM A;  3DGO A;  4HBR A;  1PU4 A;  1BRS A;  1B2M A;  2A15 A;  2IYJ A;  5KP4 A;  3WA3 A;  2CFD A;  2W6J H;  3FKA A;  2AAE A;  3NBB A;  4EV5 A;  5JPP A;  5EVH A;  1BRK A;  1BNG A;  3DGN A;  3FH1 A;  1R4C A;  4EXR A;  1N5P A;  1OF5 B;  3EB8 A;  1K28 A;  1TUH A;  2B1X B;  2W0Q A;  1AQZ A;  1RN7 A;  3FG4 A;  4J8T A;  8RNT A;  3L0R A;  4R1K A;  3K63 A;  2GU1 A;  3F7S A;  1Q86 4;  2L4V A;  3CCE 3;  3N8B A;  3GZY B;  4X2O A;  1AVK A;  1N5H A;  2W56 A;  3NBJ A;  1RLS A;  1YVB I;  3JVC A;  2CK3 H;  5AII A;  2OTJ 3;  4N6T A;  3LOY A;  3IPT A;  2W2C A;  1STD A;  1BSB A;  1JV2 B;  5M18 A;  5IG4 A;  1BRH A;  2F99 A;  3JUN A;  2KAA A;  1LOX A;  1NB3 I;  3CU3 A;  2RFR A;  3DGM A;  5GSP A;  4N3V A;  5LC6 A;  1FGO A;  2CFL A;  2HMJ B;  1RGA A;  3VSY A;  2F86 B;  3FF0 A;  4WYK A;  3WOF B;  3SLU A;  1LQG C;  1RSN A;  4CJN A;  1W2B 2;  1VQ6 3;  1A90 A;  3LTA A;  4HM6 B;  1RGE A;  5D83 A;  1EG9 B;  1RTU A;  4WYK B;  1E3V A;  2F98 A;  2K0M A;  4J5G A;  4WP5 A;  1YGE A;  3S27 A;  3CC4 3;  1J2B A;  3MYT A;  3TDG A;  2QEX 3;  1IU7 A;  1UCL A;  2Y73 A;  3MHE A;  3Q90 A;  4WFO A;  3D9R A;  3X40 A;  2UGI A;  1RN4 A;  1JBT A;  4KT3 B;  1HZ1 A;  3FZW A;  3GSP A;  3F8X A;  3NQY A;  4CDL A;  5IEO A;  1RCL A;  3SVA A;  1RJO A;  3LYG A;  2BMR B;  2ML6 A;  3HZP A;  3AHW A;  1LOY A;  3LTC A;  1DMM A;  1A67 A;  1EQK A;  1O7H B;  3CD6 3;  3CXC 2;  2AAD A;  1JB5 A;  4O3V A;  1LNH A;  1I3F A;  4PEJ A;  4XM4 A;  1Q82 4;  1I2G A;  3EBY A;  1KD1 4;  3MSO A;  1FGM A;  1T2H A;  1GY6 A;  1W6C A;  1QAF A;  1NU3 A;  2BO9 B;  1FA3 A;  3RDE A;  2C10 A;  5IG5 A;  2WGO A;  2KCD A;  3ZFZ A;  1OGX A;  1IQX A;  3UJM A;  6RNT A;  3CCJ 3;  1W4N A;  1M90 4;  4U13 A;  1JN5 B;  3X3Y A;  1I2E A;  3ER7 A;  1VQ4 3;  1VQP 3;  1BOX A;  2L1S A;  1BAO A;  3FG1 A;  3Q2P A;  1OCV A;  4DKI A;  5IEN A;  1Q7Y 4;  1HKX A;  1Q7H A;  2C11 A;  2GU3 A;  1W6Y A;  3NHX A;  1OGZ A;  4IT7 A;  4RBN A;  3PXM A;  5BIR A;  1Q81 4;  1DYU A;  1MWU A;  3BNE A;  2IUJ A;  4GSP A;  3VGN A;  5JPU A;  3WA2 X;  3D5G A;  5D82 A;  3EJV A;  1SAR A;  1ROA A;  4BL2 A;  3G71 3;  1GSP A;  1A2V A;  1TRP A;  1UUW B;  3MKI A;  2CFK A;  3F40 A;  1VQK 3;  1I70 A; 
#chains in the Genus database with same CATH homology
 2K54 A;  2Z77 A;  5STD A;  4OK0 A;  1EA2 A;  4O02 B;  3I0Y A;  3OWS A;  1E3R A;  2GBW B;  1JKG A;  4N6U A;  3WDG B;  4NHF A;  4K1V A;  4H3U A;  3VF1 A;  3S28 A;  1FGT A;  2GEY A;  3FSD A;  3H3H A;  5AEU B;  1QAK A;  3JUP A;  4HYZ A;  3K7C A;  1VQN 3;  2XGN A;  4XBT A;  3F8H A;  3U1W A;  5HGR A;  5ELJ A;  1RRH A;  5AYR B;  3LML A;  3F14 A;  5AIF A;  1VQ8 3;  2Z76 A;  1S5A A;  2M7O A;  4HM3 B;  5IF6 A;  1W6G A;  3WMD A;  2GBX B;  3FF2 A;  1JN5 A;  2E2T A;  3ECF A;  4FCM A;  2IUK A;  1O7P B;  2BT3 A;  2KRT A;  2W9Q A;  3HII A;  1Q40 B;  4HVN A;  5CLK A;  3BNB A;  3CPW 2;  3G8Z A;  4XB5 A;  1IDP A;  1F8N A;  1JKG B;  1YJN 3;  2STD A;  2YFJ B;  2P09 A;  1JRQ A;  4L7K A;  2P0X A;  3NBR A;  2P05 A;  1RRL A;  1WQL B;  3V98 A;  1UUV B;  4BTW A;  3I56 3;  5EQL A;  2LYX A;  1YJ9 3;  3T0U A;  5AYS C;  2OOV C;  3EX9 A;  1N8Q A;  1OHO A;  5CF1 A;  1N9J A;  1Q42 A;  4KFD A;  1DVD A;  7STD A;  2HMM B;  1W5Z A;  5KP3 A;  3EN8 A;  3G16 A;  3CCQ 3;  3RGR A;  4HM0 B;  3V92 A;  1CQS A;  1DMQ A;  1O7N B;  1ULJ B;  3FLJ A;  2HMN B;  2V1L A;  3KSE D;  4L8P A;  3I55 3;  4O8S A;  2CWT A;  3FGY A;  3HK4 A;  4L8O A;  2HML B;  4RNZ A;  5AIG A;  5CF2 A;  3O8Y A;  4AKZ A;  1DVC A;  5FGO A;  5BXQ A;  1KQS 2;  1OF5 A;  5ELU A;  1ZX2 A;  4FCJ A;  3S29 A;  4N6V 0;  3U97 A;  3MG2 A;  5IW9 A;  1VQ5 3;  3OX9 A;  1QAL A;  1UI8 A;  2BMQ B;  1YHQ 3;  1N9E A;  4K90 B;  1ISK A;  2O3O A;  3EN1 B;  4KZ1 A;  1QVF 2;  3K5T A;  4G1M B;  4MMX B;  2RCD A;  3NX0 A;  3NQZ A;  4N6M A;  1CYU A;  1YIJ 3;  4GL6 A;  4RZM A;  3GZR A;  1ASK A;  1AR0 A;  4AEQ A;  1US1 A;  1YJW 3;  4I4K A;  3EBT A;  3KN4 A;  1U8C B;  1O7G B;  4R9K A;  4K61 A;  3PCR A;  6STD A;  2XR8 B;  5AIH A;  3LH4 A;  1LVN A;  3BNC A;  4HM1 B;  2Z6B A;  2D42 A;  4N6O B;  5CK6 A;  1K73 4;  5D81 A;  3J7Y d;  4O2H A;  4XBY A;  4HKV B;  4N6N B;  1IQY A;  3LTD A;  1W02 A;  3K9M C;  4IPB A;  3X42 A;  4J9A A;  5IER A;  2WOF A;  1K9M 4;  1KWI A;  1IV7 A;  3MWZ A;  1QJG A;  1VQM 3;  4ZM8 A;  3CC2 3;  1UW1 A;  1A2K A;  1TFO A;  3BND A;  3JUM A;  2R4I A;  2GEX A;  4BTX A;  3DUK A;  4RNY A;  1IV9 A;  5JBS A;  4HM2 B;  3G0K A;  1TFK A;  1TU5 A;  2XGL A;  2CWU A;  2IMJ A;  4KVH A;  2RSX A;  5IG4 A;  2CHC A;  1NO3 A;  3ROB A;  3EF8 A;  3E99 A;  5LC7 A;  1M1X B;  2E2U A;  2MF7 A;  4EV2 A;  2WOH A;  1W7C A;  2I9W A;  1O7W B;  3DM8 A;  4KFF A;  3DY5 A;  3KE7 A;  1VQ9 3;  1GY5 A;  1OH0 A;  1OUN A;  1FGQ A;  1FGR A;  2B24 B;  2IA7 A;  2YX9 A;  1AV4 A;  4HZ9 B;  4Q53 A;  5IEP A;  3OV4 A;  3FG3 A;  1HU9 A;  3Q1C A;  4LZI A;  2BMO B;  1YI2 3;  1IT7 A;  1GYB A;  3MPH A;  1K41 A;  3B8L A;  1JNQ A;  3CPO A;  4FR9 A;  1WMN A;  3MG3 A;  5IG0 A;  1IVU A;  3JUO A;  3KSP A;  4EC6 A;  2CWV A;  1D6U A;  4R4K A;  5DRE A;  3SOY A;  2ZL8 A;  3KKG A;  3KII A;  3N54 B;  3OXA A;  3SXX A;  5G2G A;  1WMO A;  1GY7 A;  4QWT A;  1KSI A;  3T8N A;  3G6E 3;  4HM7 B;  3GZX B;  4ORL A;  1DMN A;  1GD4 A;  2INX A;  5BVB A;  2XF3 A;  2CW9 A;  3OWY A;  1OHP A;  3KZT A;  4H61 A;  5AI1 A;  1SIH A;  2XSO B;  4XDW A;  2OQE A;  1V74 A;  1ULI B;  1PFP A;  1E97 A;  1UI7 A;  1ZO2 A;  3IJE B;  2FNQ A;  1IVX A;  2CFG A;  1N8R 4;  3X3Z A;  3DGL A;  2JDI H;  1GD3 A;  1OPY A;  2SBL A;  3GAX A;  2W56 B;  1FUW A;  4BTY A;  3IMA B;  2PZV A;  2MC8 A;  2YFI B;  2CG1 A;  3B4P A;  5EEO A;  2OTL 3;  3KFQ C;  1Q40 A;  3SED A;  2E2V A;  4FCZ A;  4FMA A;  2HMO B;  1QVG 2;  3DZL A;  3CCU 3;  3NUV A;  2GXF A;  4K1U A;  4HM8 B;  4FMB A;  1IT8 A;  2CC3 A;  3B4O A;  1YIT 3;  1EKM A;  3LTB A;  4X2H A;  3CCS 3;  3B7C A;  2D1W A;  2QA4 3;  2FXT A;  3GWR A;  2BNG A;  4MEI A;  3RGA A;  1MNL A;  3WOE B;  3AMO A;  3LZA A;  2CFW A;  1G96 A;  2WGQ A;  2JQ5 A;  3FCS B;  2XRX B;  3AMO B;  4MMZ B;  4NRE A;  1QMA A;  2OOV A;  5DRV A;  4HM5 B;  2OQE C;  3NM7 A;  4OUQ A;  1W2Z A;  4N6L A;  4EYC A;  3H51 A;  3GRD A;  2PNC A;  1NJI 4;  1W01 A;  3PCS A;  5I97 A;  2W03 A;  3HI7 A;  1SQW A;  2ZDJ A;  1VQO 3;  3OWU A;  2P0M A;  4OVM A;  1M1K 4;  2RGQ A;  1CYV A;  1IQ8 A;  3NV0 A;  3CC7 3;  4LGQ A;  1NDO B;  3WOD G;  1NB5 I;  3HX8 A;  4IIA A;  1K8A 4;  1VZZ A;  1W00 A;  2YFL B;  2UX0 A;  3UL6 A;  3CCL 3;  2ML5 A;  3K0Z A;  3CCV 3;  3EE1 A;  3JUQ A;  4FMD A;  1Z1S A;  3N9H A;  3NM2 A;  1ROV A;  1RKY A;  3UB1 A;  1IVV A;  4WWU C;  1JB2 A;  3F7X A;  1D6Y A;  4GB5 A;  4HJL B;  3X41 A;  1WTH A;  1CEW I;  1GS3 A;  4LEH A;  1OAC A;  5TGN A;  2CG0 A;  4AKY A;  4EBG A;  5AEW B;  3QK9 A;  2XFS A;  3PZW A;  2CIU A;  2LQV A;  3HIG A;  4XBX A;  5KP1 A;  2XH9 A;  4MMY B;  4LMI A;  1AVL A;  5CXO A;  3M8C A;  1JJ2 2;  3OW2 2;  2P38 A;  1MOL A;  3X3X A;  3DMC A;  3F9S A;  1Y4K A;  1IVW A;  1TP6 A;  1NWW A;  1BUQ A;  3PYJ A;  3EC9 A;  3UNL A;  3NXJ A;  4R80 A;  1T5Y A;  2O9U X;  3STD A;  4R9L A;  3GZB A;  3NV0 B;  4STD A;  3CNX A;  3LXU X;  4CCV A;  1S72 3;  3D3L A;  3EQQ B;  1SPU A;  3A76 A;  1C7H A;  4TX4 A;  2QIY A;  2QGU A;  2OWP A;  4XDV A;  2WO0 A;  3S5C A;  3SX1 A;  1SJW A;  1M9G A;  2XEP A;  1STF I;  2OCT A;  4FMC A;  4KFE A;  1SII A;  3CMA 3;  3ALA A;  1VQ7 3;  2KXG A;  1D6Z A;  3PGB A;  1VQL 3;  3BLZ A;  4MJD A;  8CHO A;  3DXO A;  1OHS A;  2XFT A;  3G4S 3;  1TIJ A;  2W9P A;  4JRF A;  1O7M B;  2Q07 A;  3MG1 A;  3S67 A;  3CCM 3;  1WNH A;  5IG3 A;  2FGT A;  3PS8 A;  2W04 A;  5A0O B;  4HM4 B;  1WMP A;  3LT8 A;  4JF8 A;  3CNM A;  3SOA A;  3V99 A;  1JB4 A;  2HMK B;  2CKF B;  3EHC A;  2CH9 A;  3LT9 A;  4WHA A;  3CCR 3;  1KC8 4;  3BB9 A;  3CME 3;  1L5G B;  3QRD A;  5FW5 A;  4LSO A;  1U5O A;  2Z7A A;  3T8U A;  1LXE A;  4HZB B;  2Y74 A;  2XSH B;  3UL5 A;  1IK3 A;  2BHM A;  3DGO A;  4HBR A;  1PU4 A;  2A15 A;  5KP4 A;  3WA3 A;  2CFD A;  2W6J H;  3FKA A;  3NBB A;  4EV5 A;  5JPP A;  5EVH A;  3DGN A;  3FH1 A;  1R4C A;  4EXR A;  1N5P A;  1OF5 B;  3EB8 A;  1K28 A;  1TUH A;  2B1X B;  2W0Q A;  1RN7 A;  3FG4 A;  4J8T A;  3L0R A;  4R1K A;  3K63 A;  2GU1 A;  3F7S A;  1Q86 4;  2L4V A;  3CCE 3;  3N8B A;  3GZY B;  4X2O A;  1AVK A;  1N5H A;  2W56 A;  3NBJ A;  1YVB I;  3JVC A;  2CK3 H;  5AII A;  2OTJ 3;  4N6T A;  3LOY A;  3IPT A;  2W2C A;  1STD A;  1JV2 B;  3JUN A;  2F99 A;  1LOX A;  1NB3 I;  3CU3 A;  2RFR A;  3DGM A;  4N3V A;  5LC6 A;  1FGO A;  2CFL A;  2HMJ B;  3VSY A;  2F86 B;  3FF0 A;  4WYK A;  3WOF B;  3SLU A;  1VQ6 3;  1W2B 2;  1A90 A;  3LTA A;  4HM6 B;  5D83 A;  1EG9 B;  4WYK B;  1E3V A;  2F98 A;  2K0M A;  3S27 A;  4WP5 A;  1YGE A;  3CC4 3;  1J2B A;  3MYT A;  3TDG A;  2QEX 3;  1IU7 A;  4WFO A;  2Y73 A;  3MHE A;  3Q90 A;  3D9R A;  3X40 A;  3FZW A;  3NQY A;  3F8X A;  4CDL A;  5IEO A;  3SVA A;  1RJO A;  3LYG A;  2BMR B;  3HZP A;  3LTC A;  1DMM A;  1A67 A;  1EQK A;  1O7H B;  3CD6 3;  3CXC 2;  1JB5 A;  4O3V A;  1LNH A;  4PEJ A;  4XM4 A;  1Q82 4;  3EBY A;  1KD1 4;  3MSO A;  1FGM A;  1GY6 A;  1W6C A;  1QAF A;  1NU3 A;  2BO9 B;  1FA3 A;  3RDE A;  2C10 A;  5IG5 A;  2WGO A;  2KCD A;  1OGX A;  1IQX A;  3UJM A;  3CCJ 3;  1W4N A;  1M90 4;  4U13 A;  1JN5 B;  3X3Y A;  3ER7 A;  1VQ4 3;  1VQP 3;  3FG1 A;  3Q2P A;  1OCV A;  5IEN A;  1Q7Y 4;  1HKX A;  2C11 A;  2GU3 A;  1W6Y A;  3NHX A;  1OGZ A;  4IT7 A;  4RBN A;  3PXM A;  1Q81 4;  1DYU A;  2IUJ A;  3BNE A;  3VGN A;  5JPU A;  3WA2 X;  5D82 A;  3EJV A;  1ROA A;  3G71 3;  1A2V A;  1UUW B;  2ML6 A;  3MKI A;  2CFK A;  3F40 A;  1VQK 3; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...