1K41A

Crystal structure of ksi y57s mutant
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
125
structure length
121
Chain Sequence
b'NLPTAQEVQGLMARYIELVDVGDIEAIVQMYADDATVEDPFGQPPIHGREQIAAFSRQGKVRACLTGPVRASHNGCGAMPFRVEMVWNGQPCALDVIDVMRFDEHGRIQTMQAYWSEVNLS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ketosteroid Isomerase
publication title Maintenance of alpha-helical structures by phenyl rings in the active-site tyrosine triad contributes to catalysis and stability of ketosteroid isomerase from Pseudomonas putida biotype B
pubmed doi rcsb
source organism Pseudomonas putida
molecule tags Isomerase
total genus 31
structure length 121
sequence length 125
chains with identical sequence B
ec nomenclature ec 5.3.3.1: Steroid Delta-isomerase.
pdb deposition date 2001-10-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12680 SnoaL_2 SnoaL-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.50 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 1k41A00
2OWPA 2B24B 2I9WA 2YFJB 4KVHA 3MG3A 3FZWA 3MYTA 4XDWA 2INXA 2YFIB 3G0KA 5AI1A 4OVMA 5CXOA 4WYKB 2UX0A 3ROBA 1ZO2A 5CF2A 1DMMA 2Z7AA 4LMIA 3KE7A 1Z1SA 4HM7B 2PZVA 3DM8A 1DMNA 5AIIA 1JKGA 4HJLB 5KP4A 1DMQA 5CF1A 4N3VA 3GZYB 1O7MB 2GBXB 5IENA 5IERA 1AR0A 3DZLA 4XBTA 3DXOA 3GWRA 1NDOB 3FLJA 1EG9B 4HZ9B 5IG0A 1Q40B 3NV0A 1UUVB 3S5CA 5IEOA 4XDVA 4GB5A 3FGYA 4XM4A 1JB5A 4IIAA 1JN5B 3JUNA 3H3HA 1OGZA 1OUNA 4J8TA 2CKFB 1GS3A 4LEHA 1JB2A 4HM1B 5D83A 3KSPA 3ER7A 3FSDA 3GZRA 5G2GA 2YFLB 2R4IA 1O7HB 5EVHA 5BVBA 4HM4B 3M8CA 3EBTA 3CNXA 2CHCA 2HMLB 4HVNA 3I0YA 3F9SA 3OV4A 2W2CA 3SOAA 4MJDA 3RGRA 3NHXA 3JUPA 4X2HA 1E3VA 1ASKA 2JQ5A 3K7CA 2BMRB 1ULJB 3RGAA 3F40A 3A76A 1JKGB 3F8HA 3SEDA 3D9RA 3H51A 2RCDA 3ECFA 3B7CA 5AIGA 3LZAA 1C7HA 4R9LA 4HM8B 1STDA 1UUWB 3MG2A 2BMQB 3JUOA 1W00A 1OCVA 4HM5B 3NV0B 2BNGA 3G16A 3F7XA 1OH0A 2B1XB 4L7KA 5JPPA 4J9AA 4HM6B 5BXQA 5AIHA 3DUKA 1EA2A 5TGNA 2HMKB 1OF5A 5AEWB 4RZMA 3FH1A 2STDA 6STDA 3OWUA 3Q90A 4WP5A 3OX9A 1GY5A 3JUQA 5DREA 1OHSA 4WWUC 5CLKA 5CK6A 1W01A 4HM0B 3UJMA 1K41A 3GZXB 2XSHB 5IF6A 5AEUB 4K1UA 3CNMA 3F7SA 3VSYA 1OPYA 2XR8B 4HM2B 4CDLA 3EBYA 3EF8A 3EN8A 2QIYA 3T8UA 3KZTA 2QGUA 2RFRA 2BMOB 3K0ZA 3T8NA 2GEXA 1TP6A 2XRXB 3EN1B 4L8OA 2F86B 4LGQA 1CQSA 3OWSA 4OUQA 3SOYA 3FF0A 5IG5A 2A15A 1O7PB 1QJGA 5D81A 4STDA 3KKGA 3EC9A 4Q53A 3NM2A 1OHOA 3B4OA 3IPTA 1W02A 5FW5A 1SJWA 3EX9A 1O7WB 3CPOA 3MG1A 3MSOA 1OF5B 2Z77A 3FKAA 1A2KA 1GY6A 1U5OA 4XBYA 1E97A 3WMDA 8CHOA 1NU3A 1GYBA 1ZX2A 4FCMA 3F14A 5IG3A 1WQLB 3FF2A 2RGQA 3HK4A 4HZBB 4PEJA 1NWWA 1S5AA 2K54A 3GRDA 3OWYA 4R1KA 4WYKA 3BLZA 3F8XA 2Z76A 3VGNA 3NUVA 3G8ZA 1W6YA 5JPUA 4K1VA 4U13A 1O7GB 1ULIB 5IG4A 1VZZA 4L8PA 1O7NB 3LYGA 3NBRA 3EHCA 1GY7A 4HM3B 3E99A 3B8LA 3OXAA 2GXFA 3CU3A 2HMMB 3GZBA 4I4KA 5KP3A 4FCJA 1BUQA 5IEPA 3JUMA 1OHPA 3HZPA 3EQQB 3B4PA 2HMJB 1E3RA 1Q40A 4R9KA 7STDA 2F99A 4ORLA 3HX8A 3MHEA 1HKXA 3DMCA 4X2OA 1JN5A 1JB4A 4H3UA 1TUHA 5HGRA 1ISKA 2XSOB 3STDA 3NXJA 2GBWB 5DRVA 5KP1A 4XB5A 3EJVA 2F98A 3MKIA 1QMAA 5D82A 1IDPA 2GEYA 2HMNB 2IMJA 5STDA 5AIFA 1OGXA 2HMOB 4XBXA 4HKVB 3BB9A 3UNLA 1Q42A
chains in the Genus database with same CATH superfamily
2OWPA 4BTXA 1Q9EA 2W9QA 1IQXA 1MWUA 1L5GB 3WHOA 1EKMA 2B24B 2I9WA 2YFJB 3PS8A 4KVHA 4GHOA 4CJNA 1RSNA 3FZWA 3MG3A 3MYTA 4XDWA 1Y4KA 1VQ93 1BNSA 2INXA 2YFIB 3G0KA 5AI1A 5GSPA 5BU4A 1JV2B 4OVMA 3CCU3 1RJOA 3PGBA 2AAEA 1BRGA 5CXOA 4AKZA 1BSCA 1FYSA 2WGOA 3QK9A 3U1WA 1BRSA 7RNTA 4EXRA 1N5PA 4WYKB 1I70A 3OW22 2FXTA 1BNGA 2BU4A 2UX0A 2OQEA 1IT8A 4MMYB 2IYJA 1ZO2A 3ROBA 1BSAA 4N6NB 1LQGC 5CF2A 3Q2PA 1DMMA 1R4CA 2Z7AA 2HOHA 4LMIA 3KE7A 4BTWA 2KAAA 1Z1SA 2K3DA 3LTDA 1B2XA 3T0UA 4HM7B 1D6UA 4EV5A 1JBRA 2PZVA 3DM8A 1D6YA 4EYCA 1DMNA 1Q824 1UI8A 5AIIA 1YI23 1JKGA 1RNTA 3FCSB 4HJLB 1DMQA 1PY3A 1W5ZA 2RBIA 5CF1A 2XF3A 4N3VA 3GZYB 1YJ93 1T2HA 1O7MB 3X3YA 3D3LA 1UCKA 2GBXB 1M1XB 1BRKA 1ZS7A 2XGLA 3K5TA 1NNVA 5IENA 5IERA 3CC73 3CMA3 1AR0A 3AHWA 4R80A 3DGLA 3DZLA 1STFI 4XBTA 3DXOA 3GWRA 2W03A 2W6JH 3WDGB 1A67A 1NDOB 3LMLA 2IY2A 3MPHA 1S723 1BRNL 3FLJA 1EG9B 4CPKA 1JJ22 4HZ9B 1W2B2 2W0QA 4DKIA 5IG0A 3URPA 3NBBA 4HAAA 1Q40B 3NV0A 1UUVB 4O8SA 2OQEC 1I2FA 3S5CA 1UCLA 4AKYA 5IEOA 1M1K4 3HIGA 3CME3 1W7CA 1W6GA 1W6CA 1BIRA 1X1UA 2IUKA 4GL6A 4XDVA 4GB5A 5G1LA 5LC6A 3CCV3 1QVG2 3V99A 2KXGA 2L4VA 3DH2A 3FGYA 4XM4A 1BNFA 1JB5A 3FG1A 1BRJA 4FR9A 2ZA4A 4KT3B 4IIAA 3X42A 1PFPA 2CC3A 1JN5B 3X40A 1FZUA 3D79A 3JUNA 3H3HA 1N8QA 1OGZA 1RGLA 1VQO3 3LTAA 2WOHA 1OUNA 4J8TA 1EQKA 2CKFB 4HYZA 1IV7A 1GS3A 1IVVA 4LEHA 2IA7A 3QRDA 1SPUA 1JB2A 4HM1B 4K90B 5D83A 3PZWA 3Q1CA 4QWTA 3CXC2 2GU3A 5AYSC 3KSPA 1B21A 1F8NA 2Z6BA 3ER7A 3FSDA 1JZDA 1RGKA 3GZRA 4LSOA 5G2GA 3RDEA 2CWUA 2YFLB 3DGYA 1FGMA 3GAXA 5A0OB 1EUIC 1IVXA 2R4IA 1O7HB 2SBLA 4LYLB 5EVHA 3N8BA 4HM4B 5M1AA 5BVBA 1W2ZA 3M8CA 3EBTA 3PCRA 3CNXA 2P09A 2CHCA 2HMLB 1IVWA 2OTJ3 2KRTA 4HVNA 1U8CB 1PYLA 3IJEB 2C10A 4RBNA 7GSPA 3I0YA 1FGOA 3L0RA 1HZ1A 3CCJ3 4WFOA 3F9SA 1QAFA 4CCVA 1A90A 3OV4A 3N9HA 1RGFA 2W2CA 1BVIA 3SOAA 1LVNA 1X1XA 3WA2X 4EC6A 3S28A 2XFSA 3NM7A 1V57A 2WGQA 3AGNA 4MJDA 3BNBA 3D5IA 3RGRA 1LNHA 1BNIA 5EQLA 3NHXA 3MWZA 2YX9A 2ZHXB 1NJI4 1AVLA 1VQ53 1VQP3 3O8YA 3WOFB 1FGRA 2LQVA 3JUPA 1DVDA 4X2HA 1E3VA 2GSPA 1BNRA 2RNTA 3BIRA 1ASKA 3KN4A 1RKYA 3G713 2JQ5A 1UGHI 3LH4A 2RSXA 1YGWA 3K7CA 3PCSA 3BNCA 1Q7HA 1RN1A 2BMRB 1ULJB 3K9MC 3RGAA 1HU9A 2H0HA 5RNTA 4N6OB 2W56A 4KFDA 1IQ8A 1N9EA 1YJN3 3F40A 4NPBA 2IUJA 1AV4A 3TDGA 1K28A 3A76A 1BU4A 1JKGB 1I0XA 2XEPA 3F8HA 3D9RA 2GU1A 3SEDA 1JZOA 1TJDA 3CC43 3H51A 3S29A 1FGQA 2RCDA 3ECFA 1MNLA 2MF7A 5IW9A 3B7CA 1UW1A 1G96A 3LT8A 1WNHA 3WA3A 1AQZA 1AVKA 5AIGA 1GOVA 4EBGA 2CX1A 1SIIA 3LOYA 5M19A 3LZAA 3CCS3 1C7HA 1B3SA 2R41A 2UGIA 1US1A 4R9LA 3I553 3UB1A 2ZL8A 4HM8B 1MWTA 1RGEA 1STDA 1UUWB 3MG2A 4MMXB 2BMQB 1B2UA 3HIIA 5LC7A 3AMOA 3JUOA 2WO0A 1IK3A 1W00A 3CPW2 1OCVA 3K63A 4HM5B 3X3ZA 3NV0B 1RN7A 3KSED 3SLUA 1FW7A 1KSIA 2V1LA 1LNIA 1I3IA 2BNGA 3G16A 5ELUA 4BIRA 3F7XA 1OH0A 2B1XB 4L7KA 1BANA 1ROVA 1RGGA 4EW5A 5JPPA 1LOYA 3SVAA 2CW9A 3Q3FA 4J9AA 2J8XB 1TIJA 4HM6B 1B2SA 4H61A 5BXQA 5AIHA 1YVSA 3DUKA 1EA2A 2ZDJA 5TGNA 1ZGXA 2HMKB 1OF5A 3NQYA 5AEWB 1J2BA 1JBTA 4RZMA 3FH1A 2STDA 6STDA 2CX0A 3SX1A 3BU4A 1Q814 1NB5I 3G6E3 1T5YA 1T2IA 1UUGB 3OWUA 3Q90A 4BL3A 1CYVA 4K61A 1RRHA 4WP5A 1I3FA 1V58A 1GY5A 2P38A 2PNCA 3DGMA 1B27A 1MWRA 3OX9A 1MOLA 3CCL3 3JUQA 1LXEA 5DREA 1MGWA 5ELJA 3V98A 8RNTA 4FMCA 2BT3A 1OHSA 4WWUC 1EEJA 5CLKA 5CK6A 1W01A 1B20A 4HM0B 3UJMA 1WTHA 1I2EA 1K41A 3GZXB 1KC84 2XSHB 4HOHA 2CFLA 4WHAA 4ILFA 2QA43 5IF6A 1I8VA 1I2GA 5AEUB 4G1MB 4BU4A 1QALA 1Q864 5I97A 4K1UA 3UL5A 2P0XA 4MEIA 5BIRA 1VQ43 2F56A 2Q07A 2Y73A 2OOVA 2CFWA 1LOVA 3CNMA 3F7SA 4N6LA 3VSYA 4R4KA 3KFQC 3U97A 1OPYA 2XR8B 4HM2B 4MMZB 5M18A 3AGOA 4CDLA 2CG1A 1QVF2 3EBYA 3PXMA 5KP4A 3EF8A 3EE1A 1TFOA 1X1WA 3EN8A 5EEOA 2QIYA 2XGNA 1OACA 3NQZA 3T8UA 3KZTA 1RDSA 2D1WA 2QGUA 2RFRA 2BMOB 3K0ZA 3T8NA 1YIT3 2GEXA 3S67A 1BRHA 1IVUA 1NO3A 3GSPA 4NHFA 1FA3A 1TP6A 2XRXB 1UDII 3EN1B 2KF6A 4L8OA 2F86B 4FMDA 2D42A 4LGQA 1CQSA 2CWVA 3UL6A 5AYRB 2ML6A 1BRIA 1RHLA 1Q7Y4 1UI7A 2Y74A 3OWSA 2H0GA 4OUQA 3G4S3 1T3BA 4J5GA 1YNVX 3SOYA 2W56B 3AHSA 4OK0A 2UUGC 6GSPA 3FF0A 3D4AA 4KFEA 1BSBA 1GSPA 4N6V0 1RGHA 2OOVC 3ALAA 1RCKA 3KCHA 2A15A 5IG5A 1O7PB 3A5EA 4O2HA 1K9M4 4GSPA 3BNEA 1QJGA 1N9JA 5D81A 2W04A 3CCQ3 1VQK3 4STDA 1GMPA 3KKGA 3FG3A 2CIUA 2KCDA 3EC9A 2L1SA 3LTCA 4Q53A 1RGAA 3NM2A 2KF3A 4FMBA 2MC8A 1JNQA 1RMSA 4I5QA 1OHOA 3AMOB 2C11A 4JRFA 3B4OA 4RNYA 3DGOA 3DY5A 1K8A4 5G1KA 1VQ73 6RNTA 3PYJA 1I0VA 2CFGA 1UGIA 1C54A 5HOHA 2CH9A 2E2VA 3IPTA 2H0IA 3DGNA 1W02A 2CK3H 1YHQ3 1UCIA 1TRQA 5FW5A 1SJWA 3CCM3 3EX9A 1B2MA 3HI7A 1N5HA 4JF8A 4BL2A 1JBSA 1O7WB 3CPOA 3HOHA 3MG1A 3MSOA 1DE3A 1PU4A 1OF5B 3SXXA 4AEQA 2Z77A 3NBJA 4HBRA 4IPBA 2P0MA 1WMOA 3FKAA 3LXUX 1A2KA 1VQL3 9RNTA 1GY6A 1TFKA 1U5OA 1G02A 4XBYA 1GMRA 1VQ83 1E97A 1BSDA 1NB3I 3WMDA 1RLSA 8CHOA 1G0TA 2F4YA 1NU3A 3SYUA 3X41A 4RNZA 2F5WA 1GYBA 1SIHA 1BAOA 1X1YA 3RNTA 1ZX2A 1IYYA 4FCMA 1ROAA 3F14A 1JRQA 5IG3A 1WQLB 4N6UA 3FF2A 5JBSA 2RGQA 3HK4A 4HZBB 4PEJA 1QAKA 2BHMA 3N54B 1IU7A 1NWWA 1S5AA 1VQM3 2K54A 1D6ZA 3GRDA 4BTYA 1R4YA 3OWYA 4R1KA 1GOYA 4WYKA 3BLZA 3F8XA 2Z76A 3KIIA 3VGNA 3NUVA 3I563 1N8R4 1RRLA 3G8ZA 1W6YA 5JPUA 3IMAB 4K1VA 4U13A 1O7GB 1CH0A 1ULIB 1HYFA 5IG4A 1VZZA 3NX0A 1WMNA 1YVBI 2W9PA 3CD63 4L8PA 2FNQA 3BNDA 4NREA 2E2TA 1BUJA 1YIJ3 4IT7A 1O7NB 3LYGA 3NBRA 4N6TA 3EHCA 1GOUA 1GY7A 2BIRA 4HM3B 1VQQA 3E99A 3B8LA 3OXAA 2KF5A 1IV9A 2SARA 1WMPA 2GXFA 4FCZA 3CU3A 3J7Yd 2HMMB 3GZBA 1M9GA 4TX4A 4I4KA 5KP3A 1FGTA 2C4BA 4FCJA 1DVCA 1BSEA 1BUQA 1GD4A 5IEPA 1CEWI 3JUMA 4EV2A 3CC23 1OHPA 2JDIH 2LYXA 3CCE3 1DYUA 1MWSA 4KFFA 3HZPA 1RGCA 1FUTA 2KF4A 1LOWA 1IQYA 3EQQB 4FMAA 1A2VA 3JVCA 3WODG 3B4PA 2K0MA 2HMJB 1KD14 1E3RA 1TRPA 1Q40A 1W4NA 3FG4A 1RNBA 1FUSA 1TTOA 2CFDA 4R9KA 3ZG5A 2P05A 3X3XA 1GD3A 7STDA 2F99A 4ORLA 2AADA 2CWTA 3HX8A 2ML5A 3ZG0A 3MHEA 2M7OA 1RCLA 4KZ1A 1HKXA 3S27A 2OTL3 2QEX3 1TU5A 1B2ZA 2O3OA 3DMCA 1BGSA 1RTUA 4X2OA 1JN5A 1JB4A 2XFTA 1UCJA 4H3UA 1CYUA 1TUHA 1AY7A 1KWIA 3VF1A 2CFKA 1VQN3 2FGTA 1K734 5HGRA 1KQS2 1GMQA 1MGRA 1IT7A 1YJW3 1ISKA 1LRAA 4N6MA 3WR2A 2F5MA 4O3VA 4ZM8A 2XSOB 3STDA 2BO9B 3NXJA 2CG0A 2GBWB 5DRVA 4LZIA 5KP1A 3LTBA 1FUWA 4XB5A 2O9UX 3EJVA 1LOXA 2F98A 2XH9A 3MKIA 1VQ63 1YGEA 1QMAA 5D82A 1IDPA 2GEYA 1BNJA 1M904 1BNEA 1LQMB 2HMNB 3LT9A 2IMJA 4RNTA 4J5KA 5FGOA 5STDA 5AIFA 1SARA 1SQWA 2E2UA 1OGXA 2OCTA 1A2PA 1V74A 1DETA 2HMOB 1BOXA 3V92A 1RN4A 3D5GA 4XBXA 2WOFA 3EB8A 3CCR3 4HKVB 3WOEB 3BB9A 3UNLA 1Q42A 4O02B 3ZFZA
chains in the Genus database with same CATH topology
2OWPA 4BTXA 2W9QA 1IQXA 1L5GB 1EKMA 2B24B 2I9WA 2YFJB 3PS8A 4KVHA 3MG3A 3FZWA 3MYTA 4XDWA 1Y4KA 1VQ93 2INXA 2YFIB 3G0KA 5AI1A 1JV2B 4OVMA 3CCU3 1RJOA 3PGBA 5CXOA 4AKZA 3QK9A 2WGOA 3U1WA 4EXRA 1N5PA 4WYKB 3OW22 2FXTA 2UX0A 2OQEA 1IT8A 4MMYB 3ROBA 1ZO2A 4N6NB 5CF2A 3Q2PA 1DMMA 1R4CA 2Z7AA 4LMIA 3KE7A 4BTWA 1Z1SA 3LTDA 3T0UA 4HM7B 1D6UA 4EV5A 2PZVA 3DM8A 1D6YA 4EYCA 1DMNA 1Q824 1UI8A 5AIIA 1YI23 1JKGA 3FCSB 4HJLB 5KP4A 1DMQA 3CCV3 1W5ZA 5CF1A 1YJ93 2XF3A 4N3VA 3GZYB 1O7MB 3X3YA 3D3LA 2GBXB 1M1XB 2XGLA 3K5TA 5IENA 5IERA 3CC73 3CMA3 1AR0A 4R80A 3DGLA 3DZLA 1STFI 4XBTA 3DXOA 3GWRA 2W03A 2W6JH 3WDGB 1A67A 1NDOB 3LMLA 3MPHA 1S723 3FLJA 1EG9B 1JJ22 4HZ9B 1W2B2 2W0QA 5IG0A 3NBBA 1Q40B 3NV0A 1UUVB 4O8SA 2OQEC 3S5CA 4AKYA 5IEOA 1M1K4 3HIGA 3CME3 1W7CA 1W6GA 1W6CA 2IUKA 4GL6A 4XDVA 5LC6A 1QVG2 4GB5A 3V99A 2KXGA 2L4VA 3FGYA 4XM4A 1JB5A 3FG1A 4FR9A 4IIAA 3X42A 1PFPA 2CC3A 1JN5B 3X40A 3JUNA 3H3HA 1N8QA 1OGZA 1VQO3 3LTAA 2WOHA 1OUNA 4J8TA 1EQKA 2CKFB 4HYZA 1IV7A 1GS3A 1IVVA 4LEHA 2IA7A 3QRDA 1SPUA 1JB2A 4HM1B 4K90B 5D83A 3PZWA 3Q1CA 4QWTA 3CXC2 2GU3A 5AYSC 3KSPA 1F8NA 2Z6BA 3ER7A 3FSDA 3GZRA 4LSOA 5G2GA 3RDEA 2CWUA 2YFLB 5A0OB 1FGMA 3GAXA 1IVXA 2R4IA 1O7HB 2SBLA 5EVHA 3N8BA 4HM4B 5BVBA 1W2ZA 3M8CA 3EBTA 3PCRA 3CNXA 2P09A 2CHCA 2HMLB 1IVWA 2OTJ3 2KRTA 4HVNA 1U8CB 3IJEB 2C10A 4RBNA 3I0YA 1FGOA 3L0RA 3CCJ3 4WFOA 3F9SA 1QAFA 4CCVA 1A90A 3OV4A 3N9HA 2W2CA 3SOAA 1LVNA 3WA2X 4EC6A 3S28A 2XFSA 3NM7A 2WGQA 4MJDA 3BNBA 3RGRA 1LNHA 5EQLA 3NHXA 3MWZA 2YX9A 1NJI4 1AVLA 1VQ53 1VQP3 3O8YA 3WOFB 1FGRA 2LQVA 3JUPA 1DVDA 4X2HA 1E3VA 1ASKA 3KN4A 1RKYA 3G713 2JQ5A 3LH4A 3PCSA 2RSXA 3K7CA 3BNCA 2BMRB 1ULJB 3K9MC 3RGAA 1HU9A 4N6OB 2W56A 4KFDA 1IQ8A 1N9EA 1YJN3 3F40A 2IUJA 3TDGA 1AV4A 1K28A 3A76A 1JKGB 2XEPA 3F8HA 3SEDA 3D9RA 2GU1A 3CC43 3H51A 3S29A 1FGQA 2RCDA 3ECFA 1MNLA 2MF7A 5IW9A 3B7CA 1UW1A 1G96A 3LT8A 1WNHA 3WA3A 5AIGA 1AVKA 4EBGA 1SIIA 3LOYA 3LZAA 3CCS3 1C7HA 4R9LA 3I553 1US1A 3UB1A 2ZL8A 4HM8B 4MMXB 1STDA 1UUWB 3MG2A 2BMQB 3HIIA 5LC7A 3AMOA 3JUOA 2WO0A 1IK3A 1W00A 3CPW2 1OCVA 3K63A 4HM5B 3X3ZA 3NV0B 1RN7A 3KSED 3SLUA 1KSIA 2V1LA 2BNGA 5ELUA 3G16A 3F7XA 1OH0A 2B1XB 4L7KA 1ROVA 5JPPA 3SVAA 2CW9A 4J9AA 4HM6B 1TIJA 4H61A 5BXQA 5AIHA 3DUKA 1EA2A 2ZDJA 5TGNA 2HMKB 1OF5A 3NQYA 5AEWB 1J2BA 4RZMA 3FH1A 2STDA 6STDA 3SX1A 1Q814 1NB5I 3G6E3 1T5YA 3OWUA 3Q90A 1CYVA 4K61A 1RRHA 4WP5A 3OX9A 1GY5A 2P38A 2PNCA 3DGMA 1MOLA 3CCL3 3JUQA 1LXEA 5DREA 5ELJA 3V98A 4FMCA 2BT3A 1OHSA 4WWUC 5CLKA 5CK6A 1W01A 4HM0B 3UJMA 1WTHA 1K41A 3GZXB 1KC84 2XSHB 2CFLA 4WHAA 2QA43 5IF6A 5AEUB 4G1MB 1QALA 1Q864 5I97A 4K1UA 3UL5A 2P0XA 4MEIA 1VQ43 2Q07A 2Y73A 2OOVA 2CFWA 3CNMA 3F7SA 4N6LA 3VSYA 4R4KA 3KFQC 3U97A 1OPYA 2XR8B 4HM2B 4MMZB 4CDLA 2CG1A 1QVF2 3EBYA 3PXMA 3EF8A 3EE1A 1TFOA 3EN8A 5EEOA 2QIYA 2XGNA 1OACA 3NQZA 3T8UA 3KZTA 2D1WA 2QGUA 2RFRA 2BMOB 3K0ZA 3T8NA 1YIT3 2GEXA 3S67A 1IVUA 1NO3A 4NHFA 1FA3A 1TP6A 2XRXB 3EN1B 4L8OA 2F86B 4FMDA 2D42A 4LGQA 1CQSA 2CWVA 3UL6A 5AYRB 2ML6A 1Q7Y4 1UI7A 2Y74A 3OWSA 4OUQA 3G4S3 3SOYA 2W56B 4OK0A 3FF0A 4KFEA 4N6V0 2OOVC 3ALAA 5IG5A 2A15A 1O7PB 4O2HA 1K9M4 3BNEA 1QJGA 1N9JA 5D81A 2W04A 3CCQ3 1VQK3 4STDA 3KKGA 3FG3A 2CIUA 2KCDA 3EC9A 3LTCA 4Q53A 3NM2A 4FMBA 2MC8A 1JNQA 1OHOA 3AMOB 2C11A 4JRFA 3B4OA 4RNYA 3DGOA 3DY5A 1K8A4 1VQ73 3PYJA 2CFGA 2CH9A 2E2VA 3IPTA 3DGNA 1W02A 2CK3H 1YHQ3 5FW5A 1SJWA 3CCM3 3EX9A 3HI7A 1N5HA 4JF8A 1O7WB 3CPOA 3MG1A 3MSOA 1PU4A 1OF5B 3SXXA 4AEQA 2Z77A 3NBJA 4HBRA 4IPBA 2P0MA 1WMOA 3FKAA 3LXUX 1A2KA 1VQL3 1GY6A 1TFKA 1U5OA 4XBYA 1VQ83 1E97A 1NB3I 3WMDA 8CHOA 1NU3A 3X41A 4RNZA 1GYBA 1SIHA 1ZX2A 4FCMA 1ROAA 3F14A 1JRQA 5IG3A 1WQLB 4N6UA 3FF2A 5JBSA 2RGQA 3HK4A 4HZBB 4PEJA 1QAKA 2BHMA 3N54B 1IU7A 1NWWA 1S5AA 1VQM3 2K54A 1D6ZA 3GRDA 4BTYA 3OWYA 4R1KA 4WYKA 3BLZA 3F8XA 2Z76A 3KIIA 3VGNA 3NUVA 3I563 1N8R4 1RRLA 3G8ZA 1W6YA 5JPUA 3IMAB 4K1VA 4U13A 1O7GB 1ULIB 5IG4A 1VZZA 3NX0A 1WMNA 1YVBI 2W9PA 3CD63 4L8PA 2FNQA 3BNDA 4NREA 2E2TA 1YIJ3 4IT7A 1O7NB 3LYGA 3NBRA 4N6TA 3EHCA 1GY7A 4HM3B 3E99A 3B8LA 3OXAA 1IV9A 1WMPA 2GXFA 4FCZA 3CU3A 3J7Yd 2HMMB 3GZBA 1M9GA 4TX4A 4I4KA 5KP3A 1FGTA 4FCJA 1BUQA 1DVCA 1GD4A 5IEPA 1CEWI 3JUMA 4EV2A 3CC23 1OHPA 2JDIH 2LYXA 3CCE3 1DYUA 4KFFA 3HZPA 4FMAA 1IQYA 3EQQB 1A2VA 3JVCA 3WODG 3B4PA 2K0MA 2HMJB 1KD14 1E3RA 1Q40A 1W4NA 3FG4A 2CFDA 4R9KA 2P05A 3X3XA 1GD3A 7STDA 2F99A 4ORLA 2CWTA 3HX8A 2ML5A 3MHEA 2M7OA 4KZ1A 1HKXA 3S27A 2OTL3 2QEX3 1TU5A 2O3OA 3DMCA 4X2OA 1JN5A 1JB4A 2XFTA 4H3UA 1CYUA 1TUHA 3VF1A 1KWIA 2CFKA 1VQN3 2FGTA 1K734 5HGRA 1KQS2 1IT7A 1YJW3 1ISKA 4N6MA 4ZM8A 4O3VA 2XSOB 3STDA 2BO9B 3NXJA 2CG0A 2GBWB 5DRVA 4LZIA 5KP1A 3LTBA 1FUWA 4XB5A 2O9UX 3EJVA 1LOXA 2F98A 2XH9A 3MKIA 1VQ63 1YGEA 1QMAA 5D82A 1IDPA 2GEYA 1M904 2HMNB 3LT9A 2IMJA 5FGOA 5STDA 5AIFA 1SQWA 2E2UA 1OGXA 2OCTA 1V74A 2HMOB 3V92A 4XBXA 2WOFA 3EB8A 3CCR3 4HKVB 3WOEB 3BB9A 3UNLA 1Q42A 4O02B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2OWP A;  2B24 B;  2I9W A;  2YFJ B;  4KVH A;  3MG3 A;  3FZW A;  3MYT A;  4XDW A;  2INX A;  2YFI B;  3G0K A;  5AI1 A;  4OVM A;  5CXO A;  4WYK B;  2UX0 A;  3ROB A;  1ZO2 A;  5CF2 A;  1DMM A;  2Z7A A;  4LMI A;  3KE7 A;  1Z1S A;  4HM7 B;  2PZV A;  3DM8 A;  1DMN A;  5AII A;  1JKG A;  4HJL B;  5KP4 A;  1DMQ A;  5CF1 A;  4N3V A;  3GZY B;  1O7M B;  2GBX B;  5IEN A;  5IER A;  1AR0 A;  3DZL A;  4XBT A;  3DXO A;  3GWR A;  1NDO B;  3FLJ A;  1EG9 B;  4HZ9 B;  5IG0 A;  1Q40 B;  3NV0 A;  1UUV B;  3S5C A;  5IEO A;  4XDV A;  4GB5 A;  3FGY A;  4XM4 A;  1JB5 A;  4IIA A;  1JN5 B;  3JUN A;  3H3H A;  1OGZ A;  1OUN A;  4J8T A;  2CKF B;  1GS3 A;  4LEH A;  1JB2 A;  4HM1 B;  5D83 A;  3KSP A;  3ER7 A;  3FSD A;  3GZR A;  5G2G A;  2YFL B;  2R4I A;  1O7H B;  5EVH A;  5BVB A;  4HM4 B;  3M8C A;  3EBT A;  3CNX A;  2CHC A;  2HML B;  4HVN A;  3I0Y A;  3F9S A;  3OV4 A;  2W2C A;  3SOA A;  4MJD A;  3RGR A;  3NHX A;  3JUP A;  4X2H A;  1E3V A;  1ASK A;  2JQ5 A;  3K7C A;  2BMR B;  1ULJ B;  3RGA A;  3F40 A;  3A76 A;  1JKG B;  3F8H A;  3SED A;  3D9R A;  3H51 A;  2RCD A;  3ECF A;  3B7C A;  5AIG A;  3LZA A;  1C7H A;  4R9L A;  4HM8 B;  1STD A;  1UUW B;  3MG2 A;  2BMQ B;  3JUO A;  1W00 A;  1OCV A;  4HM5 B;  3NV0 B;  2BNG A;  3G16 A;  3F7X A;  1OH0 A;  2B1X B;  4L7K A;  5JPP A;  4J9A A;  4HM6 B;  5BXQ A;  5AIH A;  3DUK A;  1EA2 A;  5TGN A;  2HMK B;  1OF5 A;  5AEW B;  4RZM A;  3FH1 A;  2STD A;  6STD A;  3OWU A;  3Q90 A;  4WP5 A;  3OX9 A;  1GY5 A;  3JUQ A;  5DRE A;  1OHS A;  4WWU C;  5CLK A;  5CK6 A;  1W01 A;  4HM0 B;  3UJM A;  1K41 A;  3GZX B;  2XSH B;  5IF6 A;  5AEU B;  4K1U A;  3CNM A;  3F7S A;  3VSY A;  1OPY A;  2XR8 B;  4HM2 B;  4CDL A;  3EBY A;  3EF8 A;  3EN8 A;  2QIY A;  3T8U A;  3KZT A;  2QGU A;  2RFR A;  2BMO B;  3K0Z A;  3T8N A;  2GEX A;  1TP6 A;  2XRX B;  3EN1 B;  4L8O A;  2F86 B;  4LGQ A;  1CQS A;  3OWS A;  4OUQ A;  3SOY A;  3FF0 A;  5IG5 A;  2A15 A;  1O7P B;  1QJG A;  5D81 A;  4STD A;  3KKG A;  3EC9 A;  4Q53 A;  3NM2 A;  1OHO A;  3B4O A;  3IPT A;  1W02 A;  5FW5 A;  1SJW A;  3EX9 A;  1O7W B;  3CPO A;  3MG1 A;  3MSO A;  1OF5 B;  2Z77 A;  3FKA A;  1A2K A;  1GY6 A;  1U5O A;  4XBY A;  1E97 A;  3WMD A;  8CHO A;  1NU3 A;  1GYB A;  1ZX2 A;  4FCM A;  3F14 A;  5IG3 A;  1WQL B;  3FF2 A;  2RGQ A;  3HK4 A;  4HZB B;  4PEJ A;  1NWW A;  1S5A A;  2K54 A;  3GRD A;  3OWY A;  4R1K A;  4WYK A;  3BLZ A;  3F8X A;  2Z76 A;  3VGN A;  3NUV A;  3G8Z A;  1W6Y A;  5JPU A;  4K1V A;  4U13 A;  1O7G B;  1ULI B;  5IG4 A;  1VZZ A;  4L8P A;  1O7N B;  3LYG A;  3NBR A;  3EHC A;  1GY7 A;  4HM3 B;  3E99 A;  3B8L A;  3OXA A;  2GXF A;  3CU3 A;  2HMM B;  3GZB A;  4I4K A;  5KP3 A;  4FCJ A;  1BUQ A;  5IEP A;  3JUM A;  1OHP A;  3HZP A;  3EQQ B;  3B4P A;  2HMJ B;  1E3R A;  1Q40 A;  4R9K A;  7STD A;  2F99 A;  4ORL A;  3HX8 A;  3MHE A;  1HKX A;  3DMC A;  4X2O A;  1JN5 A;  1JB4 A;  4H3U A;  1TUH A;  5HGR A;  1ISK A;  2XSO B;  3STD A;  3NXJ A;  2GBW B;  5DRV A;  5KP1 A;  4XB5 A;  3EJV A;  2F98 A;  3MKI A;  1QMA A;  5D82 A;  1IDP A;  2GEY A;  2HMN B;  2IMJ A;  5STD A;  5AIF A;  1OGX A;  2HMO B;  4XBX A;  4HKV B;  3BB9 A;  3UNL A;  1Q42 A; 
#chains in the Genus database with same CATH topology
 2OWP A;  4BTX A;  1Q9E A;  2W9Q A;  1IQX A;  1MWU A;  1L5G B;  3WHO A;  1EKM A;  2B24 B;  2I9W A;  2YFJ B;  3PS8 A;  4KVH A;  4GHO A;  4CJN A;  1RSN A;  3FZW A;  3MG3 A;  3MYT A;  4XDW A;  1Y4K A;  1VQ9 3;  1BNS A;  2INX A;  2YFI B;  3G0K A;  5AI1 A;  5GSP A;  5BU4 A;  1JV2 B;  4OVM A;  3CCU 3;  1RJO A;  3PGB A;  2AAE A;  1BRG A;  5CXO A;  4AKZ A;  1BSC A;  1FYS A;  2WGO A;  3QK9 A;  3U1W A;  1BRS A;  7RNT A;  4EXR A;  1N5P A;  4WYK B;  1I70 A;  3OW2 2;  2FXT A;  1BNG A;  2BU4 A;  2UX0 A;  2OQE A;  1IT8 A;  4MMY B;  2IYJ A;  1ZO2 A;  3ROB A;  1BSA A;  4N6N B;  1LQG C;  5CF2 A;  3Q2P A;  1DMM A;  1R4C A;  2Z7A A;  2HOH A;  4LMI A;  3KE7 A;  4BTW A;  2KAA A;  1Z1S A;  2K3D A;  3LTD A;  1B2X A;  3T0U A;  4HM7 B;  1D6U A;  4EV5 A;  1JBR A;  2PZV A;  3DM8 A;  1D6Y A;  4EYC A;  1DMN A;  1Q82 4;  1UI8 A;  5AII A;  1YI2 3;  1JKG A;  1RNT A;  3FCS B;  4HJL B;  1DMQ A;  1PY3 A;  1W5Z A;  2RBI A;  5CF1 A;  2XF3 A;  4N3V A;  3GZY B;  1YJ9 3;  1T2H A;  1O7M B;  3X3Y A;  3D3L A;  1UCK A;  2GBX B;  1M1X B;  1BRK A;  1ZS7 A;  2XGL A;  3K5T A;  1NNV A;  5IEN A;  5IER A;  3CC7 3;  3CMA 3;  1AR0 A;  3AHW A;  4R80 A;  3DGL A;  3DZL A;  1STF I;  4XBT A;  3DXO A;  3GWR A;  2W03 A;  2W6J H;  3WDG B;  1A67 A;  1NDO B;  3LML A;  2IY2 A;  3MPH A;  1S72 3;  1BRN L;  3FLJ A;  1EG9 B;  4CPK A;  1JJ2 2;  4HZ9 B;  1W2B 2;  2W0Q A;  4DKI A;  5IG0 A;  3URP A;  3NBB A;  4HAA A;  1Q40 B;  3NV0 A;  1UUV B;  4O8S A;  2OQE C;  1I2F A;  3S5C A;  1UCL A;  4AKY A;  5IEO A;  1M1K 4;  3HIG A;  3CME 3;  1W7C A;  1W6G A;  1W6C A;  1BIR A;  1X1U A;  2IUK A;  4GL6 A;  4XDV A;  4GB5 A;  5G1L A;  5LC6 A;  3CCV 3;  1QVG 2;  3V99 A;  2KXG A;  2L4V A;  3DH2 A;  3FGY A;  4XM4 A;  1BNF A;  1JB5 A;  3FG1 A;  1BRJ A;  4FR9 A;  2ZA4 A;  4KT3 B;  4IIA A;  3X42 A;  1PFP A;  2CC3 A;  1JN5 B;  3X40 A;  1FZU A;  3D79 A;  3JUN A;  3H3H A;  1N8Q A;  1OGZ A;  1RGL A;  1VQO 3;  3LTA A;  2WOH A;  1OUN A;  4J8T A;  1EQK A;  2CKF B;  4HYZ A;  1IV7 A;  1GS3 A;  1IVV A;  4LEH A;  2IA7 A;  3QRD A;  1SPU A;  1JB2 A;  4HM1 B;  4K90 B;  5D83 A;  3PZW A;  3Q1C A;  4QWT A;  3CXC 2;  2GU3 A;  5AYS C;  3KSP A;  1B21 A;  1F8N A;  2Z6B A;  3ER7 A;  3FSD A;  1JZD A;  1RGK A;  3GZR A;  4LSO A;  5G2G A;  3RDE A;  2CWU A;  2YFL B;  3DGY A;  1FGM A;  3GAX A;  5A0O B;  1EUI C;  1IVX A;  2R4I A;  1O7H B;  2SBL A;  4LYL B;  5EVH A;  3N8B A;  4HM4 B;  5M1A A;  5BVB A;  1W2Z A;  3M8C A;  3EBT A;  3PCR A;  3CNX A;  2P09 A;  2CHC A;  2HML B;  1IVW A;  2OTJ 3;  2KRT A;  4HVN A;  1U8C B;  1PYL A;  3IJE B;  2C10 A;  4RBN A;  7GSP A;  3I0Y A;  1FGO A;  3L0R A;  1HZ1 A;  3CCJ 3;  4WFO A;  3F9S A;  1QAF A;  4CCV A;  1A90 A;  3OV4 A;  3N9H A;  1RGF A;  2W2C A;  1BVI A;  3SOA A;  1LVN A;  1X1X A;  3WA2 X;  4EC6 A;  3S28 A;  2XFS A;  3NM7 A;  1V57 A;  2WGQ A;  3AGN A;  4MJD A;  3BNB A;  3D5I A;  3RGR A;  1LNH A;  1BNI A;  5EQL A;  3NHX A;  3MWZ A;  2YX9 A;  2ZHX B;  1NJI 4;  1AVL A;  1VQ5 3;  1VQP 3;  3O8Y A;  3WOF B;  1FGR A;  2LQV A;  3JUP A;  1DVD A;  4X2H A;  1E3V A;  2GSP A;  1BNR A;  2RNT A;  3BIR A;  1ASK A;  3KN4 A;  1RKY A;  3G71 3;  2JQ5 A;  1UGH I;  3LH4 A;  2RSX A;  1YGW A;  3K7C A;  3PCS A;  3BNC A;  1Q7H A;  1RN1 A;  2BMR B;  1ULJ B;  3K9M C;  3RGA A;  1HU9 A;  2H0H A;  5RNT A;  4N6O B;  2W56 A;  4KFD A;  1IQ8 A;  1N9E A;  1YJN 3;  3F40 A;  4NPB A;  2IUJ A;  1AV4 A;  3TDG A;  1K28 A;  3A76 A;  1BU4 A;  1JKG B;  1I0X A;  2XEP A;  3F8H A;  3D9R A;  2GU1 A;  3SED A;  1JZO A;  1TJD A;  3CC4 3;  3H51 A;  3S29 A;  1FGQ A;  2RCD A;  3ECF A;  1MNL A;  2MF7 A;  5IW9 A;  3B7C A;  1UW1 A;  1G96 A;  3LT8 A;  1WNH A;  3WA3 A;  1AQZ A;  1AVK A;  5AIG A;  1GOV A;  4EBG A;  2CX1 A;  1SII A;  3LOY A;  5M19 A;  3LZA A;  3CCS 3;  1C7H A;  1B3S A;  2R41 A;  2UGI A;  1US1 A;  4R9L A;  3I55 3;  3UB1 A;  2ZL8 A;  4HM8 B;  1MWT A;  1RGE A;  1STD A;  1UUW B;  3MG2 A;  4MMX B;  2BMQ B;  1B2U A;  3HII A;  5LC7 A;  3AMO A;  3JUO A;  2WO0 A;  1IK3 A;  1W00 A;  3CPW 2;  1OCV A;  3K63 A;  4HM5 B;  3X3Z A;  3NV0 B;  1RN7 A;  3KSE D;  3SLU A;  1FW7 A;  1KSI A;  2V1L A;  1LNI A;  1I3I A;  2BNG A;  3G16 A;  5ELU A;  4BIR A;  3F7X A;  1OH0 A;  2B1X B;  4L7K A;  1BAN A;  1ROV A;  1RGG A;  4EW5 A;  5JPP A;  1LOY A;  3SVA A;  2CW9 A;  3Q3F A;  4J9A A;  2J8X B;  1TIJ A;  4HM6 B;  1B2S A;  4H61 A;  5BXQ A;  5AIH A;  1YVS A;  3DUK A;  1EA2 A;  2ZDJ A;  5TGN A;  1ZGX A;  2HMK B;  1OF5 A;  3NQY A;  5AEW B;  1J2B A;  1JBT A;  4RZM A;  3FH1 A;  2STD A;  6STD A;  2CX0 A;  3SX1 A;  3BU4 A;  1Q81 4;  1NB5 I;  3G6E 3;  1T5Y A;  1T2I A;  1UUG B;  3OWU A;  3Q90 A;  4BL3 A;  1CYV A;  4K61 A;  1RRH A;  4WP5 A;  1I3F A;  1V58 A;  1GY5 A;  2P38 A;  2PNC A;  3DGM A;  1B27 A;  1MWR A;  3OX9 A;  1MOL A;  3CCL 3;  3JUQ A;  1LXE A;  5DRE A;  1MGW A;  5ELJ A;  3V98 A;  8RNT A;  4FMC A;  2BT3 A;  1OHS A;  4WWU C;  1EEJ A;  5CLK A;  5CK6 A;  1W01 A;  1B20 A;  4HM0 B;  3UJM A;  1WTH A;  1I2E A;  1K41 A;  3GZX B;  1KC8 4;  2XSH B;  4HOH A;  2CFL A;  4WHA A;  4ILF A;  2QA4 3;  5IF6 A;  1I8V A;  1I2G A;  5AEU B;  4G1M B;  4BU4 A;  1QAL A;  1Q86 4;  5I97 A;  4K1U A;  3UL5 A;  2P0X A;  4MEI A;  5BIR A;  1VQ4 3;  2F56 A;  2Q07 A;  2Y73 A;  2OOV A;  2CFW A;  1LOV A;  3CNM A;  3F7S A;  4N6L A;  3VSY A;  4R4K A;  3KFQ C;  3U97 A;  1OPY A;  2XR8 B;  4HM2 B;  4MMZ B;  5M18 A;  3AGO A;  4CDL A;  2CG1 A;  1QVF 2;  3EBY A;  3PXM A;  5KP4 A;  3EF8 A;  3EE1 A;  1TFO A;  1X1W A;  3EN8 A;  5EEO A;  2QIY A;  2XGN A;  1OAC A;  3NQZ A;  3T8U A;  3KZT A;  1RDS A;  2D1W A;  2QGU A;  2RFR A;  2BMO B;  3K0Z A;  3T8N A;  1YIT 3;  2GEX A;  3S67 A;  1BRH A;  1IVU A;  1NO3 A;  3GSP A;  4NHF A;  1FA3 A;  1TP6 A;  2XRX B;  1UDI I;  3EN1 B;  2KF6 A;  4L8O A;  2F86 B;  4FMD A;  2D42 A;  4LGQ A;  1CQS A;  2CWV A;  3UL6 A;  5AYR B;  2ML6 A;  1BRI A;  1RHL A;  1Q7Y 4;  1UI7 A;  2Y74 A;  3OWS A;  2H0G A;  4OUQ A;  3G4S 3;  1T3B A;  4J5G A;  1YNV X;  3SOY A;  2W56 B;  3AHS A;  4OK0 A;  2UUG C;  6GSP A;  3FF0 A;  3D4A A;  4KFE A;  1BSB A;  1GSP A;  4N6V 0;  1RGH A;  2OOV C;  3ALA A;  1RCK A;  3KCH A;  2A15 A;  5IG5 A;  1O7P B;  3A5E A;  4O2H A;  1K9M 4;  4GSP A;  3BNE A;  1QJG A;  1N9J A;  5D81 A;  2W04 A;  3CCQ 3;  1VQK 3;  4STD A;  1GMP A;  3KKG A;  3FG3 A;  2CIU A;  2KCD A;  3EC9 A;  2L1S A;  3LTC A;  4Q53 A;  1RGA A;  3NM2 A;  2KF3 A;  4FMB A;  2MC8 A;  1JNQ A;  1RMS A;  4I5Q A;  1OHO A;  3AMO B;  2C11 A;  4JRF A;  3B4O A;  4RNY A;  3DGO A;  3DY5 A;  1K8A 4;  5G1K A;  1VQ7 3;  6RNT A;  3PYJ A;  1I0V A;  2CFG A;  1UGI A;  1C54 A;  5HOH A;  2CH9 A;  2E2V A;  3IPT A;  2H0I A;  3DGN A;  1W02 A;  2CK3 H;  1YHQ 3;  1UCI A;  1TRQ A;  5FW5 A;  1SJW A;  3CCM 3;  3EX9 A;  1B2M A;  3HI7 A;  1N5H A;  4JF8 A;  4BL2 A;  1JBS A;  1O7W B;  3CPO A;  3HOH A;  3MG1 A;  3MSO A;  1DE3 A;  1PU4 A;  1OF5 B;  3SXX A;  4AEQ A;  2Z77 A;  3NBJ A;  4HBR A;  4IPB A;  2P0M A;  1WMO A;  3FKA A;  3LXU X;  1A2K A;  1VQL 3;  9RNT A;  1GY6 A;  1TFK A;  1U5O A;  1G02 A;  4XBY A;  1GMR A;  1VQ8 3;  1E97 A;  1BSD A;  1NB3 I;  3WMD A;  1RLS A;  8CHO A;  1G0T A;  2F4Y A;  1NU3 A;  3SYU A;  3X41 A;  4RNZ A;  2F5W A;  1GYB A;  1SIH A;  1BAO A;  1X1Y A;  3RNT A;  1ZX2 A;  1IYY A;  4FCM A;  1ROA A;  3F14 A;  1JRQ A;  5IG3 A;  1WQL B;  4N6U A;  3FF2 A;  5JBS A;  2RGQ A;  3HK4 A;  4HZB B;  4PEJ A;  1QAK A;  2BHM A;  3N54 B;  1IU7 A;  1NWW A;  1S5A A;  1VQM 3;  2K54 A;  1D6Z A;  3GRD A;  4BTY A;  1R4Y A;  3OWY A;  4R1K A;  1GOY A;  4WYK A;  3BLZ A;  3F8X A;  2Z76 A;  3KII A;  3VGN A;  3NUV A;  3I56 3;  1N8R 4;  1RRL A;  3G8Z A;  1W6Y A;  5JPU A;  3IMA B;  4K1V A;  4U13 A;  1O7G B;  1CH0 A;  1ULI B;  1HYF A;  5IG4 A;  1VZZ A;  3NX0 A;  1WMN A;  1YVB I;  2W9P A;  3CD6 3;  4L8P A;  2FNQ A;  3BND A;  4NRE A;  2E2T A;  1BUJ A;  1YIJ 3;  4IT7 A;  1O7N B;  3LYG A;  3NBR A;  4N6T A;  3EHC A;  1GOU A;  1GY7 A;  2BIR A;  4HM3 B;  1VQQ A;  3E99 A;  3B8L A;  3OXA A;  2KF5 A;  1IV9 A;  2SAR A;  1WMP A;  2GXF A;  4FCZ A;  3CU3 A;  3J7Y d;  2HMM B;  3GZB A;  1M9G A;  4TX4 A;  4I4K A;  5KP3 A;  1FGT A;  2C4B A;  4FCJ A;  1DVC A;  1BSE A;  1BUQ A;  1GD4 A;  5IEP A;  1CEW I;  3JUM A;  4EV2 A;  3CC2 3;  1OHP A;  2JDI H;  2LYX A;  3CCE 3;  1DYU A;  1MWS A;  4KFF A;  3HZP A;  1RGC A;  1FUT A;  2KF4 A;  1LOW A;  1IQY A;  3EQQ B;  4FMA A;  1A2V A;  3JVC A;  3WOD G;  3B4P A;  2K0M A;  2HMJ B;  1KD1 4;  1E3R A;  1TRP A;  1Q40 A;  1W4N A;  3FG4 A;  1RNB A;  1FUS A;  1TTO A;  2CFD A;  4R9K A;  3ZG5 A;  2P05 A;  3X3X A;  1GD3 A;  7STD A;  2F99 A;  4ORL A;  2AAD A;  2CWT A;  3HX8 A;  2ML5 A;  3ZG0 A;  3MHE A;  2M7O A;  1RCL A;  4KZ1 A;  1HKX A;  3S27 A;  2OTL 3;  2QEX 3;  1TU5 A;  1B2Z A;  2O3O A;  3DMC A;  1BGS A;  1RTU A;  4X2O A;  1JN5 A;  1JB4 A;  2XFT A;  1UCJ A;  4H3U A;  1CYU A;  1TUH A;  1AY7 A;  1KWI A;  3VF1 A;  2CFK A;  1VQN 3;  2FGT A;  1K73 4;  5HGR A;  1KQS 2;  1GMQ A;  1MGR A;  1IT7 A;  1YJW 3;  1ISK A;  1LRA A;  4N6M A;  3WR2 A;  2F5M A;  4O3V A;  4ZM8 A;  2XSO B;  3STD A;  2BO9 B;  3NXJ A;  2CG0 A;  2GBW B;  5DRV A;  4LZI A;  5KP1 A;  3LTB A;  1FUW A;  4XB5 A;  2O9U X;  3EJV A;  1LOX A;  2F98 A;  2XH9 A;  3MKI A;  1VQ6 3;  1YGE A;  1QMA A;  5D82 A;  1IDP A;  2GEY A;  1BNJ A;  1M90 4;  1BNE A;  1LQM B;  2HMN B;  3LT9 A;  2IMJ A;  4RNT A;  4J5K A;  5FGO A;  5STD A;  5AIF A;  1SAR A;  1SQW A;  2E2U A;  1OGX A;  2OCT A;  1A2P A;  1V74 A;  1DET A;  2HMO B;  1BOX A;  3V92 A;  1RN4 A;  3D5G A;  4XBX A;  2WOF A;  3EB8 A;  3CCR 3;  4HKV B;  3WOE B;  3BB9 A;  3UNL A;  1Q42 A;  4O02 B;  3ZFZ A; 
#chains in the Genus database with same CATH homology
 2OWP A;  4BTX A;  2W9Q A;  1IQX A;  1L5G B;  1EKM A;  2B24 B;  2I9W A;  2YFJ B;  3PS8 A;  4KVH A;  3MG3 A;  3FZW A;  3MYT A;  4XDW A;  1Y4K A;  1VQ9 3;  2INX A;  2YFI B;  3G0K A;  5AI1 A;  1JV2 B;  4OVM A;  3CCU 3;  1RJO A;  3PGB A;  5CXO A;  4AKZ A;  3QK9 A;  2WGO A;  3U1W A;  4EXR A;  1N5P A;  4WYK B;  3OW2 2;  2FXT A;  2UX0 A;  2OQE A;  1IT8 A;  4MMY B;  3ROB A;  1ZO2 A;  4N6N B;  5CF2 A;  3Q2P A;  1DMM A;  1R4C A;  2Z7A A;  4LMI A;  3KE7 A;  4BTW A;  1Z1S A;  3LTD A;  3T0U A;  4HM7 B;  1D6U A;  4EV5 A;  2PZV A;  3DM8 A;  1D6Y A;  4EYC A;  1DMN A;  1Q82 4;  1UI8 A;  5AII A;  1YI2 3;  1JKG A;  3FCS B;  4HJL B;  5KP4 A;  1DMQ A;  3CCV 3;  1W5Z A;  5CF1 A;  1YJ9 3;  2XF3 A;  4N3V A;  3GZY B;  1O7M B;  3X3Y A;  3D3L A;  2GBX B;  1M1X B;  2XGL A;  3K5T A;  5IEN A;  5IER A;  3CC7 3;  3CMA 3;  1AR0 A;  4R80 A;  3DGL A;  3DZL A;  1STF I;  4XBT A;  3DXO A;  3GWR A;  2W03 A;  2W6J H;  3WDG B;  1A67 A;  1NDO B;  3LML A;  3MPH A;  1S72 3;  3FLJ A;  1EG9 B;  1JJ2 2;  4HZ9 B;  1W2B 2;  2W0Q A;  5IG0 A;  3NBB A;  1Q40 B;  3NV0 A;  1UUV B;  4O8S A;  2OQE C;  3S5C A;  4AKY A;  5IEO A;  1M1K 4;  3HIG A;  3CME 3;  1W7C A;  1W6G A;  1W6C A;  2IUK A;  4GL6 A;  4XDV A;  5LC6 A;  1QVG 2;  4GB5 A;  3V99 A;  2KXG A;  2L4V A;  3FGY A;  4XM4 A;  1JB5 A;  3FG1 A;  4FR9 A;  4IIA A;  3X42 A;  1PFP A;  2CC3 A;  1JN5 B;  3X40 A;  3JUN A;  3H3H A;  1N8Q A;  1OGZ A;  1VQO 3;  3LTA A;  2WOH A;  1OUN A;  4J8T A;  1EQK A;  2CKF B;  4HYZ A;  1IV7 A;  1GS3 A;  1IVV A;  4LEH A;  2IA7 A;  3QRD A;  1SPU A;  1JB2 A;  4HM1 B;  4K90 B;  5D83 A;  3PZW A;  3Q1C A;  4QWT A;  3CXC 2;  2GU3 A;  5AYS C;  3KSP A;  1F8N A;  2Z6B A;  3ER7 A;  3FSD A;  3GZR A;  4LSO A;  5G2G A;  3RDE A;  2CWU A;  2YFL B;  5A0O B;  1FGM A;  3GAX A;  1IVX A;  2R4I A;  1O7H B;  2SBL A;  5EVH A;  3N8B A;  4HM4 B;  5BVB A;  1W2Z A;  3M8C A;  3EBT A;  3PCR A;  3CNX A;  2P09 A;  2CHC A;  2HML B;  1IVW A;  2OTJ 3;  2KRT A;  4HVN A;  1U8C B;  3IJE B;  2C10 A;  4RBN A;  3I0Y A;  1FGO A;  3L0R A;  3CCJ 3;  4WFO A;  3F9S A;  1QAF A;  4CCV A;  1A90 A;  3OV4 A;  3N9H A;  2W2C A;  3SOA A;  1LVN A;  3WA2 X;  4EC6 A;  3S28 A;  2XFS A;  3NM7 A;  2WGQ A;  4MJD A;  3BNB A;  3RGR A;  1LNH A;  5EQL A;  3NHX A;  3MWZ A;  2YX9 A;  1NJI 4;  1AVL A;  1VQ5 3;  1VQP 3;  3O8Y A;  3WOF B;  1FGR A;  2LQV A;  3JUP A;  1DVD A;  4X2H A;  1E3V A;  1ASK A;  3KN4 A;  1RKY A;  3G71 3;  2JQ5 A;  3LH4 A;  3PCS A;  2RSX A;  3K7C A;  3BNC A;  2BMR B;  1ULJ B;  3K9M C;  3RGA A;  1HU9 A;  4N6O B;  2W56 A;  4KFD A;  1IQ8 A;  1N9E A;  1YJN 3;  3F40 A;  2IUJ A;  3TDG A;  1AV4 A;  1K28 A;  3A76 A;  1JKG B;  2XEP A;  3F8H A;  3SED A;  3D9R A;  2GU1 A;  3CC4 3;  3H51 A;  3S29 A;  1FGQ A;  2RCD A;  3ECF A;  1MNL A;  2MF7 A;  5IW9 A;  3B7C A;  1UW1 A;  1G96 A;  3LT8 A;  1WNH A;  3WA3 A;  5AIG A;  1AVK A;  4EBG A;  1SII A;  3LOY A;  3LZA A;  3CCS 3;  1C7H A;  4R9L A;  3I55 3;  1US1 A;  3UB1 A;  2ZL8 A;  4HM8 B;  4MMX B;  1STD A;  1UUW B;  3MG2 A;  2BMQ B;  3HII A;  5LC7 A;  3AMO A;  3JUO A;  2WO0 A;  1IK3 A;  1W00 A;  3CPW 2;  1OCV A;  3K63 A;  4HM5 B;  3X3Z A;  3NV0 B;  1RN7 A;  3KSE D;  3SLU A;  1KSI A;  2V1L A;  2BNG A;  5ELU A;  3G16 A;  3F7X A;  1OH0 A;  2B1X B;  4L7K A;  1ROV A;  5JPP A;  3SVA A;  2CW9 A;  4J9A A;  4HM6 B;  1TIJ A;  4H61 A;  5BXQ A;  5AIH A;  3DUK A;  1EA2 A;  2ZDJ A;  5TGN A;  2HMK B;  1OF5 A;  3NQY A;  5AEW B;  1J2B A;  4RZM A;  3FH1 A;  2STD A;  6STD A;  3SX1 A;  1Q81 4;  1NB5 I;  3G6E 3;  1T5Y A;  3OWU A;  3Q90 A;  1CYV A;  4K61 A;  1RRH A;  4WP5 A;  3OX9 A;  1GY5 A;  2P38 A;  2PNC A;  3DGM A;  1MOL A;  3CCL 3;  3JUQ A;  1LXE A;  5DRE A;  5ELJ A;  3V98 A;  4FMC A;  2BT3 A;  1OHS A;  4WWU C;  5CLK A;  5CK6 A;  1W01 A;  4HM0 B;  3UJM A;  1WTH A;  1K41 A;  3GZX B;  1KC8 4;  2XSH B;  2CFL A;  4WHA A;  2QA4 3;  5IF6 A;  5AEU B;  4G1M B;  1QAL A;  1Q86 4;  5I97 A;  4K1U A;  3UL5 A;  2P0X A;  4MEI A;  1VQ4 3;  2Q07 A;  2Y73 A;  2OOV A;  2CFW A;  3CNM A;  3F7S A;  4N6L A;  3VSY A;  4R4K A;  3KFQ C;  3U97 A;  1OPY A;  2XR8 B;  4HM2 B;  4MMZ B;  4CDL A;  2CG1 A;  1QVF 2;  3EBY A;  3PXM A;  3EF8 A;  3EE1 A;  1TFO A;  3EN8 A;  5EEO A;  2QIY A;  2XGN A;  1OAC A;  3NQZ A;  3T8U A;  3KZT A;  2D1W A;  2QGU A;  2RFR A;  2BMO B;  3K0Z A;  3T8N A;  1YIT 3;  2GEX A;  3S67 A;  1IVU A;  1NO3 A;  4NHF A;  1FA3 A;  1TP6 A;  2XRX B;  3EN1 B;  4L8O A;  2F86 B;  4FMD A;  2D42 A;  4LGQ A;  1CQS A;  2CWV A;  3UL6 A;  5AYR B;  2ML6 A;  1Q7Y 4;  1UI7 A;  2Y74 A;  3OWS A;  4OUQ A;  3G4S 3;  3SOY A;  2W56 B;  4OK0 A;  3FF0 A;  4KFE A;  4N6V 0;  2OOV C;  3ALA A;  5IG5 A;  2A15 A;  1O7P B;  4O2H A;  1K9M 4;  3BNE A;  1QJG A;  1N9J A;  5D81 A;  2W04 A;  3CCQ 3;  1VQK 3;  4STD A;  3KKG A;  3FG3 A;  2CIU A;  2KCD A;  3EC9 A;  3LTC A;  4Q53 A;  3NM2 A;  4FMB A;  2MC8 A;  1JNQ A;  1OHO A;  3AMO B;  2C11 A;  4JRF A;  3B4O A;  4RNY A;  3DGO A;  3DY5 A;  1K8A 4;  1VQ7 3;  3PYJ A;  2CFG A;  2CH9 A;  2E2V A;  3IPT A;  3DGN A;  1W02 A;  2CK3 H;  1YHQ 3;  5FW5 A;  1SJW A;  3CCM 3;  3EX9 A;  3HI7 A;  1N5H A;  4JF8 A;  1O7W B;  3CPO A;  3MG1 A;  3MSO A;  1PU4 A;  1OF5 B;  3SXX A;  4AEQ A;  2Z77 A;  3NBJ A;  4HBR A;  4IPB A;  2P0M A;  1WMO A;  3FKA A;  3LXU X;  1A2K A;  1VQL 3;  1GY6 A;  1TFK A;  1U5O A;  4XBY A;  1VQ8 3;  1E97 A;  1NB3 I;  3WMD A;  8CHO A;  1NU3 A;  3X41 A;  4RNZ A;  1GYB A;  1SIH A;  1ZX2 A;  4FCM A;  1ROA A;  3F14 A;  1JRQ A;  5IG3 A;  1WQL B;  4N6U A;  3FF2 A;  5JBS A;  2RGQ A;  3HK4 A;  4HZB B;  4PEJ A;  1QAK A;  2BHM A;  3N54 B;  1IU7 A;  1NWW A;  1S5A A;  1VQM 3;  2K54 A;  1D6Z A;  3GRD A;  4BTY A;  3OWY A;  4R1K A;  4WYK A;  3BLZ A;  3F8X A;  2Z76 A;  3KII A;  3VGN A;  3NUV A;  3I56 3;  1N8R 4;  1RRL A;  3G8Z A;  1W6Y A;  5JPU A;  3IMA B;  4K1V A;  4U13 A;  1O7G B;  1ULI B;  5IG4 A;  1VZZ A;  3NX0 A;  1WMN A;  1YVB I;  2W9P A;  3CD6 3;  4L8P A;  2FNQ A;  3BND A;  4NRE A;  2E2T A;  1YIJ 3;  4IT7 A;  1O7N B;  3LYG A;  3NBR A;  4N6T A;  3EHC A;  1GY7 A;  4HM3 B;  3E99 A;  3B8L A;  3OXA A;  1IV9 A;  1WMP A;  2GXF A;  4FCZ A;  3CU3 A;  3J7Y d;  2HMM B;  3GZB A;  1M9G A;  4TX4 A;  4I4K A;  5KP3 A;  1FGT A;  4FCJ A;  1BUQ A;  1DVC A;  1GD4 A;  5IEP A;  1CEW I;  3JUM A;  4EV2 A;  3CC2 3;  1OHP A;  2JDI H;  2LYX A;  3CCE 3;  1DYU A;  4KFF A;  3HZP A;  4FMA A;  1IQY A;  3EQQ B;  1A2V A;  3JVC A;  3WOD G;  3B4P A;  2K0M A;  2HMJ B;  1KD1 4;  1E3R A;  1Q40 A;  1W4N A;  3FG4 A;  2CFD A;  4R9K A;  2P05 A;  3X3X A;  1GD3 A;  7STD A;  2F99 A;  4ORL A;  2CWT A;  3HX8 A;  2ML5 A;  3MHE A;  2M7O A;  4KZ1 A;  1HKX A;  3S27 A;  2OTL 3;  2QEX 3;  1TU5 A;  2O3O A;  3DMC A;  4X2O A;  1JN5 A;  1JB4 A;  2XFT A;  4H3U A;  1CYU A;  1TUH A;  3VF1 A;  1KWI A;  2CFK A;  1VQN 3;  2FGT A;  1K73 4;  5HGR A;  1KQS 2;  1IT7 A;  1YJW 3;  1ISK A;  4N6M A;  4ZM8 A;  4O3V A;  2XSO B;  3STD A;  2BO9 B;  3NXJ A;  2CG0 A;  2GBW B;  5DRV A;  4LZI A;  5KP1 A;  3LTB A;  1FUW A;  4XB5 A;  2O9U X;  3EJV A;  1LOX A;  2F98 A;  2XH9 A;  3MKI A;  1VQ6 3;  1YGE A;  1QMA A;  5D82 A;  1IDP A;  2GEY A;  1M90 4;  2HMN B;  3LT9 A;  2IMJ A;  5FGO A;  5STD A;  5AIF A;  1SQW A;  2E2U A;  1OGX A;  2OCT A;  1V74 A;  2HMO B;  3V92 A;  4XBX A;  2WOF A;  3EB8 A;  3CCR 3;  4HKV B;  3WOE B;  3BB9 A;  3UNL A;  1Q42 A;  4O02 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...