1K4MA

Crystal structure of e.coli nicotinic acid mononucleotide adenylyltransferase complexed to deamido-nad
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
213
structure length
213
Chain Sequence
b'MKSLQALFGGTFDPVHYGHLKPVETLANLIGLTRVTIIPNNVPPHRPQPEANSVQRKHMLELAIADKPLFTLDERELKRNAPSYTAQTLKEWRQEQGPDVPLAFIIGQDSLLTFPTWYEYETILDNAHLIVCRRPGYPLEMAQPQYQQWLEDHLTHNPEDLHLQPAGKIYLAETPWFNISATIIRERLQNGESCEDLLPEPVLTYINQQGLYR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords NaMN adenylyltransferase
publication title Crystal structures of E. coli nicotinate mononucleotide adenylyltransferase and its complex with deamido-NAD.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transferase
total genus 61
structure length 213
sequence length 213
chains with identical sequence B, C
ec nomenclature ec 2.7.7.18: Nicotinate-nucleotide adenylyltransferase.
pdb deposition date 2001-10-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01467 CTP_transf_like Cytidylyltransferase-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.620 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HUPs 1k4mA00
1IHOA 4CDMA 1LI7A 2XRYA 1T9GS 1OBHA 1EUQA 4MUJA 1ILEA 3FWKA 4NAHA 3HFJA 3IOBA 1G8FA 3FY4A 3SDBA 1KQOA 1G8HA 3QTTA 1GLNA 1QNFA 4MW1A 3G5AA 5F23A 3SEZA 1WXEA 1U3DA 4EF6A 3H97A 3I05A 5HUJA 3COZA 2QTMA 3AIIA 4CQNA 3KT3A 3ND7A 3L93A 1O96B 2IP1A 3PXUA 1KQPA 2DERA 3A04A 4ZT5A 4PBRA 1QRSA 3FNRA 3ZXSA 2D5BA 3COVA 1YULA 3BL5A 4MLPA 3HL4A 1VLHA 1O97C 1PG2A 2D54A 1J20A 5KWVA 1LW7A 3H05A 5K0TA 1PFWA 2QTNA 5K0SA 4QBTA 3KT8A 1CT9A 3VRHA 3CLTD 1H3NA 3ZJVA 1V8FA 1YUNA 2CSXA 1J70A 2EL7A 4ZT6A 4MUKA 2CYCA 4KR9A 1K4KA 3LCJA 4NX2A 3GLVA 1GPMA 1ULHA 4JXXA 4HPWA 2HZ7A 4JFAA 3IOCA 3P52A 2G36A 1Q15A 3DPIA 2CUZA 1KKUA 4EG1A 1MRZA 1P7PA 1Y42X 3X1KA 2D13A 2C5SA 3RK1A 4DDMA 3MUEA 2E18A 4XFJA 1EFVA 4MAFA 3A4IA 4YP6A 1MAUA 2ZUEA 2DPLA 1K92A 1IH8A 3HZRA 1M8FA 4K0RA 1GTRA 2Z3VA 3PNYA 1OWPA 1D2RA 2RD2A 2CYAA 5TEWA 4ZCPA 2V0GA 1JHDA 3CR8A 4G6ZA 1VL2A 1M8GA 3LOQA 1N3LA 4F3RA 3P0IA 3TQIA 5KHAA 4MWBA 4S1OA 5DASA 2J4DA 3PRHA 4QREA 2O5RA 4J76A 5HUHA 2GOYA 1XNHA 3JXEA 3A2KA 1M1ZA 4P2BA 1ZH0A 1X8XA 3IODA 4DJAA 2JA2A 4BWVA 3CLSD 2CYBA 1O0CA 4ARIA 4MW5A 1MJHA 1NP7A 1MC1A 3IDFA 2J07A 5J5AA 2VTBA 4MW4A 5FNZA 3CLUD 5J58A 1NUSA 2YY5A 4UZFA 3IVXA 3H9BA 2QUJA 3TS1A 1JGTA 3CVUA 4MWEA 4MW0A 2JANA 3VU8A 3P0HA 4ZT3A 1K97A 2DLCX 3NBAA 1R6XA 2AG6A 1YIDA 2YXNA 1PFUA 4MUNA 1K4MA 2ZUFA 1KP3A 2A1TR 1HYBA 3SZGA 3CA8A 4EG4A 2OV4A 3FDXA 2GKSA 3PNVA 2HMAA 4U7JA 2BTEA 1A8HA 1N78A 1O95D 4I6EA 4MVWA 4ZCRA 1KAQA 3RBAA 1EUYA 1WY5A 2QUHA 2A1UB 3ISJA 1JIIA 2WB2A 4ZCTA 1ZJWA 1WXFA 3KT0A 4JYZA 1COZA 2X1LA 2PIDA 1NSYA 4U63A 1O5TA 3S3TA 1I6MA 3MMXA 3DLAA 1O96A 3ILVA 4G5YA 4ZT2A 3IMCA 4MVYA 4NAUA 3CLTC 5TGTA 2QUIA 3UK2A 1U3CA 4EGAA 3FOCA 1MB9A 2DETA 2JAXA 1OWNA 2O8VA 4XSVA 4EG6A 1B6TA 1S4MA 3L92A 3AFHA 2PZAA 4TS1A 3X1JA 4EG7A 4EG3A 1RQGA 4Q93A 1TYCA 1M8JA 3FH0A 3C8ZA 4MUHA 5HG0A 1TYAE 3CLRC 4I6JA 1IFXA 1KQNA 1G8GA 2A88A 1NUTA 1WJGA 4MWDA 3U1VA 1SURA 1I6LA 1T6ZA 3SEQA 1VBKA 5IHXA 3D6UA 1UFVA 1EFPB 4YBRA 1KH2A 1M8PA 2BYTA 2WQ6A 1VBMA 2PZ8A 3IH5A 2VXOA 3D6VA 3N8HA 4L2IB 1NZJA 1KAMA 3COYA 4R2LA 1H3FA 2J09A 3A05A 1NUPA 3FIUA 5EKDA 2RE8A 4R2MA 4XFDA 3K32A 2OQ2A 2H29A 4OUDB 4EFKA 1F7UA 4OJMX 4H3SA 3ZGZA 2Z08A 3RK0A 4PY2A 1N2BA 3UY4A 3FHJA 1FYDA 1QQTA 1KH1A 1Q11A 2E89A 3G59A 2CT8A 2X0KA 4EG8A 1T9GR 5H7XA 4E1AA 4RUKA 3CLSC 1R6UA 1IQUA 2QJOA 3IMGA 2DUMA 1WXGA 2X1MA 3SYTA 4KKVA 1WQ3A 1EJ2A 3CVWA 2CFOA 4MUGA 1V47A 1TYDE 3TZLA 4KR7A 3ZUGA 3AL0C 2DXIA 1KR2A 1JILA 4PBSA 4WNYA 4UZEA 1QU2A 2A86A 5DK4A 3SP1A 3IUEA 3AG6A 3FETA 1MBZA 5LLTA 2GM3A 2EJCA 1N77A 1QRTA 1JZSA 3N9IA 4MW9A 5BNZA 1N2EA 4KPUB 3QTBA 4DE5A 5JBNA 2DR2A 3INNA 4MUEA 1T6YA 1XJQA 1TFUA 4AQ7A 1QU3A 1J21A 2AKEA 4YP7A 2PXHA 1JIKA 1I2DA 5DB4A 2ZP1A 4HJXA 2H2AA 4DDKA 3ND5A 2WSIA 3Q10A 4JZYA 1N75A 1WKBA 3MXTA 2J5BA 2IELA 1O95C 1R6TA 5FO1A 4HK4A 3DV2A 1N1DA 5H16A 4MVCA 3G6KA 4X0EA 3ZIUA 1WQ4A 1O94D 1T6XA 4U8HA 2AZXA 3OTWA 4CT0A 3CVXA 4YMIA 1N2GA 3MLAA 1EXDA 1KP2A 1N2JA 3FG9A 3ZXIA 3AKZA 1GTSA 1OD6A 1U0BB 1WXHA 2YWBA 3IVGA 4MW2A 4MQ6A 4MWCA 3HV0A 1QTQA 1M8KA 3F3MA 1WOYA 1JEEA 3COWA 1G59A 1GZUA 2X3FA 3FI0A 3TZEA 4ZCSA 1PG0A 3KFLA 1J1UA 4YP5A 4DDHA 3TNJA 5AHWA 4HJRA 1EE1A 4ZT7A 4FZJA 2IJGX 4QRDA 1ZUNA 1KORA 1NYLA 3H99A 3K9WA 5LM3A 3E27A 2V0CA 4EG5A 1JEDA 2Z09A 1H3EA 1TYBE 3RJZA 1XNGA 1TEZA 4KR6A 1QJCA 4ND7A 4R0NA 2CV0A 1OBCA 4NATA 1F9AA 2CV1A 1X6VA 1YUMA 2PG3A 3ND6A 2J08A 1VBNA 3Q12A 1GN8A 4ARCA 3IMEA 3QE4A 3LE8A 4J75A 1IVSA 4ND6A 3NBKA 4NDAA 1EFPA 2QJTA 5LFAA 1WZ2A 1JIJA 3UC5A 1J09A 1JMVA 4DNXA 1O6BA 3HMQA 1MOPA 1JECA 1YIAA 4L2IA 3Q4GA 3DO8A 2I1LA 1O97D 2NZ2A 3IUBA 2R5WA 3RFFA 2A1TS 1IQ0A 1IRXA 4OUDA 4JXZA 3AG5A 4MW7A 2NSYA 1Q77A 2A4MA 3TQOA 1PFVA 5TS2A 1ZH6A 3CVVA 1LI5A 3ELBA 3CLRD 2HGZA 3MLBA 1M83A 4F4HA 1I6KA 2B7LA 1MB2A 1QRUA 3H9CA 1EFVB 1U7DA 3OP1A 5KCMA 1BS2A 1Q19A 1U7XA 1IQRA 2YWCA 4NZPA 3GUZA 2A84A 1TQ8A 3CLUC 5FO0A 3ZJUA 1DNPA 4PBTA 1O0BA 1NUUA 4MW6A 4Q16A 1JZQA 4GRIA 3P0JA 4GU5A 3UMVA 3PNBA 1N2HA 1OWLA 4MULA 3HGMA 1N2OA 4KPUA 3SZ3A 3VGJA 3IVCA 2WQ7A 1XNJA 2PZBA 1YI8A 1F4LA 1NURA 3M5WA 3N2YA 4I6GA 3GMIA 4DLPA 1PFYA 2CV2A 4CDNA 2E0IA 3RHSA 4MVXA 1KH3A 1MAWA 3ZJTA 1O94C 2A7XA 4ZCQA 1F7VA 4AS1A 1FFYA 5TEVA 4RPIA 1WXIA 1H1TA 3N05A 5J59A 3NV7A 2PFSA 2VTBB 4ZT4A 2QTRA 1OWMA 4K03A 2QJFA 1NI5A 3KT6A 1NUQA 3UOWA 3IOEA 4G5FA 5DEOA 5IJXA 2QUKA 4WSOA 2XRZA 3X1MA 4A91A 3CVYA 1OWOA 1N2IA 2E21A 4MUFA 2A1UA 2DEUA 1J1ZA 2TS1A 4MUIA 1GAXA
chains in the Genus database with same CATH superfamily
4BB6A 1TMYA 1KEKA 1U5BA 3AEUA 3FW1A 3ICWA 1NX9A 1T9GS 4FCWA 1EUQA 4Z4EA 3ID6C 4XYBA 3TCKA 3FWKA 1XJ5A 5IRCD 2CVQA 3KZXA 1KY2A 3KV3O 2I2WA 3DVQX 2B92A 1WOMA 2GVZC 1DRJA 4EY8A 4K81B 4M88A 2FG5A 4TV8B 1BGWA 3PICA 4XCQA 4MGYR 4CV3A 3OX3A 3GGJA 5IKEA 2EWVA 5K45A 1GLNA 4OLHA 3TAXA 1XAGA 1NXOA 1Y6FA 1QQAA 4GM0A 5CURA 2LD4A 5BUCA 4I9NA 4TZTA 1T9KA 2LUOA 2B25A 2WWRA 3Q72A 3JQBA 1QQ6A 4II2A 4ETIA 3UMMA 1SQ6A 2D0DA 4PPFA 4HEHA 2Z6UA 3GMSA 4Q7EA 4B6JA 3PLRA 3PXUA 4ALJA 1ZN2A 5CDUA 4BS9A 3U4DA 2V7EA 2DRIA 4U0JA 5EGSA 2XRMA 3K4QA 4I5EA 4LJKA 4RGBA 5KPJA 3D6HA 1VMIA 4M53A 5AHXA 4BP9A 4RK6A 1VKJA 1JNXX 3I4CA 3P9KA 2HCJB 4PONA 3CJTA 2XKKA 1Q22A 1UKAA 4CCSA 1MO6A 2BTQB 2O7NA 4JJ6A 4LBWA 3PS9A 4HAIA 2GPSA 4MRMB 1UK7A 2ZXEA 3EAQA 3H1FA 5K0TA 4ZJYA 4CRWB 5K0SA 1ZN8A 2JD1A 1LLCA 3M6XA 3S40A 1QIKA 4JJFA 1OBFO 5D85A 3UCEA 2FWPA 4QNRA 2BLNA 2EW8A 5LYYA 3ZJVA 1F06A 4FFRA 2WILA 3RS4A 1BCRB 2VCYA 4X7RA 1L4NA 1LA2A 2VAXA 4OAQA 2WU8A 4Q39A 3LCJA 1WULS 1BXRA 2OEPA 3D3WA 3MWLA 4X5OA 5LZ8A 4FE4A 2P9HA 4DABA 1CEYA 3N2ZB 2IYAA 4EVRA 3PXXA 1HE1C 2G36A 4R3UC 2F8SA 2RONA 2AN1A 1UAAA 1P9NA 2JFZA 2X0EA 3TXYA 3G02A 2VT2A 1JYEA 3ROGA 1MC5A 5LWQA 2OBYA 3HDHA 1QVRA 1VFNA 2F1RA 2GT1A 2D13A 2Y92A 3M5CA 5HM8A 3AYXB 4KW7A 5AVUA 4W82A 1X1RA 4KZPA 1N3BA 1FVFA 3F9RA 5BV8A 3UV3A 4IV0A 1RP7A 5EJ6A 1DQNA 1WHSA 2P4QA 4S05A 4DSNA 1UJ4A 1XXHA 5B7GA 3T3OA 3HKDA 1D2HA 4R7ZA 4KU4A 1JA0A 1M8FA 3B3JA 4HFMA 4RIGA 4A7PA 4LXGA 3DUFB 5LNK6 3QWAA 4RGVA 3S1AA 5ILQA 3UT0A 3ZXXA 1NNSA 2IQIA 2PDAA 2Y0PA 2AE1A 4UU8A 5FUMA 2GM5A 3AT1A 1TEVA 1DE0A 3C4JA 2P11A 5FADA 1E5DA 2JAWA 3M1AA 2CFIA 1NF3A 3X1YA 4MITA 3LQYA 5JWRA 3P0IA 4X6UA 4F96A 1II9A 1ACMA 1SRQA 1KAEA 1W34A 2BGKA 2FQXA 2VFAA 4WIAA 3SYNA 1K7YA 3U80A 5IANA 4MYTA 1HETA 3SC2B 1VE3A 2GZSA 2L82A 2FP3A 1CJTC 2P2SA 2AC2A 3PKZA 5LB2A 3TDNA 3CBGA 1MW8X 2AX4A 3BEOA 3OKFA 1E3EA 4G1EB 1IY2A 4P53A 2FSVC 2IKSA 3VMFA 4CIVA 5AKXA 5CT8A 2VJOA 5JH7B 1Y5MA 2Q7DA 1KVUA 5DTMA 4BWVA 2JLCA 5E3HA 4CVNA 3KAPA 3W8RA 4KRFA 1XFAA 4D97A 4QOHA 1YB4A 2G6TA 1D7AA 1E7SA 1HFKA 4D3ZA 5IC6A 4HN9A 1L7PA 2KJQA 2F9LA 2FUEA 1MC1A 3WWPA 3LFHA 1I7PA 3TQHA 1F2UB 3N3AC 4RY0A 2WJ3A 2QRVA 4OFWA 4B83A 4EEXA 1YO6A 4KACA 1UWVA 3CF4G 5LPNA 3QRWA 2C00A 2R66A 3NP7A 3Q85A 3V55A 4ZI7A 3NS7A 3U6KA 4FD3A 3D0KA 4DQVA 2DPGA 1K6MA 2QUJA 2YWDA 4DIDA 4DQXA 3QHAA 4QLAA 2EDCA 1J5EB 3GARA 3LX6A 2ZSJA 3WK5A 1Z4IA 3MOIA 4YJ2F 3B6JA 4GGOA 1QOPB 4Z4QA 1M1UA 1E94E 3VTZA 2GJSA 1P2FA 2NZXA 2IL1A 2WTAA 3C0KA 4BMDA 1XD2A 4FDTA 1Y8QA 1MOZA 2XUDA 1E3SA 2HMWA 4ENWA 3K9FC 3IUNA 1B6RA 2JZNA 5LOVF 1W5SA 3OM8A 1DX9A 1Q6YA 3ZS9A 4LG1A 4E32A 3U4HA 2HKIA 3M4ZA 4GI5A 4MRNA 1P74A 2VBIA 2VRBA 5F5XA 3FCXA 3SIWA 3FDXA 4C89A 2H17A 4LK3A 2I4NA 2D1FA 4ALIA 4U7JA 1VJDA 1A8HA 5ES3A 3UHOA 3P20A 4LZWA 1AK9A 3UK0A 1QO7A 1SCKA 2R1TA 2HJ9A 1NJ2A 3HPQA 3N7TA 2QGFA 1WF3A 4QVKA 3ZBQA 2YY7A 3PPIA 8ADHA 5KVSA 4CTOA 2QN6A 2HDHA 4HXYA 3FNEA 4O0LA 2XOEA 3H9QA 3D7KA 1GFSA 3V48A 1AMUA 5KOYA 3KJNA 3RS0A 3UH0A 3HY3A 4Y9UA 3PQ6A 3VZRA 1TQHA 2G67A 1G291 1THGA 4GF5A 3JZAA 3DMYA 4G5YA 4L3OA 4MAMA 1B76A 3GAZA 1FFDA 1LF5A 2HCBA 1KJZA 1J8FA 2PR7A 3LX4A 2RIPA 3U4QB 2RI1A 1GQQA 1MAAA 2GRUA 2VF5X 2ZIXB 3VZSA 3EEQA 3UMYA 5B1DA 2OSBA 1F8GA 2F43B 4CDGA 4ZU6X 1ODKA 1SUCA 2JFNA 3PGLA 3BIXA 2B1IA 4M49A 4DV6B 2QL7A 5FPTA 2RAVA 1KVSA 2CLHB 1QV7A 2P1DA 3UXYA 4RJTA 3T0IA 4ER3A 1F6DA 2IIBA 2WRZA 1LFDB 3VU1A 2VQDA 1YIOA 3DLCA 5JVDA 1PHRA 1NUTA 3LUGA 5PGMA 3QX9A 3TUJC 4R05A 4A73A 2IXEA 5J1TB 4FC7A 2PE5A 3PVCA 3V4ZA 1VCIA 3QMVA 2C3MA 3G2PA 4G5QA 1MENA 3L6RA 4NENB 1KH2A 2B94A 4L0CA 1ZUD1 3ITEA 4X8LA 2NQ2C 1AXRA 1QTRA 1GLGA 1KJWA 3D9QX 4O4LF 4TWIA 4ZAVA 3WKAA 4Z6KA 3K73O 3E58A 4KLZA 4YCNA 2IVFA 5JNLA 3KWLA 4F56A 1QE3A 3PF9A 1V7CA 2AMJA 2J09A 3F90A 4GR5A 4ARUA 2HWYA 4DLNA 1RJEA 4BPBA 5EKDA 1QUFA 2BBTA 3V4SA 1H8ED 4FQ5A 3K6SA 2JIZD 4KBGA 3ZGZA 1VTKA 2WHEA 3BIOA 1N2BA 2CWDA 5D3MA 3MTGA 4LOAA 1W0JD 2AH5A 4N40A 5DGIA 4YR9A 2N9UA 1B26A 1Q11A 1ZUIA 3I39X 2I76A 1QIEA 1WZUA 3PHHA 3R0JA 4MJLA 5CG1A 3D3QA 1P2SA 4Y30A 3UGQA 1MO4A 1PL6A 1Y1QA 1ZNXA 4ES6A 2XE4A 3JQ9C 3AWIA 1YCDA 2NUAB 4CKEB 3A2LA 3RU7A 4CHTA 2PZLA 3LLUA 1RDFA 3T52A 1A9XB 2ZPAA 2BC9A 3OCWA 5EERA 4IUDS 3UV7A 2P90A 3S1AB 3H5TA 1R16A 5IMBA 1DQSA 1OGIA 5C4GB 1Q1EA 4PGGA 2YOGA 4PZ9A 4N39A 1COWA 1Q1ZA 5CK4A 4M9XA 2VRCA 4XB6B 5FBQB 1JDBC 4B3SB 1A88A 2YNMC 4YRRA 1LW6E 5C31A 1R6AA 1JT2A 3RRZA 1XAJA 2FDXA 5T4EA 3TIGA 2B36A 4MW9A 4DJEC 3BD9A 3ZCQA 3ECSA 1CRLA 1E99A 2DBQA 1SB9A 2J4CA 5EUBA 4CIDA 2WFZA 3L46A 3IHTA 3UOGA 3ZZTA 1BEUB 4G4SO 1Z17A 1YA6A 1J8QA 1T0UA 2CLFB 1J21A 3ESXA 3FGOA 3NYWA 5D87A 1A96A 3NHAA 4P08A 1GNPA 2A0KA 5E6UB 4QBFA 2DFKB 3I92A 4OXYA 4KZKA 4O2RA 3PNQA 4Y9SA 3FYCA 1N75A 1V4VA 2LKDA 1LBHA 2RCNA 2KB0A 1X74A 2H4YA 2HAEA 1GL9B 2P78A 3GP5A 4FMDB 3VOAA 2PD3A 1NBEA 3RHFA 1VE1A 5H9WA 3KETA 1SA0B 5EQJB 1AH2A 1N32B 2VZLA 1N1DA 3DF9A 2ZZKA 2HSWA 1HA3A 4UBOA 4EWLA 3G6KA 4X0EA 2CNWD 1TKRA 4UAJA 1MB4A 1NXVA 3NASA 4LYAA 2C2MA 2QYSA 1ZJ4A 1I51A 1JEQB 1KEVA 1YBMA 1JKJA 2G0TA 2GXQA 3K2QA 4HRXA 3TLKA 4DQLA 4EPRA 3FROA 3T94A 1G8AA 2EGGA 1CUEA 3VPAA 3R9XA 2BPOA 3BRCA 3B9RA 1OD6A 4BNWA 1J42A 3JQQA 3QJGA 2MMGA 3HV0A 1O4WA 3UM9A 4RJJA 2BRUA 4YO7A 2GHIA 4X97A 1PI3A 1J56A 1SCUA 2VP0A 1NE2A 4XR9A 1J0CA 4Y18A 2QZ4A 2JFBA 1PTJC 1BKSB 3KXDA 1PG0A 1EVIA 3KFLA 1MJGM 3SKVA 3I6IA 2Q3MA 2A5JA 5FTWA 5KCZA 3AM1A 1P7VA 5ANRB 4HJRA 3SR0A 4DIUA 1NJ8A 2Y1EA 1F20A 4G2NA 1SC3A 4NBRA 5CJ2A 2ODNA 5LQNA 1RRMA 3GBSA 3EY9A 4L4XA 4YQFA 4CIBA 2X86A 2JH9A 5I5EA 4ZHQA 2PL9A 3BE6A 2XUKA 2YWXA 3I9OA 3Q87B 4M1SA 3RC1A 4BN0A 1S7CA 4UNSA 3BGIA 2W22A 1U0JA 3E27A 3KL2A 4KLAA 1M1NA 2NSHA 3DFUA 2BT4A 2A5FA 3KQTA 7MHTA 1IK6A 2DYKA 5F33A 1JAHA 3AJAA 3GJRA 3H16A 4PRYA 4KE9A 3QE9Y 3TL2A 3L0DA 4EYSA 4HF7A 1GM5A 4AD8A 2ERCA 3JZDA 3CUKA 2AR9A 3HSSA 3UPUA 4ND7A 1OGYA 4BC1A 4NYJR 4Q6BA 3ZDQA 5F9FA 1X6VA 4UVIA 3PIIA 2OAQ1 1GN8A 2J5RA 3FPCA 3Q0TA 2B0CA 2ZRDA 1GGVA 5K01A 2O14A 1RSZA 1Z2NX 4HRAA 3F71A 1G0NA 4ECAA 3AVYA 2XBMA 3AV0B 5HA5A 1ZISA 3WIBA 1A2QA 4TOIA 3MD0A 1J8YF 5KYGA 5CFLA 3CEJA 2XTNA 5ADVA 2NM0A 3KQOA 1FFWA 3AEKB 1Y8CA 1ORIA 1FDRA 3FNIA 4FJ1A 5AKZA 2X7HA 4XGRA 1KSFX 2OC9A 3Q4GA 4A15A 4CL2A 5F76A 4IEEA 1JXQA 1XDUA 2MSCB 2I1LA 2WU3A 4OSEA 2HHHB 2NZ2A 5IARA 1CZRA 4JKYA 2HJRA 1ZN7A 3GJ0A 3LD9A 2AI3A 4P38A 2HUPA 3BMQA 1IC6A 3VPFA 2BN4A 3EIUA 4XIJA 5AKKA 2QQ5A 5EXXA 4UXIA 4KE6A 4LQDA 4ZVOA 4BGVA 1A71A 1PL0A 5EHZA 4DS3A 1L4GA 4JJZA 4KMRA 4BKOA 2IF2A 3O8OB 3MELA 2XUJA 1W1WA 3KDPA 2A1IA 2Q9CA 5D01A 2AOUA 4B7AA 4MV8A 1XYYA 2HY7A 1JN0A 2YV1A 3FYHA 2FU5C 3GN1A 3KLNA 3L8MA 3OIFA 5IK2A 3TL6A 3MWYW 3K0AA 1U7DA 2WM8A 4FWBA 1XN4A 4PG8A 1XTPA 4N0QA 4PC2A 4J0QA 1XDZA 4EI7A 2WFAA 1CE8A 3B6MA 5IJ9A 1PSDA 3J7TA 5AO9A 2CEAA 5COQA 4A0HA 2NO9A 4LHVA 1GTVA 1STOA 4G1UC 1PJCA 4FGZA 4NZYA 5ALZA 2Q3HA 3RHZA 5HFJA 4Y9RA 4FS3A 5TSDA 4H7DA 1QTIA 2EWWA 1ESEA 3W4KA 2WJVA 8ABPA 2F3UA 2HEIA 4DLWA 1FSGA 3I83A 1O0BA 2FMIA 3QWFA 1C3JA 4GRIA 4GPBA 3TLMA 4GG1A 1P1BA 1XU7A 4B9EA 4Q6WA 3HKBA 3KZ1E 1PZMA 3A4MA 1E2JA 3C3XA 1Z5OA 3A27A 1OWLA 5EJ4A 1I5EA 4OQPA 2AFRA 2OYSA 5LCXA 3G79A 1ZQ9A 1NQOA 2ATIA 5DIZA 4NZOA 5DFAA 1NVTA 1SCDA 2WPDD 5JNSA 4IMJB 3DKRA 1ZIPA 2V3WA 5DNAA 1M5RA 1W47A 4BQIA 3GPLA 1CNEA 2YZNA 3A1TA 4II7A 4UAUA 4DLPA 1PFYA 2E0IA 1GKKA 1RQ7A 3O47A 1L8AA 1XX6A 3NGXA 5KTSA 3H17A 5ED4A 4LVCA 1SCQA 1KQGA 2GNPA 2L69A 2BFCB 5JQGF 3Q3HA 3BZUA 4JSTA 4PW0A 1YI1A 5TEVA 4B17A 3F96A 2YRFA 3UGTA 4OJYA 1QZXA 4FDAA 4ME6A 4LYFA 1ZNQO 2C5HA 2PFSA 1R66A 2G4CA 2AQKA 2VSOA 3D1LA 3H0CA 2VDJA 2QTFA 5FWYB 3GEBA 4TRMA 4U7PB 4EL0A 1ZWKA 1CUWA 4I1IA 1A8IA 1QG0A 2FOIA 3HKEB 3OWHA 2ZRNA 3X44A 5EZYA 3ZWWA 1OTXA 2QHXA 4CT4B 221PA 1SXGA 4O2BA 1JHZA 1KERA 3ORRA 4QE3A 3RG8A 1VA4A 2OBXA 4ZK2A 2RC6A 2GN1A 1NMQA 1U3GA 3A6EA 1Z7WA 3C8MA 4HDCA 2GEUA 1TK3A 2A59A 2HDWA 4EF4A 5TV2A 1GL6A 5AK5A 2PGLA 1R3UA 4NXMB 2I78A 1UKVY 1UMCB 4X1IA 3Q7RA 3I1FA 1E61A 1IHOA 2C7VA 2J1LA 2QLBA 3GO4A 1Z5ZA 3G2KA 3ODGA 1LBTA 3F74A 4M0DA 1Z8DA 1OBHA 1YU6A 1RE1A 2P9TA 3R3WA 1KPGA 1R5NA 2BUBA 3RIMA 1K98A 1PJBA 2EFYA 3OX1A 4I55A 3B6ZA 2HV9A 521PA 3BF7A 3W5AA 4AS2A 1RYHA 1H6BA 2PNFA 3W8DA 4MCAA 1W6UA 1VLZA 2X5OA 3KUDA 4GBJA 1VECA 1SUFA 3S5JA 5ER6A 2YZ7A 4BLSA 3IDSA 3GGCA 4BZXA 4UNQA 3IQIX 2GEJA 4JBLA 1B8VA 1FK8A 2H5LA 2RGUA 2VDVE 3KHKA 1U2DC 3VX3A 1XQXA 3Q3GE 4EFNA 2I4IA 3L7MA 4ZGBA 1OE0A 4U2FA 3ZHXA 4GX1A 3EH1A 2JIPA 4YROA 4CNQA 3PV0A 3KOMA 2Q1TA 1J2JA 4YJFA 4JJAA 3MMNA 4PZEA 3RC8A 5JI2E 1QGUA 2PSJA 3N7UA 5CUQA 1KI9A 2VF4X 1BWPA 1EVJA 3DXXA 4IXNA 1HQDA 2VHUA 2ZJ7A 1NU6A 4PBRA 5K3BA 3UKDA 5BQOA 1HRKA 4CKYA 1I1OA 1GPWB 2D5BA 3ORYA 1J23A 1QHYA 5U4QA 3RYIB 3I64A 4US0R 3T4UA 2ES4A 5AOBA 2NUPB 5I9BA 4ODIA 2TSYB 1CS0A 1DRWA 3OMXA 3AHJA 4WEOA 4AY4A 3OQVA 4ZHQB 2QZPA 2JAHA 3OJ0A 9ABPA 1IEWA 3NGMA 3U39A 2JFXA 2WF5A 1J0EA 2ETXA 2ATXA 4RHYA 4TWJA 3RUHA 1Y9EA 1BWSA 3KSRA 1E5TA 1XO1A 3C1UA 2WZCA 1GSOA 3FPJA 3NDIA 4Z0PA 3RVDA 4CF3A 2GFHA 2EL7A 1SXHA 1WCV1 1NKTA 3DMTA 4FZ3A 1Z7GA 3IE1A 3V4PB 3U6BA 2R3SA 1ZS9A 2I55A 1R8QA 1GR1A 1LKZA 3LXUX 4G1CA 4IDPA 5AM0A 4YWHA 3T95A 1UEJA 5FA8A 3D2BA 4TN1A 1P0MA 3IOCA 3RSHA 4F38A 3SZLA 3V1LA 4E94A 2XOKD 3I1IA 4YMUA 3FVQA 4KPEC 1RC0A 3EZ2A 2Y77A 4EG1A 1MRZA 3I9LA 3EVDA 1GFWA 3GGSA 1CIVA 2C5SA 2DTEA 2WSSD 4JU9A 3SXJA 1YVUA 4EPYA 3CURA 3SHQA 4O5OA 4QUEA 1P1JA 2N0SA 3UAOA 3I6ZA 4NHOA 4AWXA 1ESDA 3V7YA 4KDFA 1EBBA 4PGFA 1QBKC 1ZOSA 2CXNA 1Y98A 3K2BA 1RYFA 3W5IA 3V4RA 2VK2A 3Q3CA 5KSYA 3BSWA 4DA0A 1XRLA 3VR5D 2R85A 1OWPA 3WC4A 5A9TA 4X8OA 1TCCA 1QRAA 4YTEA 3TG8A 1D4AA 3SCZA 2PGDA 2FOXA 4G6ZA 1ULUA 3GGDA 4K8OA 4LVNA 5DHAA 5TF0A 4HKTA 2UYCA 4L78A 2YHIB 1Q0TA 1MFPA 1NY5A 3OE5A 1KK0A 1TLFA 1QV9A 2CF6A 3L6DA 2IPXA 1XMOB 1OFGA 1QORA 2VT7A 3UJ8A 1TO6A 4E13A 1P80A 2NU7A 1FMTA 5IJZA 2FRDC 4PCAA 2OGTA 2XCTB 2WDZA 3L7LA 1U0GA 2BBOA 2XB4A 2HB6A 2W5UA 2XKJE 3URKA 4C4YA 4RESA 2HNAA 1K66A 4WY8A 2QPLA 1SBNE 2Q1UA 3ACCA 3N6RA 5JSKA 3AU9A 1MJHA 1RQRA 4X44A 1Z83A 1OLSA 3NTLA 5CAEB 4G3XA 2PH1A 1FLAA 4H6WA 4OI0A 4QLBA 3LXRA 1GUYA 3RSGA 2TECE 2VLBA 3OC6A 1KAGA 4QOIA 3LV8A 1A9OA 5B3JA 3W05A 1GWNA 2ERXA 1Q95A 3CX7A 3DVAB 4P3YA 3CLUD 4ZI5A 3HKCB 1EBFA 3KEGA 1PEDA 2LXNA 2Q5OA 1JQJC 2WU0A 4Q5IA 1KXJA 3TS1A 4AMYA 1K08A 4RFSB 5JAHA 1L7DA 1M7HA 1ORTA 2WYHA 2YNMD 4DM3A 3W1EA 4YJ3B 4W6QA 5KTNA 4FGLA 4WEQA 2VP4A 2YYZA 2Z9CA 3AETA 4NCXA 3L0SA 1TVEA 3EXHB 5FR2A 1VCMA 5DBIA 1MOQA 1Q1AA 4MNTA 4EVIA 1AGRA 3PZRA 3RWOA 3AR9A 1SU6A 2P77A 3WV4A 1YIDA 1G6Q1 1DINA 1QIMA 1Z6YA 2VJNA 4CR8A 2QPOA 3GL9A 3DEJA 3D8HA 1SM4A 2A1TR 1DBSA 2ZTLA 1RTKA 3AR8A 3TSAA 3ZWMA 1HYBA 1RYZA 3GVHA 3QLEA 2YCBA 3CA8A 1YZVA 2OV4A 2HIHA 3NDRA 4BAGA 2WI8A 2FR1A 3STYA 5LIRA 3HFGA 3RQSA 2YFHA 4Q3OA 1FMCA 1HBJA 3QX3A 1Q0SA 1C3OB 3T3DA 2QD4A 4DRZA 3FWHA 4ENSA 1ZNWA 3LHSA 2P62A 5D7BA 1GAXA 1FSPA 1SZCA 3NI2A 2RK6A 2YJ5A 1TCUA 2R7MA 1P1RA 3ZE1B 3FJ1A 1P61B 1WXFA 2F8LA 3VPXA 3AGQA 1CW2B 1Z6ZA 4AF8A 2KLHA 1ZD1A 3EWIA 2JVKA 1NDUA 4MYDA 2IYNA 3ICQB 3WB2A 3D4LA 3BSSA 2D62A 3H5IA 5JSZB 2H4FA 3I6YA 4CLOB 5BQPA 1ZM3A 3VKHA 2Z2JA 4K6CA 2F1JA 4CU5A 1QKKA 1C2TA 2G1KA 2YXBA 5JXHA 4QRHA 3QU9A 2D6FA 4S1TA 1DIOB 3FWZA 3KPWA 3WLLA 2ZVDA 3GDFA 4EIWA 1E4OA 2JAXA 2VNIA 5ENDA 1LLDA 4XSVA 3ZQUA 1T6BY 2IF0A 2J0VA 4OXXA 4IQ8A 3V3TA 4JBIA 3B2EA 3WZLA 1P9OA 3GCDA 5KVCA 2E6UX 3CNQS 4J4TA 5A4IS 2J6CA 1WXDA 4GYJA 4YUYA 3F6BX 2QN9A 3CSUA 3EHDA 5JRZA 5ISMA 1KBZA 4YV0A 4JI0B 4MV5A 1T1JA 3PF8A 1E64A 5A2GA 1EFTA 5C8XA 4P6VF 2IS6A 2I67A 1KQNA 3R0ZA 1AZWA 3O91A 1IXRC 1YA8A 3RF6A 4B31A 1IWOA 3SI7A 4CM9D 5KYYB 1SURA 4J0HA 4QBGB 5J5VA 4IJWA 1WSDA 5ALGA 2Z6QA 4B3HA 3TTSA 4HVLA 2AOVA 3UN1A 4YV1A 2BWJA 3TJMA 1YR3A 3O0TA 5KTMA 4NR0A 5I8PA 2XUQA 3G17A 3QIAA 3KNZA 4F8YA 4MPRA 1MB0A 2WQ6A 1AGYA 4E88A 3LUCA 5T3YA 3PEFA 4P86A 1CZNA 4YAWA 3D4IA 4J29A 3H2HA 3B82A 4BVHA 1WO8A 3TO5A 4ZGWA 4ATNA 3EXEB 3OE7D 5EJAA 3WLAA 2F9FA 4RK5A 4EI9A 3CINA 3ITNA 3OTHA 4IUCS 5JFGA 2CLCX 2I2BA 2RBKA 2ZSAA 3UY4A 3DH0A 2WC1A 3HP4A 2Y66A 1D2MA 3K6RA 2NG1A 3D4PA 1C0EA 3LI2A 1I4OA 1KH1A 4AJHA 1FIUA 2I3BA 3UO8B 4UFNA 4K9MA 4MUAA 4EG8A 1CR1A 3PC7A 1VXRA 3I2JA 2JI4A 3F8WA 5LQKA 3DL2A 1L7AA 4NK5A 4YH1A 3TSOA 3DYBA 1NC1A 5EP4A 4B3TB 1KTVA 1VE7A 2BMDA 2HXYA 3FKSD 1NTOA 4BO8A 4OGLA 3PQFA 3U7QB 1L6RA 3RIEA 5J1SB 1SXPA 1SKUA 3QV1A 2VJMB 4ZV4A 5JPDA 2BGJA 2JIZA 4X7PA 1PJ2A 3DULA 1W0JA 2C4NA 1V8PA 4EFLA 1QU2A 5C52B 1ADGA 4F3NA 3AH8A 3BJMA 3C8HA 1E79D 5JDCC 1V4NA 3O8DA 2ZW9A 4JV5B 1BFKA 4Z5XA 5DHFA 3ZDEA 1PGPA 2ZS7A 1ID8A 3IJPA 4I8IA 2JK0A 3INNA 3CZRA 1HFEL 5AM1A 1IM5A 1TFUA 1XJQA 4GFDA 4FEYA 2XDWA 1J5PA 2P7IA 4MLZA 4H0CA 1NVMB 1Z25A 4RGYA 2ACVA 2H4ZA 5J47A 2L0XA 1F5NA 4LRTB 3MSCA 1H2YA 1IPEA 1EFDN 1N2CA 3Q10A 2ARKA 4MWSA 3TOCA 4CTNA 1IBMB 4C3VA 4TN5A 1HR0B 3S8YA 2VYVD 3KUXA 1R9MA 3FVVA 3C3MA 3HY6A 1QZUA 1GG2A 2ZIEA 3QVKA 2OOSA 3ESYA 3V1KA 5ITSA 4LXUA 2FA9A 2YMPA 4P0QB 2I8CA 3AY7A 1PW7A 4ID3A 2A5DA 1BEZA 2Q4RA 4NU6A 4HDQB 4AXXA 4CT0A 3KZCA 2R6GA 1CTQA 4BJ3A 1U8ZA 1NDQA 1VJ0A 1YQEA 2I4MA 3I3OA 2ONKA 4GNRA 4HXEB 5COAA 5AP9A 3NHRA 3OCVA 5B57C 1AV7A 1EDBA 3JYHA 4LHXA 3W34A 4CUZA 3R3YA 4MW2A 1YQ9A 3QVOA 1DCFA 2Q46A 3W9SA 4LNUA 2RHHA 3FPHA 1P0CA 1XPOA 3ABZA 5LD2B 5CT9A 1K9VF 4D74A 1UZUA 4HBZA 2FPIB 4KO8A 4C4SA 4JYCA 1GZUA 3JD2A 4YECA 3IP7A 2CNWA 4IIJB 2BKUA 1W5AA 4W8GA 1RM0A 5KIAA 3DA8A 4Q3CA 3S2ZA 3OT1A 4FR2A 4YP0A 4ENRA 2L2QA 2P6UA 3BK2A 2QUAA 2MWMA 1Y7HA 1I3MA 3L18A 2IJGX 1N4DA 2PLFA 4BVFA 1ZAYA 1OU0A 1KJIA 1GZ4A 1OY1A 4RJKA 2FPPB 3IV6A 2YV4A 4HB4A 3KKNA 3ESBA 1XKLA 2PKCA 4JCCA 1EJ0A 4P2GA 4YCBA 3S44A 1YMUA 5DM2A 1OBVA 2ZJ8A 2QXYA 1K7XB 4Z99A 3MGCA 4LTDA 3SXUA 1FFXB 1OSNA 3GHHA 1TYBE 4YPFA 4EEKA 4XJVA 1BE0A 2PT5A 2G3YA 1HFJA 2WFLB 3JD1A 3EC1A 1G21B 4GEGA 1PJ4A 4PYOA 4LJSA 5AIBA 4NATA 5E3IA 3IQHX 2PG3A 4H7KA 3KKZA 3L4JA 3FYDA 4NWIA 3O94A 2XCQA 1IVSA 1ZLXA 4PN3A 1K7SN 4YACA 3CRMA 5FBKA 2CDRA 4EYOA 1U0EA 5I01A 3GCGA 4EHKA 5LZ4A 2P5UA 4QODA 4Z51A 5TMEA 1TYZA 3COPA 4R51A 5FNVA 5G0VA 5J9FA 1UZAA 3KKQA 1JECA 5G1NA 2QM7A 4C76A 4CV2A 2QU8A 1R15A 2W11A 2BEJA 4BVGA 1J2YA 3RFFA 1GDHA 1LRLA 1USUA 5SICE 2A1TS 4MUYA 4DFDA 3L8YA 5HOEA 2BGWA 1Q7CA 1M67A 4G23A 1QHNA 1RCUA 1UXHA 4L73A 4Z4HA 1K3FA 2N46A 4JP1A 1EWTA 4WW0A 3ZR4B 4RH3A 2DTDA 2P9JA 1MGPA 4LXHA 5KNCD 3CB4A 3ELBA 2OUIA 2XQIA 4WLUA 4ZRMA 4ND4A 1K5HA 4M1WA 2O3UA 5EG5A 2PBZA 3O4VA 4RLFA 3BOSA 4RVSA 1L5ZA 2OLKA 1RQ2A 2DSNA 1JEYB 3S99A 1XCPA 1KU6A 1Q19A 2GCPA 2GHRA 4MEJA 5H0IA 1SHUX 1LXCA 4UNRA 4DCUA 4RELA 4G36A 3MINB 1T8RA 2DT8A 2NXCA 3CB2A 3I9KA 4GXTA 4IUBS 4M0EA 4NBTA 4H7HA 2YRXA 1P5RA 1UMDB 4NYIQ 5CTJA 3ZCVA 4L7QA 1AUQA 1IXYA 4B81A 1TM7E 4KFCA 1IB0A 1E9RA 1Z5WA 2ZB3A 1Z8NA 3KBOA 3GJQA 2XGOA 4DNPA 1VPTA 3O73A 4EUEA 1UOQA 1W4AA 5EPOA 1DPFA 3G0OA 3V4OA 1QLWA 2PZBA 1Z2OX 4OQFA 5DNUA 1V1RA 4WH0A 1W25A 3LDHA 1NMSA 1YB6A 1YL5A 4FYYA 4EA8A 1N0UA 5FXMA 5HHTA 1WM1A 5HQ3A 3I5AA 2NU6A 2FOLA 2E4ZA 3C7DB 2IY8A 5JADA 2K7FA 5DN6D 1U3UA 3DQZA 1VLLA 5A4FS 3FOEC 5A62A 5AVKA 2ZBQA 3ZHVA 5JMWA 4QDTA 4W5OA 1JU3A 4NXNB 4LJAA 1OXUA 1CETA 1JKFA 4GL2A 2VXCA 5ED0A 3AF3A 4FE3A 1SU8A 4PPQA 1J25A 4ZGGA 5KQSA 3CM0A 2R1VB 4RD2A 1WSAA 1EHCA 5C7LO 3MTJA 2CCJA 4K03A 2I4RA 1RZVA 1B8UA 2B5WA 5TVGA 5C7OO 3TTXA 1KDZA 3I4FA 3IIKA 2WPDA 4BBJA 3OZSA 4R2KA 2HWUA 1UFOA 5IJXA 3JYPA 1ODSA 4RSGA 2CE2X 1TGYA 3GG2A 4KBFA 1ICIA 5FA5A 4B3CA 3ORSA 3ZVKA 2VH2A 7YASA 3AHDA 5JJLA 1GO2A 2EX0A 1IXSB 2IV3A 2B98A 2JKVA 3HYTA 1G60A 1X7DA 3VO8A 1G8JA 1UADA 4XOUA 4D4KA 1CD5A 4MGZR 4YCLA 1RKQA 5FLKA 2FSVA 5J4LA 3D4BA 3GBVA 3CXUA 2W37A 5SY4A 1LS6A 4R9UC 4W63A 2IK8A 4CM6A 1Z63A 2C20A 2VNHA 3RB8A 3ZX5A 2CVFA 2WSYB 4PRKA 5GP1A 2ZRJA 3BK1A 3N1UA 1GCUA 1D4OA 2I33A 4COKA 4DR4B 1BO6A 1MF7A 3GEEA 3P2EA 1YRHA 4FHZA 1LBQA 2YUIA 4DSOA 2LIPA 5D51S 8ATCA 3IBFA 2VATA 1JNYA 2HCTA 3IRVA 4HY3A 1CS4C 1H0KA 4HQ6A 4OQDA 4BBZA 4B40A 2ASVA 2QLNA 2ZANA 2J3IA 2ZYSA 4ZAFA 1Y4SA 3RARA 1Q12A 3HJTA 5DM1A 1YH3A 5EIFA 3E1GA 3DVRX 2YC2C 3L93A 2GZAA 4YJDA 3ZDBA 1F0KA 4JSRA 1J49A 4IXDA 3FNRA 3VYTB 1K89A 3MUFA 4DMHA 3P2OA 2B2XA 1XTJA 3B1XA 4CM7A 2QP4A 3DG9A 2ICAA 1IMJA 1Z0SA 1O97C 1P8JA 1BOOA 1RIFA 2CHFA 3ESRA 5HEKA 4LHWA 3WOVA 3QPDA 3RF7A 1Z33A 3Q2OA 4YRSA 4OU4A 3TNYA 4PLVA 1KZHA 4EKGA 3PENA 4DDUA 4JL5A 4NBLA 1BCSB 5BVGB 2A0UA 2XMPA 3A4YA 4RA9B 1D0VA 4Y2RA 3FOZA 2FHSA 3TW4A 4NJOA 5FUVA 3TECE 1E9EA 5K0BA 4FNMA 1ZJJA 3KAKA 1QR6A 4Q0MA 2PZFA 5LL6P 3ETDA 2UZ3A 1SIWA 1NRIA 4JLSA 2VHZA 3BIWA 3J81k 4RD3A 1R4NA 4HYEA 5FPKA 2FEMA 3KJIA 1MG0A 2D2VA 1R9NA 2Q6KA 3IYLW 3E4DA 1FDSA 2GA9A 9MHTA 3NHFA 1RM3A 2HA6A 2ZUFA 5EZ6B 1JA1A 1GIAA 1EFVA 5HCIA 3ZWCA 3IXLA 4MCJA 4MAFA 4AN0A 1HOXA 3N8KA 4D26A 1TKCA 3AJ9A 1HNWB 2KBEA 3N86A 4ID9A 4LC1A 4RKFA 5DGCA 1VG9B 4F72A 2EJUA 3OQJA 1XTRA 5JCJD 1I7QB 3PU6A 3NM5A 1GQSA 4I19A 3HH8A 1AQIA 2J5QA 3MCAA 2B30A 2R8YA 1LNQA 2REQA 2Q0HA 2ZTVA 4KFSA 2GZRA 2MMCA 3AHCA 4N5IX 2CYAA 2FFQA 2XOKA 1FLDA 3I61A 1KI1A 4AG3A 1NPDA 2WD8A 2WW8A 3G8CA 4A2QA 4B3FX 4QUAA 5CIWA 1KO5A 4BEVA 4BO5A 4C30A 4XYEA 5EOVA 3V4LA 1N57A 1XPJA 2PU7A 2XIQA 3LOQA 3T1HB 5KX5B 4RORA 2UKDA 3THYB 2H0AA 4NMMA 2WSSA 3O93A 1JB9A 1FNCA 4GMHA 4IX9A 4IZOA 3WGJA 4J90A 2O5RA 3EPPA 4N8SA 5DK6A 1XCJA 5DX1A 2RBEA 2OCLA 2R7KA 1F48A 2BHTA 4CQLA 4XEHA 1SBQA 3E3LA 4MRAA 1JUDA 1YJXA 2VHWA 1KMCA 3LYAA 4ZO4A 1JJBA 2QRHA 1Q74A 1TC2A 3VR5A 4UEWA 1E0AA 2LDBA 3RM3A 1IM2A 4R1UA 3CX8A 4MARA 4FYKA 4HTFA 3OECA 3V42A 1G18A 3TSYA 4Q9HA 3PGXA 5IPFA 1J4AA 2B1GA 3PHCA 3IDFA 4LXTA 5AKEA 1IZ0A 1XE3A 3EMVA 3RODA 2JCVA 2XXAA 4MW4A 3RU3A 4QT4A 2O7QA 2VNJA 1XAIA 3BWDD 3DCIA 3LRPA 3GN2A 2CDCA 3NB0A 4MP6A 1V1RB 2AJ8A 2BGIA 3MJ4A 3QEMB 2P91A 2GN9A 2NYRA 1G5TA 3DTTA 3QLVA 4JC4A 1UZMA 1NA5A 2B4YA 3IT0A 2JANA 1G63A 3B1FA 1GNTA 1II8B 3T0GA 4RSMA 3F6YA 4HG2A 1DTSA 3GLFB 3D3JA 1ZI9A 5U1PA 1PBTA 4DY4A 1R6XA 3U17A 2H1VA 3K53A 4CEHB 2HWWA 3S2EA 2IT1A 3DOHA 3EGXB 2X0DA 3WK6A 2WT4A 1BHSA 2FMUA 2I1QA 1G5FA 1VPEA 1ZCZA 3A6HA 3ZY3A 1PAUA 4ICIA 2P4HX 1KP3A 4KQ6A 4OJNA 5AYVA 3O9ZA 2WM3A 2DH5A 4NYMR 1DHTA 2XCSB 3GUVA 1GITA 3SZGA 2P3SA 3OZBA 4CEJA 2X41A 2YIVX 1RJGA 2EG9A 2ZJ5A 3JR7A 3N2GA 1ZMRA 2GKSA 4G26A 3LYUA 4FCTA 2VHJA 3CPEA 3D2CA 2G25A 2XUPA 2GGSA 3SJAA 2D1YA 2YNMA 3MWGA 1SELA 4R2XA 5EMKA 3EDOA 4MVWA 3NIBA 1KAQA 3ONNA 4JLAA 3ME5A 3F5MA 2QV7A 3CUWA 3C3PA 4IICA 3DE7X 1GNVA 4J3FA 1RYMA 2OZKA 2I87A 2P40A 4JSYA 2FQYA 3WKCA 4M99A 4E2FA 4F60A 1PEKE 3IEIA 1WWKA 1XMPA 4NRDA 1EWKA 5JAPA 4TV8F 5DX0A 2ZETA 3T7IA 1ZHHA 1BDMA 1KMMA 1XMSA 5A5EA 4OBEA 2OZPA 1B43A 2I71A 1PV1A 1Q17A 2RI0A 1I7SB 3ZU6A 3VNQA 3QGMA 1MT0A 4KV7A 2IZ7A 2W8ZA 2CSUA 4C04A 4CR7A 3IMCA 4MKRA 4XIGS 5BMVA 3STVA 1C1DA 1GEGA 3SSAA 3KQPA 1O54A 3L6BA 5GGXA 4C4AA 1H2HA 2XXJA 1QF7A 1WB6A 4K26A 2P4EA 3AGPA 3U3XA 3UWKA 4EARA 1IVNA 3OHSX 4FBMA 4LAFA 3MCTA 1QHXA 4PN7A 1C7IA 1DU4A 4Q01A 4Q21A 5FD8A 4PLTA 2R6JA 1PQPA 5TR9A 1AU9A 4AT1A 3B2QA 3ACBA 5KYKA 1TT5A 2VVTA 4YRGA 2QM3A 1UR5A 5GWXA 2CKDA 3TBKA 3WXMA 4C4XA 4Z2AA 1APBA 1Z5NA 1ZC3A 2H4XA 3O2QB 5LDHA 3L05A 1DRUA 1U7WA 4MRVA 4RK4A 5LP6B 1CUJA 3QVWA 2FG6C 4A23A 1WV1A 3QKRB 2WT9A 5CB8A 1OF1A 3MJFA 4Y1FA 1OFUA 3PXAA 4BTLA 3B85A 4HS4A 4AMVA 4WVLA 3VU3A 5B1EA 5JARA 4WKBA 1Y4UA 4REQB 4CI0B 4X20B 2ZWMA 1PTJA 2X3YA 10MHA 3A70A 1A1VA 5ABPA 1S8OA 4NBUA 3N8HA 3RVPA 5IX8A 4F3TA 2CWWA 1P18A 3NBMA 1CB7A 2ID4A 3AJRA 3K9HA 1W88B 1RRVA 4JOBA 1NUPA 1U3VA 2R60A 3KEQA 1MO2A 3D7RA 4NV0A 1ECPA 1JR4A 2C2KA 2GM9A 2WF7A 2X5KO 3GFSA 4IRMA 4RZ3A 4CM9A 1ZA1A 4TLAA 5E8JA 4F06A 2ZJZA 3LY9A 1PFQA 1JLKA 3EK2A 4DIOA 4E5KA 4RENA 2C3YA 3PUIA 4GS5A 4HH0A 3D8NA 4YAJA 2XMSA 3MLEA 3TLAA 5C5DA 1QO0D 3OIGA 1PWEA 4ND8B 2XVZA 4XPIB 3DOJA 3LM8A 1Z16A 4JHLA 5TNXA 2K4MA 1GYQA 2TRSB 3AX6A 1KDVA 4NV1A 4EB0A 3P9RA 4KKVA 1QYIA 3NBFA 2GRJA 4NKRA 3NWBA 4NECA 1XHEA 4M0LA 2A0YA 3OJEA 4OIMA 5EKUA 2IXTA 3HZOA 3OE7A 3SJZA 4G85A 3GHYA 3OPXA 4JXJA 4UOEA 3KQHA 1O4VA 5EJ2A 4PSCA 3ZY5A 1TAUA 3AEYA 1RJ9B 3B1VA 3GJSA 1S2OA 2IYOA 4OHOA 1J2UA 1U8TA 4PFKA 1Y3FE 2KBFA 5HBRA 3DMPA 4WAUA 2HK6A 5FV7A 3UT5A 4ARZA 2I3DA 4NNOA 1DAHA 1R4ZA 5T57A 4CCWA 5JH7F 5KQLA 4Z9BA 3ZQ4A 2QG9A 1JZSA 1H66A 1V6SA 4DE5A 1ODTC 4WBNB 2GQ0A 3HWX1 1CFZA 1DMRA 3FKSA 3WMXA 2ZRPA 3MAAC 2W2KA 2NX2A 1ATZA 1G2IA 3LUJA 3DW3X 3TDMA 2H0RA 3F0TA 3M4YA 1EGAA 2NSLA 3NUQA 2JATA 3W5HA 3OO1A 1SG0A 4BMCA 1W85B 1X87A 4UNPA 2R84A 1ZRHA 1B7GO 1YQXA 4PYLA 3S6JA 4EJMA 2PH3A 3K1JA 1KJNA 4MGIR 2JK1A 2P6MA 1QK4A 3H75A 1RPTA 4JUCA 3G6WA 4XX0A 2GR9A 1E79A 1ONNA 1P4JA 4HWPA 3KTOA 4HK4A 2HD4A 4J7CA 5LLSA 2IWRA 4BFLA 3E3NA 3K8YA 1O2DA 1XN1A 1VHWA 4C5CA 1YDFA 2O0JA 3DPSA 4RVOA 2FJ0A 1VLQA 4X00A 1U80A 4BX2A 2QRMA 4FFOA 1DWOA 1NRWA 5CXUA 3HHPA 3EPRA 3CUSA 1PR3A 1T9CA 3N2LA 2XI4A 5L3ZA 2C42A 1R37A 3JAWB 3L7YA 2UXCB 1PJ8A 2VP3A 2JEOA 3OZXA 4XWOA 5AMXA 1W94A 2VUSA 3EVNA 3UKOA 2YINC 2CJWB 4N7BA 2EP8A 3UENA 1U0BB 1JLMA 4KNWA 2YWBA 3ORHA 5FCDA 3DOFA 1WEHA 3QSGA 4MR7A 3WG9A 4H7EA 1M2EA 4S2EA 2QYHA 4KWIA 3B1JA 2CL7X 1J24A 3PJEA 3PUXA 3IB6A 2VYVA 5AM4A 5I7OA 4LE2A 5DLQC 3M70A 4JT2A 1E2BA 3BWEA 3FI0A 3SC6A 5JRJA 5AI9A 3ENKA 4G4IA 2CXQA 2C8KA 2M6SA 4WI1A 3UG7A 1JHVA 3FB1A 1V5WA 1LSUA 4ZOLA 1RAGA 3TNJA 3U1TA 2IHBA 5EWLA 1UZLA 3LUKA 5HKLA 5KU7A 3I9V6 2JLVA 3F9CA 4PGHA 3ZDDA 4HQKA 2Z1NA 1C9DB 4B46A 5H5JA 3MWJA 1SHJA 2A30A 3WA7A 5IABA 4NOKA 1BNCA 2VWQA 1SWWA 1CJVC 2JGDB 2Z98A 1ZFNA 1SOWA 3H4MA 2WT8A 5FTMA 3W8EA 1NXXA 2XUFA 3UAVA 3M1IA 3LIIA 1P5FA 1X1TA 1D0IA 2LPMA 1TUBB 2Y2VA 4LX0A 3WYFA 1XRNA 2XIJA 1JFRA 5TQ2A 3T9AA 3ZWNA 2KPOA 2H8KA 3U9LA 5BP7A 2AN5A 4V1CB 1M0SA 2HGSA 4KR6A 4N47A 3T3MB 3O3MB 4J43A 1E6CA 5IW8A 4XUCA 2X8LA 1XFDA 2GESA 3Q5EA 4YBZA 3VDRA 4MKFA 1GARA 5IYZA 3BQMB 4MX8A 1FSSA 1Q14A 5MDHA 5KJEA 3RADC 4AZWA 4HGRA 4ARCA 3B9PA 3HBLA 2ISCA 1P4RA 4QGGA 2ZT5A 3SJ7A 3DPUA 3T3PB 1S96A 1S5PA 2H85A 2NOAA 2NYVA 4Q82A 3QVJA 4OB6A 1T2UA 5JG7A 3ESDA 4KIJA 1JDJA 3TLXA 3FGNA 4UHBA 4YVFA 3VR4H 5EEHA 2RGNC 1O6BA 4I1SA 3USZA 1R12A 4UHHA 2PN1A 1NUHA 1Q1GA 3LF2A 1MEJA 1QP8A 1ZD9A 2O2XA 2QJWA 4M6WA 3H9JA 2V55B 3FBTA 2K5UA 1JHQA 1TI7A 2W98A 3NZEA 5J5CA 1O97D 3OKCA 3RUFA 2WM2A 1OAOC 1ISPA 1HXHA 2EDAA 1THTA 3VSDA 4EABA 2VPQA 2RAFA 1U2DA 3JSAA 4PE5B 1AKTA 1V7PC 2JI7A 3AG5A 1RRPA 2O19A 2YHUA 1Z0IA 2PAAA 4URHA 3SC4A 4CMIA 1JPVA 1Z6PA 5TS2A 1X8LA 2E87A 4QM6A 2B8EA 1WQ1R 4BWYA 1XD9A 3AF0A 3W06A 2YH2A 3TW8A 1DXYA 2QRGA 4OJKA 2X3UA 1Y6RA 4AU1A 1A5BB 1FBNA 2HMVA 1ZGAA 2R2GA 5AJWA 5C35A 3L79A 2DLDA 2VP9A 4YMHA 2FW9A 2Q8PA 3DFKA 3O4FA 1CZLA 1Q2XA 1JLLB 1W30A 3OP1A 3HGTA 1OI2A 3WZMA 5DP2A 1X9HA 4KGZA 5GV8A 3OJOA 4DBLE 2EFHB 1LDNA 1ES9A 1Y9ZA 3AVQA 3MD9A 4ROTA 2R7LA 5LA6A 3FOAA 2BFBB 2GF0A 3F46A 1Z4KA 7ADHA 2CFCA 2ZSFA 4OXKA 1C4OA 4UEOA 2LR0A 4CKCA 5TB5A 5B7NA 5IT5A 4BVLA 1Q0RA 4UM9D 2CL0X 1KK1A 1PR0A 5EKSA 4D4MA 2H18A 3M1LA 4PYKA 2BHLA 1LDMA 2NO7A 3HCNA 4WOKA 3IVCA 1TD9A 5A5VA 3FX2A 1NURA 1YZKA 2P2DA 2GEVA 5HRCA 1QDLB 2VEOA 3F5FA 3ZLUA 1J0BA 1UJMA 4K88A 1HRDA 4OOFA 4E08A 3H0KA 4ZYWA 3QE0A 4NONA 1Q3KA 4GVPA 3WHLA 3ZJTA 4ZQFA 2HRCA 2E4XA 5K3FA 5JDIC 2HLDD 4L16A 3GFGA 4U6SA 4XYMA 3UT5B 5IH3A 1NXTA 5J59A 2VUIB 1XZAA 3UUEA 4JP3A 2O50A 3ZD8A 1L5HB 2MINA 5MN4A 3LK6A 4MVJM 1QH1B 5LSAA 2DHEA 1FRVA 2J0UB 1FJXA 1NUQA 4UXHA 2ORIA 4AUKA 3IOEA 4DL9A 3WK9A 4BRZA 4G4GA 4RPJA 2I4TA 1YDEA 4FMDF 5LBUA 1QMGA 2ZQZA 1H93A 3DEHA 4J1QA 5HTKA 2FFBA 3CSDA 3VUEA 5DN6A 2XRZA 2V7BA 2QRPA 4HS9A 2ZAOA 4A91A 1WAMA 3ZC3A 3G7SA 2FRDA 5CVTA 1YGYA 1QZZA 1R5BA 4FYIA 4TZ0A 3L4EA 2ONYA 4LJLA 2ISQA 4DV1B 3X1XA 1VI6A 4E6EA 1M3SA 4RTPA 3UJAA 4YJGB 1MPTA 5FORA 2E82A 1JX6A 2IS4A 5FOVA 1KAOA 3VX4A 2QG4A 1XELA 3HZZA 2BR3A 4MQLA 1EX6A 4RHXA 2G8NA 1XLVA 4TKVB 4ZODA 3VAZA 4BIMA 3NAGA 1EK6A 1RR6A 1C9EA 1NT4A 3DFIA 3I23A 4O2AB 4XDHA 3WLIA 2P6RA 1BFUA 2I1VB 1MEEA 4ONEA 4ZQBA 4TX1A 5MFZA 4C7OB 3QTTA 3L4SO 1RM5A 3VYRB 1CJSA 1CRQA 4MV9A 3TAHA 1YVDA 5EMMA 1QAOA 1VJCA 1E2UA 1I7DA 3PR1A 2QAIA 2VP5A 4WCDA 2UUAB 3L8FA 3JWIA 5E3JA 2AUMA 3EVEA 2WG2A 4OHRA 3CT6A 5JXJA 1SG6A 2Z9DA 3CKMA 2AIRA 1PIWA 3KT3A 3MRVA 4CQNA 2PUFA 2XMBA 1U8AA 3FM9A 4KSYA 2FX3A 1BMFD 2Z30A 1W5TA 3RVKA 4WLFA 3G1WA 3GLFE 4MLPA 5DYYA 5LP1A 3RAFC 3HL4A 3MOGA 4GECA 4YQYA 2ZS9A 5FOWA 2D54A 2DULA 3SVLA 4X95A 3IAS6 2FFAA 2QRZA 1XZEA 3DBRB 1KVTA 3G1UA 1AC5A 3MJEA 5CVJA 5CB4B 1YZGA 3OZRA 5CXXA 1VDZA 3GD7A 2O8EB 3B3QA 2ZSUA 2EFCB 4P9NA 3Q3VA 3ZVLA 1YHNA 4BNUA 3KZVA 1J33A 4PIPA 1HO3A 2H1HA 2VYQA 3K0EA 3QKSA 3ICEA 4EA7A 5KYXB 1M9NA 5KEIA 2CVZA 4PINA 1ULHA 3K1ZA 1CUIA 3AIMA 3DBOB 3KEMA 4R2JA 1L7NA 1ZW6A 2WDPA 2P4SA 4HDAA 2QX9A 2JGRA 3H4VA 1WSWA 5TDHA 4UHCA 5CXSA 3OQMA 3WLQA 2UYYA 4D57A 1L5YA 4Q3BA 5LDGA 4PNEA 5LMCA 4GZMA 2OFWA 5JVDF 1R4MA 1U04A 4NJEB 4IQGA 5F4ZA 3W5SA 4DKXA 1IAQA 4PGMA 4LHZA 2HF7A 1JFFA 3AESB 3MUEA 4QEZA 5A7FA 4UJ3A 4WN9A 3UK6A 3GUUA 3X3HA 5JRDS 1HWYA 4IOLA 4GPZA 1ZCFA 4WGGA 3VVCA 2GZ1A 2Y1KA 2VHVA 5EIBC 2APJA 1QIIA 2XD4A 3DL0A 4M1QA 5DNWA 4BATA 2QTCA 3HYNA 4WFKA 1SCNE 3RYTC 2X22A 2IYPA 3GR6A 3QXCA 1GT91 2CB0A 2IPMA 2RHBA 2FPKA 4EKYA 4N48A 3IJEB 5AVSA 2Y6VA 1JAXA 2QTBA 1JTFA 3QXGA 1QG2A 4OBBA 4TS9A 4PZPA 1ZZEA 4AKGA 1XD8A 2BI8A 3AXSA 4MWBA 2BM8A 3O83A 5J2TA 4QHTA 4BVAA 1PK7A 1UXGA 2OB1A 3BHJA 4B33A 3PPYA 1NW6A 1ZIYA 4JMPA 4EB6A 4LBZA 1QP0A 2X6QA 1SBIA 2FTKE 3UWSA 4A27A 1U7HA 1C9NA 1X8XA 2O48X 1TMOA 3AUFA 1OLOA 4UBNA 5JCJA 1GTJ1 3QI7A 5DXFA 5KYTA 2WMDA 2G63A 4DG9A 4HAVA 4B6PA 1B8NA 2R7NA 4BNGA 2VS1A 3UICA 1ZXXA 1GD1O 5TRTA 3W6UA 1XKXA 3K15A 2OCGA 5DBHX 1P0PA 4Y6GB 3C6ZA 4QU9A 5FPHA 2M2IA 5F1OA 2O0HA 1ECGA 4ABYA 4CKBA 4X71A 1PSZA 5DRTA 2EBWA 1B0AA 2XMCA 3K2EA 4Q3EA 3Q0EA 4JNKA 5G0WA 1DV2A 4J03A 5GADl 3HJNA 4OQYA 4BXOA 4YRMA 1H05A 4U4AA 4BUJA 5EJIA 4E2WA 5LMUB 3ZDAA 2DB3A 4C0HA 3N2NA 4HGPA 3DZBA 3JD0A 1W6RA 1CQZA 4HAZA 2BCGY 4R9NA 2GD6A 4RXMA 2B83A 5BN5A 4DWVA 4DSZA 2EKQA 4BFYA 1WDKA 2X2OA 3DAHA 1JDUA 3V8NA 1WP4A 2GH1A 2CXRA 2O3TA 1EFRD 3I8SA 3HVRA 3JD3A 1T2NA 3I52A 2NO1A 5IXJA 1GQOA 5K2OA 2PSFA 1E89A 1I9CA 4AFNA 3AR5A 3OPYI 4UVDA 1K8ZB 1OBOA 3C3CA 4I2VA 1GTZA 1LX6A 1QVWA 3FBGA 2F3SA 5E95A 4B7XA 1R0LA 1AQYA 1W19A 3E7XA 4JI2B 4MO9A 5DH9A 4A8JC 3N0VA 2ECFA 1GPUA 4U3JB 5LKAA 2JLXA 4AM8A 4TYYA 5SZJA 1T5BA 3BCUA 3P4UA 4ZAWA 1FW6A 3TG2A 1GGFA 5JDCA 4L22A 2WABA 2C96A 5AK4A 1WY5A 5AW6A 2XLCA 4BO7A 1U81A 4I5GA 5B12A 3KSAC 4KQ2A 2CDNA 2VJAA 5DYNA 2FSHA 5B55A 721PA 1T4GA 2FWNA 4O02B 1BS1A 4JROA 3DLIA 4RH0A 5KDLA 3OOSA 2QB5A 3MGAA 1ARZA 1VFPA 2Y8EA 2EKPA 3IERA 4G84A 3THXA 2L42A 4WCVA 5CYPA 1WE2A 1ZK1A 3LLMA 1GADO 1P9RA 3IR6A 1NUAA 1UT8A 1VLVA 4HX9A 4TTQA 5KWSA 4YV7A 4AX8A 2QLLA 3CLTC 4CGZA 3W7AA 3OWOA 4EY4A 4Q3DA 1OHHD 4JT4A 3V3KA 1QIJA 2C0QA 4D3SA 1BN7A 3FOCA 4G4SP 1V41E 1EM8A 2UYOA 5I4BA 1Z28A 1OLUA 5ALOA 5JYBA 3IHKA 4DBZA 2JBAA 3OIUA 3JAKB 1YZYA 4FGKA 4MVJG 2OC4A 5G4KA 3W6PA 4KVGA 1X1BA 1XCMA 6LDHA 4FVTA 2ID9A 3M5DA 5BPFA 3OBBA 4HYQA 4KSBA 4Y6SA 4I6JA 1K8XB 3VHXA 4RIHA 4ZHQF 1IFXA 3K0SA 4GLFA 2Y27A 3AHIA 3BK7A 7REQB 1NKSA 3A3OA 1SCJA 3OLYA 4EAAA 2VQSA 3DXZA 2XE7A 2UUBB 1PZGA 5ENVA 4D3DA 1EVKA 3SEQA 4NEHB 4GQBA 1NIPA 4UEQA 2CMHA 1V6AA 2IU4A 2W6IA 3BCRA 4YYEA 4AO6A 1U8CB 2WV9A 5K3SA 3F4LA 1VG8A 1Q0QA 1EFUA 3WB9A 1DAPA 5EQFA 4HQRA 1Z4QA 3CO5A 1YMVA 3FBWA 4OAOA 3W6NA 1XVTA 2Z4TA 3L3BA 3RREA 1PJ3A 5I9LA 1AHIA 3A05A 3KL4A 3OUUA 1NVUQ 5ALWA 3A1CA 1XA4A 2RH8A 1XEXA 5JE8A 3RKUA 4JLWA 4Z7NB 4ZEVA 5IBCA 2HTEA 2D2FA 4M21A 2A9VA 2GYYA 4I0WB 3VV2A 1H23A 3BWXA 4NYJQ 3TZQA 1BS9A 5KOJA 4I7EA 1NP6A 2AJLI 3PDUA 2QX4A 3MA0A 4IGKA 5A05A 5TT0A 3BJZA 5E6RB 2BKAA 2JGJA 4JI4B 4KQFA 5SZKB 1RYDA 2CXHA 4FI3F 2LCQA 2BMJA 4M38A 5ECYA 5H81A 4EO4A 2GN0A 1BOFA 3VQTA 4D43A 3I73A 2NPFA 2JLSA 3ETLA 3NBXX 5FBLB 2CLIB 1H1LA 3HO6A 3MWDA 3VNSA 5I45A 1J6UA 3A6PC 5REQA 5JFOA 1YZLA 1M6WA 1MRNA 4D3FA 2CLKB 2X2EA 1A04A 1POXA 2AR7A 4X54A 3ZS8A 4B2YA 4N0EA 1SHLA 2DXIA 2ECKA 5HJEA 4XI9A 1FPQA 2R9VA 2A35A 4AS3A 4Z4FA 3ZY6A 4QGFA 1OX4A 3CF4A 2FZWA 3ITKA 3AG6A 2ZI3A 1MJ5A 3HVUA 3DLTA 3SZUA 1PFKA 4Q03A 1QO0A 2HRRA 2HJGA 2O0MA 1MQSA 3GEMA 2PUGA 1AKYA 3QEAZ 4YAOA 4G24A 4ZVQA 4MAAA 1IBCA 3UAXA 4HUTA 1CY4A 1JSCA 2ZRGA 1EZ1A 1HKHA 2WP0A 3KQNA 4MUEA 2CUNA 4AG5A 4QJ4A 1QU3A 5CNJA 3AOGA 3FHCB 4QBIA 5EKXA 3RE1A 5KJ1A 1LPMA 4EB8A 1EYZA 4BLVA 4NV3A 5ESXA 1Z7EA 3TZCA 1P73A 3CKLA 3JVDA 2DVMA 2WSIA 3MTEA 3PI6A 3PX2A 2J9GA 4MUXA 2Q4OA 1KSJA 2ST1A 2Y71A 3SPXA 1R6DA 1QR2A 2V9PA 4W1SA 5DWDA 1XBTA 4JKIA 5PNTA 2YJ6A 2IYQA 4N3NA 1CSEE 1KOFA 5C7IO 1TZCA 2FUG1 4MVCA 1J97A 3ZIUA 4P0TA 3ZQKA 4BO3A 4D9KA 4CQMB 5A5FA 5L53A 2Q5HA 3P8ZA 4U8HA 4KN5A 4R6XA 3SEFA 2AZXA 2Z57A 4GYKA 4F9FA 4NIMA 1M66A 3HDTA 4IUYA 4X20A 4KC0A 1LPNA 1GSHA 1OIVA 3ZV5A 2E4VA 5IUNC 2A9RA 1BX3A 3ZCPA 3TDKA 5HP4A 2W2XA 5DNDA 5JJKA 4ZOQI 1CJMA 2A0FA 1RAFA 4L75A 3AVXA 4BMYA 1ZW1A 2JHCA 1FX0B 2R8RA 5EZYF 4C43A 1M8KA 1DHRA 2ACWA 3UNXA 3O74A 1PQYA 2QT0A 3QVGA 1D4FA 4WTOA 2CMKA 3UC9A 1K63A 3IE2A 2IYLD 5D86A 5ERXA 3QF7A 3PFNA 4DDHA 1Z0JA 1X7WA 4GM4A 2GXSA 3PT5A 1KI6A 3O21A 2R62A 3OJCA 5C1PA 3C3AA 1ULTA 3WYEA 1FNDA 2ZJ4A 3M81A 1YONA 1LVHA 1NOIA 3WKDA 1EVZA 2P68A 4M60A 2AB0A 2JF0A 2G88A 3BKXA 2PLRA 2YVAA 3LKDA 5HPYB 5LM3A 4B3GA 2WUWE 2B4TO 1PUXA 5CCDA 3AHHA 2Z58A 5IAGA 1A5ZA 3NHZA 3E9RA 5FX2A 1HNXB 3VC1A 2RGBA 4IDEA 2DT5A 3NHUA 2G04A 5JI3E 1OLXA 1AHPA 1I4LD 1QDUA 2QZZA 2XNCA 4ZMBA 3FHTA 1QJCA 3NTXA 4LGCA 2ZBPA 2OHOA 1XCLA 5FLEX 1T0HB 2I62A 3OQNA 1X77A 4P4TA 4B3DA 3PL1A 5BSRA 2O23A 3LVFO 1U31A 2YFKA 3F7NA 3FLAA 1KZ4A 4IDGA 1R0ZA 4I50A 4TWAA 2B20A 1UMBA 3CGWA 4OIFA 4P5PA 4DCCA 2YDYA 3COSA 3HMQA 4L6CA 1G1AA 5GONB 3Q15C 4FFLA 1QLJA 4A0SA 2H9YA 3MRTA 3B1ZA 3QQPA 2A58A 3CYFA 2YL2A 2DPXA 3AUAA 4F6RA 5FPSA 2PXCA 1T9DA 1PRYA 4UATA 4ZYVA 1ZONA 5FULA 4C08A 2ZJFA 4BB5A 3BQ9A 2QG6A 4MS1B 3CRNA 2OXTA 4D56A 3DBLB 1CEXA 3AHEA 4IOKA 1ISGA 3SBOA 3OQ1A 3ZHQA 2FN7A 2O57A 4MHTA 2XSZD 1YJQA 4UBKA 3U44B 3HGQA 3STUA 2X0NA 3HYRA 4DMKA 2BGRA 2I7VA 3MBIA 1A69A 5SZIA 1LPSA 2BH9A 4A2WA 3H7IA 1N0VC 4WK2B 1MB2A 4LCBA 3DDCA 1OT3A 2WICA 2ZT7A 1SJ9A 4V0LA 2C77A 2H7CA 3F7MA 4Z4IA 2WF6A 2FX5A 5KQRA 4QPCA 2C5GA 2JIQA 3FOFC 1L3IA 3HLTA 3BL6A 1US8A 3AIKA 4LOHA 2YXEA 4H60A 4CEIA 3ISTA 2LZ0A 4UCXA 2E2WA 3HBMA 2BL4A 5I48A 4WCFB 3WTCA 4G0VA 3VH2A 4Z7JA 1A9SA 3RBVA 3NG1A 3P9IA 5K5EA 3DM9B 3F6SA 1XZJA 1TQ4A 5EIBD 1EVEA 2IY9A 1W1UA 3AB7A 5IASA 2P5YA 1ZHOA 4HQNA 3GZNA 4KPUA 2BUAA 1VIAA 1Z38A 2XLBA 4I5IA 4QRIA 3LWDA 5FR1A 1TCBA 3IELA 1DJPA 1PK8A 1S2NA 1Q44A 4MKZA 1UQTA 1LTQA 4Y2TA 3V1TC 2J4FA 2OHIA 3OEED 3ECAA 3GA0A 2HXSA 2JIOA 3PFWO 4RTQA 1V7ZA 4U5QA 2CL5A 3NHPA 5KJCA 4FZRA 4URXR 1AGXA 2QDKA 2CXTA 3MJDA 4K6FA 4AS1A 1BC5A 2QORA 3KTDA 3IUSA 2OHJA 1CHNA 4QYSA 5K0EA 3PC2A 2WQZA 3KQKA 5C5CA 2AG0A 5H83A 3JQFC 3DEAA 1LD3A 4JQYA 5AJXA 5KZMB 2VPYA 1QUEA 3LQKA 4L4ZA 4UC0A 3P9YA 1YVRA 1V1MA 3BWCA 4JJ7A 1SB8A 1J2RA 1TKBA 3RD5A 1M34A 1NBHA 1SBYA 3AY6A 2B9EA 4BYMA 3DYIA 1L4UA 2ZM5A 1WCYA 2IDZA 3A11A 3N0TA 5FTNA 4A03A 2YBEA 4F86A 1YQUA 2KE5A 1WTAA 2EJBA 3HBFA 4IWYA 4BECA 5NLLA 4QZVA 4UQLA 5L95A 1ZGHA 2P2LA 3CNLA 4BASA 2YMQA 4N54A 4EW1A 2F7SA 3PDHA 4UAGA 3UBTA 2HLDA 1M5UA 2O5VA 3KQVA 2E49A 2V5AA 1RKUA 5KQGA 4B85A 3EAGA 5KWEA 4EELA 1N9GA 5C3UA 4ESHA 1B1CA 4CDMA 2NTJA 2WJWA 2NYUA 1CYEA 2A9PA 1FMFA 3BXFA 1D2EA 4MUJA 5EJFA 4FYXA 1XVLA 5A6VA 2IZZA 4FJ0A 3R7AA 3ROKA 5LKRA 3CPSA 1YQQA 4FNAA 4YUXA 3L0CA 1DTWA 1EFKA 1S2MA 3L1IA 1U7TA 4KL8S 5C4IA 2IYZA 2JZCA 1DSSG 4S0ZA 3RJ9A 4J91A 3DMGA 3BICA 3G5UA 4K9QA 1JH8A 3BGOS 3H9UA 4XASA 3BT7A 4ISBA 1IRIA 2FEOA 2NVUA 2VXYA 1AA9A 2Q0QA 1J39A 4IIJF 5F7JA 5JSHA 1OCEA 2IKQA 4JT9A 4CFYA 1DJOA 1WA5A 3GJ4A 3RJMA 3NRBA 3C1TA 1MJNA 1JSZA 1OYYA 2CUTA 3AO0B 1WCXA 1T36B 2G06A 3WMEA 5IH7A 3PCRB 4DLYA 4WK4B 4NCAA 2FZVA 2YVUA 1HC7A 3LQFA 1Z0FA 1L9XA 3IUJA 4P31A 4EPWA 1GAEO 2Q4TA 4IFIA 1L7OA 4UU1A 5HS6A 3K72B 5C8ZA 5KSZA 4WNIA 4DLRA 4TVOA 1WHTA 4BGIA 4GE0A 4YJKA 2DKNA 2BFWA 1RS0A 3QF4A 1W5BA 5DTIA 5FI3A 3WADA 4IQ4A 4J4BA 5ALDA 4RF5A 1J20A 2SCUA 4TL8A 4OQ4A 1TCAA 3K4PA 2XF2A 2QTNA 5GJWC 3UXMA 4OHBA 4QBTA 1ZCJA 1CT9A 3GYBA 3CLTD 1DKQA 1BD4A 1UEXC 3WGNA 2G17A 2CLDX 1DLJA 1I7LA 1Y5IA 1LDGA 1QHFA 3CZCA 2JLBA 4QYWA 1WL8A 1E5LA 4ZT6A 3DBHA 5AJHA 1CU1A 5A04A 1W9MA 1ZIOA 5CA0B 1GQRA 1I01A 1I33A 2GBCA 2XWSA 1SRRA 3B3FA 3DQQA 1BMFA 3GLVA 4K40A 4YRTA 4C7XA 4EJ6A 3LBIA 1BX1A 3D1JA 1I36A 2OE2A 2RGGA 1RAAA 4KG7A 3ZCXA 1FQKA 3ER9A 4OL0A 1UBKS 2VJDA 4QAJA 3IUPA 1OJLA 2V5VA 3H3FA 3RC3A 2ZZNA 2EQ5A 3KE8A 2I3AA 4U2EA 1L5LA 4BFCA 2AYXA 4G41A 4J0DA 1CQIB 1J8DA 4LJ4A 3IAUA 2JIDA 5ALTA 5BO5A 5FKJA 4HV4A 4DYVA 1E0JA 1ZYUA 3AKEA 3K7EA 2Q62A 2Q3EA 4URUR 1G2PA 1GILA 4F6RB 3DHYA 1GPH1 3DEZA 3DZIA 2ZUEA 1DTEA 3WGLA 4C06A 2RARA 2Z0MA 4CTJA 5H82A 1PVOA 4ZTBA 3GA5A 1KJJA 1WD5A 3BCSA 1F1BA 3F3SA 3K70B 2PGNA 1XZFA 1MV8A 4UEJA 1XQWA 5FH9A 3HSYA 1Y8RA 3SK0A 2HQOA 2X7JA 5B1SA 4LFAB 3O84A 2EFEB 1VMEA 2P3OA 2BM9A 1PR1A 1W5EA 2VHEA 3C6QA 5DASA 4ZCLA 3HBNA 4M8IA 4AL4A 4B8ZA 2QDXA 1F8YA 3PRHA 1SVLA 1OVMA 3OLXA 4KQXA 2X2PA 4INAA 4RHCA 2CNOA 3LPNA 1NQVA 1TM5E 1CVIA 1QOQB 3K9NA 4P2BA 4U2CA 5AWFC 1U90A 2D3TA 4G01B 2CJPA 2KS6A 3RVNA 3VNVA 1T2AA 2BFAA 5EJMA 1LBSA 2QN7A 1ADCA 2VP6A 5KWJA 4GKKB 1E2QA 3P27A 4CF4A 1B0ZA 4R2IA 4YO8A 1OXSC 4PR3A 2ZXFA 2COEA 4YT5A 1XZCA 3ZW7A 1E2NA 4PRLA 3GC6A 3U4CA 1N8SA 3DFMA 1GFIA 5EVJA 5AXBA 3ZGOA 4JB8A 1ZVKA 2JFPA 3LPAA 1GPDG 1X7GA 1V3VA 2GTHA 3D02A 3HU5A 5YASA 5KINB 4NU0A 3OJWA 2VYND 2JAPA 3LKVA 5ENZA 4PCVA 1BYIA 4DZZA 1JXMA 1N3YA 4ZYUA 1QS0A 1MQ8B 3NNSA 3UAWA 3VDNB 3H9BA 3WBFA 2KYRA 2QMZA 5HW0A 5JAIA 3CVUA 1Y3BE 4QO8A 1QGED 1Y1KE 1QPBA 4LJ6A 1WG8A 1WS6A 3ASUA 3V7UA 1MC4A 2BBSA 1E92A 4HSGA 1YQDA 4JMLA 2FPGA 2QRLA 3AR3A 3QEBZ 3NETA 3TI7A 4C87A 4KDCA 1R50A 1XVIA 2A9KA 4X7MA 3UW1A 2G7ZA 5CLFA 5JR3A 1Z5UA 4ZPXA 2YZ2A 3N75A 4XQCA 2AGVA 2DBVO 3C6YA 4J2OA 4WUVA 5L7YA 1CY8A 1R74A 4UTXA 1CLUA 4JL8A 3CN7A 2ZR9A 3MT8A 4MVJP 2QRNA 1LVGA 3FIJA 5EP3A 1II0A 1PZFA 4IDFA 4MV0A 5EYPA 3DP7A 5P21A 4HN4B 4YLGA 3OZIA 4L9WA 4WGFA 4Q3KA 4RQBA 3LRXA 3GGGA 4I1PA 4G25A 4URFA 2W8BA 3O1JC 3RIHA 4OG2A 1RZRD 2BTEA 1SIUA 4QKQA 2AFIA 1CULC 1EXVA 1KVRA 4PLZA 5IHPA 2HNKA 4K7JA 3WNDA 1EVYA 1Y4DE 1EFRA 4XLLA 1NLMA 1ZJZA 2C5FA 4S35A 3ZU3A 3G0HA 5T67A 1WKCA 2JH8A 4HNGA 2HFJA 3C2QA 3UMFA 4O5AA 4BLRA 5L6MB 3AUJB 1EUZA 1RYEA 1N9GB 3SJBA 5C3MA 5BQXA 1SC6A 1H2XA 2JJQA 4Z2YA 4GOKA 1MVLA 3PE4A 4MQ4A 4A6DA 1O96A 3QPAA 3BILA 2ZIAA 3IJ5A 4LV6A 4O63O 1QG4A 4ZT2A 4ZWNA 4CG2A 1MC8A 1DAMA 4OHKA 3RBXA 1GPNA 1EFHA 5HDQA 4YR7A 1SD5A 1BE6A 1O08A 3FF4A 3WKBA 4D4IA 4DDVA 1ONSA 4MWZA 1R0KA 1OGJA 1RW4A 2PR2A 2QVZX 2ZOSA 3K5WA 4EGAA 3G49A 1LV7A 3C5EA 3WV5A 2PA3A 3KOZA 3P7MA 2AV6A 4PU0A 1WZEA 4I9GA 1E2PA 3HUEA 1LI4A 4AXBA 3DSRA 4G8DA 1JFTA 4TXNA 1TJ5A 3L0OA 1TW3A 2P9YA 3C3KA 5EINA 3AF1A 2WZBA 3G7UA 5EEGA 1LGYA 4R54A 3C8ZA 4MUHA 1NWHA 2VJQA 4KQGA 4ETNA 1W75A 2ZFUA 4TWBA 3WB0A 4CM4A 2WMYA 4O4LA 1VRWA 3PSHA 1WHTB 1I6LA 4BNMA 3BRWD 5G3ZA 3JAMA 3SYKA 1OHHA 1U3TA 3COJA 2HRQA 1BAPA 1LJLA 2OBBA 2W48A 2ZUVA 2NTEA 2AG5A 4LUCA 2DAPA 3L7BA 4L72A 2OA0A 1L4BA 3VDXA 3WP1B 1TPYA 2MYPA 3ZWPA 5HZHA 2PT9A 3G2HA 4RPGA 1SQSA 1VBMA 3OICA 3S8MA 2FRXA 1CWUA 1E96A 2PZ8A 3NU1A 1KJ9A 4PNZA 1G4HA 4IIXA 4RAQA 1H5QA 1KAMA 1N5RA 4MDYA 3WJ2A 5AVWA 4Q9NA 3IBCA 3IV9A 3ZDYB 5DW0A 4AROA 4B80A 3BYZA 3P26A 3FIUA 4XW2A 3K0KA 4OB7A 1Q0HA 1JHRA 5GZ6A 1CHDA 1Q3TA 1DKNA 1WZNA 4Q4DA 2O8BB 3G9XA 2OPHA 3SWWA 1CY6A 1V8DA 3KJFA 3ZXYA 3WL7A 4R1QA 1TM1E 1XLTC 2E89A 3OF2A 5F78A 2BKLA 4YHBA 2M9MA 3ZNQA 1EPUA 2GN6A 1Y9DA 2XYHA 5H7XA 2JH3A 4RUKA 4S2UA 4DV2B 1DG9A 3B9BA 3P5BA 1RLTA 4HP8A 4B7CA 3UQYS 1YOBA 2G80A 2PS9A 4MQMA 4AF7A 5F7XA 1F4VA 1Y81A 1ZDMA 2HQBA 2ZUBA 1PDWA 2ZPUA 4QFMA 4R9RA 3R7WB 4KAXA 1KJYA 1QNLA 1VCOA 3C7TA 4ZRDA 1NRXA 5KX5F 4R4JA 2GHTA 3IBGA 3VFDA 4Z53A 3D8SA 2RGNA 3PGKA 4YUWA 3RTGA 4KWEA 2ZWOA 2F90A 4WNYA 3A2NA 3C15C 4Q4HB 3FHOA 1HF3A 4RPLA 3H1TA 4UHEA 3NYIA 1A9QA 4IVNA 2JS7A 4J0KA 4LMBA 4O1IA 4PYIA 2RH9B 2FPUA 4F0JA 4PHHA 1SMKA 2HM7A 1Q57A 3REQA 4N3AA 3JU3A 5JWOA 2AOXA 2VHQA 2A0XA 2ZWPA 2Q5QA 3OMWA 4TTVA 5I3CA 3KR0A 4CCYA 4M55A 2NP6A 3MUOA 4REMA 3EE6A 3GP3A 4HLNA 2GNOA 3LX8A