1K50A

A v49a mutation induces 3d domain swapping in the b1 domain of protein l from peptostreptococcus magnus
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
63
structure length
63
Chain Sequence
b'EEVTIKANLIFANGSTQTAEFKGTFEKATSEAYAYADTLKKDNGEWTADVADKGYTLNIKFAG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Protein L
publication title Single-site mutations induce 3D domain swapping in the B1 domain of protein L from Peptostreptococcus magnus.
pubmed doi rcsb
source organism Finegoldia magna
molecule tags Protein binding
total genus 18
structure length 63
sequence length 63
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2001-10-09
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.10 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 1k50A00
3FILB 5JXVA 2LHEA 1MHHE 2LHDA 3V3XA 4OZAA 2RPVA 1HZ6A 1F2RI 1KH0A 1YNTE 2NMQA 2ZW0A 2J52A 3UI3A 2GB1A 1IBXA 1XCQL 1IGDA 4GLSC 2I38A 5HHDG 1JMLA 2I2YA 2JSVX 1XCTL 1GB1A 4HJGE 1IBXB 2RMMA 1K52A 1IGCA 1PGBA 1HZ5A 4KGTA 1HEZE 1FCLA 2LUMA 5HFYA 1P7FA 1D4BA 2IGGA 2QSDA 2KQ4X 2N9KA 1K50A 4OZCA 5BMGA 4D2KA 2PW9A 1MVKA 1K53A 2QMTA 2EELA 4OZBA 4WH4A 2KDMA 2IGDA 2IGHA 1YMHE 1MI0A 3GB1A 2J53A 1F2RC 4IKGA 5BMIA 2ZW1A 2ONQA 1FD6A 2JZPA 1UWXA 2KACA 1XF5L 2ON8A 1P7EA 3MP9A 5HI1A 5BMHA 1FCCC 4KGSA 4MACA 1QKZA 1PGXA 1PGAA 2OEDA 2K0PA 1EM7A 1MPEA 2PLPA 2JWUA 2PTLA 5HG2A 2KWDA 2N9LA 2JXTA 3FILA 2LGIA 1C9FA 4HKZE 1Q10A 4KGRA 4IOIE 1GB4A 2GI9A 2KN4A 1MHXA 2JU6X 1ZXHA 2N7JA 1K51A
chains in the Genus database with same CATH superfamily
4W9JA 3TJPA 2LFIA 3ALBA 3OJ4B 1I42A 1JALA 4US9A 1YJIA 2MEKA 2JRHA 5GMVA 2R61A 4ZRQA 2EMTA 3VUWA 3VHTC 2YEPF 3SEBA 1EU4A 3PLUA 1E7VA 2NBVB 4ZDVA 2K8CA 4RGNA 1E5WA 2YVCA 1U4AA 5TSSA 2GBKA 1V5TA 4D2KA 3N30A 2KX0A 3NVWA 1WH3A 2EELA 4CQNA 5TR5A 3ZKJC 3GB1A 2J53A 3PTFC 1ZDVA 2WDRB 5BMIA 1V1PA 2BVCA 4N6EB 2CHXA 2X8XX 4JL9A 5E6OA 3BZDB 1WYGA 3QARA 2WDQB 1WI0A 4KKIA 4KVGB 3RULA 1PGAA 2OEDA 5G55A 2XNAC 3T8MA 1WXVA 3NY5A 3Q8BA 1CMXB 4JE3B 3JYUA 4ZHPA 1N60A 3TIXA 5JHAA 4I6NB 1KLGD 4HPMB 3W2DA 2IO1B 5J17A 3ZUNA 2RDGA 1JWMD 2JU6X 5D2MB 3BWUD 3CMMB 2WWZA 4FADA 2BGFA 1N63A 4WWPA 1JCKB 1L6UA 4HRSA 1IP9A 3M3JA 1L0XB 2L7RA 1L0YB 2MBBB 1P9DU 3A1QA 3UI3A 4NAWA 3PHWB 3VDZA 2NVUI 1HXYD 2I38A 3AM9A 2Z59B 3N1YC 2IJ0A 3A9JB 2AQ2B 4IM2A 3PVLA 1UF0A 4FN2A 2CHWA 4RM9A 2ZNVC 3IG3A 4MDKE 3DBSA 3LJ3A 1L0VB 2VH1A 5AUKA 3EFUA 2N9EB 1XT9B 5AZFA 3PO0A 2PPHA 1R4NB 3Q14C 4M8NA 4OZCA 1OEYA 3EGRA 4K3CA 1J7BA 1MVKA 4XX5A 1K53A 2DAFA 1UD7A 3KW5B 1UZXB 2KDIA 3AE5B 2EKIA 2KKCA 1WJ6A 1E6EB 4KX6B 4YTMB 1KRHA 2NR2A 2KVRA 4EZJA 1AN8A 2WHIA 4RF1A 1XF5L 4ZYSA 4KIKA 3KVFB 5HI1A 3W9CB 2K5PA 4ITKA 4ACFA 1OQRA 1DOIA 3L4PA 2WX1A 3AEFB 1XEEA 4MSMB 2JX5A 2G9HD 2ZPYA 2LVOA 1CQVA 3I63C 1DGJA 3BYYB 1L5PA 1WXMA 4OVZA 1TY0A 4C4VA 3DBHI 3HHMA 3U7DA 2M0XA 3ML8A 1PDXA 1MHXA 1I4XA 1Q5WB 1GC7A 2K25A 3P4SB 3P4RB 4E3CA 4C80A 4DQOC 3QA8A 3QIJA 2IY0B 4KDLB 1YNTE 4A6QA 4KSLC 4L2YA 2NMQA 2M56B 4ZRIA 2MP2B 1I4PA 1SE9A 3DBLB 3RPFC 2DYBA 4P16A 1EU3A 3V05A 1STEA 2JZZA 2BBCA 5HHDG 2WXLA 3I9V1 5FR6A 3TEZA 1V6EA 2MSED 1WF9A 1FIQA 2NTTA 3AU4A 4HDOA 4TMAB 2TSSA 1BUIC 2JUOA 1ZKHA 4WWMA 3V6EB 2LD9A 1F9JA 1IUEA 2QSDA 2N9KA 1UELA 3OG5A 3CSFA 2CU3A 1ZE3D 2QILA 1T5XD 1J7AA 2CR5A 2BQQA 2AEHA 1KTKA 1D5XC 2WNMA 4II3B 4RH6A 2ONQA 2LGDA 3TEYA 1V49A 3VQIA 1UWMA 2QC8A 1PQSA 1YD8U 3DHHC 1SB3C 4KGSA 2V3NA 1S1QB 3BVGA 4JIOU 1ZPSA 1Y8RC 4J6IA 3LYYA 4ANUA 5DPTA 5D3DA 1AW7A 3SFEB 2E3TA 1FXIA 4PYZA 2QCZA 3VR8B 1GC6A 4HEA1 2LGIA 3GZNB 4B0MA 2M0AA 2W3SA 4C7ZA 3L0WB 2WDTB 3UIOB 3DBRB 3I57A 4LK0M 4A90A 1RM6C 2WXHA 1YOVB 1XO3A 1MHHE 2SEBD 4BKSD 2KT7A 2LRUA 4TSSA 1VR9A 4JPSA 3EHVA 1WM3A 1V97A 1T0YA 1WJNA 3U7ZA 2BS4B 3MHSD 3AEBB 3RI7C 1TJEA 1XQQA 4W9CA 2PE9A 3CIRB 2DAJA 3Q3NC 3NS8A 2C9WB 1YIWA 3NOBA 2CHZA 4YSXB 2JF5A 3APFA 1XXGA 5MPOA 4IUMB 3DCGA 4JQWC 2NPTA 4KGTA 3GS2A 1NI3A 3MFGA 4AJYB 4BFRA 4TUUA 1QLBB 4EKUA 2MJEA 1ZUD2 2FAZA 1WFYA 2BKRB 2V1YA 3HUIA 4ASWC 4NJ7A 1HTOA 5BMGA 1V1OA 2DBYA 3RNEC 5LNK1 3X0WA 1KFYB 3PZ8A 3P2BA 4F1SA 3U52E 4KKJA 1SIJA 1WZ3A 3VFKA 2QDFA 3HIZA 1HA5A 3W1SC 3N1ZC 5CTRC 5C1ZA 1NBFC 2G1EA 3QC8B 1TZ1A 4A55A 2REXA 4LJPB 1EM7A 5IA7A 3MC9A 1EWYC 1OQYA 2KD0A 1EF1A 2PLPA 4DXAB 4A3OA 1TKGA 1WGRA 1F77A 1ISNA 2K3UA 1E9MA 1YX6B 2INCC 2N1VA 3RNBC 1JROA 3PT2B 3QHTA 4AP4C 1YQBA 1XLNA 3NVYA 2N7DA 1VZ7A 2KX3A 1K8RB 1YQ4B 3BK2A 2GRIA 2C7NB 3AE3B 3ONSA 1ENFA 1EWCA 3B2GA 3FAHA 2KC1A 1WE7A 2AX5A 2LHDA 4LNKA 3TUOA 1RRBA 1WRDB 4P7IA 2AYOB 3JSVA 4WAFA 4CHKA 1WGGA 2KQ7A 4NNJB 4EFOA 3L08A 3K9PB 2LI5A 3KQ4A 4BOZB 5HKHA 3CF6E 3RNGC 1SJHD 1A5RA 2WXOA 1C3TA 1ET9A 3IT6B 1AWDA 3QK0A 3Q2AC 4XWWA 2KC2A 3ZRFA 2ZEQA 5IAAC 2KJRA 4US8A 2V4IB 1SIFA 3AE7B 2KMCA 3B1LX 3KH0A 2FNJB 3WAPA 1C77A 2MBHA 5CHWA 1V86A 4K3BA 3ECIA 3GOEA 1NYRA 1Q0WB 4M00A 1YJ1A 1ZDXA 4URKA 2VH2A 1FMAD 3NUHB 1J7CA 1YN3A 4MACA 2BS3B 2YEPB 3HM6X 4AQ7A 2MCNB 3KWVA 2AQ3B 1M4VA 2JWUA 3AEGB 2L00B 1E7PB 2WXKA 3MTNB 2RDBC 4K7UA 1R4MI 2G4SA 1E8WA 4IM0A 4WWOA 4K7SA 3PZ7A 2MX2A 3PZDA 2K8HA 2GBRA 2LVPA 1FO4A 2KO3A 2J4XA 4FHKA 1FXTB 4I6PA 1MG4A 2MBOA 1TBEA 2W9NA 1KH0A 4GGQA 2J52A 4AWJA 3PLVA 2GBMA 1E8ZA 3AEEB 4G11A 1I4QA 2I2YA 2MBQA 4KZ0A 2HD5B 3V60A 1GB1A 2BWFA 3H7SA 2BS2B 3SD5A 2OOBB 2KAJA 2OJWA 4EEWA 4MGYE 5G5GA 2L83A 1D5ZC 1PGBA 2IY1B 2JYEA 2ZPNA 5I4DA 3DVNV 1IYFA 2IDYA 3I3TB 1FXAA 2IO3B 2FCMA 4LNFA 3IAM1 1ESFA 4BKGA 4LNOA 3Q69A 4BKTA 4GMVA 2ZVNA 2C7MB 3QWZB 4M0WA 4DHZB 1RWSA 4CYEA 1UUPA 2L1AA 4FA6A 3UINB 2HJ8A 4WJNA 1EF5A 5BMHA 3ZJUA 3ML9A 2DZJA 2K0PA 3B08A 1V1PB 3QX1A 5LXHA 3N3KB 1WMHA 4MGIE 1CK1A 2FE8A 2L8JA 2JXTA 4KZCA 2D07B 2V4LA 5LXIB 1L6VA 4HKZE 2WXQA 1DYQA 4OHJA 2J0KA 2HTME 3RD2A 4FXCA 3TCAA 2LGXA 3U8ZA 3OJ3A 3R7QA 4C00A 1QOFA 1I4HA 5JXVA 3BINA 3V62A 4YXDB 4JWUC 4XWTA 4R3DA 3WAMA 4ANXA 3NVVA 2RPVA 4BBNF 1FRDA 1NDDA 1SE3A 1QILA 3PS6A 1IBXA 4OVUA 3DWMA 1N5XA 1WX8A 1QZEA 2FUG1 2DZMA 3A1QB 3NZUA 4BZAA 4NAWB 4MGKE 1FNUA 4HKQA 3A9KA 5H8YE 1QF6A 1HZ5A 1WGDA 3ZXVA 5FKAC 2WXJA 1JRPA 4FBJB 2KFJA 1HE8A 1ZGUB 3ZNZB 5CX3A 2BPSA 4IM3A 2C60A 3BVMA 4JGHB 3PRPB 2IGDA 4HPPA 2IGHA 2ZVOA 4FHJA 5EE0A 1F2RC 4OVVA 2WXIA 2ZW1A 2RD0A 4FJZA 1WE6A 2JZPA 2HTHA 1VZ6A 3IBEA 5EE3A 2PKOA 1JWSD 3D32A 1P7EA 1TKEA 1V5OA 2LASA 1RLFA 2INNE 5D6JB 1E10A 2KVZA 2DENB 3K9OB 1WGKA 3O65B 2Y5BB 3UGBB 3VRAB 4KIKB 4G3XB 2KWDA 4XZ4A 1YN4A 4OW0A 2H88B 2W55A 1D3ZA 4W9GA 3KLSX 2N9PC 4W9LA 3OLMD 4MM3A 4ANVA 1ZXHA 3AE2B 4HJKA 3ZVVA 2DZIA 4HWIB 4WJOA 2FCNA 5AZGA 4C4VB 4F7ZA 1R4NI 2KMMA 1L4DB 4RM8A 2KDBA 4YL8A 3SDLC 2JT4B 3IHPC 2KLGA 5E6JA 4C7YA 1T0QC 2V9HA 4FJYA 3EUB2 4WIPA 2KFKA 3A4SC 4XDDA 3RFZB 3A4RA 3S2AA 2LGSA 1L2NA 4NPNA 4A3PA 1H4RA 3DVGX 5DCNA 3TBLD 1T0SC 1C4AA 4W9EA 3WIMA 4X57B 2WXMA 1NENB 1FM0D 3N1XC 1XLPA 3UQBA 1IPGA 1CZPA 3Q6BA 1TS4A 2D3GA 3QCAA 1WJ4A 3DHGC 1L7YA 1NYQA 1UNSA 1F52A 1WRIA 2NBWB 1UWXA 2J0MA 3ZXRA 2W54A 3Q3MC 3LDZE 2FCSA 1FCCC 1C79A 3U2SC 1TS5A 3IFWB 2KN5A 2RPQA 3H7PA 1WX9A 3U4EG 4W9DA 1GUAB 3ZQ4A 1EUVB 2ACZB 5HG2A 3HM3A 2JZ3B 3KUCB 4C56C 5J2RA 1GJZA 2JQRB 3GE3C 3APDA 4MJSA 1GB4A 2DX5B 5IOIA 4ZRPA 3R66C 4PK1A 1WX7A 2LZ6A 3Q8AA 4ZRKA 4WQOB 1G6JA 3ABVB 3NS1A 5CHVC 2HDEA 4DWFA 2L76A 3ZTDA 2A5UA 2K9XA 4K7WA 1GAQB 4YTNB 1LGRA 2N7EA 3TL5A 3SFDB 4IWQA 2BTEA 3RMKC 4N9F4 2KTRA 3VTWA 2DZKA 5L83A 1WGHA 2D10A 4ZOHC 4ICUA 5FK9C 2VZKB 1P7FA 3AEDB 2GOWA 3APCA 2RR9A 1OGWA 2LJ5A 2O6VA 4ZYNA 1N6ZA 3DPDA 1GOZA 2NPTB 2J42A 3C8YA 2DHZA 4E71A 3PSEB 2N0SB 4WH4A 1I7HA 2KDMA 3GZNI 3GP7A 2MWSB 3URYA 2ZZPB 2UWQA 2VZKD 2DLBA 1B1ZA 2GBNA 2XK5A 3AV8A 3FC4A 3AMZA 3DBRI 3MHZA 4MH0E 3H9DA 3ZNHB 2CJOA 1SGHA 1SE2A 4WWNA 2D2QA 1P0RA 4LNIA 2MRPA 3Q8CA 2O2VA 2MBEA 2UYZB 3PREA 4B0EA 1JWBD 3UF8A 4AUQC 5KHOA 2ASQA 3AU5A 1TS3A 5IP4D 4S17A 1AYFA 3FILA 4PS3A 1RFKA 1SBBB 1WR6E 2OJRA 3ZNID 2WS3B 1FNVA 2FIDA 3BVZA 3W1YA 3Q3JA 3ENEA 4M02A 3PRZA 2PEAA 4P6VF 3NZ3A 2DWQA 2JY6A 2INDC 3SR6A 3ZRCA 4WQMA 4F8CB 1KLVA 2WGSA 4RFBA 3TEWA 3DWGC 3H6NA 2W82A 4A8XC 1XCQL 4PT5A 3N9YC 2IBIB 1UBQA 4YSZB 3RYTA 2FBWB 2V3PA 1I35A 4KSKC 3JSVB 2L52A 4BVUC 4GB9A 4B9KA 4JWSC 4RGMA 2SAKA 2D3CA 5BO4B 1QT9A 1FCLA 2LJIA 4XDCA 1JWUD 4GDKB 4GOCA 1F1HA 1ET6A 3J9CA 5IO9A 2R2OA 1TTNA 3AE1B 4ARIA 1VJKA 1KM7A 1V8CA 3AB5A 3OAWA 3RUIB 1TS2A 3BK1A 4PS8A 2DYOA 4GDKA 1WY8A 1MI0A 1FFUA 3ETRA 4BBNC 2WP9B 2WXPA 4YWGG 2JPHA 5EDSA 2XBBC 3QAQA 1BMLC 5DPSA 2KACA 2KQSA 3MP9A 1ZOYB 2BW2A 1N61A 1Z5SB 4W9KA 1T0RC 1AARA 4LNNA 2HJ1A 1FEHA 3VR9B 2AL6A 4DXFA 4M8MA 1RFAA 4XE0A 3VH4B 2M17A 2N1WA 4AOFA 2I1KA 2NS5A 2ZCCA 4N58A 3ZO5B 1CJEA 2LHEA 2HE7A 3C19A 3RNAC 2WXNA 4L23A 1HZ6A 3VUXA 3BIID 2CS4A 3W5UB 2QIEB 1YJJA 2FCQA 4E74A 5H92C 2IYDB 3DHIC 3KYDD 1QOAA 1VD2A 4LDTB 4FJVB 5JH5C 2BYTA 3N32A 4GU2A 4IC7B 1WWTA 2RDHA 1F0ZA 3ZNGC 2QJLA 3EECA 2KQ4X 4LDTD 4HROA 3B2FA 3VAWA 4Q2JA 5BYQA 2J0JA 4WURA 4XYCA 3IAS1 1SSNA 4GIVA 4GN1A 4YTPB 4YSYB 2LMCA 4TV3A 2IO0B 4MT5A 4S0RA 3C0RB 1WXQA 5DPWA 3UQAA 3VTUA 3T3NA 2INPE 2MQJA 4NJCA 5AZHA 4HXDA 4TQ0A 2JXXA 2C7HA 1H8CA 4M0WB 2LRWA 3E9SA 1E8YA 2IZVB 3BY4B 2JWZA 1MPEA 3P4QB 3DQVA 1C78A 3P1MA 2PTLA 1XLQA 2BWES 2KYWA 1PFDA 2L0TA 4AJWA 1Q10A 3TMPB 1OTRB 2V3SA 4ANWA 5E6PA 2KN4A 2RSUA 4RMAA 4DXGA 1WMHB 2XEWA 1FRRA 2N7JA 2Y3AA 3L17A 2YLMA 4XC2A 2M1MA 2KMAA 4BAXA 3JW0X 3RN9C 2GB1A 2WXGA 2E6XA 1R7SA 4JLCA 1IGDA 2D3AA 4TKNA 1J19A 3H1UA 2W3RA 1JMLA 4WJPA 4B6WA 4W9HA 1WGYA 1Z2MA 2LEKA 2BB5A 1IBXB 1GNUA 3P63A 1OFFA 2QHOA 4RNAA 3KWLA 2BYFA 5KHQA 1E90A 4H2AA 3MJWA 2PIAA 1WXAA 2LUMA 4MELA 1KLUD 2BYEA 2G45B 1VCBA 5AUIA 2WXFA 1K50A 1YQ3B 2WYQA 3A9KB 3RNCC 4G50A 2D11A 2D3BA 3L13A 4ZRJA 4WAAA 3HK0A 3IVFA 3WCQA 4DHJB 4QAYA 3Q8EA 2IPKD 2WU2B 4AS1A 2B3AA 1TIFA 4EUTA 1WR1A 2WDVB 1SJED 3OWEB 1E8XA 2JVCA 4HCNB 4I6LB 2KANA 2BF8B 3HRDD 4USAA 4REZA 3AULA 2G3QB 3V6CB 3VRBB 3I5JC 3L10B 4DHJD 1V80A 3L54A 4YT0B 3NJTA 3B9JA 1QQRA 1T6BX 2K8BA 3PV1A 2N9XA 2JRIB 4RF0A 3Q8FA 2PE6B 3T9LA 4PYUA 3BYTB 1L4ZB 1HTQA 1BXTA 2MA9B 3WAOA 5G2NA 1P1AA 1HQRD 3V61A 2A4ZA 3SU8X 2KHWB 5CHFA 3HVZA 5D94A 3R7RA 3A9JA 4IG7B 2EKEC 2NBUA 4MM3B 4XGAB 2BKFA 3TEXA 1TT5B 1B9RA 1OEYJ 2JYTA 1J0GA 4G0NB 4GLSC 2LGYA 2KWCA 3ZLZA 3EA6A 1WYWB 2KK8A 1WXSA 1JRUA 2QEJC 2FIFA 3DBHB 1C4PA 2PJHA 2RMMA 1RYJA 1E7UA 2C5LC 2AWTA 2KFKB 4NAMA 2BYVE 2H89B 1S3SG 3M95A 2MH7A 2L3ZA 2LXCA 2L32A 1EO6A 5AEKB 2DYMA 4OZBA 2VRRB 3W5VB 5JHBA 1YN5A 3IT4B 2M4NA 5FR3A 3KUZA 1JWAD 2UU7A 3N20C 3R2TA 2KJ6A 3MC8A 3RT3B 3AN1A 1WSPA 3PPAA 1PGXA 1E0ZA 4DBGA 1UBIA 2MJ3A 2EMSA 3NG0A 3AI5A 4HPLB 2K39A 3ZTCA 1LFDA 4DDID 4M01A 3EFCA 4RCOA 4RGOS 3U30A 2N9LA 2GLSA 3P42A 4ARCA 1TY2A 3H7PB 2LWPA 5IN7A 1D6EC 2ZNVB 2X38A 4FLHA 3AXCA 3DVNU 2MP2A 1C9FA 3DBLI 4NQKE 3KYCD 3V3XA 2CU1A 4OZAA 4P1BC 4II2B 1ZXIA 4UDUC 3ZJTA 4MJSB 1F2RI 1MJDA 1V9JA 5D7GA 2ZW0A 1V81A 4W9IA 1DOYA 2WU5B 1GG3A 3QQ8B 2NTSA 2Q5WD 3B0AA 1LO5D 4HCPB 4LJOB 2PMVA 3NVZA 3ZGZA 2Y5PA 1XCTL 3ZYYX 5JZEB 5L95C 1IGCA 2MLBA 3FKYA 4GDLB 3A33B 2IGGA 5C2TB 2B76B 5DPRA 3O13A 5LLIA 1UGJA 2KTRB 2PW9A 4KDIC 5T8IA 1I4RA 1KJTA 2KXJA 3R3MA 1VDVA 4B95A 4GDLA 3VVWB 4IWOA 4N59A 1NI2A 4A9AA 2BT6A 3P4PB 1WM2A 3DVGY 2O6VB 3Q3OC 1SXTA 3E56A 1UGMA 3NZSA 4MSQB 3VXWA 4BOSC 4P1CC 3PRMB 5D3IB 4BKSA 2CKHB 2XK5B 2L0FA 2KWVB 2MHJA 1C1YB 2LVQA 2KDFB 2K1FA 1FNWA 2O6VD 5E6NA 4DK5A 2MW5A 3IXSA 2N4FA 2O2VB 4JX1C 2KOXA 3AE4B 3EC8A 1WJUA 1NVID 1TYGB 2GMIC 4KGRA 2AQ1B 2L05A 1C76A 4IOIE 1KF6B 3FILB 3ZW3A 4J3OD 2K22A 1C4CA 2WX0A 1ZW7A 1LM8B 4K81A 3VUYA 3RZWC 3VTVA 4MH8A 1P98A 3WANA 2M19A 4HLEA 1VRAB 3HVDA 3T3OA 4W9FA 3CSTA 2DNFA 1SE4A 2RGFA 3UIPB 1KOTA 4HJGE 4NZLB 3M62B 2Z0DB 3X23A 2Z8LA 4IWPA 4NJ6A 4A20A 4HDQA 3CWIA 4NY0A 1Y56A 2WXRA 5HFYA 1D4BA 4HK2A 2KWUB 1LXDA 1PYWD 1SF0A 3RNFC 2KZRA 1GPXA 3Q3FA 5BYRA 1P3QU 4MGZE 1JW9D 2ICIA 3R2IA 1QOGA 1VLBA 2ZJDA 1NEKB 2D5GA 5C23A 2K6QA 3PHXB 3VH3B 5EE1A 3MC0B 2KJHB 2ON8A 3DOWA 1QKZA 1Q1OA 4NQLB 4LLGM 5J18A 3L16A 4IDIA 2IO2B 3SHQA 5G5HA 1T3QA 2KLCA 4L1BA 1VZ8A 1OQQA 3JVZX 2LUEA 2MJDA 3AE8B 2OHFA 3DDCB 4DDGD 3WA0A 1WZ0A 3H8HA 4PS7A 2GI9A 2I1JA 4EZKA 1X1MA 2CJNA 3GE8C 3LB8C 3AEAB 4EZLA 1ZP0B 2XN9C 3ZIMA 1N62A 2NCNA 5C3JB 2KDEB 4O1NA 5BYSA 1ROEA 4MEMA 4LCDE 3M63B 2KNBA 4DHZE 4FULA 3NRZA 2FUHB 1V2YA 1BT0A 1M94A 1JQ4A 1YX5B 3AECB 4HVBA 3MJ5A 2JSVX 4GXBA 2BB6A 1TGZB 1R4MB 1K52A 3AH7A 2ZCBA 4EOYA 1HEZE 2V0GA 2J7QB 3AE9B 5EE9A 3R8BA 3W1SA 5GXGB 4ZHOA 2PVOD 2M8SA 4WJQA 1WIAA 1PUTA 4RGTA 1MFWA 3TSSA 2QMTA 1D5MC 1UH6A 1A70A 3NHEB 2KTFA 1MG8A 1YMHE 1TKYA 3ZJVA 2GBJA 4IKGA 1J8CA 1FD6A 3LXFA 3AE6B 4EE2A 2Z0EB 1RAXA 2R2QA 2Y5CA 4ICVA 3WALA 5IKCM 1XLOA 3QJZA 1FFVA 1N5WA 1SEBD 4CO7A 2LXAA 1LQBA 3ZDTA 2WLBA 2G4DB 2WQYB 1QOBA 1DOXA 1XD3B 4GSWA 4KV2A 4LTUA 3KUDB 1ACCA 3RCZA 2PVGC 1I4GA 4K1RB 3RZFA 2AL3A 3PGEA 1FPYA 2K6DB 1TZOA 3ZDMC 4IW0A 4TQ1A 1K51A
chains in the Genus database with same CATH topology
1ENFA 1EWCA 1HQRD 3B2GA 3FAHA 2AX5A 2LHDA 2LFIA 3HVZA 3TUOA 3Q8AA 3ABVB 1JALA 3NS1A 4MM3B 4US9A 2HDEA 1YJIA 2MEKA 3TEXA 1B9RA 4WAFA 2JYTA 2K9XA 4GLSC 1GAQB 2R61A 4YTNB 3SFDB 4ZRQA 2BTEA 3KQ4A 3EA6A 2QEJC 1SJHD 1C4PA 2WXOA 1ET9A 3IT6B 1AWDA 2YEPF 3SEBA 2RMMA 1EU4A 1RYJA 4XWWA 4NAMA 4RGNA 4ZOHC 5FK9C 2H89B 2VZKB 1P7FA 3AEDB 4US8A 2V4IB 5TSSA 2MH7A 3AE7B 4D2KA 1GOZA 3NVWA 2L32A 2J42A 3C8YA 2EELA 1C77A 2DYMA 2N0SB 4OZBA 4CQNA 4WH4A 1I7HA 2KDMA 3GP7A 3URYA 3W5VB 1NYRA 3GB1A 1YN5A 2J53A 3IT4B 5FR3A 2VZKD 1ZDVA 2DLBA 2WDRB 1ZDXA 1B1ZA 3AV8A 3FC4A 3AMZA 5BMIA 3MHZA 1JWAD 1FMAD 3R2TA 2CJOA 1V1PA 3NUHB 1SE2A 1WSPA 3AN1A 4N6EB 1J7CA 3BZDB 1YN3A 1WYGA 4MACA 2BS3B 2WDQB 3Q8CA 1PGXA 2YEPB 1E0ZA 4KKIA 4ZRPA 1PGAA 2OEDA 4B0EA 2MJ3A 4AQ7A 1JWBD 2XNAC 3KWVA 3Q8BA 4JE3B 2AQ3B 1M4VA 2JWUA 3AEGB 1TS3A 4ZHPA 1AYFA 4RCOA 1N60A 1E7PB 4RGOS 2N9LA 3FILA 1KLGD 2WXKA 3P42A 3W2DA 4ARCA 1TY2A 1RFKA 1SBBB 2WS3B 1D6EC 1FNVA 2X38A 3BVZA 2RDGA 1JWMD 2JU6X 3BWUD 3PZ7A 1C9FA 4P6VF 3NZ3A 2DWQA 1FO4A 1N63A 3V3XA 1JCKB 2J4XA 4OZAA 3SR6A 1L6UA 4HRSA 1ZXIA 4WQMA 4UDUC 1L0XB 3ZJTA 1F2RI 1KH0A 1L0YB 4RFBA 3TEWA 5D7GA 2ZW0A 2J52A 3DWGC 1DOYA 3UI3A 2W82A 4A8XC 1XCQL 4PT5A 3N9YC 2WU5B 1HXYD 2I38A 4YSZB 2NTSA 3AM9A 2Q5WD 2IJ0A 3AEEB 1LO5D 1I4QA 2AQ2B 2FBWB 2V3PA 2PMVA 3NVZA 2I2YA 3ZGZA 2Y5PA 1XCTL 1GB1A 3ZYYX 2BS2B 2L52A 2KAJA 1L0VB 5G5GA 2L83A 1D5ZC 1IGCA 1PGBA 4JWSC 2JYEA 4RGMA 2SAKA 1QT9A 5AUKA 1FCLA 2LJIA 4XDCA 4GDLB 1JWUD 2IGGA 4GDKB 5C2TB 2B76B 5I4DA 3PO0A 1ET6A 3J9CA 2IDYA 3O13A 1UGJA 4OZCA 1FXAA 2PW9A 3AE1B 3EGRA 5T8IA 4ARIA 1J7BA 1I4RA 1MVKA 1K53A 3IAM1 1ESFA 1VJKA 1VDVA 3Q69A 1V8CA 3AB5A 1TS2A 3BK1A 4N59A 2DYOA 4A9AA 1MI0A 1FFUA 3AE5B 2BT6A 3ETRA 2EKIA 3P4PB 4M0WA 1E6EB 4KX6B 4YTMB 1SXTA 1RWSA 3E56A 1UUPA 2WP9B 1KRHA 2WXPA 4YWGG 2L1AA 1AN8A 5D3IB 1BMLC 2KACA 4RF1A 1XF5L 4ZYSA 3MP9A 1ZOYB 5HI1A 5BMHA 3ZJUA 2BW2A 3W9CB 1N61A 2K5PA 4ITKA 2K0PA 1OQRA 1DOIA 3L4PA 1FNWA 3AEFB 1XEEA 1V1PB 2JX5A 2G9HD 1FEHA 3VR9B 3IXSA 4DXFA 1CQVA 4XE0A 1CK1A 2FE8A 4JX1C 2JXTA 1DGJA 3BYYB 1L5PA 1L6VA 4OVZA 1TY0A 3AE4B 4HKZE 1NVID 2WXQA 1TYGB 1DYQA 4KGRA 4OHJA 2AQ1B 1C76A 4IOIE 2HTME 4FXCA 4N58A 1KF6B 1PDXA 1MHXA 1I4XA 1CJEA 3FILB 1QOFA 1I4HA 5JXVA 2LHEA 3P4SB 3P4RB 2WXNA 4L23A 4A90A 4JWUC 4J3OD 4XWTA 4C80A 4YXDB 4R3DA 2K22A 3NVVA 2RPVA 1HZ6A 4DQOC 1C4CA 3BIID 3W5UB 1YNTE 4A6QA 1FRDA 4L2YA 2NMQA 2M56B 2QIEB 1YJJA 1SE3A 1I4PA 1QILA 5H92C 1IBXA 3RPFC 4P16A 1EU3A 3DWMA 3V05A 1STEA 4MH8A 1N5XA 2BBCA 5HHDG 2M19A 2WXLA 3I9V1 1QOAA 1VRAB 3HVDA 2FUG1 3T3OA 3TEZA 1SE4A 1FIQA 2NTTA 2BYTA 4HJGE 4NAWB 4NZLB 4TMAB 2TSSA 1FNUA 2Z8LA 1BUIC 4HKQA 1WWTA 5H8YE 1QF6A 1HZ5A 2RDHA 3CWIA 1F0ZA 5FKAC 4WWMA 1Y56A 2WXRA 2QJLA 5HFYA 1D4BA 2WXJA 1JRPA 1IUEA 2QSDA 2KQ4X 1PYWD 2N9KA 1SF0A 3B2FA 4HROA 4Q2JA 1GPXA 2CU3A 3BVMA 1ZE3D 5BYQA 2QILA 1T5XD 5BYRA 1J7AA 4WURA 1JW9D 2IGDA 2ICIA 2IGHA 3IAS1 1KTKA 1D5XC 3R2IA 1QOGA 1SSNA 1VLBA 5EE0A 2WNMA 4YTPB 1F2RC 1NEKB 2D5GA 4RH6A 4YSYB 2WXIA 2LMCA 2ZW1A 2ONQA 4MT5A 2JZPA 1WXQA 5EE1A 3TEYA 3VQIA 3MC0B 1VZ6A 5EE3A 2PKOA 1JWSD 3T3NA 1UWMA 2INPE 4NJCA 2ON8A 1P7EA 4TQ0A 1TKEA 1SB3C 4KGSA 1QKZA 2INNE 2V3NA 3BVGA 3E9SA 1ZPSA 1E10A 4LLGM 1WGKA 1MPEA 3LYYA 3P4QB 3P1MA 1C78A 4IDIA 5G5HA 1T3QA 5D3DA 1AW7A 3SFEB 3VRAB 4L1BA 2E3TA 1FXIA 1VZ8A 1OQQA 2MJDA 2PTLA 3VR8B 1XLQA 3AE8B 2KWDA 1PFDA 1YN4A 4OW0A 2H88B 2W55A 2OHFA 4HEA1 2LGIA 1Q10A 4B0MA 2M0AA 2W3SA 4C7ZA 3H8HA 3KLSX 2GI9A 2CJNA 2KN4A 4DXGA 1ZXHA 3LB8C 3AEAB 3AE2B 3I57A 1FRRA 1RM6C 1ZP0B 2N7JA 2WXHA 2XN9C 2Y3AA 4LK0M 1XO3A 1MHHE 2SEBD 2KMMA 1L4DB 4TSSA 1VR9A 1N62A 4JPSA 5C3JB 5BYSA 4O1NA 1V97A 3U7ZA 1ROEA 2BS4B 3AEBB 2GB1A 5E6JA 2WXGA 4C7YA 1TJEA 2E6XA 1R7SA 1IGDA 3NRZA 3EUB2 4WIPA 4XDDA 3CIRB 2W3RA 1JMLA 1JQ4A 3RFZB 3AECB 3MJ5A 2JSVX 4YSXB 2LEKA 2BB5A 2BB6A 1XXGA 5MPOA 1IBXB 3P63A 1OFFA 4RNAA 1K52A 3AH7A 3KWLA 4KGTA 3GS2A 1NI3A 3MFGA 4H2AA 1HEZE 2V0GA 2PIAA 1QLBB 5EE9A 3AE9B 2LUMA 2MJEA 1C4AA 1KLUD 1ZUD2 3R8BA 3W1SA 5GXGB 4ZHOA 2PVOD 3HUIA 5AUIA 2WXFA 2WXMA 1K50A 1YQ3B 1NENB 1PUTA 5BMGA 1FM0D 1V1OA 2DBYA 4RGTA 1XLPA 3TSSA 2QMTA 5LNK1 1CZPA 1D5MC 1TS4A 1A70A 1KFYB 3PZ8A 3WCQA 3U52E 1YMHE 4KKJA 1SIJA 1NYQA 1TKYA 3Q8EA 2IPKD 3ZJVA 1UNSA 2WU2B 4AS1A 4IKGA 2WDVB 1FD6A 1SJED 3LXFA 1HA5A 3OWEB 3AE6B 4EE2A 1WRIA 1UWXA 2W54A 2Y5CA 2G1EA 1FCCC 3HRDD 4USAA 1C79A 1XLOA 4REZA 1TS5A 3U2SC 4A55A 1FFVA 3VRBB 1N5WA 1SEBD 1EM7A 4YT0B 3U4EG 2WLBA 3B9JA 1EWYC 1QQRA 1T6BX 2PLPA 2WQYB 1TKGA 1F77A 3ZQ4A 1QOBA 2ACZB 1DOXA 4RF0A 2K3UA 5HG2A 3Q8FA 1E9MA 1JROA 4LTUA 4C56C 1ACCA 3BYTB 1XLNA 3NVYA 2PVGC 1L4ZB 1I4GA 2JQRB 1VZ7A 1BXTA 1YQ4B 3BK2A 1GB4A 2GRIA 1TZOA 3AE3B 4TQ1A 1K51A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3FIL B;  5JXV A;  2LHE A;  1MHH E;  2LHD A;  3V3X A;  4OZA A;  2RPV A;  1HZ6 A;  1F2R I;  1KH0 A;  1YNT E;  2NMQ A;  2ZW0 A;  2J52 A;  3UI3 A;  2GB1 A;  1IBX A;  1XCQ L;  1IGD A;  4GLS C;  2I38 A;  5HHD G;  1JML A;  2I2Y A;  2JSV X;  1XCT L;  1GB1 A;  4HJG E;  1IBX B;  2RMM A;  1K52 A;  1IGC A;  1PGB A;  1HZ5 A;  4KGT A;  1HEZ E;  1FCL A;  2LUM A;  5HFY A;  1P7F A;  1D4B A;  2IGG A;  2QSD A;  2KQ4 X;  2N9K A;  1K50 A;  4OZC A;  5BMG A;  4D2K A;  2PW9 A;  1MVK A;  1K53 A;  2QMT A;  2EEL A;  4OZB A;  4WH4 A;  2KDM A;  2IGD A;  2IGH A;  1YMH E;  1MI0 A;  3GB1 A;  2J53 A;  1F2R C;  4IKG A;  5BMI A;  2ZW1 A;  2ONQ A;  1FD6 A;  2JZP A;  1UWX A;  2KAC A;  1XF5 L;  2ON8 A;  1P7E A;  3MP9 A;  5HI1 A;  5BMH A;  1FCC C;  4KGS A;  4MAC A;  1QKZ A;  1PGX A;  1PGA A;  2OED A;  2K0P A;  1EM7 A;  1MPE A;  2PLP A;  2JWU A;  2PTL A;  5HG2 A;  2KWD A;  2N9L A;  2JXT A;  3FIL A;  2LGI A;  1C9F A;  4HKZ E;  1Q10 A;  4KGR A;  4IOI E;  1GB4 A;  2GI9 A;  2KN4 A;  1MHX A;  2JU6 X;  1ZXH A;  2N7J A;  1K51 A; 
#chains in the Genus database with same CATH topology
 4W9J A;  3TJP A;  2LFI A;  3ALB A;  3OJ4 B;  1I42 A;  1JAL A;  4US9 A;  1YJI A;  2MEK A;  2JRH A;  5GMV A;  2R61 A;  4ZRQ A;  2EMT A;  3VUW A;  3VHT C;  2YEP F;  3SEB A;  1EU4 A;  3PLU A;  1E7V A;  2NBV B;  4ZDV A;  2K8C A;  4RGN A;  1E5W A;  2YVC A;  1U4A A;  5TSS A;  2GBK A;  1V5T A;  4D2K A;  3N30 A;  2KX0 A;  3NVW A;  1WH3 A;  2EEL A;  4CQN A;  5TR5 A;  3ZKJ C;  3GB1 A;  2J53 A;  3PTF C;  1ZDV A;  2WDR B;  5BMI A;  1V1P A;  2BVC A;  4N6E B;  2CHX A;  2X8X X;  4JL9 A;  5E6O A;  3BZD B;  1WYG A;  3QAR A;  2WDQ B;  1WI0 A;  4KKI A;  4KVG B;  3RUL A;  1PGA A;  2OED A;  5G55 A;  2XNA C;  3T8M A;  1WXV A;  3NY5 A;  3Q8B A;  1CMX B;  4JE3 B;  3JYU A;  4ZHP A;  1N60 A;  3TIX A;  5JHA A;  4I6N B;  1KLG D;  4HPM B;  3W2D A;  2IO1 B;  5J17 A;  3ZUN A;  2RDG A;  1JWM D;  2JU6 X;  5D2M B;  3BWU D;  3CMM B;  2WWZ A;  4FAD A;  2BGF A;  1N63 A;  4WWP A;  1JCK B;  1L6U A;  4HRS A;  1IP9 A;  3M3J A;  1L0X B;  2L7R A;  1L0Y B;  2MBB B;  1P9D U;  3A1Q A;  3UI3 A;  4NAW A;  3PHW B;  3VDZ A;  2NVU I;  1HXY D;  2I38 A;  3AM9 A;  2Z59 B;  3N1Y C;  2IJ0 A;  3A9J B;  2AQ2 B;  4IM2 A;  3PVL A;  1UF0 A;  4FN2 A;  2CHW A;  4RM9 A;  2ZNV C;  3IG3 A;  4MDK E;  3DBS A;  3LJ3 A;  1L0V B;  2VH1 A;  5AUK A;  3EFU A;  2N9E B;  1XT9 B;  5AZF A;  3PO0 A;  2PPH A;  1R4N B;  3Q14 C;  4M8N A;  4OZC A;  1OEY A;  3EGR A;  4K3C A;  1J7B A;  1MVK A;  4XX5 A;  1K53 A;  2DAF A;  1UD7 A;  3KW5 B;  1UZX B;  2KDI A;  3AE5 B;  2EKI A;  2KKC A;  1WJ6 A;  1E6E B;  4KX6 B;  4YTM B;  1KRH A;  2NR2 A;  2KVR A;  4EZJ A;  1AN8 A;  2WHI A;  4RF1 A;  1XF5 L;  4ZYS A;  4KIK A;  3KVF B;  5HI1 A;  3W9C B;  2K5P A;  4ITK A;  4ACF A;  1OQR A;  1DOI A;  3L4P A;  2WX1 A;  3AEF B;  1XEE A;  4MSM B;  2JX5 A;  2G9H D;  2ZPY A;  2LVO A;  1CQV A;  3I63 C;  1DGJ A;  3BYY B;  1L5P A;  1WXM A;  4OVZ A;  1TY0 A;  4C4V A;  3DBH I;  3HHM A;  3U7D A;  2M0X A;  3ML8 A;  1PDX A;  1MHX A;  1I4X A;  1Q5W B;  1GC7 A;  2K25 A;  3P4S B;  3P4R B;  4E3C A;  4C80 A;  4DQO C;  3QA8 A;  3QIJ A;  2IY0 B;  4KDL B;  1YNT E;  4A6Q A;  4KSL C;  4L2Y A;  2NMQ A;  2M56 B;  4ZRI A;  2MP2 B;  1I4P A;  1SE9 A;  3DBL B;  3RPF C;  2DYB A;  4P16 A;  1EU3 A;  3V05 A;  1STE A;  2JZZ A;  2BBC A;  5HHD G;  2WXL A;  3I9V 1;  5FR6 A;  3TEZ A;  1V6E A;  2MSE D;  1WF9 A;  1FIQ A;  2NTT A;  3AU4 A;  4HDO A;  4TMA B;  2TSS A;  1BUI C;  2JUO A;  1ZKH A;  4WWM A;  3V6E B;  2LD9 A;  1F9J A;  1IUE A;  2QSD A;  2N9K A;  1UEL A;  3OG5 A;  3CSF A;  2CU3 A;  1ZE3 D;  2QIL A;  1T5X D;  1J7A A;  2CR5 A;  2BQQ A;  2AEH A;  1KTK A;  1D5X C;  2WNM A;  4II3 B;  4RH6 A;  2ONQ A;  2LGD A;  3TEY A;  1V49 A;  3VQI A;  1UWM A;  2QC8 A;  1PQS A;  1YD8 U;  3DHH C;  1SB3 C;  4KGS A;  2V3N A;  1S1Q B;  3BVG A;  4JIO U;  1ZPS A;  1Y8R C;  4J6I A;  3LYY A;  4ANU A;  5DPT A;  5D3D A;  1AW7 A;  3SFE B;  2E3T A;  1FXI A;  4PYZ A;  2QCZ A;  3VR8 B;  1GC6 A;  4HEA 1;  2LGI A;  3GZN B;  4B0M A;  2M0A A;  2W3S A;  4C7Z A;  3L0W B;  2WDT B;  3UIO B;  3DBR B;  3I57 A;  4LK0 M;  4A90 A;  1RM6 C;  2WXH A;  1YOV B;  1XO3 A;  1MHH E;  2SEB D;  4BKS D;  2KT7 A;  2LRU A;  4TSS A;  1VR9 A;  4JPS A;  3EHV A;  1WM3 A;  1V97 A;  1T0Y A;  1WJN A;  3U7Z A;  2BS4 B;  3MHS D;  3AEB B;  3RI7 C;  1TJE A;  1XQQ A;  4W9C A;  2PE9 A;  3CIR B;  2DAJ A;  3Q3N C;  3NS8 A;  2C9W B;  1YIW A;  3NOB A;  2CHZ A;  4YSX B;  2JF5 A;  3APF A;  1XXG A;  5MPO A;  4IUM B;  3DCG A;  4JQW C;  2NPT A;  4KGT A;  3GS2 A;  1NI3 A;  3MFG A;  4AJY B;  4BFR A;  4TUU A;  1QLB B;  4EKU A;  2MJE A;  1ZUD 2;  2FAZ A;  1WFY A;  2BKR B;  2V1Y A;  3HUI A;  4ASW C;  4NJ7 A;  1HTO A;  5BMG A;  1V1O A;  2DBY A;  3RNE C;  5LNK 1;  3X0W A;  1KFY B;  3PZ8 A;  3P2B A;  4F1S A;  3U52 E;  4KKJ A;  1SIJ A;  1WZ3 A;  3VFK A;  2QDF A;  3HIZ A;  1HA5 A;  3W1S C;  3N1Z C;  5CTR C;  5C1Z A;  1NBF C;  2G1E A;  3QC8 B;  1TZ1 A;  4A55 A;  2REX A;  4LJP B;  1EM7 A;  5IA7 A;  3MC9 A;  1EWY C;  1OQY A;  2KD0 A;  1EF1 A;  2PLP A;  4DXA B;  4A3O A;  1TKG A;  1WGR A;  1F77 A;  1ISN A;  2K3U A;  1E9M A;  1YX6 B;  2INC C;  2N1V A;  3RNB C;  1JRO A;  3PT2 B;  3QHT A;  4AP4 C;  1YQB A;  1XLN A;  3NVY A;  2N7D A;  1VZ7 A;  2KX3 A;  1K8R B;  1YQ4 B;  3BK2 A;  2GRI A;  2C7N B;  3AE3 B;  3ONS A;  1ENF A;  1EWC A;  3B2G A;  3FAH A;  2KC1 A;  1WE7 A;  2AX5 A;  2LHD A;  4LNK A;  3TUO A;  1RRB A;  1WRD B;  4P7I A;  2AYO B;  3JSV A;  4WAF A;  4CHK A;  1WGG A;  2KQ7 A;  4NNJ B;  4EFO A;  3L08 A;  3K9P B;  2LI5 A;  3KQ4 A;  4BOZ B;  5HKH A;  3CF6 E;  3RNG C;  1SJH D;  1A5R A;  2WXO A;  1C3T A;  1ET9 A;  3IT6 B;  1AWD A;  3QK0 A;  3Q2A C;  4XWW A;  2KC2 A;  3ZRF A;  2ZEQ A;  5IAA C;  2KJR A;  4US8 A;  2V4I B;  1SIF A;  3AE7 B;  2KMC A;  3B1L X;  3KH0 A;  2FNJ B;  3WAP A;  1C77 A;  2MBH A;  5CHW A;  1V86 A;  4K3B A;  3ECI A;  3GOE A;  1NYR A;  1Q0W B;  4M00 A;  1YJ1 A;  1ZDX A;  4URK A;  2VH2 A;  1FMA D;  3NUH B;  1J7C A;  1YN3 A;  4MAC A;  2BS3 B;  2YEP B;  3HM6 X;  4AQ7 A;  2MCN B;  3KWV A;  2AQ3 B;  1M4V A;  2JWU A;  3AEG B;  2L00 B;  1E7P B;  2WXK A;  3MTN B;  2RDB C;  4K7U A;  1R4M I;  2G4S A;  1E8W A;  4IM0 A;  4WWO A;  4K7S A;  3PZ7 A;  2MX2 A;  3PZD A;  2K8H A;  2GBR A;  2LVP A;  1FO4 A;  2KO3 A;  2J4X A;  4FHK A;  1FXT B;  4I6P A;  1MG4 A;  2MBO A;  1TBE A;  2W9N A;  1KH0 A;  4GGQ A;  2J52 A;  4AWJ A;  3PLV A;  2GBM A;  1E8Z A;  3AEE B;  4G11 A;  1I4Q A;  2I2Y A;  2MBQ A;  4KZ0 A;  2HD5 B;  3V60 A;  1GB1 A;  2BWF A;  3H7S A;  2BS2 B;  3SD5 A;  2OOB B;  2KAJ A;  2OJW A;  4EEW A;  4MGY E;  5G5G A;  2L83 A;  1D5Z C;  1PGB A;  2IY1 B;  2JYE A;  2ZPN A;  5I4D A;  3DVN V;  1IYF A;  2IDY A;  3I3T B;  1FXA A;  2IO3 B;  2FCM A;  4LNF A;  3IAM 1;  1ESF A;  4BKG A;  4LNO A;  3Q69 A;  4BKT A;  4GMV A;  2ZVN A;  2C7M B;  3QWZ B;  4M0W A;  4DHZ B;  1RWS A;  4CYE A;  1UUP A;  2L1A A;  4FA6 A;  3UIN B;  2HJ8 A;  4WJN A;  1EF5 A;  5BMH A;  3ZJU A;  3ML9 A;  2DZJ A;  2K0P A;  3B08 A;  1V1P B;  3QX1 A;  5LXH A;  3N3K B;  1WMH A;  4MGI E;  1CK1 A;  2FE8 A;  2L8J A;  2JXT A;  4KZC A;  2D07 B;  2V4L A;  5LXI B;  1L6V A;  4HKZ E;  2WXQ A;  1DYQ A;  4OHJ A;  2J0K A;  2HTM E;  3RD2 A;  4FXC A;  3TCA A;  2LGX A;  3U8Z A;  3OJ3 A;  3R7Q A;  4C00 A;  1QOF A;  1I4H A;  5JXV A;  3BIN A;  3V62 A;  4YXD B;  4JWU C;  4XWT A;  4R3D A;  3WAM A;  4ANX A;  3NVV A;  2RPV A;  4BBN F;  1FRD A;  1NDD A;  1SE3 A;  1QIL A;  3PS6 A;  1IBX A;  4OVU A;  3DWM A;  1N5X A;  1WX8 A;  1QZE A;  2FUG 1;  2DZM A;  3A1Q B;  3NZU A;  4BZA A;  4NAW B;  4MGK E;  1FNU A;  4HKQ A;  3A9K A;  5H8Y E;  1QF6 A;  1HZ5 A;  1WGD A;  3ZXV A;  5FKA C;  2WXJ A;  1JRP A;  4FBJ B;  2KFJ A;  1HE8 A;  1ZGU B;  3ZNZ B;  5CX3 A;  2BPS A;  4IM3 A;  2C60 A;  3BVM A;  4JGH B;  3PRP B;  2IGD A;  4HPP A;  2IGH A;  2ZVO A;  4FHJ A;  5EE0 A;  1F2R C;  4OVV A;  2WXI A;  2ZW1 A;  2RD0 A;  4FJZ A;  1WE6 A;  2JZP A;  2HTH A;  1VZ6 A;  3IBE A;  5EE3 A;  2PKO A;  1JWS D;  3D32 A;  1P7E A;  1TKE A;  1V5O A;  2LAS A;  1RLF A;  2INN E;  5D6J B;  1E10 A;  2KVZ A;  2DEN B;  3K9O B;  1WGK A;  3O65 B;  2Y5B B;  3UGB B;  3VRA B;  4KIK B;  4G3X B;  2KWD A;  4XZ4 A;  1YN4 A;  4OW0 A;  2H88 B;  2W55 A;  1D3Z A;  4W9G A;  3KLS X;  2N9P C;  4W9L A;  3OLM D;  4MM3 A;  4ANV A;  1ZXH A;  3AE2 B;  4HJK A;  3ZVV A;  2DZI A;  4HWI B;  4WJO A;  2FCN A;  5AZG A;  4C4V B;  4F7Z A;  1R4N I;  2KMM A;  1L4D B;  4RM8 A;  2KDB A;  4YL8 A;  3SDL C;  2JT4 B;  3IHP C;  2KLG A;  5E6J A;  4C7Y A;  1T0Q C;  2V9H A;  4FJY A;  3EUB 2;  4WIP A;  2KFK A;  3A4S C;  4XDD A;  3RFZ B;  3A4R A;  3S2A A;  2LGS A;  1L2N A;  4NPN A;  4A3P A;  1H4R A;  3DVG X;  5DCN A;  3TBL D;  1T0S C;  1C4A A;  4W9E A;  3WIM A;  4X57 B;  2WXM A;  1NEN B;  1FM0 D;  3N1X C;  1XLP A;  3UQB A;  1IPG A;  1CZP A;  3Q6B A;  1TS4 A;  2D3G A;  3QCA A;  1WJ4 A;  3DHG C;  1L7Y A;  1NYQ A;  1UNS A;  1F52 A;  1WRI A;  2NBW B;  1UWX A;  2J0M A;  3ZXR A;  2W54 A;  3Q3M C;  3LDZ E;  2FCS A;  1FCC C;  1C79 A;  3U2S C;  1TS5 A;  3IFW B;  2KN5 A;  2RPQ A;  3H7P A;  1WX9 A;  3U4E G;  4W9D A;  1GUA B;  3ZQ4 A;  1EUV B;  2ACZ B;  5HG2 A;  3HM3 A;  2JZ3 B;  3KUC B;  4C56 C;  5J2R A;  1GJZ A;  2JQR B;  3GE3 C;  3APD A;  4MJS A;  1GB4 A;  2DX5 B;  5IOI A;  4ZRP A;  3R66 C;  4PK1 A;  1WX7 A;  2LZ6 A;  3Q8A A;  4ZRK A;  4WQO B;  1G6J A;  3ABV B;  3NS1 A;  5CHV C;  2HDE A;  4DWF A;  2L76 A;  3ZTD A;  2A5U A;  2K9X A;  4K7W A;  1GAQ B;  4YTN B;  1LGR A;  2N7E A;  3TL5 A;  3SFD B;  4IWQ A;  2BTE A;  3RMK C;  4N9F 4;  2KTR A;  3VTW A;  2DZK A;  5L83 A;  1WGH A;  2D10 A;  4ZOH C;  4ICU A;  5FK9 C;  2VZK B;  1P7F A;  3AED B;  2GOW A;  3APC A;  2RR9 A;  1OGW A;  2LJ5 A;  2O6V A;  4ZYN A;  1N6Z A;  3DPD A;  1GOZ A;  2NPT B;  2J42 A;  3C8Y A;  2DHZ A;  4E71 A;  3PSE B;  2N0S B;  4WH4 A;  1I7H A;  2KDM A;  3GZN I;  3GP7 A;  2MWS B;  3URY A;  2ZZP B;  2UWQ A;  2VZK D;  2DLB A;  1B1Z A;  2GBN A;  2XK5 A;  3AV8 A;  3FC4 A;  3AMZ A;  3DBR I;  3MHZ A;  4MH0 E;  3H9D A;  3ZNH B;  2CJO A;  1SGH A;  1SE2 A;  4WWN A;  2D2Q A;  1P0R A;  4LNI A;  2MRP A;  3Q8C A;  2O2V A;  2MBE A;  2UYZ B;  3PRE A;  4B0E A;  1JWB D;  3UF8 A;  4AUQ C;  5KHO A;  2ASQ A;  3AU5 A;  1TS3 A;  5IP4 D;  4S17 A;  1AYF A;  3FIL A;  4PS3 A;  1RFK A;  1SBB B;  1WR6 E;  2OJR A;  3ZNI D;  2WS3 B;  1FNV A;  2FID A;  3BVZ A;  3W1Y A;  3Q3J A;  3ENE A;  4M02 A;  3PRZ A;  2PEA A;  4P6V F;  3NZ3 A;  2DWQ A;  2JY6 A;  2IND C;  3SR6 A;  3ZRC A;  4WQM A;  4F8C B;  1KLV A;  2WGS A;  4RFB A;  3TEW A;  3DWG C;  3H6N A;  2W82 A;  4A8X C;  1XCQ L;  4PT5 A;  3N9Y C;  2IBI B;  1UBQ A;  4YSZ B;  3RYT A;  2FBW B;  2V3P A;  1I35 A;  4KSK C;  3JSV B;  2L52 A;  4BVU C;  4GB9 A;  4B9K A;  4JWS C;  4RGM A;  2SAK A;  2D3C A;  5BO4 B;  1QT9 A;  1FCL A;  2LJI A;  4XDC A;  1JWU D;  4GDK B;  4GOC A;  1F1H A;  1ET6 A;  3J9C A;  5IO9 A;  2R2O A;  1TTN A;  3AE1 B;  4ARI A;  1VJK A;  1KM7 A;  1V8C A;  3AB5 A;  3OAW A;  3RUI B;  1TS2 A;  3BK1 A;  4PS8 A;  2DYO A;  4GDK A;  1WY8 A;  1MI0 A;  1FFU A;  3ETR A;  4BBN C;  2WP9 B;  2WXP A;  4YWG G;  2JPH A;  5EDS A;  2XBB C;  3QAQ A;  1BML C;  5DPS A;  2KAC A;  2KQS A;  3MP9 A;  1ZOY B;  2BW2 A;  1N61 A;  1Z5S B;  4W9K A;  1T0R C;  1AAR A;  4LNN A;  2HJ1 A;  1FEH A;  3VR9 B;  2AL6 A;  4DXF A;  4M8M A;  1RFA A;  4XE0 A;  3VH4 B;  2M17 A;  2N1W A;  4AOF A;  2I1K A;  2NS5 A;  2ZCC A;  4N58 A;  3ZO5 B;  1CJE A;  2LHE A;  2HE7 A;  3C19 A;  3RNA C;  2WXN A;  4L23 A;  1HZ6 A;  3VUX A;  3BII D;  2CS4 A;  3W5U B;  2QIE B;  1YJJ A;  2FCQ A;  4E74 A;  5H92 C;  2IYD B;  3DHI C;  3KYD D;  1QOA A;  1VD2 A;  4LDT B;  4FJV B;  5JH5 C;  2BYT A;  3N32 A;  4GU2 A;  4IC7 B;  1WWT A;  2RDH A;  1F0Z A;  3ZNG C;  2QJL A;  3EEC A;  2KQ4 X;  4LDT D;  4HRO A;  3B2F A;  3VAW A;  4Q2J A;  5BYQ A;  2J0J A;  4WUR A;  4XYC A;  3IAS 1;  1SSN A;  4GIV A;  4GN1 A;  4YTP B;  4YSY B;  2LMC A;  4TV3 A;  2IO0 B;  4MT5 A;  4S0R A;  3C0R B;  1WXQ A;  5DPW A;  3UQA A;  3VTU A;  3T3N A;  2INP E;  2MQJ A;  4NJC A;  5AZH A;  4HXD A;  4TQ0 A;  2JXX A;  2C7H A;  1H8C A;  4M0W B;  2LRW A;  3E9S A;  1E8Y A;  2IZV B;  3BY4 B;  2JWZ A;  1MPE A;  3P4Q B;  3DQV A;  1C78 A;  3P1M A;  2PTL A;  1XLQ A;  2BWE S;  2KYW A;  1PFD A;  2L0T A;  4AJW A;  1Q10 A;  3TMP B;  1OTR B;  2V3S A;  4ANW A;  5E6P A;  2KN4 A;  2RSU A;  4RMA A;  4DXG A;  1WMH B;  2XEW A;  1FRR A;  2N7J A;  2Y3A A;  3L17 A;  2YLM A;  4XC2 A;  2M1M A;  2KMA A;  4BAX A;  3JW0 X;  3RN9 C;  2GB1 A;  2WXG A;  2E6X A;  1R7S A;  4JLC A;  1IGD A;  2D3A A;  4TKN A;  1J19 A;  3H1U A;  2W3R A;  1JML A;  4WJP A;  4B6W A;  4W9H A;  1WGY A;  1Z2M A;  2LEK A;  2BB5 A;  1IBX B;  1GNU A;  3P63 A;  1OFF A;  2QHO A;  4RNA A;  3KWL A;  2BYF A;  5KHQ A;  1E90 A;  4H2A A;  3MJW A;  2PIA A;  1WXA A;  2LUM A;  4MEL A;  1KLU D;  2BYE A;  2G45 B;  1VCB A;  5AUI A;  2WXF A;  1K50 A;  1YQ3 B;  2WYQ A;  3A9K B;  3RNC C;  4G50 A;  2D11 A;  2D3B A;  3L13 A;  4ZRJ A;  4WAA A;  3HK0 A;  3IVF A;  3WCQ A;  4DHJ B;  4QAY A;  3Q8E A;  2IPK D;  2WU2 B;  4AS1 A;  2B3A A;  1TIF A;  4EUT A;  1WR1 A;  2WDV B;  1SJE D;  3OWE B;  1E8X A;  2JVC A;  4HCN B;  4I6L B;  2KAN A;  2BF8 B;  3HRD D;  4USA A;  4REZ A;  3AUL A;  2G3Q B;  3V6C B;  3VRB B;  3I5J C;  3L10 B;  4DHJ D;  1V80 A;  3L54 A;  4YT0 B;  3NJT A;  3B9J A;  1QQR A;  1T6B X;  2K8B A;  3PV1 A;  2N9X A;  2JRI B;  4RF0 A;  3Q8F A;  2PE6 B;  3T9L A;  4PYU A;  3BYT B;  1L4Z B;  1HTQ A;  1BXT A;  2MA9 B;  3WAO A;  5G2N A;  1P1A A;  1HQR D;  3V61 A;  2A4Z A;  3SU8 X;  2KHW B;  5CHF A;  3HVZ A;  5D94 A;  3R7R A;  3A9J A;  4IG7 B;  2EKE C;  2NBU A;  4MM3 B;  4XGA B;  2BKF A;  3TEX A;  1TT5 B;  1B9R A;  1OEY J;  2JYT A;  1J0G A;  4G0N B;  4GLS C;  2LGY A;  2KWC A;  3ZLZ A;  3EA6 A;  1WYW B;  2KK8 A;  1WXS A;  1JRU A;  2QEJ C;  2FIF A;  3DBH B;  1C4P A;  2PJH A;  2RMM A;  1RYJ A;  1E7U A;  2C5L C;  2AWT A;  2KFK B;  4NAM A;  2BYV E;  2H89 B;  1S3S G;  3M95 A;  2MH7 A;  2L3Z A;  2LXC A;  2L32 A;  1EO6 A;  5AEK B;  2DYM A;  4OZB A;  2VRR B;  3W5V B;  5JHB A;  1YN5 A;  3IT4 B;  2M4N A;  5FR3 A;  3KUZ A;  1JWA D;  2UU7 A;  3N20 C;  3R2T A;  2KJ6 A;  3MC8 A;  3RT3 B;  3AN1 A;  1WSP A;  3PPA A;  1PGX A;  1E0Z A;  4DBG A;  1UBI A;  2MJ3 A;  2EMS A;  3NG0 A;  3AI5 A;  4HPL B;  2K39 A;  3ZTC A;  1LFD A;  4DDI D;  4M01 A;  3EFC A;  4RCO A;  4RGO S;  3U30 A;  2N9L A;  2GLS A;  3P42 A;  4ARC A;  1TY2 A;  3H7P B;  2LWP A;  5IN7 A;  1D6E C;  2ZNV B;  2X38 A;  4FLH A;  3AXC A;  3DVN U;  2MP2 A;  1C9F A;  3DBL I;  4NQK E;  3KYC D;  3V3X A;  2CU1 A;  4OZA A;  4P1B C;  4II2 B;  1ZXI A;  4UDU C;  3ZJT A;  4MJS B;  1F2R I;  1MJD A;  1V9J A;  5D7G A;  2ZW0 A;  1V81 A;  4W9I A;  1DOY A;  2WU5 B;  1GG3 A;  3QQ8 B;  2NTS A;  2Q5W D;  3B0A A;  1LO5 D;  4HCP B;  4LJO B;  2PMV A;  3NVZ A;  3ZGZ A;  2Y5P A;  1XCT L;  3ZYY X;  5JZE B;  5L95 C;  1IGC A;  2MLB A;  3FKY A;  4GDL B;  3A33 B;  2IGG A;  5C2T B;  2B76 B;  5DPR A;  3O13 A;  5LLI A;  1UGJ A;  2KTR B;  2PW9 A;  4KDI C;  5T8I A;  1I4R A;  1KJT A;  2KXJ A;  3R3M A;  1VDV A;  4B95 A;  4GDL A;  3VVW B;  4IWO A;  4N59 A;  1NI2 A;  4A9A A;  2BT6 A;  3P4P B;  1WM2 A;  3DVG Y;  2O6V B;  3Q3O C;  1SXT A;  3E56 A;  1UGM A;  3NZS A;  4MSQ B;  3VXW A;  4BOS C;  4P1C C;  3PRM B;  5D3I B;  4BKS A;  2CKH B;  2XK5 B;  2L0F A;  2KWV B;  2MHJ A;  1C1Y B;  2LVQ A;  2KDF B;  2K1F A;  1FNW A;  2O6V D;  5E6N A;  4DK5 A;  2MW5 A;  3IXS A;  2N4F A;  2O2V B;  4JX1 C;  2KOX A;  3AE4 B;  3EC8 A;  1WJU A;  1NVI D;  1TYG B;  2GMI C;  4KGR A;  2AQ1 B;  2L05 A;  1C76 A;  4IOI E;  1KF6 B;  3FIL B;  3ZW3 A;  4J3O D;  2K22 A;  1C4C A;  2WX0 A;  1ZW7 A;  1LM8 B;  4K81 A;  3VUY A;  3RZW C;  3VTV A;  4MH8 A;  1P98 A;  3WAN A;  2M19 A;  4HLE A;  1VRA B;  3HVD A;  3T3O A;  4W9F A;  3CST A;  2DNF A;  1SE4 A;  2RGF A;  3UIP B;  1KOT A;  4HJG E;  4NZL B;  3M62 B;  2Z0D B;  3X23 A;  2Z8L A;  4IWP A;  4NJ6 A;  4A20 A;  4HDQ A;  3CWI A;  4NY0 A;  1Y56 A;  2WXR A;  5HFY A;  1D4B A;  4HK2 A;  2KWU B;  1LXD A;  1PYW D;  1SF0 A;  3RNF C;  2KZR A;  1GPX A;  3Q3F A;  5BYR A;  1P3Q U;  4MGZ E;  1JW9 D;  2ICI A;  3R2I A;  1QOG A;  1VLB A;  2ZJD A;  1NEK B;  2D5G A;  5C23 A;  2K6Q A;  3PHX B;  3VH3 B;  5EE1 A;  3MC0 B;  2KJH B;  2ON8 A;  3DOW A;  1QKZ A;  1Q1O A;  4NQL B;  4LLG M;  5J18 A;  3L16 A;  4IDI A;  2IO2 B;  3SHQ A;  5G5H A;  1T3Q A;  2KLC A;  4L1B A;  1VZ8 A;  1OQQ A;  3JVZ X;  2LUE A;  2MJD A;  3AE8 B;  2OHF A;  3DDC B;  4DDG D;  3WA0 A;  1WZ0 A;  3H8H A;  4PS7 A;  2GI9 A;  2I1J A;  4EZK A;  1X1M A;  2CJN A;  3GE8 C;  3LB8 C;  3AEA B;  4EZL A;  1ZP0 B;  2XN9 C;  3ZIM A;  1N62 A;  2NCN A;  5C3J B;  2KDE B;  4O1N A;  5BYS A;  1ROE A;  4MEM A;  4LCD E;  3M63 B;  2KNB A;  4DHZ E;  4FUL A;  3NRZ A;  2FUH B;  1V2Y A;  1BT0 A;  1M94 A;  1JQ4 A;  1YX5 B;  3AEC B;  4HVB A;  3MJ5 A;  2JSV X;  4GXB A;  2BB6 A;  1TGZ B;  1R4M B;  1K52 A;  3AH7 A;  2ZCB A;  4EOY A;  1HEZ E;  2V0G A;  2J7Q B;  3AE9 B;  5EE9 A;  3R8B A;  3W1S A;  5GXG B;  4ZHO A;  2PVO D;  2M8S A;  4WJQ A;  1WIA A;  1PUT A;  4RGT A;  1MFW A;  3TSS A;  2QMT A;  1D5M C;  1UH6 A;  1A70 A;  3NHE B;  2KTF A;  1MG8 A;  1YMH E;  1TKY A;  3ZJV A;  2GBJ A;  4IKG A;  1J8C A;  1FD6 A;  3LXF A;  3AE6 B;  4EE2 A;  2Z0E B;  1RAX A;  2R2Q A;  2Y5C A;  4ICV A;  3WAL A;  5IKC M;  1XLO A;  3QJZ A;  1FFV A;  1N5W A;  1SEB D;  4CO7 A;  2LXA A;  1LQB A;  3ZDT A;  2WLB A;  2G4D B;  2WQY B;  1QOB A;  1DOX A;  1XD3 B;  4GSW A;  4KV2 A;  4LTU A;  3KUD B;  1ACC A;  3RCZ A;  2PVG C;  1I4G A;  4K1R B;  3RZF A;  2AL3 A;  3PGE A;  1FPY A;  2K6D B;  1TZO A;  3ZDM C;  4IW0 A;  4TQ1 A;  1K51 A; 
#chains in the Genus database with same CATH homology
 1ENF A;  1EWC A;  1HQR D;  3B2G A;  3FAH A;  2AX5 A;  2LHD A;  2LFI A;  3HVZ A;  3TUO A;  3Q8A A;  3ABV B;  1JAL A;  3NS1 A;  4MM3 B;  4US9 A;  2HDE A;  1YJI A;  2MEK A;  3TEX A;  1B9R A;  4WAF A;  2JYT A;  2K9X A;  4GLS C;  1GAQ B;  2R61 A;  4YTN B;  3SFD B;  4ZRQ A;  2BTE A;  3KQ4 A;  3EA6 A;  2QEJ C;  1SJH D;  1C4P A;  2WXO A;  1ET9 A;  3IT6 B;  1AWD A;  2YEP F;  3SEB A;  2RMM A;  1EU4 A;  1RYJ A;  4XWW A;  4NAM A;  4RGN A;  4ZOH C;  5FK9 C;  2H89 B;  2VZK B;  1P7F A;  3AED B;  4US8 A;  2V4I B;  5TSS A;  2MH7 A;  3AE7 B;  4D2K A;  1GOZ A;  3NVW A;  2L32 A;  2J42 A;  3C8Y A;  2EEL A;  1C77 A;  2DYM A;  2N0S B;  4OZB A;  4CQN A;  4WH4 A;  1I7H A;  2KDM A;  3GP7 A;  3URY A;  3W5V B;  1NYR A;  3GB1 A;  1YN5 A;  2J53 A;  3IT4 B;  5FR3 A;  2VZK D;  1ZDV A;  2DLB A;  2WDR B;  1ZDX A;  1B1Z A;  3AV8 A;  3FC4 A;  3AMZ A;  5BMI A;  3MHZ A;  1JWA D;  1FMA D;  3R2T A;  2CJO A;  1V1P A;  3NUH B;  1SE2 A;  1WSP A;  3AN1 A;  4N6E B;  1J7C A;  3BZD B;  1YN3 A;  1WYG A;  4MAC A;  2BS3 B;  2WDQ B;  3Q8C A;  1PGX A;  2YEP B;  1E0Z A;  4KKI A;  4ZRP A;  1PGA A;  2OED A;  4B0E A;  2MJ3 A;  4AQ7 A;  1JWB D;  2XNA C;  3KWV A;  3Q8B A;  4JE3 B;  2AQ3 B;  1M4V A;  2JWU A;  3AEG B;  1TS3 A;  4ZHP A;  1AYF A;  4RCO A;  1N60 A;  1E7P B;  4RGO S;  2N9L A;  3FIL A;  1KLG D;  2WXK A;  3P42 A;  3W2D A;  4ARC A;  1TY2 A;  1RFK A;  1SBB B;  2WS3 B;  1D6E C;  1FNV A;  2X38 A;  3BVZ A;  2RDG A;  1JWM D;  2JU6 X;  3BWU D;  3PZ7 A;  1C9F A;  4P6V F;  3NZ3 A;  2DWQ A;  1FO4 A;  1N63 A;  3V3X A;  1JCK B;  2J4X A;  4OZA A;  3SR6 A;  1L6U A;  4HRS A;  1ZXI A;  4WQM A;  4UDU C;  1L0X B;  3ZJT A;  1F2R I;  1KH0 A;  1L0Y B;  4RFB A;  3TEW A;  5D7G A;  2ZW0 A;  2J52 A;  3DWG C;  1DOY A;  3UI3 A;  2W82 A;  4A8X C;  1XCQ L;  4PT5 A;  3N9Y C;  2WU5 B;  1HXY D;  2I38 A;  4YSZ B;  2NTS A;  3AM9 A;  2Q5W D;  2IJ0 A;  3AEE B;  1LO5 D;  1I4Q A;  2AQ2 B;  2FBW B;  2V3P A;  2PMV A;  3NVZ A;  2I2Y A;  3ZGZ A;  2Y5P A;  1XCT L;  1GB1 A;  3ZYY X;  2BS2 B;  2L52 A;  2KAJ A;  1L0V B;  5G5G A;  2L83 A;  1D5Z C;  1IGC A;  1PGB A;  4JWS C;  2JYE A;  4RGM A;  2SAK A;  1QT9 A;  5AUK A;  1FCL A;  2LJI A;  4XDC A;  4GDL B;  1JWU D;  2IGG A;  4GDK B;  5C2T B;  2B76 B;  5I4D A;  3PO0 A;  1ET6 A;  3J9C A;  2IDY A;  3O13 A;  1UGJ A;  4OZC A;  1FXA A;  2PW9 A;  3AE1 B;  3EGR A;  5T8I A;  4ARI A;  1J7B A;  1I4R A;  1MVK A;  1K53 A;  3IAM 1;  1ESF A;  1VJK A;  1VDV A;  3Q69 A;  1V8C A;  3AB5 A;  1TS2 A;  3BK1 A;  4N59 A;  2DYO A;  4A9A A;  1MI0 A;  1FFU A;  3AE5 B;  2BT6 A;  3ETR A;  2EKI A;  3P4P B;  4M0W A;  1E6E B;  4KX6 B;  4YTM B;  1SXT A;  1RWS A;  3E56 A;  1UUP A;  2WP9 B;  1KRH A;  2WXP A;  4YWG G;  2L1A A;  1AN8 A;  5D3I B;  1BML C;  2KAC A;  4RF1 A;  1XF5 L;  4ZYS A;  3MP9 A;  1ZOY B;  5HI1 A;  5BMH A;  3ZJU A;  2BW2 A;  3W9C B;  1N61 A;  2K5P A;  4ITK A;  2K0P A;  1OQR A;  1DOI A;  3L4P A;  1FNW A;  3AEF B;  1XEE A;  1V1P B;  2JX5 A;  2G9H D;  1FEH A;  3VR9 B;  3IXS A;  4DXF A;  1CQV A;  4XE0 A;  1CK1 A;  2FE8 A;  4JX1 C;  2JXT A;  1DGJ A;  3BYY B;  1L5P A;  1L6V A;  4OVZ A;  1TY0 A;  3AE4 B;  4HKZ E;  1NVI D;  2WXQ A;  1TYG B;  1DYQ A;  4KGR A;  4OHJ A;  2AQ1 B;  1C76 A;  4IOI E;  2HTM E;  4FXC A;  4N58 A;  1KF6 B;  1PDX A;  1MHX A;  1I4X A;  1CJE A;  3FIL B;  1QOF A;  1I4H A;  5JXV A;  2LHE A;  3P4S B;  3P4R B;  2WXN A;  4L23 A;  4A90 A;  4JWU C;  4J3O D;  4XWT A;  4C80 A;  4YXD B;  4R3D A;  2K22 A;  3NVV A;  2RPV A;  1HZ6 A;  4DQO C;  1C4C A;  3BII D;  3W5U B;  1YNT E;  4A6Q A;  1FRD A;  4L2Y A;  2NMQ A;  2M56 B;  2QIE B;  1YJJ A;  1SE3 A;  1I4P A;  1QIL A;  5H92 C;  1IBX A;  3RPF C;  4P16 A;  1EU3 A;  3DWM A;  3V05 A;  1STE A;  4MH8 A;  1N5X A;  2BBC A;  5HHD G;  2M19 A;  2WXL A;  3I9V 1;  1QOA A;  1VRA B;  3HVD A;  2FUG 1;  3T3O A;  3TEZ A;  1SE4 A;  1FIQ A;  2NTT A;  2BYT A;  4HJG E;  4NAW B;  4NZL B;  4TMA B;  2TSS A;  1FNU A;  2Z8L A;  1BUI C;  4HKQ A;  1WWT A;  5H8Y E;  1QF6 A;  1HZ5 A;  2RDH A;  3CWI A;  1F0Z A;  5FKA C;  4WWM A;  1Y56 A;  2WXR A;  2QJL A;  5HFY A;  1D4B A;  2WXJ A;  1JRP A;  1IUE A;  2QSD A;  2KQ4 X;  1PYW D;  2N9K A;  1SF0 A;  3B2F A;  4HRO A;  4Q2J A;  1GPX A;  2CU3 A;  3BVM A;  1ZE3 D;  5BYQ A;  2QIL A;  1T5X D;  5BYR A;  1J7A A;  4WUR A;  1JW9 D;  2IGD A;  2ICI A;  2IGH A;  3IAS 1;  1KTK A;  1D5X C;  3R2I A;  1QOG A;  1SSN A;  1VLB A;  5EE0 A;  2WNM A;  4YTP B;  1F2R C;  1NEK B;  2D5G A;  4RH6 A;  4YSY B;  2WXI A;  2LMC A;  2ZW1 A;  2ONQ A;  4MT5 A;  2JZP A;  1WXQ A;  5EE1 A;  3TEY A;  3VQI A;  3MC0 B;  1VZ6 A;  5EE3 A;  2PKO A;  1JWS D;  3T3N A;  1UWM A;  2INP E;  4NJC A;  2ON8 A;  1P7E A;  4TQ0 A;  1TKE A;  1SB3 C;  4KGS A;  1QKZ A;  2INN E;  2V3N A;  3BVG A;  3E9S A;  1ZPS A;  1E10 A;  4LLG M;  1WGK A;  1MPE A;  3LYY A;  3P4Q B;  3P1M A;  1C78 A;  4IDI A;  5G5H A;  1T3Q A;  5D3D A;  1AW7 A;  3SFE B;  3VRA B;  4L1B A;  2E3T A;  1FXI A;  1VZ8 A;  1OQQ A;  2MJD A;  2PTL A;  3VR8 B;  1XLQ A;  3AE8 B;  2KWD A;  1PFD A;  1YN4 A;  4OW0 A;  2H88 B;  2W55 A;  2OHF A;  4HEA 1;  2LGI A;  1Q10 A;  4B0M A;  2M0A A;  2W3S A;  4C7Z A;  3H8H A;  3KLS X;  2GI9 A;  2CJN A;  2KN4 A;  4DXG A;  1ZXH A;  3LB8 C;  3AEA B;  3AE2 B;  3I57 A;  1FRR A;  1RM6 C;  1ZP0 B;  2N7J A;  2WXH A;  2XN9 C;  2Y3A A;  4LK0 M;  1XO3 A;  1MHH E;  2SEB D;  2KMM A;  1L4D B;  4TSS A;  1VR9 A;  1N62 A;  4JPS A;  5C3J B;  5BYS A;  4O1N A;  1V97 A;  3U7Z A;  1ROE A;  2BS4 B;  3AEB B;  2GB1 A;  5E6J A;  2WXG A;  4C7Y A;  1TJE A;  2E6X A;  1R7S A;  1IGD A;  3NRZ A;  3EUB 2;  4WIP A;  4XDD A;  3CIR B;  2W3R A;  1JML A;  1JQ4 A;  3RFZ B;  3AEC B;  3MJ5 A;  2JSV X;  4YSX B;  2LEK A;  2BB5 A;  2BB6 A;  1XXG A;  5MPO A;  1IBX B;  3P63 A;  1OFF A;  4RNA A;  1K52 A;  3AH7 A;  3KWL A;  4KGT A;  3GS2 A;  1NI3 A;  3MFG A;  4H2A A;  1HEZ E;  2V0G A;  2PIA A;  1QLB B;  5EE9 A;  3AE9 B;  2LUM A;  2MJE A;  1C4A A;  1KLU D;  1ZUD 2;  3R8B A;  3W1S A;  5GXG B;  4ZHO A;  2PVO D;  3HUI A;  5AUI A;  2WXF A;  2WXM A;  1K50 A;  1YQ3 B;  1NEN B;  1PUT A;  5BMG A;  1FM0 D;  1V1O A;  2DBY A;  4RGT A;  1XLP A;  3TSS A;  2QMT A;  5LNK 1;  1CZP A;  1D5M C;  1TS4 A;  1A70 A;  1KFY B;  3PZ8 A;  3WCQ A;  3U52 E;  1YMH E;  4KKJ A;  1SIJ A;  1NYQ A;  1TKY A;  3Q8E A;  2IPK D;  3ZJV A;  1UNS A;  2WU2 B;  4AS1 A;  4IKG A;  2WDV B;  1FD6 A;  1SJE D;  3LXF A;  1HA5 A;  3OWE B;  3AE6 B;  4EE2 A;  1WRI A;  1UWX A;  2W54 A;  2Y5C A;  2G1E A;  1FCC C;  3HRD D;  4USA A;  1C79 A;  1XLO A;  4REZ A;  1TS5 A;  3U2S C;  4A55 A;  1FFV A;  3VRB B;  1N5W A;  1SEB D;  1EM7 A;  4YT0 B;  3U4E G;  2WLB A;  3B9J A;  1EWY C;  1QQR A;  1T6B X;  2PLP A;  2WQY B;  1TKG A;  1F77 A;  3ZQ4 A;  1QOB A;  2ACZ B;  1DOX A;  4RF0 A;  2K3U A;  5HG2 A;  3Q8F A;  1E9M A;  1JRO A;  4LTU A;  4C56 C;  1ACC A;  3BYT B;  1XLN A;  3NVY A;  2PVG C;  1L4Z B;  1I4G A;  2JQR B;  1VZ7 A;  1BXT A;  1YQ4 B;  3BK2 A;  1GB4 A;  2GRI A;  1TZO A;  3AE3 B;  4TQ1 A;  1K51 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...