1K52A

Monomeric protein l b1 domain with a k54g mutation
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
72
structure length
72
Chain Sequence
MHHHHHHAMEEVTIKANLIFANGSTQTAEFKGTFEKATSEAYAYADTLKKDNGEWTVDVADGGYTLNIKFAG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Single-site mutations induce 3D domain swapping in the B1 domain of protein L from Peptostreptococcus magnus.
pubmed doi rcsb
source organism Finegoldia magna
molecule tags Protein binding
molecule keywords Protein L
total genus 20
structure length 72
sequence length 72
chains with identical sequence B
ec nomenclature
pdb deposition date 2001-10-09
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.10 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 1k52A00
2N9LA 5BMGA 1K53A 2I2YA 1MHHE 5HG2A 1FCCC 3FILB 1GB1A 1JMLA 1MI0A 2EELA 1MVKA 3UI3A 1IBXB 1MPEA 2K0PA 4KGSA 1P7EA 2JU6X 2ZW0A 1MHXA 1QKZA 1C9FA 2RPVA 5JXVA 1Q10A 2JZPA 1YNTE 1XCTL 2N7JA 1D4BA 2QSDA 2RMMA 4OZAA 2LHDA 4D2KA 2JSVX 1KH0A 1EM7A 1IBXA 3V3XA 4WH4A 4IKGA 4GLSC 2LGIA 1PGXA 2LUMA 5BMIA 5HFYA 1ZXHA 1K51A 2OEDA 5HI1A 2GB1A 2JXTA 1P7FA 1XCQL 1XF5L 1IGCA 5HHDG 1HZ5A 2GI9A 4OZCA 4KGTA 2PLPA 3FILA 3MP9A 3GB1A 4IOIE 2JWUA 2PTLA 1GB4A 1HEZE 1F2RC 2KWDA 2I38A 1UWXA 2KN4A 1IGDA 2NMQA 2ZW1A 2LHEA 1K52A 1PGBA 1HZ6A 2KACA 2KDMA 4OZBA 4HKZE 1PGAA 5BMHA 2IGHA 4KGRA 2IGDA 2ON8A 2N9KA 2KQ4X 1F2RI 2QMTA 1K50A 2PW9A 1FCLA 1FD6A 2IGGA 2J53A 1YMHE 4MACA 4HJGE 2J52A 2ONQA
chains in the Genus database with same CATH superfamily
2RD0A 2DLBA 3SHQA 3JW0X 2BW2A 3HK0A 3N20C 2QCZA 4DXGA 2KOXA 2YEPF 1T0SC 2CU3A 1I35A 1L5PA 3HM6X 2M1MA 1RFAA 4OVZA 1FNUA 3RZFA 4ICUA 2J42A 4WWPA 4NQKE 2DWQA 2HD5B 1D3ZA 1C77A 1ISNA 4HCNB 2L7RA 2A5UA 1PUTA 1KFYB 3A33B 5E6JA 2KXJA 3PHWB 4XWTA 1GOZA 3UQBA 2Z59B 1FNVA 2WHIA 2KFKA 1YD8U 3PSEB 4ACFA 3ALBA 1CJEA 1YQBA 1WY8A 2JF5A 5EE3A 3VTUA 3Q2AC 4FBJB 2WDRB 1K51A 4WJQA 2N1WA 1P1AA 4G0NB 2MCNB 1QOFA 1TS2A 2WXJA 2O2VA 3EFUA 3FAHA 3U2SC 1J7CA 2LD9A 3KUDB 1F2RC 4RGMA 2KC1A 3E9SA 3NHEB 2D3BA 3AECB 2E3TA 1GJZA 1TS5A 3AE2B 4N6EB 4HLEA 2WDVB 3LYYA 4GDLA 1MG4A 3RMKC 2IGDA 3M62B 1J8CA 2HDEA 4AUQC 4KIKA 4GU2A 1WRIA 4C80A 1YN3A 2ONQA 2BF8B 2MHJA 3CIRB 4II2B 2MJ3A 1TY0A 2PKOA 3QA8A 5HG2A 1NI3A 4C4VB 3TEZA 3VTVA 3L13A 4P6VF 5JHBA 3H6NA 3B9JA 1A5RA 1QKZA 1VD2A 1TIFA 1Q10A 3QK0A 3NY5A 4DK5A 1FMAD 3SU8X 2JZ3B 4US9A 1VZ7A 1OQQA 4LNIA 1QLBB 1JQ4A 3R2TA 2FE8A 1F77A 4R3DA 1KH0A 2CKHB 4OVUA 2FIFA 2XNAC 5FK9C 4IKGA 3GOEA 4JQWC 4HPMB 1Q1OA 3EUB2 4MGIE 2OEDA 2JXTA 3DPDA 3C0RB 2LRUA 4KGTA 2PLPA 2FIDA 1NENB 1WGKA 3PGEA 3FKYA 4FHKA 4HVBA 3TSSA 2WXIA 5EDSA 2FNJB 1C3TA 1F9JA 4W9FA 4BFRA 3DBLB 1EUVB 3TUOA 2AL6A 5FR3A 2KMAA 3A4SC 2NS5A 1IGDA 2X38A 1IUEA 1VZ8A 4RM9A 2EKIA 4M00A 4HK2A 4WWNA 2L32A 2D5GA 2QMTA 1RYJA 3L4PA 1AWDA 2NTTA 2INCC 2Z8LA 2I1KA 1I4XA 4IW0A 2GBRA 5CHWA 2I2YA 4LNFA 2RDGA 2BS4B 1HE8A 4KSLC 4WQMA 2K8HA 2K0PA 4MJSA 1EWCA 2WYQA 1L0XB 5CX3A 4LNNA 3L08A 4HPLB 2IO2B 2ZJDA 3VUXA 3ML8A 4J6IA 4LDTD 4S0RA 2LWPA 3HHMA 1M4VA 2KLGA 2V4LA 2BKRB 3QIJA 4WWOA 2OJWA 3DVGY 4L23A 2ASQA 3WANA 1GC7A 1WIAA 1EM7A 3AU5A 3B2FA 1E5WA 2ZNVC 4B9KA 1NYQA 3RNBC 2GBJA 3QCAA 3NOBA 5HFYA 1XLOA 1TKEA 4I6PA 3I57A 1V6EA 2MBEA 4MH0E 3NS1A 3IT6B 1MFWA 1E90A 2LVOA 1E7VA 4ITKA 1E7PB 1GAQB 2IY1B 3QARA 4ARCA 5FKAC 2A4ZA 2N9EB 1PQSA 2V9HA 3L16A 4P1CC 2D07B 4C00A 2DZJA 1WXAA 5C23A 3PV1A 2CS4A 2KYWA 2N0SB 1NI2A 3RNGC 2AX5A 3IAS1 1E8XA 4URKA 4MJSB 2KACA 4DHZB 3DBLI 3AE3B 5BYSA 3OJ3A 2FCMA 2DNFA 5JZEB 2KDEB 1C1YB 4MT5A 5EE1A 5DCNA 5KHQA 2K9XA 2J53A 2JYEA 1FNWA 1YMHE 4MACA 1PYWD 1WM2A 3ZQ4A 5DPSA 2K39A 1KLUD 1PFDA 2N7DA 3DBHB 2AEHA 2LJIA 4ZRKA 1MHHE 3V05A 3LDZE 3V60A 2MBQA 3PZ8A 5IP4D 1SJED 3Q3NC 3AEDB 3QHTA 2WX0A 3TEWA 5JXVA 4JIOU 4USAA 3DWMA 2NBUA 5LXIB 1YOVB 4LJPB 3U30A 1E7UA 3PTFC 2RMMA 3KUZA 1N60A 3AEGB 4OVVA 1H4RA 5AZHA 2K3UA 1WGYA 3RNFC 4BKSD 3ZXVA 1RWSA 4PYZA 3AN1A 2NVUI 5FR6A 4IC7B 1NVID 1L0VB 2LGYA 1SE4A 1D5MC 1Z2MA 2LXAA 3IVFA 3N3KB 3MC8A 5TR5A 1I4RA 2QIEB 1BUIC 1E6EB 2KJ6A 3SEBA 2VZKB 2KFJA 3ZNID 1WXVA 1KLGD 1SF0A 3RUIB 3I9V1 2EKEC 3JYUA 3ZJVA 4IOIE 3ML9A 4EE2A 2GBMA 1HEZE 4E3CA 1ZW7A 2DZIA 2KK8A 3BVGA 1RFKA 3KYCD 3AEEB 2BB5A 2OHFA 3ZNGC 4FHJA 1I4PA 1ZDVA 4IM0A 1T0YA 1SIJA 4NQLB 5E6NA 4AP4C 2MQJA 4HKZE 1L6UA 3VH4B 3M95A 4DHJD 4XC2A 3DVGX 1UGJA 2IGGA 2RR9A 4GDKB 3A9KA 2J52A 2N9LA 4LDTB 4HEA1 2C7HA 3DHGC 3UGBB 2G4DB 2PMVA 3UIPB 4UDUC 2JYTA 1MI0A 5GXGB 3UI3A 4DXFA 5CTRC 1FM0D 1IBXB 3AM9A 3BVMA 3ZGZA 1QOBA 2JWZA 2CHXA 1YNTE 2V3NA 3ZW3A 1C4PA 3U7ZA 4BOZB 4YL8A 2KZRA 3BIID 1L7YA 1QF6A 1LGRA 3MJ5A 1T0RC 2M4NA 4RGOS 4OZAA 2D3GA 2MSED 3AULA 1HTQA 2RPQA 3ZRCA 2IO3B 2JSVX 4RCOA 2CHZA 1J0GA 4TUUA 4TSSA 4O1NA 4DXAB 1DOYA 1AARA 4HROA 2KVZA 4L2YA 4JPSA 4LNOA 3A4RA 3DWGC 2JT4B 2QEJC 3RT3B 2ZVNA 3EGRA 4AWJA 4CHKA 3RFZB 3N9YC 1TJEA 2MA9B 4FN2A 2V4IB 3DBRI 3V6CB 5CHFA 5AEKB 4IUMB 2BWES 3IXSA 2NBVB 3V6EB 2NPTB 2LFIA 3B1LX 2JZZA 3M63B 2WXKA 4DWFA 4JWSC 2YEPB 1TYGB 1ENFA 2ACZB 2KKCA 1YX6B 3TMPB 3ZO5B 3ECIA 5JHAA 1TZOA 2ICIA 2KX3A 1H8CA 2KT7A 1VCBA 4KKIA 4IDIA 2WDTB 2VH2A 1V97A 3NG0A 4BKGA 1FXIA 2N9PC 2M0AA 3PHXB 2DYBA 1TT5B 4MGZE 1C78A 4WJOA 3W2DA 2M8SA 4W9DA 1MVKA 2CJOA 3LJ3A 2BYEA 3VVWB 1MPEA 4MELA 1V86A 1JROA 4P1BC 2CR5A 2IZVB 4EZKA 1J19A 1E8YA 2V1YA 4IWPA 3P4QB 4PYUA 1UD7A 1L0YB 2KJHB 1Y8RC 1B1ZA 1QZEA 3J9CA 1SB3C 5J18A 4KDLB 5D2MB 1I4HA 4JL9A 2NPTA 3CWIA 1EF1A 1EF5A 2IY0B 3ZVVA 1WZ0A 2K6DB 3Q8AA 1FIQA 2DAJA 1TGZB 3PZ7A 3ZUNA 4BZAA 2J0KA 3WAOA 3WIMA 3DDCB 2LI5A 1P0RA 4KV2A 1VJKA 3HVZA 3SDLC 1SBBB 1HZ5A 3NJTA 2Q5WD 5JH5C 4MDKE 4C56C 1JWUD 1XD3B 3EA6A 4EKUA 2LVQA 2L83A 1WI0A 2H88B 2SAKA 2LEKA 5IN7A 5TSSA 1GC6A 2UWQA 1VRAB 4KVGB 3NUHB 2D2QA 1Q5WB 2KDMA 1N5XA 3CF6E 4WURA 1T6BX 3OJ4B 3NS8A 3CMMB 4ZRQA 3AB5A 1K50A 2PW9A 4A90A 4BOSC 2QILA 3NZ3A 1JWMD 1NEKB 2FBWB 1CQVA 4G11A 1IYFA 2GI9A 3L10B 4G3XB 3TJPA 3UQAA 4N58A 3FILB 5IOIA 3HIZA 3ETRA 4BVUC 2WXPA 3T8MA 3EC8A 5L95C 4ARIA 1S3SG 3BK2A 2INNE 2WGSA 4N9F4 2WWZA 4W9IA 1FFUA 1EU3A 3VUWA 4RH6A 2Y3AA 1UBIA 4B95A 1ET6A 3WAMA 5C1ZA 2TSSA 4DQOC 4EEWA 2DAFA 3PZDA 4FXCA 4ANUA 3VR9B 3BINA 2DZMA 1T5XD 4AOFA 1NYRA 4M0WA 4ZHOA 2X8XX 2JPHA 3I3TB 3W5UB 5AZGA 3DQVA 1ZXHA 1JW9D 3W1SC 5H8YE 1WGRA 1WGDA 4W9CA 2K25A 2LVPA 1SE9A 5BO4B 3U52E 3MP9A 4WAFA 4LJOB 2XK5A 2KLCA 1BXTA 2BKFA 2NBWB 1XO3A 3U4EG 3TEXA 3PRZA 2N4FA 2PE9A 4LTUA 5MPOA 1JALA 1WXMA 1V2YA 1YN4A 2O2VB 4GDLB 1WR1A 2EMTA 3R2IA 3X23A 4JWUC 3AEAB 3H7PA 2WNMA 4HKQA 2ON8A 1F2RI 2ZVOA 3A1QB 3Q6BA 2BT6A 1EWYC 2HTME 4HRSA 2IBIB 3A1QA 1E0ZA 1ZXIA 3B2GA 3Q3MC 2PEAA 1C76A 4HPPA 3ZYYX 3VUYA 2RSUA 3Q14C 1WMHB 1UUPA 2EELA 2M19A 1ET9A 1R4MB 4C7ZA 4RF1A 2DYOA 5AZFA 1MHXA 2MW5A 1C9FA 3DVNU 5J2RA 1VR9A 4XGAB 1UZXB 1HA5A 2UU7A 1WSPA 2Z0DB 3DHHC 1OEYA 1OGWA 1XLNA 2V0GA 1EU4A 3RI7C 1MJDA 1V81A 1V49A 1GG3A 3HRDD 3TL5A 3BWUD 2HJ8A 3L54A 4NNJB 2E6XA 4MH8A 1FEHA 3Q3OC 4GLSC 1FO4A 4GDKA 3L17A 5BMIA 4CYEA 2INPE 4ZHPA 4BBNC 1V80A 5BYRA 3HVDA 3SD5A 1SEBD 3APDA 2ZZPB 3P42A 4RMAA 3ZRFA 1RLFA 1K8RB 1MG8A 4M8MA 1T3QA 4GSWA 1P9DU 1GB4A 1PDXA 4A20A 2KWDA 4YSXB 4YXDB 5G5GA 3GP7A 2LASA 3E56A 2KWCA 2NMQA 2DX5B 2FUG1 4BKTA 1I4QA 4XWWA 4LNKA 2L52A 4A9AA 1T0QC 2ZCCA 1KTKA 1D5ZC 2R61A 4H2AA 4LK0M 3ENEA 2LGXA 2WXMA 4W9GA 1XQQA 2FCSA 5EE0A 3H9DA 2W82A 2R2OA 2FAZA 3NVVA 5LNK1 1WRDB 4A8XC 2BS3B 2JU6X 4FJVB 4IWQA 1XLPA 1EO6A 2G1EA 1X1MA 4NZLB 4ZRIA 4NJCA 2KHWB 2QSDA 3P2BA 1ZGUB 1DOIA 4M8NA 4WAAA 4DDID 2RDBC 1VDVA 2KDBA 1I7HA 4REZA 1BMLC 2WS3B 2MWSB 5EE9A 2Y5CA 3PT2B 2IDYA 3LB8C 4MM3B 3KVFB 2JUOA 3UIOB 3P63A 2K6QA 3PVLA 1F0ZA 3AE5B 1F52A 3RULA 4K81A 2AQ1B 1WGGA 1I42A 4HXDA 4EOYA 3GZNB 2KWUB 3OG5A 3KH0A 4A6QA 4ZDVA 2BBCA 2L76A 1BT0A 3T3NA 3KYDD 4LLGM 2CU1A 3VHTC 4YTPB 3IFWB 3TCAA 2IO0B 2W3SA 2ZW1A 1K52A 5G2NA 2RDHA 3AMZA 3C8YA 2M17A 1N61A 4PS7A 3KLSX 1DYQA 3QQ8B 4ZYSA 4RGTA 1AW7A 1XLQA 2EMSA 1LQBA 5LXHA 4WIPA 4C4VA 4PS8A 2QJLA 3U8ZA 4IG7B 2REXA 2L05A 3Q3FA 1WZ3A 2GBKA 2AQ3B 1VLBA 4KGSA 2WX1A 4I6LB 2GLSA 1CMXB 3PO0A 1FRDA 2KDFB 4K3CA 4KIKB 1XCTL 2DBYA 1ZUD2 3SR6A 2HTHA 2R2QA 3R7RA 2OOBB 1IPGA 1GNUA 4F1SA 1D5XC 4S17A 4CO7A 4Q2JA 2WU5B 4PK1A 2WDQB 1XXGA 3AE6B 3BZDB 1P98A 3NVWA 3OAWA 3QJZA 1TZ1A 4II3B 2B3AA 3VAWA 3AE9B 4FJZA 2MEKA 3VR8B 2JY6A 2IYDB 3CSFA 1D6EC 3PLVA 3PRPB 4OHJA 3ZTDA 4M01A 4GXBA 4BKSA 4W9LA 1SE3A 1WE6A 2O6VB 2G3QB 2PTLA 1V1OA 1WM3A 2OJRA 3FC4A 3NRZA 1ZDXA 3APFA 3LXFA 3WAPA 1WJNA 4RM8A 2K1FA 1PGAA 2L00B 3IAM1 1V9JA 2MRPA 1SJHD 5D3IB 2VZKD 1R7SA 1UWMA 4BBNF 4K1RB 3A9KB 1WGHA 3K9OB 2LMCA 4K7WA 3MTNB 4YSYB 1V5OA 4US8A 2LGSA 3PREA 4MSMB 2BYTA 3R8BA 1B9RA 2JRIB 3KW5B 4F7ZA 3O65B 4HCPB 3GZNI 3DHIC 2H89B 5I4DA 1FXTB 1GUAB 2RPVA 5G55A 4WWMA 2SEBD 4WJPA 2KC2A 3ABVB 5J17A 2C60A 2D3CA 4MGYE 5D3DA 2WXQA 4L1BA 2DYMA 2LHDA 5T8IA 3ZNZB 4IM2A 5DPRA 1RRBA 1WX7A 4ANWA 4NAWA 4XE0A 2BS2B 5D6JB 3MFGA 2J7QB 4ANXA 5G5HA 3T3OA 1OQYA 4GGQA 2Z0EB 4JE3B 4PT5A 1IGCA 3AE4B 2KMCA 2AYOB 3Q69A 3TIXA 4B0MA 1TS3A 1Y56A 4E71A 3H7SA 2BGFA 2JWUA 4GOCA 3RNCC 2KX0A 1UWXA 2KN4A 2PE6B 1UH6A 1KF6B 1V5TA 1HXYD 3K9PB 4BAXA 2D11A 2XBBC 3EHVA 2MJEA 4KGRA 1LM8B 4GN1A 2ZPNA 5AUIA 3R7QA 5H92C 4FA6A 2KTFA 3N1XC 3Q3JA 2MBHA 4YTNB 4YT0B 4XDCA 2UYZB 4C7YA 3UF8A 3HM3A 2ZPYA 5HKHA 1WFYA 4K7UA 2RGFA 1WE7A 3U7DA 1FCCC 3P4PB 4J3OD 4DDGD 3A9JB 5KHOA 1A70A 3N1YC 1P7EA 1LFDA 4M0WB 5IA7A 1YJIA 1S1QB 3S2AA 4NJ6A 1XT9B 4HDOA 1I4GA 3ZDMC 3D32A 1TBEA 3BYTB 2GRIA 2N7JA 2MJDA 2KWVB 4XZ4A 1C4CA 4W9HA 3NVYA 3DBSA 4KZCA 4D2KA 1YX5B 2XEWA 4KDIC 5IKCM 4TMAB 4W9EA 3DOWA 2DZKA 3I63C 1QILA 2DENB 2QHOA 2BVCA 5L83A 5CHVC 2KAJA 1QOGA 3MHZA 1OFFA 1STEA 2D10A 2JRHA 1IP9A 2WXLA 3Q8BA 2WXFA 2VRRB 3ZIMA 2GB1A 2J0MA 3R3MA 2KJRA 4QAYA 3T9LA 3BYYB 4W9KA 2WXRA 2LXCA 1WYWB 4KX6B 3GB1A 4JX1C 3RN9C 3RNAC 4N59A 1TTNA 2PJHA 2INDC 1ACCA 2JVCA 3Q8FA 4A3OA 3QWZB 1UELA 4ZOHC 3ZDTA 2BYFA 1WX9A 2PPHA 2VH1A 5BMHA 4RGNA 1R4MI 1TY2A 1DGJA 3Q8EA 4XYCA 2CHWA 4I6NB 2IPKD 1FRRA 1N63A 2IJ0A 2C5LC 2WLBA 4EZJA 2M56B 1JCKB 2AWTA 3NZUA 2K5PA 2BTEA 4NPNA 4P7IA 1GB1A 3VFKA 2GMIC 1C79A 2XK5B 1SXTA 2KANA 3MC0B 2LRWA 1JRPA 4JGHB 3H8HA 4PS3A 1SIFA 1WJ6A 4AQ7A 3ZNHB 1ZPSA 1V8CA 3AE8B 1OQRA 2D3AA 4NJ7A 2ZEQA 4OW0A 2KVRA 3BY4B 2WP9B 3MJWA 2KMMA 4K7SA 3IBEA 3PPAA 1PGXA 4KSKC 2LUMA 2L8JA 1AN8A 4WQOB 4NY0A 3AI5A 3JSVA 2WXNA 4W9JA 3H1UA 1OTRB 5HHDG 2YVCA 5AUKA 5IAAC 4MSQB 4XX5A 3ZXRA 4AS1A 4YWGG 5BYQA 2L0FA 3NVZA 2I38A 3OLMD 3GS2A 5GMVA 4TV3A 4NAMA 2C7NB 1VZ6A 4MM3A 2K8CA 3AEBB 2KTRA 2MBBB 2QDFA 1E10A 2GOWA 1PGBA 2HE7A 3AH7A 3RPFC 2LZ6A 2AQ2B 4KZ0A 4EFOA 1JRUA 2N9KA 4IWOA 1L6VA 1FD6A 4WJNA 2JXXA 3RNEC 3W9CB 4MEMA 2WXHA 2W9NA 2J4XA 1RAXA 4ANVA 2XN9C 5BMGA 4FJYA 1WX8A 3V62A 1WH3A 4CQNA 4XDDA 1JMLA 3O13A 2WU2B 1ZOYB 4LCDE 2N7EA 4DBGA 1SE2A 2MLBA 4A3PA 2KQSA 5D94A 2J0JA 1V1PA 2B76B 4TQ0A 2KNBA 3SFDB 4K3BA 3VRBB 1UGMA 3M3JA 1P3QU 4ZRJA 1FPYA 2L1AA 1WYGA 3VQIA 2I1JA 3TEYA 2L0TA 2O6VD 4DHZE 4B6WA 3DBRB 3HUIA 1KRHA 2KO3A 2BWFA 3B0AA 3VDZA 1YQ4B 2MH7A 3VRAB 1ROEA 2LGIA 1GPXA 1L4DB 2JX5A 3AE1B 3IHPC 5DPTA 3JVZX 1E8ZA 2BYVE 4TKNA 1XCQL 1LO5D 3Q8CA 3EFCA 4OZCA 1WWTA 3FILA 4DHJB 1WJUA 2N1VA 1WR6E 1YJ1A 3W1SA 4JLCA 4AJYB 3BVZA 3MC9A 1SSNA 3VH3B 3RZWC 1N62A 2YLMA 2LHEA 2L3ZA 5E6PA 3RCZA 1V1PB 1WMHA 2PVOD 4HDQA 2QC8A 4FULA 1J7BA 3DBHI 1LXDA 1J7AA 3URYA 1HQRD 3SFEB 4EUTA 3QAQA 1CK1A 3UINB 1K53A 4FLHA 4IM3A 4ASWC 4FADA 2KQ7A 4TQ1A 4GIVA 1FXAA 3KUCB 3X0WA 2LUEA 1NDDA 1ZP0B 3H7PB 4RFBA 3P4RB 3QC8B 4KKJA 2M0XA 5LLIA 1F1HA 4NAWB 1NBFC 1N6ZA 2HJ1A 2JZPA 2FCNA 2ZCBA 4HJKA 2W55A 2KTRB 2AL3A 1FFVA 1D4BA 3P1MA 3P4SB 4GB9A 2MX2A 1ZKHA 2WXGA 1WXSA 1E9MA 2LGDA 1UNSA 1N5WA 1L4ZB 1WJ4A 3AE7B 1DOXA 3V61A 1TS4A 1TKGA 3ONSA 1IBXA 3AV8A 2G4SA 4WH4A 3MHSD 2Y5PA 4RNAA 3KWLA 1OEYJ 2CJNA 3GE3C 2FUHB 5DPWA 4YSZB 3PLUA 4G50A 3ZJTA 4X57B 1XF5L 5E6OA 3ZLZA 4A55A 2KFKB 4YTMB 3WCQA 4EZLA 2NTSA 4ICVA 2NCNA 2C7MB 3PS6A 4RF0A 2K22A 3ZTCA 1JWBD 2MP2B 4P16A 3A9JA 4F8CB 2W54A 1QQRA 2MP2A 1HZ6A 3JSVB 3APCA 1L2NA 1TKYA 4GMVA 1FCLA 2BQQA 1YJJA 5C2TB 3PRMB 3CSTA 2KQ4X 1ZE3D 1Q0WB 2K8BA 2V3SA 2KD0A 2O6VA 1R4NI 5IO9A 1XEEA 1KM7A 1UBQA 1WF9A 1RM6C 3KQ4A 3TBLD 1AYFA 4ZRPA 2KN5A 2ZW0A 1UF0A 4HWIB 1QOAA 3QX1A 3RD2A 2N9XA 1SGHA 1C4AA 3IT4B 2W3RA 1JWAD 1M94A 3GE8C 4AJWA 1KOTA 3AEFB 2NR2A 3OWEB 1YN5A 2PVGC 3W5VB 4E74A 1KLVA 1ESFA 3BK1A 2GBNA 3V3XA 2PIAA 2LJ5A 3B08A 1R4NB 5D7GA 1U4AA 2C9WB 1QT9A 1Z5SB 2IO1B 3R66C 1JWSD 2G45B 1E8WA 1KJTA 2MBOA 2KDIA 5HI1A 1P7FA 2DHZA 3VXWA 3DVNV 2Y5BB 2WXOA 3RYTA 3N1ZC 5C3JB 1CZPA 3AU4A 3L0WB 1G6JA 3AXCA 2BPSA 1HTOA 2FCQA 4ZYNA 3IG3A 3WALA 3I5JC 3C19A 3ZKJC 1WXQA 3EECA 2G9HD 3N32A 3ZJUA 3NZSA 1YQ3B 4B0EA 4OZBA 2V3PA 2BB6A 2ZNVB 3W1YA 2IGHA 3KWVA 4MGKE 2WQYB 1YIWA 3DCGA 3WA0A 3VTWA 4M02A 3N30A 4HJGE 2JQRB
chains in the Genus database with same CATH topology
2M56B 2N9LA 2DLBA 4HEA1 1JCKB 2K5PA 2BTEA 2BW2A 2PMVA 4DXGA 5EE0A 2J52A 2W82A 2YEPF 4UDUC 1GB1A 2JYTA 2CU3A 1MI0A 1C79A 3NVVA 5LNK1 5GXGB 3UI3A 1L5PA 4DXFA 1IBXB 1FM0D 3AM9A 3BVMA 1SXTA 3MC0B 4A8XC 2BS3B 2JU6X 4OVZA 1JRPA 1FNUA 3H8HA 3ZGZA 1QOBA 1XLPA 2G1EA 2J42A 4NZLB 4AQ7A 1YNTE 2V3NA 2DWQA 1C77A 1C4PA 3U7ZA 4NJCA 1ZPSA 2QSDA 1V8CA 3BIID 3AE8B 1OQRA 1QF6A 3MJ5A 4RGOS 1DOIA 4OZAA 1PUTA 1KFYB 1VDVA 5E6JA 1I7HA 2JSVX 4OW0A 4XWTA 4RCOA 1GOZA 2WP9B 4REZA 1BMLC 2WS3B 1FNVA 5EE9A 2Y5CA 4TSSA 2KMMA 2IDYA 3LB8C 4MM3B 4O1NA 1PGXA 1DOYA 1CJEA 3P63A 4HROA 1F0ZA 2LUMA 5EE3A 4L2YA 1AN8A 4JPSA 3AE5B 2WDRB 3DWGC 1K51A 2QEJC 3EGRA 2WXNA 3RFZB 3N9YC 1TJEA 1QOFA 2V4IB 5HHDG 1TS2A 2AQ1B 5AUKA 2WXJA 3FAHA 3U2SC 3IXSA 4AS1A 4YWGG 1J7CA 5BYQA 3NVZA 4A6QA 2BBCA 1F2RC 2LFIA 4RGMA 2I38A 3T3NA 3GS2A 4LLGM 4NAMA 3E9SA 1VZ6A 2WXKA 3AEBB 3AECB 4JWSC 4YTPB 2YEPB 2E3TA 1TYGB 1E10A 1ENFA 2W3SA 2ZW1A 2ACZB 1K52A 1TS5A 3AE2B 1PGBA 4N6EB 2WDVB 3LYYA 3AH7A 3RPFC 1TZOA 2AQ2B 2RDHA 3C8YA 2ICIA 3AMZA 2IGDA 2N9KA 2HDEA 1N61A 1L6VA 3KLSX 1FD6A 4KKIA 1DYQA 3W9CB 4IDIA 4ZYSA 1WRIA 4RGTA 1AW7A 1XLQA 2WXHA 4C80A 1V97A 2J4XA 2ONQA 1YN3A 1FXIA 2M0AA 2XN9C 5BMGA 3CIRB 4WIPA 4CQNA 2MJ3A 1C78A 1TY0A 2PKOA 4XDDA 5HG2A 3W2DA 1NI3A 2QJLA 1JMLA 3O13A 2WU2B 1ZOYB 1MVKA 3TEZA 2CJOA 1SE2A 1MPEA 1JROA 2AQ3B 4P6VF 1VLBA 4KGSA 3B9JA 1V1PA 2B76B 1QKZA 3PO0A 1Q10A 4TQ0A 1FRDA 3SFDB 3P4QB 1FMAD 3VRBB 1XCTL 2DBYA 1ZUD2 4US9A 3SR6A 1L0YB 1VZ7A 1OQQA 1QLBB 2L1AA 1B1ZA 1WYGA 3VQIA 3TEYA 1D5XC 1JQ4A 3J9CA 1SB3C 4Q2JA 3R2TA 2FE8A 1F77A 4R3DA 3HUIA 2WU5B 1KH0A 1KRHA 2WDQB 1I4HA 1XXGA 3AE6B 2XNAC 5FK9C 3BZDB 4IKGA 1YQ4B 3CWIA 2MH7A 3VRAB 3NVWA 1ROEA 2LGIA 1GPXA 1L4DB 3EUB2 3Q8AA 1FIQA 3PZ7A 2JX5A 3AE1B 3AE9B 2MEKA 3VR8B 2OEDA 2JXTA 1XCQL 1LO5D 1VJKA 3HVZA 1D6EC 3Q8CA 1SBBB 1HZ5A 4OHJA 4OZCA 1WWTA 4KGTA 2PLPA 2Q5WD 3FILA 1NENB 1WGKA 4C56C 3TSSA 1JWUD 3EA6A 2WXIA 1SE3A 2L83A 2PTLA 2H88B 2SAKA 2LEKA 3TUOA 5FR3A 3W1SA 1V1OA 3BVZA 3FC4A 3NRZA 1IGDA 1ZDXA 2X38A 5TSSA 1SSNA 1IUEA 1VZ8A 1N62A 1VRAB 3LXFA 3NUHB 2LHEA 2KDMA 1N5XA 2EKIA 1PGAA 3IAM1 4WURA 1SJHD 1V1PB 1T6BX 2VZKD 5D3IB 1R7SA 1UWMA 4ZRQA 3AB5A 2L32A 2D5GA 2QMTA 1K50A 2PVOD 2PW9A 2LMCA 4YSYB 2QILA 3NZ3A 4A90A 1JWMD 1RYJA 1J7BA 1NEKB 2FBWB 3L4PA 4US8A 1CQVA 1AWDA 2NTTA 2Z8LA 1J7AA 2GI9A 1I4XA 3URYA 1HQRD 3SFEB 1CK1A 1K53A 2I2YA 2BYTA 3R8BA 4TQ1A 4N58A 2RDGA 1FXAA 2BS4B 3FILB 4WQMA 1ZP0B 1B9RA 3ETRA 4RFBA 3P4RB 4KKJA 2K0PA 2H89B 2WXPA 5I4DA 4NAWB 1EWCA 1L0XB 4ARIA 2RPVA 3BK2A 4WWMA 2INNE 2JZPA 2SEBD 3ABVB 1FFUA 5D3DA 1EU3A 2W55A 4RH6A 1FFVA 1D4BA 3P1MA 3P4SB 2WXQA 1M4VA 2Y3AA 4L1BA 2WXGA 1E9MA 1ET6A 1UNSA 2TSSA 2DYMA 4DQOC 2LHDA 1N5WA 5T8IA 1L4ZB 4FXCA 4L23A 3AE7B 3VR9B 1DOXA 1T5XD 1TS4A 1TKGA 1EM7A 1NYRA 3AV8A 1IBXA 3B2FA 4WH4A 4XE0A 2BS2B 2Y5PA 3MFGA 1NYQA 4M0WA 4ZHOA 4RNAA 3KWLA 5HFYA 1XLOA 1TKEA 2CJNA 3W5UB 3I57A 5G5HA 3T3OA 1ZXHA 1JW9D 3NS1A 3IT6B 4YSZB 5H8YE 3ZJTA 4JE3B 4PT5A 1XF5L 1IGCA 3AE4B 4A55A 4ITKA 1E7PB 1GAQB 3Q69A 4YTMB 4B0MA 4ARCA 1TS3A 1Y56A 3MP9A 5FKAC 3U52E 4WAFA 3WCQA 1BXTA 2NTSA 2JWUA 1XO3A 3U4EG 4RF0A 3TEXA 2K22A 1UWXA 2KN4A 4LTUA 5MPOA 1JWBD 1JALA 4P16A 2N0SB 1YN4A 1KF6B 2W54A 1HXYD 2AX5A 1QQRA 4GDLB 3IAS1 2KACA 1HZ6A 5BYSA 3AE3B 3R2IA 4JWUC 3AEAB 2MJEA 1TKYA 2WNMA 4KGRA 4HKQA 2ON8A 4MT5A 5EE1A 5AUIA 1F2RI 5H92C 1FCLA 2BT6A 2K9XA 1EWYC 2HTME 1YJJA 2J53A 5C2TB 4HRSA 4YTNB 2JYEA 4XDCA 1FNWA 1YMHE 4MACA 4YT0B 1E0ZA 2KQ4X 1PYWD 1ZXIA 4C7YA 3ZQ4A 1ZE3D 3B2GA 1KLUD 1PFDA 2LJIA 1MHHE 3V05A 1XEEA 1C76A 1FCCC 3P4PB 4J3OD 3ZYYX 3PZ8A 1UUPA 2EELA 2M19A 1RM6C 1A70A 1ET9A 1SJED 3KQ4A 4C7ZA 1AYFA 3AEDB 4ZRPA 4RF1A 2DYOA 1P7EA 2ZW0A 1MHXA 1YJIA 1C9FA 3TEWA 5JXVA 1QOAA 1VR9A 4USAA 1C4AA 1HA5A 3DWMA 1WSPA 1I4GA 3IT4B 2W3RA 1JWAD 3BYTB 2GRIA 2N7JA 2MJDA 3AEFB 1XLNA 2V0GA 2RMMA 1C4CA 1N60A 1EU4A 3AEGB 3OWEB 1YN5A 2PVGC 2K3UA 3NVYA 3HRDD 3W5VB 4D2KA 3BWUD 1ESFA 1RWSA 4TMAB 3BK1A 3AN1A 3V3XA 2E6XA 2PIAA 4MH8A 1QILA 1NVID 1L0VB 1FEHA 4GLSC 1SE4A 5D7GA 1FO4A 1D5MC 1QT9A 2KAJA 1QOGA 5BMIA 3MHZA 1OFFA 1STEA 1JWSD 2INPE 2WXLA 3Q8BA 4ZHPA 2WXFA 5HI1A 1I4RA 2GB1A 5BYRA 3HVDA 1P7FA 2QIEB 1BUIC 1SEBD 2WXOA 1E6EB 5C3JB 3SEBA 1CZPA 2VZKB 3P42A 3BYYB 2WXRA 1KLGD 1SF0A 3I9V1 4KX6B 3GB1A 4JX1C 3ZJVA 4IOIE 4EE2A 1T3QA 4N59A 1GB4A 1PDXA 1HEZE 2KWDA 4YSXB 4YXDB 5G5GA 3BVGA 1RFKA 3GP7A 1WXQA 3AEEB 2BB5A 3E56A 2OHFA 2G9HD 1ACCA 1I4PA 1ZDVA 2NMQA 3Q8FA 2FUG1 1SIJA 3ZJUA 1I4QA 4ZOHC 1YQ3B 4B0EA 4OZBA 1L6UA 2V3PA 2BB6A 4HKZE 4XWWA 5BMHA 4RGNA 2IGHA 2L52A 3KWVA 4A9AA 1TY2A 1DGJA 3Q8EA 2IPKD 1FRRA 1KTKA 1UGJA 1N63A 1D5ZC 2R61A 2WQYB 2IGGA 2IJ0A 4GDKB 4H2AA 4LK0M 2WXMA 4HJGE 2JQRB 2WLBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2N9L A;  5BMG A;  1K53 A;  2I2Y A;  1MHH E;  5HG2 A;  1FCC C;  3FIL B;  1GB1 A;  1JML A;  1MI0 A;  2EEL A;  1MVK A;  3UI3 A;  1IBX B;  1MPE A;  2K0P A;  4KGS A;  1P7E A;  2JU6 X;  2ZW0 A;  1MHX A;  1QKZ A;  1C9F A;  2RPV A;  5JXV A;  1Q10 A;  2JZP A;  1YNT E;  1XCT L;  2N7J A;  1D4B A;  2QSD A;  2RMM A;  4OZA A;  2LHD A;  4D2K A;  2JSV X;  1KH0 A;  1EM7 A;  1IBX A;  3V3X A;  4WH4 A;  4IKG A;  4GLS C;  2LGI A;  1PGX A;  2LUM A;  5BMI A;  5HFY A;  1ZXH A;  1K51 A;  2OED A;  5HI1 A;  2GB1 A;  2JXT A;  1P7F A;  1XCQ L;  1XF5 L;  1IGC A;  5HHD G;  1HZ5 A;  2GI9 A;  4OZC A;  4KGT A;  2PLP A;  3FIL A;  3MP9 A;  3GB1 A;  4IOI E;  2JWU A;  2PTL A;  1GB4 A;  1HEZ E;  1F2R C;  2KWD A;  2I38 A;  1UWX A;  2KN4 A;  1IGD A;  2NMQ A;  2ZW1 A;  2LHE A;  1K52 A;  1PGB A;  1HZ6 A;  2KAC A;  2KDM A;  4OZB A;  4HKZ E;  1PGA A;  5BMH A;  2IGH A;  4KGR A;  2IGD A;  2ON8 A;  2N9K A;  2KQ4 X;  1F2R I;  2QMT A;  1K50 A;  2PW9 A;  1FCL A;  1FD6 A;  2IGG A;  2J53 A;  1YMH E;  4MAC A;  4HJG E;  2J52 A;  2ONQ A; 
#chains in the Genus database with same CATH topology
 2RD0 A;  2DLB A;  3SHQ A;  3JW0 X;  2BW2 A;  3HK0 A;  3N20 C;  2QCZ A;  4DXG A;  2KOX A;  2YEP F;  1T0S C;  2CU3 A;  1I35 A;  1L5P A;  3HM6 X;  2M1M A;  1RFA A;  4OVZ A;  1FNU A;  3RZF A;  4ICU A;  2J42 A;  4WWP A;  4NQK E;  2DWQ A;  2HD5 B;  1D3Z A;  1C77 A;  1ISN A;  4HCN B;  2L7R A;  2A5U A;  1PUT A;  1KFY B;  3A33 B;  5E6J A;  2KXJ A;  3PHW B;  4XWT A;  1GOZ A;  3UQB A;  2Z59 B;  1FNV A;  2WHI A;  2KFK A;  1YD8 U;  3PSE B;  4ACF A;  3ALB A;  1CJE A;  1YQB A;  1WY8 A;  2JF5 A;  5EE3 A;  3VTU A;  3Q2A C;  4FBJ B;  2WDR B;  1K51 A;  4WJQ A;  2N1W A;  1P1A A;  4G0N B;  2MCN B;  1QOF A;  1TS2 A;  2WXJ A;  2O2V A;  3EFU A;  3FAH A;  3U2S C;  1J7C A;  2LD9 A;  3KUD B;  1F2R C;  4RGM A;  2KC1 A;  3E9S A;  3NHE B;  2D3B A;  3AEC B;  2E3T A;  1GJZ A;  1TS5 A;  3AE2 B;  4N6E B;  4HLE A;  2WDV B;  3LYY A;  4GDL A;  1MG4 A;  3RMK C;  2IGD A;  3M62 B;  1J8C A;  2HDE A;  4AUQ C;  4KIK A;  4GU2 A;  1WRI A;  4C80 A;  1YN3 A;  2ONQ A;  2BF8 B;  2MHJ A;  3CIR B;  4II2 B;  2MJ3 A;  1TY0 A;  2PKO A;  3QA8 A;  5HG2 A;  1NI3 A;  4C4V B;  3TEZ A;  3VTV A;  3L13 A;  4P6V F;  5JHB A;  3H6N A;  3B9J A;  1A5R A;  1QKZ A;  1VD2 A;  1TIF A;  1Q10 A;  3QK0 A;  3NY5 A;  4DK5 A;  1FMA D;  3SU8 X;  2JZ3 B;  4US9 A;  1VZ7 A;  1OQQ A;  4LNI A;  1QLB B;  1JQ4 A;  3R2T A;  2FE8 A;  1F77 A;  4R3D A;  1KH0 A;  2CKH B;  4OVU A;  2FIF A;  2XNA C;  5FK9 C;  4IKG A;  3GOE A;  4JQW C;  4HPM B;  1Q1O A;  3EUB 2;  4MGI E;  2OED A;  2JXT A;  3DPD A;  3C0R B;  2LRU A;  4KGT A;  2PLP A;  2FID A;  1NEN B;  1WGK A;  3PGE A;  3FKY A;  4FHK A;  4HVB A;  3TSS A;  2WXI A;  5EDS A;  2FNJ B;  1C3T A;  1F9J A;  4W9F A;  4BFR A;  3DBL B;  1EUV B;  3TUO A;  2AL6 A;  5FR3 A;  2KMA A;  3A4S C;  2NS5 A;  1IGD A;  2X38 A;  1IUE A;  1VZ8 A;  4RM9 A;  2EKI A;  4M00 A;  4HK2 A;  4WWN A;  2L32 A;  2D5G A;  2QMT A;  1RYJ A;  3L4P A;  1AWD A;  2NTT A;  2INC C;  2Z8L A;  2I1K A;  1I4X A;  4IW0 A;  2GBR A;  5CHW A;  2I2Y A;  4LNF A;  2RDG A;  2BS4 B;  1HE8 A;  4KSL C;  4WQM A;  2K8H A;  2K0P A;  4MJS A;  1EWC A;  2WYQ A;  1L0X B;  5CX3 A;  4LNN A;  3L08 A;  4HPL B;  2IO2 B;  2ZJD A;  3VUX A;  3ML8 A;  4J6I A;  4LDT D;  4S0R A;  2LWP A;  3HHM A;  1M4V A;  2KLG A;  2V4L A;  2BKR B;  3QIJ A;  4WWO A;  2OJW A;  3DVG Y;  4L23 A;  2ASQ A;  3WAN A;  1GC7 A;  1WIA A;  1EM7 A;  3AU5 A;  3B2F A;  1E5W A;  2ZNV C;  4B9K A;  1NYQ A;  3RNB C;  2GBJ A;  3QCA A;  3NOB A;  5HFY A;  1XLO A;  1TKE A;  4I6P A;  3I57 A;  1V6E A;  2MBE A;  4MH0 E;  3NS1 A;  3IT6 B;  1MFW A;  1E90 A;  2LVO A;  1E7V A;  4ITK A;  1E7P B;  1GAQ B;  2IY1 B;  3QAR A;  4ARC A;  5FKA C;  2A4Z A;  2N9E B;  1PQS A;  2V9H A;  3L16 A;  4P1C C;  2D07 B;  4C00 A;  2DZJ A;  1WXA A;  5C23 A;  3PV1 A;  2CS4 A;  2KYW A;  2N0S B;  1NI2 A;  3RNG C;  2AX5 A;  3IAS 1;  1E8X A;  4URK A;  4MJS B;  2KAC A;  4DHZ B;  3DBL I;  3AE3 B;  5BYS A;  3OJ3 A;  2FCM A;  2DNF A;  5JZE B;  2KDE B;  1C1Y B;  4MT5 A;  5EE1 A;  5DCN A;  5KHQ A;  2K9X A;  2J53 A;  2JYE A;  1FNW A;  1YMH E;  4MAC A;  1PYW D;  1WM2 A;  3ZQ4 A;  5DPS A;  2K39 A;  1KLU D;  1PFD A;  2N7D A;  3DBH B;  2AEH A;  2LJI A;  4ZRK A;  1MHH E;  3V05 A;  3LDZ E;  3V60 A;  2MBQ A;  3PZ8 A;  5IP4 D;  1SJE D;  3Q3N C;  3AED B;  3QHT A;  2WX0 A;  3TEW A;  5JXV A;  4JIO U;  4USA A;  3DWM A;  2NBU A;  5LXI B;  1YOV B;  4LJP B;  3U30 A;  1E7U A;  3PTF C;  2RMM A;  3KUZ A;  1N60 A;  3AEG B;  4OVV A;  1H4R A;  5AZH A;  2K3U A;  1WGY A;  3RNF C;  4BKS D;  3ZXV A;  1RWS A;  4PYZ A;  3AN1 A;  2NVU I;  5FR6 A;  4IC7 B;  1NVI D;  1L0V B;  2LGY A;  1SE4 A;  1D5M C;  1Z2M A;  2LXA A;  3IVF A;  3N3K B;  3MC8 A;  5TR5 A;  1I4R A;  2QIE B;  1BUI C;  1E6E B;  2KJ6 A;  3SEB A;  2VZK B;  2KFJ A;  3ZNI D;  1WXV A;  1KLG D;  1SF0 A;  3RUI B;  3I9V 1;  2EKE C;  3JYU A;  3ZJV A;  4IOI E;  3ML9 A;  4EE2 A;  2GBM A;  1HEZ E;  4E3C A;  1ZW7 A;  2DZI A;  2KK8 A;  3BVG A;  1RFK A;  3KYC D;  3AEE B;  2BB5 A;  2OHF A;  3ZNG C;  4FHJ A;  1I4P A;  1ZDV A;  4IM0 A;  1T0Y A;  1SIJ A;  4NQL B;  5E6N A;  4AP4 C;  2MQJ A;  4HKZ E;  1L6U A;  3VH4 B;  3M95 A;  4DHJ D;  4XC2 A;  3DVG X;  1UGJ A;  2IGG A;  2RR9 A;  4GDK B;  3A9K A;  2J52 A;  2N9L A;  4LDT B;  4HEA 1;  2C7H A;  3DHG C;  3UGB B;  2G4D B;  2PMV A;  3UIP B;  4UDU C;  2JYT A;  1MI0 A;  5GXG B;  3UI3 A;  4DXF A;  5CTR C;  1FM0 D;  1IBX B;  3AM9 A;  3BVM A;  3ZGZ A;  1QOB A;  2JWZ A;  2CHX A;  1YNT E;  2V3N A;  3ZW3 A;  1C4P A;  3U7Z A;  4BOZ B;  4YL8 A;  2KZR A;  3BII D;  1L7Y A;  1QF6 A;  1LGR A;  3MJ5 A;  1T0R C;  2M4N A;  4RGO S;  4OZA A;  2D3G A;  2MSE D;  3AUL A;  1HTQ A;  2RPQ A;  3ZRC A;  2IO3 B;  2JSV X;  4RCO A;  2CHZ A;  1J0G A;  4TUU A;  4TSS A;  4O1N A;  4DXA B;  1DOY A;  1AAR A;  4HRO A;  2KVZ A;  4L2Y A;  4JPS A;  4LNO A;  3A4R A;  3DWG C;  2JT4 B;  2QEJ C;  3RT3 B;  2ZVN A;  3EGR A;  4AWJ A;  4CHK A;  3RFZ B;  3N9Y C;  1TJE A;  2MA9 B;  4FN2 A;  2V4I B;  3DBR I;  3V6C B;  5CHF A;  5AEK B;  4IUM B;  2BWE S;  3IXS A;  2NBV B;  3V6E B;  2NPT B;  2LFI A;  3B1L X;  2JZZ A;  3M63 B;  2WXK A;  4DWF A;  4JWS C;  2YEP B;  1TYG B;  1ENF A;  2ACZ B;  2KKC A;  1YX6 B;  3TMP B;  3ZO5 B;  3ECI A;  5JHA A;  1TZO A;  2ICI A;  2KX3 A;  1H8C A;  2KT7 A;  1VCB A;  4KKI A;  4IDI A;  2WDT B;  2VH2 A;  1V97 A;  3NG0 A;  4BKG A;  1FXI A;  2N9P C;  2M0A A;  3PHX B;  2DYB A;  1TT5 B;  4MGZ E;  1C78 A;  4WJO A;  3W2D A;  2M8S A;  4W9D A;  1MVK A;  2CJO A;  3LJ3 A;  2BYE A;  3VVW B;  1MPE A;  4MEL A;  1V86 A;  1JRO A;  4P1B C;  2CR5 A;  2IZV B;  4EZK A;  1J19 A;  1E8Y A;  2V1Y A;  4IWP A;  3P4Q B;  4PYU A;  1UD7 A;  1L0Y B;  2KJH B;  1Y8R C;  1B1Z A;  1QZE A;  3J9C A;  1SB3 C;  5J18 A;  4KDL B;  5D2M B;  1I4H A;  4JL9 A;  2NPT A;  3CWI A;  1EF1 A;  1EF5 A;  2IY0 B;  3ZVV A;  1WZ0 A;  2K6D B;  3Q8A A;  1FIQ A;  2DAJ A;  1TGZ B;  3PZ7 A;  3ZUN A;  4BZA A;  2J0K A;  3WAO A;  3WIM A;  3DDC B;  2LI5 A;  1P0R A;  4KV2 A;  1VJK A;  3HVZ A;  3SDL C;  1SBB B;  1HZ5 A;  3NJT A;  2Q5W D;  5JH5 C;  4MDK E;  4C56 C;  1JWU D;  1XD3 B;  3EA6 A;  4EKU A;  2LVQ A;  2L83 A;  1WI0 A;  2H88 B;  2SAK A;  2LEK A;  5IN7 A;  5TSS A;  1GC6 A;  2UWQ A;  1VRA B;  4KVG B;  3NUH B;  2D2Q A;  1Q5W B;  2KDM A;  1N5X A;  3CF6 E;  4WUR A;  1T6B X;  3OJ4 B;  3NS8 A;  3CMM B;  4ZRQ A;  3AB5 A;  1K50 A;  2PW9 A;  4A90 A;  4BOS C;  2QIL A;  3NZ3 A;  1JWM D;  1NEK B;  2FBW B;  1CQV A;  4G11 A;  1IYF A;  2GI9 A;  3L10 B;  4G3X B;  3TJP A;  3UQA A;  4N58 A;  3FIL B;  5IOI A;  3HIZ A;  3ETR A;  4BVU C;  2WXP A;  3T8M A;  3EC8 A;  5L95 C;  4ARI A;  1S3S G;  3BK2 A;  2INN E;  2WGS A;  4N9F 4;  2WWZ A;  4W9I A;  1FFU A;  1EU3 A;  3VUW A;  4RH6 A;  2Y3A A;  1UBI A;  4B95 A;  1ET6 A;  3WAM A;  5C1Z A;  2TSS A;  4DQO C;  4EEW A;  2DAF A;  3PZD A;  4FXC A;  4ANU A;  3VR9 B;  3BIN A;  2DZM A;  1T5X D;  4AOF A;  1NYR A;  4M0W A;  4ZHO A;  2X8X X;  2JPH A;  3I3T B;  3W5U B;  5AZG A;  3DQV A;  1ZXH A;  1JW9 D;  3W1S C;  5H8Y E;  1WGR A;  1WGD A;  4W9C A;  2K25 A;  2LVP A;  1SE9 A;  5BO4 B;  3U52 E;  3MP9 A;  4WAF A;  4LJO B;  2XK5 A;  2KLC A;  1BXT A;  2BKF A;  2NBW B;  1XO3 A;  3U4E G;  3TEX A;  3PRZ A;  2N4F A;  2PE9 A;  4LTU A;  5MPO A;  1JAL A;  1WXM A;  1V2Y A;  1YN4 A;  2O2V B;  4GDL B;  1WR1 A;  2EMT A;  3R2I A;  3X23 A;  4JWU C;  3AEA B;  3H7P A;  2WNM A;  4HKQ A;  2ON8 A;  1F2R I;  2ZVO A;  3A1Q B;  3Q6B A;  2BT6 A;  1EWY C;  2HTM E;  4HRS A;  2IBI B;  3A1Q A;  1E0Z A;  1ZXI A;  3B2G A;  3Q3M C;  2PEA A;  1C76 A;  4HPP A;  3ZYY X;  3VUY A;  2RSU A;  3Q14 C;  1WMH B;  1UUP A;  2EEL A;  2M19 A;  1ET9 A;  1R4M B;  4C7Z A;  4RF1 A;  2DYO A;  5AZF A;  1MHX A;  2MW5 A;  1C9F A;  3DVN U;  5J2R A;  1VR9 A;  4XGA B;  1UZX B;  1HA5 A;  2UU7 A;  1WSP A;  2Z0D B;  3DHH C;  1OEY A;  1OGW A;  1XLN A;  2V0G A;  1EU4 A;  3RI7 C;  1MJD A;  1V81 A;  1V49 A;  1GG3 A;  3HRD D;  3TL5 A;  3BWU D;  2HJ8 A;  3L54 A;  4NNJ B;  2E6X A;  4MH8 A;  1FEH A;  3Q3O C;  4GLS C;  1FO4 A;  4GDK A;  3L17 A;  5BMI A;  4CYE A;  2INP E;  4ZHP A;  4BBN C;  1V80 A;  5BYR A;  3HVD A;  3SD5 A;  1SEB D;  3APD A;  2ZZP B;  3P42 A;  4RMA A;  3ZRF A;  1RLF A;  1K8R B;  1MG8 A;  4M8M A;  1T3Q A;  4GSW A;  1P9D U;  1GB4 A;  1PDX A;  4A20 A;  2KWD A;  4YSX B;  4YXD B;  5G5G A;  3GP7 A;  2LAS A;  3E56 A;  2KWC A;  2NMQ A;  2DX5 B;  2FUG 1;  4BKT A;  1I4Q A;  4XWW A;  4LNK A;  2L52 A;  4A9A A;  1T0Q C;  2ZCC A;  1KTK A;  1D5Z C;  2R61 A;  4H2A A;  4LK0 M;  3ENE A;  2LGX A;  2WXM A;  4W9G A;  1XQQ A;  2FCS A;  5EE0 A;  3H9D A;  2W82 A;  2R2O A;  2FAZ A;  3NVV A;  5LNK 1;  1WRD B;  4A8X C;  2BS3 B;  2JU6 X;  4FJV B;  4IWQ A;  1XLP A;  1EO6 A;  2G1E A;  1X1M A;  4NZL B;  4ZRI A;  4NJC A;  2KHW B;  2QSD A;  3P2B A;  1ZGU B;  1DOI A;  4M8N A;  4WAA A;  4DDI D;  2RDB C;  1VDV A;  2KDB A;  1I7H A;  4REZ A;  1BML C;  2WS3 B;  2MWS B;  5EE9 A;  2Y5C A;  3PT2 B;  2IDY A;  3LB8 C;  4MM3 B;  3KVF B;  2JUO A;  3UIO B;  3P63 A;  2K6Q A;  3PVL A;  1F0Z A;  3AE5 B;  1F52 A;  3RUL A;  4K81 A;  2AQ1 B;  1WGG A;  1I42 A;  4HXD A;  4EOY A;  3GZN B;  2KWU B;  3OG5 A;  3KH0 A;  4A6Q A;  4ZDV A;  2BBC A;  2L76 A;  1BT0 A;  3T3N A;  3KYD D;  4LLG M;  2CU1 A;  3VHT C;  4YTP B;  3IFW B;  3TCA A;  2IO0 B;  2W3S A;  2ZW1 A;  1K52 A;  5G2N A;  2RDH A;  3AMZ A;  3C8Y A;  2M17 A;  1N61 A;  4PS7 A;  3KLS X;  1DYQ A;  3QQ8 B;  4ZYS A;  4RGT A;  1AW7 A;  1XLQ A;  2EMS A;  1LQB A;  5LXH A;  4WIP A;  4C4V A;  4PS8 A;  2QJL A;  3U8Z A;  4IG7 B;  2REX A;  2L05 A;  3Q3F A;  1WZ3 A;  2GBK A;  2AQ3 B;  1VLB A;  4KGS A;  2WX1 A;  4I6L B;  2GLS A;  1CMX B;  3PO0 A;  1FRD A;  2KDF B;  4K3C A;  4KIK B;  1XCT L;  2DBY A;  1ZUD 2;  3SR6 A;  2HTH A;  2R2Q A;  3R7R A;  2OOB B;  1IPG A;  1GNU A;  4F1S A;  1D5X C;  4S17 A;  4CO7 A;  4Q2J A;  2WU5 B;  4PK1 A;  2WDQ B;  1XXG A;  3AE6 B;  3BZD B;  1P98 A;  3NVW A;  3OAW A;  3QJZ A;  1TZ1 A;  4II3 B;  2B3A A;  3VAW A;  3AE9 B;  4FJZ A;  2MEK A;  3VR8 B;  2JY6 A;  2IYD B;  3CSF A;  1D6E C;  3PLV A;  3PRP B;  4OHJ A;  3ZTD A;  4M01 A;  4GXB A;  4BKS A;  4W9L A;  1SE3 A;  1WE6 A;  2O6V B;  2G3Q B;  2PTL A;  1V1O A;  1WM3 A;  2OJR A;  3FC4 A;  3NRZ A;  1ZDX A;  3APF A;  3LXF A;  3WAP A;  1WJN A;  4RM8 A;  2K1F A;  1PGA A;  2L00 B;  3IAM 1;  1V9J A;  2MRP A;  1SJH D;  5D3I B;  2VZK D;  1R7S A;  1UWM A;  4BBN F;  4K1R B;  3A9K B;  1WGH A;  3K9O B;  2LMC A;  4K7W A;  3MTN B;  4YSY B;  1V5O A;  4US8 A;  2LGS A;  3PRE A;  4MSM B;  2BYT A;  3R8B A;  1B9R A;  2JRI B;  3KW5 B;  4F7Z A;  3O65 B;  4HCP B;  3GZN I;  3DHI C;  2H89 B;  5I4D A;  1FXT B;  1GUA B;  2RPV A;  5G55 A;  4WWM A;  2SEB D;  4WJP A;  2KC2 A;  3ABV B;  5J17 A;  2C60 A;  2D3C A;  4MGY E;  5D3D A;  2WXQ A;  4L1B A;  2DYM A;  2LHD A;  5T8I A;  3ZNZ B;  4IM2 A;  5DPR A;  1RRB A;  1WX7 A;  4ANW A;  4NAW A;  4XE0 A;  2BS2 B;  5D6J B;  3MFG A;  2J7Q B;  4ANX A;  5G5H A;  3T3O A;  1OQY A;  4GGQ A;  2Z0E B;  4JE3 B;  4PT5 A;  1IGC A;  3AE4 B;  2KMC A;  2AYO B;  3Q69 A;  3TIX A;  4B0M A;  1TS3 A;  1Y56 A;  4E71 A;  3H7S A;  2BGF A;  2JWU A;  4GOC A;  3RNC C;  2KX0 A;  1UWX A;  2KN4 A;  2PE6 B;  1UH6 A;  1KF6 B;  1V5T A;  1HXY D;  3K9P B;  4BAX A;  2D11 A;  2XBB C;  3EHV A;  2MJE A;  4KGR A;  1LM8 B;  4GN1 A;  2ZPN A;  5AUI A;  3R7Q A;  5H92 C;  4FA6 A;  2KTF A;  3N1X C;  3Q3J A;  2MBH A;  4YTN B;  4YT0 B;  4XDC A;  2UYZ B;  4C7Y A;  3UF8 A;  3HM3 A;  2ZPY A;  5HKH A;  1WFY A;  4K7U A;  2RGF A;  1WE7 A;  3U7D A;  1FCC C;  3P4P B;  4J3O D;  4DDG D;  3A9J B;  5KHO A;  1A70 A;  3N1Y C;  1P7E A;  1LFD A;  4M0W B;  5IA7 A;  1YJI A;  1S1Q B;  3S2A A;  4NJ6 A;  1XT9 B;  4HDO A;  1I4G A;  3ZDM C;  3D32 A;  1TBE A;  3BYT B;  2GRI A;  2N7J A;  2MJD A;  2KWV B;  4XZ4 A;  1C4C A;  4W9H A;  3NVY A;  3DBS A;  4KZC A;  4D2K A;  1YX5 B;  2XEW A;  4KDI C;  5IKC M;  4TMA B;  4W9E A;  3DOW A;  2DZK A;  3I63 C;  1QIL A;  2DEN B;  2QHO A;  2BVC A;  5L83 A;  5CHV C;  2KAJ A;  1QOG A;  3MHZ A;  1OFF A;  1STE A;  2D10 A;  2JRH A;  1IP9 A;  2WXL A;  3Q8B A;  2WXF A;  2VRR B;  3ZIM A;  2GB1 A;  2J0M A;  3R3M A;  2KJR A;  4QAY A;  3T9L A;  3BYY B;  4W9K A;  2WXR A;  2LXC A;  1WYW B;  4KX6 B;  3GB1 A;  4JX1 C;  3RN9 C;  3RNA C;  4N59 A;  1TTN A;  2PJH A;  2IND C;  1ACC A;  2JVC A;  3Q8F A;  4A3O A;  3QWZ B;  1UEL A;  4ZOH C;  3ZDT A;  2BYF A;  1WX9 A;  2PPH A;  2VH1 A;  5BMH A;  4RGN A;  1R4M I;  1TY2 A;  1DGJ A;  3Q8E A;  4XYC A;  2CHW A;  4I6N B;  2IPK D;  1FRR A;  1N63 A;  2IJ0 A;  2C5L C;  2WLB A;  4EZJ A;  2M56 B;  1JCK B;  2AWT A;  3NZU A;  2K5P A;  2BTE A;  4NPN A;  4P7I A;  1GB1 A;  3VFK A;  2GMI C;  1C79 A;  2XK5 B;  1SXT A;  2KAN A;  3MC0 B;  2LRW A;  1JRP A;  4JGH B;  3H8H A;  4PS3 A;  1SIF A;  1WJ6 A;  4AQ7 A;  3ZNH B;  1ZPS A;  1V8C A;  3AE8 B;  1OQR A;  2D3A A;  4NJ7 A;  2ZEQ A;  4OW0 A;  2KVR A;  3BY4 B;  2WP9 B;  3MJW A;  2KMM A;  4K7S A;  3IBE A;  3PPA A;  1PGX A;  4KSK C;  2LUM A;  2L8J A;  1AN8 A;  4WQO B;  4NY0 A;  3AI5 A;  3JSV A;  2WXN A;  4W9J A;  3H1U A;  1OTR B;  5HHD G;  2YVC A;  5AUK A;  5IAA C;  4MSQ B;  4XX5 A;  3ZXR A;  4AS1 A;  4YWG G;  5BYQ A;  2L0F A;  3NVZ A;  2I38 A;  3OLM D;  3GS2 A;  5GMV A;  4TV3 A;  4NAM A;  2C7N B;  1VZ6 A;  4MM3 A;  2K8C A;  3AEB B;  2KTR A;  2MBB B;  2QDF A;  1E10 A;  2GOW A;  1PGB A;  2HE7 A;  3AH7 A;  3RPF C;  2LZ6 A;  2AQ2 B;  4KZ0 A;  4EFO A;  1JRU A;  2N9K A;  4IWO A;  1L6V A;  1FD6 A;  4WJN A;  2JXX A;  3RNE C;  3W9C B;  4MEM A;  2WXH A;  2W9N A;  2J4X A;  1RAX A;  4ANV A;  2XN9 C;  5BMG A;  4FJY A;  1WX8 A;  3V62 A;  1WH3 A;  4CQN A;  4XDD A;  1JML A;  3O13 A;  2WU2 B;  1ZOY B;  4LCD E;  2N7E A;  4DBG A;  1SE2 A;  2MLB A;  4A3P A;  2KQS A;  5D94 A;  2J0J A;  1V1P A;  2B76 B;  4TQ0 A;  2KNB A;  3SFD B;  4K3B A;  3VRB B;  1UGM A;  3M3J A;  1P3Q U;  4ZRJ A;  1FPY A;  2L1A A;  1WYG A;  3VQI A;  2I1J A;  3TEY A;  2L0T A;  2O6V D;  4DHZ E;  4B6W A;  3DBR B;  3HUI A;  1KRH A;  2KO3 A;  2BWF A;  3B0A A;  3VDZ A;  1YQ4 B;  2MH7 A;  3VRA B;  1ROE A;  2LGI A;  1GPX A;  1L4D B;  2JX5 A;  3AE1 B;  3IHP C;  5DPT A;  3JVZ X;  1E8Z A;  2BYV E;  4TKN A;  1XCQ L;  1LO5 D;  3Q8C A;  3EFC A;  4OZC A;  1WWT A;  3FIL A;  4DHJ B;  1WJU A;  2N1V A;  1WR6 E;  1YJ1 A;  3W1S A;  4JLC A;  4AJY B;  3BVZ A;  3MC9 A;  1SSN A;  3VH3 B;  3RZW C;  1N62 A;  2YLM A;  2LHE A;  2L3Z A;  5E6P A;  3RCZ A;  1V1P B;  1WMH A;  2PVO D;  4HDQ A;  2QC8 A;  4FUL A;  1J7B A;  3DBH I;  1LXD A;  1J7A A;  3URY A;  1HQR D;  3SFE B;  4EUT A;  3QAQ A;  1CK1 A;  3UIN B;  1K53 A;  4FLH A;  4IM3 A;  4ASW C;  4FAD A;  2KQ7 A;  4TQ1 A;  4GIV A;  1FXA A;  3KUC B;  3X0W A;  2LUE A;  1NDD A;  1ZP0 B;  3H7P B;  4RFB A;  3P4R B;  3QC8 B;  4KKJ A;  2M0X A;  5LLI A;  1F1H A;  4NAW B;  1NBF C;  1N6Z A;  2HJ1 A;  2JZP A;  2FCN A;  2ZCB A;  4HJK A;  2W55 A;  2KTR B;  2AL3 A;  1FFV A;  1D4B A;  3P1M A;  3P4S B;  4GB9 A;  2MX2 A;  1ZKH A;  2WXG A;  1WXS A;  1E9M A;  2LGD A;  1UNS A;  1N5W A;  1L4Z B;  1WJ4 A;  3AE7 B;  1DOX A;  3V61 A;  1TS4 A;  1TKG A;  3ONS A;  1IBX A;  3AV8 A;  2G4S A;  4WH4 A;  3MHS D;  2Y5P A;  4RNA A;  3KWL A;  1OEY J;  2CJN A;  3GE3 C;  2FUH B;  5DPW A;  4YSZ B;  3PLU A;  4G50 A;  3ZJT A;  4X57 B;  1XF5 L;  5E6O A;  3ZLZ A;  4A55 A;  2KFK B;  4YTM B;  3WCQ A;  4EZL A;  2NTS A;  4ICV A;  2NCN A;  2C7M B;  3PS6 A;  4RF0 A;  2K22 A;  3ZTC A;  1JWB D;  2MP2 B;  4P16 A;  3A9J A;  4F8C B;  2W54 A;  1QQR A;  2MP2 A;  1HZ6 A;  3JSV B;  3APC A;  1L2N A;  1TKY A;  4GMV A;  1FCL A;  2BQQ A;  1YJJ A;  5C2T B;  3PRM B;  3CST A;  2KQ4 X;  1ZE3 D;  1Q0W B;  2K8B A;  2V3S A;  2KD0 A;  2O6V A;  1R4N I;  5IO9 A;  1XEE A;  1KM7 A;  1UBQ A;  1WF9 A;  1RM6 C;  3KQ4 A;  3TBL D;  1AYF A;  4ZRP A;  2KN5 A;  2ZW0 A;  1UF0 A;  4HWI B;  1QOA A;  3QX1 A;  3RD2 A;  2N9X A;  1SGH A;  1C4A A;  3IT4 B;  2W3R A;  1JWA D;  1M94 A;  3GE8 C;  4AJW A;  1KOT A;  3AEF B;  2NR2 A;  3OWE B;  1YN5 A;  2PVG C;  3W5V B;  4E74 A;  1KLV A;  1ESF A;  3BK1 A;  2GBN A;  3V3X A;  2PIA A;  2LJ5 A;  3B08 A;  1R4N B;  5D7G A;  1U4A A;  2C9W B;  1QT9 A;  1Z5S B;  2IO1 B;  3R66 C;  1JWS D;  2G45 B;  1E8W A;  1KJT A;  2MBO A;  2KDI A;  5HI1 A;  1P7F A;  2DHZ A;  3VXW A;  3DVN V;  2Y5B B;  2WXO A;  3RYT A;  3N1Z C;  5C3J B;  1CZP A;  3AU4 A;  3L0W B;  1G6J A;  3AXC A;  2BPS A;  1HTO A;  2FCQ A;  4ZYN A;  3IG3 A;  3WAL A;  3I5J C;  3C19 A;  3ZKJ C;  1WXQ A;  3EEC A;  2G9H D;  3N32 A;  3ZJU A;  3NZS A;  1YQ3 B;  4B0E A;  4OZB A;  2V3P A;  2BB6 A;  2ZNV B;  3W1Y A;  2IGH A;  3KWV A;  4MGK E;  2WQY B;  1YIW A;  3DCG A;  3WA0 A;  3VTW A;  4M02 A;  3N30 A;  4HJG E;  2JQR B; 
#chains in the Genus database with same CATH homology
 2M56 B;  2N9L A;  2DLB A;  4HEA 1;  1JCK B;  2K5P A;  2BTE A;  2BW2 A;  2PMV A;  4DXG A;  5EE0 A;  2J52 A;  2W82 A;  2YEP F;  4UDU C;  1GB1 A;  2JYT A;  2CU3 A;  1MI0 A;  1C79 A;  3NVV A;  5LNK 1;  5GXG B;  3UI3 A;  1L5P A;  4DXF A;  1IBX B;  1FM0 D;  3AM9 A;  3BVM A;  1SXT A;  3MC0 B;  4A8X C;  2BS3 B;  2JU6 X;  4OVZ A;  1JRP A;  1FNU A;  3H8H A;  3ZGZ A;  1QOB A;  1XLP A;  2G1E A;  2J42 A;  4NZL B;  4AQ7 A;  1YNT E;  2V3N A;  2DWQ A;  1C77 A;  1C4P A;  3U7Z A;  4NJC A;  1ZPS A;  2QSD A;  1V8C A;  3BII D;  3AE8 B;  1OQR A;  1QF6 A;  3MJ5 A;  4RGO S;  1DOI A;  4OZA A;  1PUT A;  1KFY B;  1VDV A;  5E6J A;  1I7H A;  2JSV X;  4OW0 A;  4XWT A;  4RCO A;  1GOZ A;  2WP9 B;  4REZ A;  1BML C;  2WS3 B;  1FNV A;  5EE9 A;  2Y5C A;  4TSS A;  2KMM A;  2IDY A;  3LB8 C;  4MM3 B;  4O1N A;  1PGX A;  1DOY A;  1CJE A;  3P63 A;  4HRO A;  1F0Z A;  2LUM A;  5EE3 A;  4L2Y A;  1AN8 A;  4JPS A;  3AE5 B;  2WDR B;  3DWG C;  1K51 A;  2QEJ C;  3EGR A;  2WXN A;  3RFZ B;  3N9Y C;  1TJE A;  1QOF A;  2V4I B;  5HHD G;  1TS2 A;  2AQ1 B;  5AUK A;  2WXJ A;  3FAH A;  3U2S C;  3IXS A;  4AS1 A;  4YWG G;  1J7C A;  5BYQ A;  3NVZ A;  4A6Q A;  2BBC A;  1F2R C;  2LFI A;  4RGM A;  2I38 A;  3T3N A;  3GS2 A;  4LLG M;  4NAM A;  3E9S A;  1VZ6 A;  2WXK A;  3AEB B;  3AEC B;  4JWS C;  4YTP B;  2YEP B;  2E3T A;  1TYG B;  1E10 A;  1ENF A;  2W3S A;  2ZW1 A;  2ACZ B;  1K52 A;  1TS5 A;  3AE2 B;  1PGB A;  4N6E B;  2WDV B;  3LYY A;  3AH7 A;  3RPF C;  1TZO A;  2AQ2 B;  2RDH A;  3C8Y A;  2ICI A;  3AMZ A;  2IGD A;  2N9K A;  2HDE A;  1N61 A;  1L6V A;  3KLS X;  1FD6 A;  4KKI A;  1DYQ A;  3W9C B;  4IDI A;  4ZYS A;  1WRI A;  4RGT A;  1AW7 A;  1XLQ A;  2WXH A;  4C80 A;  1V97 A;  2J4X A;  2ONQ A;  1YN3 A;  1FXI A;  2M0A A;  2XN9 C;  5BMG A;  3CIR B;  4WIP A;  4CQN A;  2MJ3 A;  1C78 A;  1TY0 A;  2PKO A;  4XDD A;  5HG2 A;  3W2D A;  1NI3 A;  2QJL A;  1JML A;  3O13 A;  2WU2 B;  1ZOY B;  1MVK A;  3TEZ A;  2CJO A;  1SE2 A;  1MPE A;  1JRO A;  2AQ3 B;  4P6V F;  1VLB A;  4KGS A;  3B9J A;  1V1P A;  2B76 B;  1QKZ A;  3PO0 A;  1Q10 A;  4TQ0 A;  1FRD A;  3SFD B;  3P4Q B;  1FMA D;  3VRB B;  1XCT L;  2DBY A;  1ZUD 2;  4US9 A;  3SR6 A;  1L0Y B;  1VZ7 A;  1OQQ A;  1QLB B;  2L1A A;  1B1Z A;  1WYG A;  3VQI A;  3TEY A;  1D5X C;  1JQ4 A;  3J9C A;  1SB3 C;  4Q2J A;  3R2T A;  2FE8 A;  1F77 A;  4R3D A;  3HUI A;  2WU5 B;  1KH0 A;  1KRH A;  2WDQ B;  1I4H A;  1XXG A;  3AE6 B;  2XNA C;  5FK9 C;  3BZD B;  4IKG A;  1YQ4 B;  3CWI A;  2MH7 A;  3VRA B;  3NVW A;  1ROE A;  2LGI A;  1GPX A;  1L4D B;  3EUB 2;  3Q8A A;  1FIQ A;  3PZ7 A;  2JX5 A;  3AE1 B;  3AE9 B;  2MEK A;  3VR8 B;  2OED A;  2JXT A;  1XCQ L;  1LO5 D;  1VJK A;  3HVZ A;  1D6E C;  3Q8C A;  1SBB B;  1HZ5 A;  4OHJ A;  4OZC A;  1WWT A;  4KGT A;  2PLP A;  2Q5W D;  3FIL A;  1NEN B;  1WGK A;  4C56 C;  3TSS A;  1JWU D;  3EA6 A;  2WXI A;  1SE3 A;  2L83 A;  2PTL A;  2H88 B;  2SAK A;  2LEK A;  3TUO A;  5FR3 A;  3W1S A;  1V1O A;  3BVZ A;  3FC4 A;  3NRZ A;  1IGD A;  1ZDX A;  2X38 A;  5TSS A;  1SSN A;  1IUE A;  1VZ8 A;  1N62 A;  1VRA B;  3LXF A;  3NUH B;  2LHE A;  2KDM A;  1N5X A;  2EKI A;  1PGA A;  3IAM 1;  4WUR A;  1SJH D;  1V1P B;  1T6B X;  2VZK D;  5D3I B;  1R7S A;  1UWM A;  4ZRQ A;  3AB5 A;  2L32 A;  2D5G A;  2QMT A;  1K50 A;  2PVO D;  2PW9 A;  2LMC A;  4YSY B;  2QIL A;  3NZ3 A;  4A90 A;  1JWM D;  1RYJ A;  1J7B A;  1NEK B;  2FBW B;  3L4P A;  4US8 A;  1CQV A;  1AWD A;  2NTT A;  2Z8L A;  1J7A A;  2GI9 A;  1I4X A;  3URY A;  1HQR D;  3SFE B;  1CK1 A;  1K53 A;  2I2Y A;  2BYT A;  3R8B A;  4TQ1 A;  4N58 A;  2RDG A;  1FXA A;  2BS4 B;  3FIL B;  4WQM A;  1ZP0 B;  1B9R A;  3ETR A;  4RFB A;  3P4R B;  4KKJ A;  2K0P A;  2H89 B;  2WXP A;  5I4D A;  4NAW B;  1EWC A;  1L0X B;  4ARI A;  2RPV A;  3BK2 A;  4WWM A;  2INN E;  2JZP A;  2SEB D;  3ABV B;  1FFU A;  5D3D A;  1EU3 A;  2W55 A;  4RH6 A;  1FFV A;  1D4B A;  3P1M A;  3P4S B;  2WXQ A;  1M4V A;  2Y3A A;  4L1B A;  2WXG A;  1E9M A;  1ET6 A;  1UNS A;  2TSS A;  2DYM A;  4DQO C;  2LHD A;  1N5W A;  5T8I A;  1L4Z B;  4FXC A;  4L23 A;  3AE7 B;  3VR9 B;  1DOX A;  1T5X D;  1TS4 A;  1TKG A;  1EM7 A;  1NYR A;  3AV8 A;  1IBX A;  3B2F A;  4WH4 A;  4XE0 A;  2BS2 B;  2Y5P A;  3MFG A;  1NYQ A;  4M0W A;  4ZHO A;  4RNA A;  3KWL A;  5HFY A;  1XLO A;  1TKE A;  2CJN A;  3W5U B;  3I57 A;  5G5H A;  3T3O A;  1ZXH A;  1JW9 D;  3NS1 A;  3IT6 B;  4YSZ B;  5H8Y E;  3ZJT A;  4JE3 B;  4PT5 A;  1XF5 L;  1IGC A;  3AE4 B;  4A55 A;  4ITK A;  1E7P B;  1GAQ B;  3Q69 A;  4YTM B;  4B0M A;  4ARC A;  1TS3 A;  1Y56 A;  3MP9 A;  5FKA C;  3U52 E;  4WAF A;  3WCQ A;  1BXT A;  2NTS A;  2JWU A;  1XO3 A;  3U4E G;  4RF0 A;  3TEX A;  2K22 A;  1UWX A;  2KN4 A;  4LTU A;  5MPO A;  1JWB D;  1JAL A;  4P16 A;  2N0S B;  1YN4 A;  1KF6 B;  2W54 A;  1HXY D;  2AX5 A;  1QQR A;  4GDL B;  3IAS 1;  2KAC A;  1HZ6 A;  5BYS A;  3AE3 B;  3R2I A;  4JWU C;  3AEA B;  2MJE A;  1TKY A;  2WNM A;  4KGR A;  4HKQ A;  2ON8 A;  4MT5 A;  5EE1 A;  5AUI A;  1F2R I;  5H92 C;  1FCL A;  2BT6 A;  2K9X A;  1EWY C;  2HTM E;  1YJJ A;  2J53 A;  5C2T B;  4HRS A;  4YTN B;  2JYE A;  4XDC A;  1FNW A;  1YMH E;  4MAC A;  4YT0 B;  1E0Z A;  2KQ4 X;  1PYW D;  1ZXI A;  4C7Y A;  3ZQ4 A;  1ZE3 D;  3B2G A;  1KLU D;  1PFD A;  2LJI A;  1MHH E;  3V05 A;  1XEE A;  1C76 A;  1FCC C;  3P4P B;  4J3O D;  3ZYY X;  3PZ8 A;  1UUP A;  2EEL A;  2M19 A;  1RM6 C;  1A70 A;  1ET9 A;  1SJE D;  3KQ4 A;  4C7Z A;  1AYF A;  3AED B;  4ZRP A;  4RF1 A;  2DYO A;  1P7E A;  2ZW0 A;  1MHX A;  1YJI A;  1C9F A;  3TEW A;  5JXV A;  1QOA A;  1VR9 A;  4USA A;  1C4A A;  1HA5 A;  3DWM A;  1WSP A;  1I4G A;  3IT4 B;  2W3R A;  1JWA D;  3BYT B;  2GRI A;  2N7J A;  2MJD A;  3AEF B;  1XLN A;  2V0G A;  2RMM A;  1C4C A;  1N60 A;  1EU4 A;  3AEG B;  3OWE B;  1YN5 A;  2PVG C;  2K3U A;  3NVY A;  3HRD D;  3W5V B;  4D2K A;  3BWU D;  1ESF A;  1RWS A;  4TMA B;  3BK1 A;  3AN1 A;  3V3X A;  2E6X A;  2PIA A;  4MH8 A;  1QIL A;  1NVI D;  1L0V B;  1FEH A;  4GLS C;  1SE4 A;  5D7G A;  1FO4 A;  1D5M C;  1QT9 A;  2KAJ A;  1QOG A;  5BMI A;  3MHZ A;  1OFF A;  1STE A;  1JWS D;  2INP E;  2WXL A;  3Q8B A;  4ZHP A;  2WXF A;  5HI1 A;  1I4R A;  2GB1 A;  5BYR A;  3HVD A;  1P7F A;  2QIE B;  1BUI C;  1SEB D;  2WXO A;  1E6E B;  5C3J B;  3SEB A;  1CZP A;  2VZK B;  3P42 A;  3BYY B;  2WXR A;  1KLG D;  1SF0 A;  3I9V 1;  4KX6 B;  3GB1 A;  4JX1 C;  3ZJV A;  4IOI E;  4EE2 A;  1T3Q A;  4N59 A;  1GB4 A;  1PDX A;  1HEZ E;  2KWD A;  4YSX B;  4YXD B;  5G5G A;  3BVG A;  1RFK A;  3GP7 A;  1WXQ A;  3AEE B;  2BB5 A;  3E56 A;  2OHF A;  2G9H D;  1ACC A;  1I4P A;  1ZDV A;  2NMQ A;  3Q8F A;  2FUG 1;  1SIJ A;  3ZJU A;  1I4Q A;  4ZOH C;  1YQ3 B;  4B0E A;  4OZB A;  1L6U A;  2V3P A;  2BB6 A;  4HKZ E;  4XWW A;  5BMH A;  4RGN A;  2IGH A;  2L52 A;  3KWV A;  4A9A A;  1TY2 A;  1DGJ A;  3Q8E A;  2IPK D;  1FRR A;  1KTK A;  1UGJ A;  1N63 A;  1D5Z C;  2R61 A;  2WQY B;  2IGG A;  2IJ0 A;  4GDK B;  4H2A A;  4LK0 M;  2WXM A;  4HJG E;  2JQR B;  2WLB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...