1K52A

Monomeric protein l b1 domain with a k54g mutation
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
72
structure length
72
Chain Sequence
MHHHHHHAMEEVTIKANLIFANGSTQTAEFKGTFEKATSEAYAYADTLKKDNGEWTVDVADGGYTLNIKFAG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Protein L
publication title Single-site mutations induce 3D domain swapping in the B1 domain of protein L from Peptostreptococcus magnus.
pubmed doi rcsb
source organism Finegoldia magna
molecule tags Protein binding
total genus 20
structure length 72
sequence length 72
chains with identical sequence B
ec nomenclature
pdb deposition date 2001-10-09
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.10 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 1k52A00
2LHDA 4IOIE 3UI3A 1FCCC 1D4BA 1YNTE 2J52A 5HHDG 4HJGE 4KGSA 1XCQL 1GB1A 1MVKA 2LGIA 2JZPA 1XCTL 2ZW0A 1EM7A 1UWXA 1C9FA 2IGHA 2J53A 1IGDA 4MACA 2IGDA 2K0PA 2JWUA 3GB1A 4OZCA 1KH0A 2N9LA 5JXVA 2ZW1A 2EELA 1IGCA 4D2KA 3FILB 2ONQA 5BMIA 1K51A 1K53A 2KACA 4IKGA 2N7JA 4KGTA 1MHHE 2PLPA 4OZAA 3V3XA 4KGRA 1HZ5A 1PGXA 2JSVX 2RMMA 2LUMA 2GI9A 1IBXB 2I38A 2JXTA 2RPVA 1HEZE 2GB1A 3FILA 3MP9A 2QMTA 4GLSC 1IBXA 1PGAA 2QSDA 1F2RI 2N9KA 1HZ6A 1PGBA 1MHXA 2KWDA 1P7EA 2LHEA 1FCLA 2KDMA 1K52A 1P7FA 2KQ4X 2ON8A 5BMHA 2I2YA 1FD6A 2NMQA 1MPEA 5BMGA 1ZXHA 4WH4A 1Q10A 2PTLA 4OZBA 1MI0A 1YMHE 2IGGA 1JMLA 5HI1A 2KN4A 1QKZA 1K50A 1XF5L 4HKZE 5HG2A 2JU6X 1F2RC 1GB4A 5HFYA 2OEDA 2PW9A
chains in the Genus database with same CATH superfamily
4GGQA 4W9IA 3JYUA 4IM0A 3DBLB 1YNTE 5C3JB 1XD3B 3AE1B 4GXBA 3MTNB 3PREA 1NBFC 1Y56A 1FIQA 1KLGD 4HPPA 1L2NA 2BWES 2HTHA 3ZNGC 4WQOB 2D5GA 3V60A 2V3PA 2M0AA 4JIOU 3RD2A 2EMTA 3ZGZA 3EC8A 3R2TA 3L13A 4ARIA 2ZJDA 1TS3A 3W1SA 4GDKB 4P7IA 4L23A 3OG5A 2MJ3A 4E74A 4F7ZA 3PZ8A 2CR5A 4XDDA 1NENB 4HVBA 1LO5D 3W2DA 1PGXA 4BKSD 3MC9A 2V3NA 2LUMA 2LFIA 2MJDA 4NJCA 2JXTA 2WS3B 2WXJA 4KVGB 4ZRPA 1WFYA 4FJZA 2M8SA 3M62B 4GSWA 1J8CA 3N30A 2KQSA 2XN9C 2QC8A 2CS4A 1FO4A 1P7EA 1WZ3A 2LHEA 3AH7A 1SE2A 2KD0A 1XXGA 1E7UA 2SAKA 2XEWA 3A33B 2QCZA 1WMHA 4W9CA 5D7GA 3ZNZB 3DHIC 2RD0A 2LASA 2KWVB 3UINB 2LUEA 2R61A 5FR3A 1DOXA 1UF0A 4A3PA 5HFYA 4XDCA 2PW9A 1JWUD 4PS8A 1JQ4A 5TSSA 1I4XA 4MH8A 3RYTA 2JPHA 1WGYA 1WJ6A 3QCAA 4HDQA 1HTQA 4FHJA 3UIOB 3TCAA 4HPLB 1D5MC 1RWSA 2KMAA 4GN1A 4WJPA 2CJOA 3QAQA 3U7DA 4B0MA 2R2QA 1OTRB 2N9LA 2MRPA 4ANUA 1NYRA 3OJ3A 3SU8X 1L6UA 4HCNB 4CO7A 1C77A 4AJYB 2BGFA 2KC2A 1JALA 1SB3C 3MC0B 3ALBA 4FULA 3ZO5B 3JW0X 3Q3NC 1EWYC 2KLCA 4ICVA 2V0GA 1GOZA 4KGRA 1HZ5A 3ZIMA 1E9MA 5EE1A 2WDVB 1UUPA 3PRMB 3C19A 4FJYA 3N32A 1QILA 1SSNA 2QMTA 3GOEA 4KSLC 3MFGA 2D3BA 2BS3B 1WRIA 3HIZA 4NZLB 4PS3A 1F0ZA 1V1OA 1C4AA 1TKGA 4M0WA 3AE9B 3RPFC 1F52A 4WH4A 3HHMA 3N20C 4RNAA 2A5UA 4KSKC 1FMAD 5EE3A 1YOVB 2LRUA 3L08A 1LGRA 4AUQC 2RDHA 2G9HD 4ASWC 1H8CA 2MWSB 2QHOA 3ZRFA 1QF6A 3BK1A 1BT0A 1XLQA 4AOFA 3K9PB 4YTNB 2HTME 2IO0B 2RGFA 3U30A 3QWZB 4K3CA 1R4NI 3P4RB 1VR9A 1RFKA 4XC2A 2KYWA 4EUTA 4FADA 3I5JC 1Q0WB 1WH3A 2KT7A 2TSSA 2JYTA 3N3KB 3A9KA 1GNUA 1E8ZA 5CHVC 5BMIA 1JWBD 4M8MA 2N7JA 1FM0D 3BY4B 5C2TB 3P4SB 1WY8A 1QZEA 3APCA 1WMHB 2KOXA 3U4EG 3UGBB 4RGNA 3VFKA 4LNOA 3AE6B 5AUKA 3KWVA 4CHKA 4RGTA 3VDZA 2DBYA 1GC7A 4K1RB 1JRPA 2REXA 2I38A 2NTTA 3DBSA 4RH6A 1N63A 2RPVA 3CSTA 3QIJA 2WXPA 1J19A 2IDYA 2Z0EB 1IBXA 1BXTA 1T0QC 1ZP0B 2MBBB 4XYCA 1C78A 4NQLB 4DXGA 4FBJB 1JWSD 4K81A 1WIAA 2JQRB 5EE9A 3TEXA 2NVUI 3A9JB 1ZXHA 2INNE 4ZHPA 4KDIC 1IP9A 2CHZA 2FCMA 4USAA 4MGZE 2WYQA 4FHKA 5HG2A 1D5ZC 1ZW7A 2HJ1A 1FNWA 1L4ZB 3R2IA 2OEDA 1E7PB 4CQNA 2H89B 1IUEA 3VRAB 4FJVB 1V49A 4BAXA 4BZAA 1E5WA 4B95A 2FE8A 3PHWB 2W55A 3KH0A 4DK5A 4NAMA 3M63B 2NBUA 1XCTL 4P1BC 2R2OA 1S3SG 2WWZA 1V97A 5CX3A 1L6VA 3V05A 3TIXA 2Z0DB 5CTRC 3RMKC 2IPKD 4HJKA 1KFYB 3AM9A 4IKGA 2WU2B 2ZZPB 4XE0A 3EA6A 4RGOS 1GG3A 5H92C 4PK1A 3DVGY 5AZGA 4N58A 1LQBA 4W9HA 5JZEB 2BVCA 1KJTA 3L4PA 2QJLA 2KJHB 3RZWC 3ABVB 1TS2A 1C1YB 4A55A 2BQQA 1N5XA 3BINA 3FILA 2WXLA 3T9LA 3Q8AA 1TGZB 4WAFA 1F2RI 1MG8A 2UWQA 4RM9A 4O1NA 3IBEA 4ANXA 3DVNV 1MFWA 5CHWA 4XX5A 4C56C 2KO3A 2VRRB 1XO3A 1MI0A 4W9JA 4MGIE 1QKZA 3ETRA 1V2YA 1TZOA 2WXQA 4KV2A 4MM3A 3ENEA 4JWUC 1F2RC 3AEDB 3AE3B 1D4BA 1SIFA 1WGKA 1WYWB 2QIEB 3AEGB 1J0GA 2J52A 3RNAC 3Q8EA 3URYA 4KGSA 1GB1A 4GB9A 2JZPA 2JXXA 1YJIA 4W9DA 4YXDB 2KN5A 3N1ZC 1C9FA 1DOIA 1ISNA 2ZVOA 2N4FA 4MACA 4DDID 3MJ5A 1KH0A 5JXVA 3U8ZA 3MHZA 2BYEA 3HK0A 4ZYNA 1GJZA 1K51A 4A3OA 4W9KA 4Q2JA 2WXMA 1T0RC 1YQ3B 4OVUA 2L32A 4M02A 1TS4A 4KGTA 3ZQ4A 3VR8B 3R3MA 2IO1B 4F1SA 3GP7A 3R66C 1L0XB 2O6VB 1EF1A 1T3QA 2JUOA 1C79A 1GC6A 2N9XA 2DYBA 4BBNC 2AQ1B 4C80A 4CYEA 1YD8U 1YN4A 4LLGM 2KTFA 3H8HA 3W5VB 1I4QA 2M19A 4MGKE 4NAWA 1V80A 1J7CA 1WJUA 2DLBA 2M56B 4AWJA 3TL5A 4HRSA 3HRDD 3PZ7A 3Q6BA 2I2YA 1MPEA 5BMGA 3SD5A 4LK0M 1TYGB 4L1BA 3ZJUA 3RNBC 1QOAA 2LJIA 3VXWA 4ARCA 4KX6B 3AU4A 2K9XA 1GB4A 2BYTA 3A1QB 1UWMA 2WDQB 2LZ6A 4LCDE 4NJ7A 1SE4A 2KDBA 1YQBA 4TSSA 2KQ7A 1Y8RC 1OEYJ 2ZCCA 2KDFB 2MJEA 1TTNA 4HPMB 2WDRB 1F9JA 2Y5CA 2G45B 2KFKA 4JGHB 2OHFA 3VQIA 4B6WA 1KM7A 3LYYA 2CKHB 1E8YA 2AX5A 3IT4B 1WZ0A 5L83A 2LGSA 3DWGC 4C00A 4NPNA 1SIJA 1AW7A 3FILB 1R4NB 2PEAA 1E90A 1ZUD2 3ZJTA 3QC8B 3RUIB 4PYUA 5BYRA 4C7YA 2I1JA 4LNNA 3SFDB 1UNSA 1CJEA 3K9OB 3WCQA 2W9NA 2KXJA 4UDUC 4MM3B 3PVLA 2VH2A 4WJQA 2FUHB 2KHWB 3MP9A 1PQSA 2LMCA 3NG0A 3DBRI 2VH1A 3ZTCA 4A8XC 2K39A 2AEHA 1QQRA 1PGAA 3RNEC 2L0FA 4MSMB 3V6CB 2KWDA 1FCLA 3T3NA 1EWCA 2V4IB 1UELA 3ZNHB 2OJWA 2PIAA 3FAHA 4EZJA 2W82A 5AEKB 3R7QA 3QJZA 3OWEB 1R4MI 4HWIB 3IT6B 1QOGA 4ZRQA 3B2GA 1GPXA 1XF5L 2J4XA 3RULA 1HA5A 4BVUC 1V5OA 3TEZA 1KTKA 1EU4A 2QILA 3V6EB 4NY0A 1TJEA 2MBHA 4ZRKA 2ZNVC 2JYEA 2W54A 1RAXA 3PSEB 2JY6A 4MDKE 3B1LX 2NPTA 3S2AA 2KFJA 1V81A 2JWUA 1WF9A 2KX0A 4HDOA 4M01A 2V1YA 2M1MA 4GMVA 3AU5A 4HXDA 4J6IA 1VD2A 2LEKA 3P63A 4GDLA 1FXTB 5D3IB 2WU5B 4NAWB 2JWZA 4BKTA 1UBQA 3DBHB 3VHTC 1WX9A 3ZDMC 5D2MB 4MELA 2FCQA 1A70A 1KF6B 4URKA 3WANA 1IYFA 2DX5B 2ASQA 1TT5B 2LVPA 2N1VA 4FLHA 2M0XA 4P6VF 3NJTA 2V9HA 4YSXB 1AYFA 1SF0A 2VZKB 2HE7A 1YJ1A 1HZ6A 2LVOA 2GLSA 3AECB 4GOCA 1V86A 2K8BA 3LXFA 1D5XC 1TKYA 2L8JA 3KWLA 5E6PA 4R3DA 4EOYA 1X1MA 2WDTB 4L2YA 4MJSA 5GXGB 1OFFA 2DENB 1WR6E 4ANVA 2O6VD 3T8MA 2J0MA 3PLUA 2LXAA 1VDVA 1YJJA 3L54A 2J0JA 1XCQL 4BBNF 4BKSA 1L5PA 3BVGA 3NY5A 3VH4B 2KAJA 1UWXA 2EMSA 2INPE 3HM6X 2WGSA 3BVMA 1OEYA 1Z5SB 2NS5A 3LDZE 3H9DA 4KIKA 3E56A 3WIMA 1ZXIA 4I6PA 3VUXA 2K8CA 2GOWA 5JHAA 4JL9A 1ZDXA 3AEBB 1WGHA 1ZGUB 3BK2A 2IO2B 4DWFA 4LNIA 2W3SA 4YTPB 3BYTB 1GAQB 4ZHOA 2RMMA 1UZXB 1WM2A 2Y5PA 4G0NB 2AQ2B 3VTVA 3UIPB 3RNFC 3DBLI 2YEPB 1WX8A 2KANA 2QSDA 1FEHA 1PGBA 3ZUNA 3WA0A 1UH6A 4KZ0A 1XQQA 4DDGD 2NPTB 2N1WA 3VTUA 3NZ3A 2BB5A 3RNGC 2PE6B 1TZ1A 1YX6B 1RFAA 1RRBA 1JCKB 1TY2A 2WHIA 3VAWA 2KKCA 4IOIE 1V6EA 3IHPC 3JVZX 1SE3A 4EFOA 2JRHA 2KNBA 3DVNU 2HDEA 3H7PA 1C3TA 1VCBA 5LLIA 3RFZB 5D94A 3WAMA 1PYWD 2ZW0A 4TUUA 3ONSA 4OW0A 2ZVNA 2DAFA 2MP2A 3NZUA 2IGDA 2J7QB 2V3SA 2LJ5A 1T0SC 2ICIA 1C4PA 4AP4C 2N7DA 3O65B 2KX3A 5AZFA 1L4DB 1EO6A 1WX7A 5J17A 2B3AA 1EU3A 3KYDD 2WQYB 3RI7C 4DQOC 2PLPA 3R8BA 5LNK1 3HM3A 1BUIC 1WE7A 4ICUA 5DPSA 2Y5BB 4OHJA 4B0EA 2QEJC 3HVZA 1OQQA 4DXAB 1SJED 2UU7A 4N6EB 2MHJA 1L0YB 2BS2B 3KUCB 4ACFA 2FBWB 1HXYD 2M17A 1NI2A 1DYQA 1N60A 2C7MB 3DQVA 2BB6A 3C8YA 1XEEA 2WX0A 2MCNB 1FRDA 1SBBB 3ZKJC 2JZZA 2L52A 1MHXA 2W3RA 2LGXA 4M0WB 3CMMB 4MSQB 4DHJB 1VZ6A 2L1AA 3ZJVA 2DZMA 3L0WB 2K1FA 1B1ZA 1CQVA 1K52A 3ZXRA 3PTFC 4W9EA 3W9CB 3AE4B 2IY0B 3D32A 1UD7A 5IKCM 1XLNA 1ACCA 2WXNA 3ECIA 4HKQA 3WAOA 5D6JB 4XZ4A 1QT9A 3P42A 4HKZE 3Q3FA 4KIKB 3L10B 3NZSA 4IWOA 4M00A 3O13A 2DZJA 2CHXA 2BF8B 1FCCC 1Q1OA 3LB8C 2FCSA 2C5LC 3I57A 3N1XC 4HJGE 3JSVA 5IA7A 1MVKA 1WM3A 4TQ0A 2PVGC 5FK9C 2J53A 2K8HA 3A9KB 3X0WA 2EKIA 3P4PB 2AQ3B 3BWUD 5IP4D 1DOYA 3PV1A 2KWUB 5KHOA 1E8XA 1DGJA 2WXGA 1QOBA 1AARA 3Q3OC 2BKFA 3TSSA 3AE7B 2UYZB 4XGAB 3U7ZA 4YSYB 2M4NA 2D11A 4RFBA 1PDXA 4E71A 1AN8A 1RLFA 1V5TA 3AB5A 1NDDA 3AE8B 1IBXB 1U4AA 1WRDB 1BMLC 2INCC 4S0RA 3DWMA 4F8CB 1C76A 2KDIA 4GLSC 1YN5A 2KJRA 3PRPB 5E6NA 2C7NB 2MA9B 3H7PB 1CK1A 3NUHB 5G55A 3APFA 4JQWC 4W9FA 4YWGG 5BYQA 2EKEC 3VTWA 4LNFA 5BMHA 4W9GA 3W1SC 4JE3B 2FIFA 3U2SC 3BZDB 3NS8A 4OZBA 2IGGA 1E10A 2I1KA 2BYVE 2KVZA 4BFRA 5IO9A 3DPDA 2WXRA 4K7WA 3PPAA 2K5PA 2L83A 4RF1A 5HHDG 3E9SA 2GBKA 3PLVA 2KMCA 3L16A 2K22A 2ZCBA 4RGMA 2CJNA 3BVZA 2IJ0A 3KW5B 3ZRCA 1STEA 1N62A 1EF5A 2NR2A 2G1EA 4IC7B 4G50A 2ONQA 2WXHA 3R7RA 3ZW3A 4LNKA 1FNUA 2DZKA 3GE3C 3NS1A 3SEBA 3ZLZA 1K53A 2X8XX 1LM8B 2NBWB 2AWTA 2KMMA 2JZ3B 1PFDA 2E3TA 2WXIA 4WIPA 5TR5A 3UF8A 4IM2A 2IY1B 4HEA1 2N9PC 4I6NB 1WGRA 3ZYYX 3EHVA 5DPRA 2GBNA 4YSZB 3NOBA 2IYDB 4MGYE 4JWSC 4TMAB 1KOTA 2DNFA 1TIFA 5I4DA 3I3TB 3Q2AC 3JSVB 2B76B 1TS5A 2DYOA 5GMVA 4WJOA 4MH0E 2WXKA 1KLVA 2KQ4X 3KUZA 2JT4B 3N9YC 1T5XD 4OVZA 2NCNA 2PTLA 1WGGA 2CHWA 2KVRA 1M4VA 5E6JA 1I4PA 2BS4B 3AE5B 3UI3A 3ZVVA 2OJRA 1FRRA 2Y3AA 1SGHA 2SEBD 3QK0A 2MH7A 2K25A 2N0SB 3UQAA 1FPYA 1VJKA 1P98A 4XWWA 1VZ7A 4C4VA 1Q5WB 2IGHA 1V1PA 3MC8A 4DXFA 4G3XB 3IFWB 1ROEA 4DHJD 1M94A 1IGDA 4A90A 2KJ6A 4ZOHC 2FCNA 4BOZB 2J0KA 3B2FA 3Q8FA 3GB1A 4OZCA 1UGJA 2LVQA 4JLCA 4A9AA 3QQ8B 4US8A 3MHSD 5EDSA 2ZW1A 1TBEA 3C0RB 3IAS1 1NI3A 5FKAC 3TUOA 4K7SA 1YX5B 1WXSA 2HJ8A 1JWAD 4PT5A 3DDCB 3DHHC 3PO0A 1F1HA 3PZDA 2N7EA 1MJDA 3CWIA 3SHQA 3DOWA 3BYYB 3ZDTA 2C60A 4WWNA 2BT6A 4AJWA 4IUMB 1P9DU 2JF5A 4AS1A 2K6QA 4TKNA 1FNVA 4II3B 4A6QA 2L00B 1MG4A 1HEZE 2GB1A 4DBGA 1ENFA 5FR6A 3Q69A 3QX1A 2KLGA 3TEWA 3Q3JA 4US9A 1KRHA 2MBEA 2KDEB 2MW5A 2IZVB 1HQRD 1EUVB 1P1AA 2BBCA 5G5GA 3DVGX 3OAWA 1A5RA 1Q10A 1QOFA 2WNMA 2DAJA 3CF6E 3A9JA 1R7SA 4K7UA 2RR9A 1CMXB 3PT2B 2INDC 3I9V1 1I4HA 1I4RA 2ZPNA 1E6EB 3T3OA 3U52E 3CSFA 2KC1A 1OGWA 2LRWA 2KFKB 3VRBB 3WALA 2RSUA 3ML8A 3NRZA 2LGIA 1SE9A 3P2BA 2ACZB 4EE2A 2JX5A 5C23A 1WXMA 3IVFA 1I42A 5E6OA 4S17A 4FXCA 2LI5A 3AEFB 4TQ1A 2LGYA 2K0PA 1JWMD 1PUTA 2EELA 2FNJB 3PGEA 1WXAA 1IPGA 2CU1A 4LDTB 1UBIA 1VRAB 3KVFB 2DZIA 2AL6A 2D3CA 3V3XA 3FKYA 3WAPA 3ZTDA 1NYQA 1WYGA 1WXQA 3UQBA 1F77A 3NHEB 2OOBB 5LXIB 3CIRB 1SEBD 2LXCA 3OLMD 3HUIA 5EE0A 1V8CA 2G4DB 1TY0A 3VUYA 3J9CA 1T6BX 2A4ZA 2D3GA 3TEYA 1RYJA 3GZNI 4C4VB 2YEPF 4ITKA 1V1PB 4ANWA 3AI5A 1ET9A 4TV3A 1JMLA 1E8WA 2O2VA 3VR9B 2BWFA 2GBMA 3TBLD 4BKGA 5L95C 3ZXVA 2C7HA 1JW9D 1Z2MA 3P4QB 2LGDA 4WJNA 2DWQA 3B9JA 4EZKA 1FXAA 3Q8CA 1CZPA 3QARA 1XLOA 5KHQA 1ZOYB 3VUWA 3KUDB 2HD5B 3P1MA 5AZHA 1OQYA 3SR6A 4NQKE 4DHZE 2XK5A 4KDLB 1EM7A 3RN9C 3V62A 1UGMA 3AV8A 1I7HA 1E0ZA 4FN2A 2D3AA 1ESFA 2BPSA 5MPOA 4GDLB 4JPSA 3M3JA 1IGCA 1B9RA 4A20A 3FC4A 2GMIC 3LJ3A 4J3OD 1QLBB 2V4LA 4NNJB 5J2RA 1LXDA 4EEWA 5LXHA 2BKRB 2FIDA 1ZE3D 5G2NA 4OZAA 1WSPA 4HK2A 3EECA 2FAZA 4XWTA 2E6XA 3TMPB 1P0RA 1FXIA 1ZKHA 1S1QB 1JRUA 2XBBC 5G5HA 1ZPSA 3W5UB 2PMVA 2AYOB 1XT9B 1D6EC 2PJHA 3Q14C 1N6ZA 4AQ7A 2FUG1 2O6VA 3SDLC 4ZDVA 5JHBA 4HROA 4LTUA 2Z59B 4II2B 4X57B 2L0TA 2GBJA 2J42A 1L0VB 2GRIA 4KZCA 3DCGA 2G4SA 4YTMB 3VVWB 3NVVA 2G3QB 5IN7A 4G11A 2KTRA 2WXFA 2IBIB 1J7BA 2NMQA 4WWMA 3VH3B 4MJSB 3GE8C 5D3DA 4YT0B 4P1CC 4RF0A 4IWQA 1K50A 3EFUA 3KYCD 2WLBA 4WQMA 3NVWA 2Z8LA 1TKEA 2LHDA 1D3ZA 2RDGA 3H7SA 3V61A 3DBRB 2MX2A 4HLEA 3RCZA 3DBHI 1G6JA 4GIVA 2D2QA 2PVOD 3A1QA 1HTOA 2DYMA 2X38A 1RM6C 2YLMA 2IO3B 1C4CA 4OVVA 1JROA 3IAM1 2DHZA 2N9EB 2WX1A 2ZNVB 3H6NA 4IDIA 1R4MB 5BO4B 1H4RA 2KWCA 2MQJA 4WWOA 4IG7B 1WR1A 1WI0A 1WJNA 5IAAC 2C9WB 5DPTA 3RT3B 2KACA 2MSED 4YL8A 3TJPA 1VZ8A 4BOSC 1P3QU 4MT5A 3EGRA 2VZKD 3AXCA 2JVCA 2L7RA 4GU2A 4RMAA 2BYFA 1HE8A 1T0YA 4B9KA 2O2VB 2MBOA 3I63C 2L3ZA 2GI9A 2RDBC 4N9F4 4ZRIA 2AL3A 3N1YC 1YN3A 2K6DB 4GDKA 1FFUA 3W1YA 4W9LA 2LD9A 2LWPA 2RPQA 4KKIA 5BYSA 3PS6A 1NEKB 1K8RB 1P7FA 1FD6A 2XK5B 4HCPB 4LJOB 2D10A 3AN1A 4IWPA 4LDTD 2MEKA 1WJ4A 1SXTA 1YMHE 1WXVA 3M95A 5HI1A 5IOIA 2KN4A 2K3UA 5CHFA 1YQ4B 3PHXB 4LJPB 2JU6X 1L7YA 3RZFA 1VLBA 2L05A 2BTEA 4K3BA 4WAAA 2JRIB 3RNCC 4I6LB 2GBRA 2ZPYA 5H8YE 4FA6A 4N59A 1WE6A 3QA8A 1GUAB 3L17A 4P16A 5J18A 2MP2B 4PS7A 3A4SC 1J7AA 3KQ4A 3IXSA 2KK8A 4C7ZA 2XNAC 3AEEB 1WWTA 4REZA 4E3CA 4QAYA 2MBQA 1WGDA 3BIID 2MLBA 4IM3A 4D2KA 3APDA 2PKOA 4RCOA 5DCNA 3GS2A 2WXOA 3EUB2 3EFCA 2BW2A 1LFDA 5T8IA 1OQRA 2KZRA 1I4GA 2L76A 2Q5WD 2H88B 3B0AA 2PE9A 3HVDA 1MHHE 1FFVA 2KTRB 4NJ6A 4IW0A 3PRZA 1N5WA 1V9JA 2JSVX 3Q8BA 3DHGC 2NBVB 2D07B 4EZLA 4PYZA 3KLSX 5C1ZA 4ZYSA 4DHZB 1KLUD 2PPHA 3H1UA 4H2AA 1SJHD 3OJ4B 4MEMA 3QHTA 4WURA 3MJWA 1ZDVA 4M8NA 2YVCA 3X23A 1YIWA 3ZNID 1NVID 2N9KA 1E7VA 3AULA 5HKHA 3AEAB 3Q3MC 1N61A 3A4RA 1ET6A 2KDMA 3AMZA 4KKJA 2ON8A 4WWPA 4RM8A 5JH5C 2ZEQA 1XLPA 1I35A 4EKUA 5AUIA 5DPWA 3SFEB 3NVZA 3AE2B 4JX1C 3B08A 2WP9B 3IG3A 4ZRJA 3GZNB 3ML9A 2NTSA 2CU3A 1AWDA 2QDFA 3NVYA
chains in the Genus database with same CATH topology
1I4RA 4IOIE 3AE3B 1E6EB 3T3OA 1D4BA 1WGKA 1SE3A 3U52E 2QIEB 3AEGB 1YNTE 2J52A 5C3JB 3AE1B 3VRBB 1Y56A 2HDEA 3Q8EA 3URYA 1FIQA 1KLGD 4KGSA 1GB1A 3NRZA 3RFZB 2LGIA 2JZPA 1YJIA 2ACZB 1PYWD 4EE2A 2JX5A 2ZW0A 2D5GA 4YXDB 2V3PA 1C9FA 2M0AA 1DOIA 4OW0A 3ZGZA 4FXCA 4MACA 3AEFB 2IGDA 4TQ1A 2K0PA 3MJ5A 1JWMD 1KH0A 3R2TA 5JXVA 4ARIA 1PUTA 1C4PA 2EELA 2ICIA 1TS3A 3W1SA 4GDKB 1L4DB 4L23A 3MHZA 1K51A 4Q2JA 2WXMA 2MJ3A 1EU3A 1YQ3B 2L32A 2WQYB 1TS4A 4DQOC 4KGTA 2PLPA 3PZ8A 3R8BA 5LNK1 1VRAB 4XDDA 1BUIC 3ZQ4A 3VR8B 1NENB 4OHJA 1LO5D 3V3XA 3GP7A 3W2DA 2QEJC 4B0EA 3HVZA 1OQQA 1PGXA 1NYQA 1SJED 1L0XB 1WYGA 1WXQA 1T3QA 4N6EB 2V3NA 1F77A 1C79A 2LUMA 2LFIA 1L0YB 2BS2B 2FBWB 1HXYD 3CIRB 1SEBD 2AQ1B 4C80A 1DYQA 1N60A 2MJDA 4NJCA 2JXTA 2WS3B 3HUIA 2WXJA 5EE0A 1V8CA 4ZRPA 2BB6A 3C8YA 1XEEA 1YN4A 4LLGM 1FRDA 3H8HA 1SBBB 2XN9C 3W5VB 1I4QA 1TY0A 2M19A 2L52A 1FO4A 1MHXA 2W3RA 3J9CA 1P7EA 2LHEA 1VZ6A 1T6BX 1J7CA 2DLBA 3AH7A 2M56B 1SE2A 2L1AA 3ZJVA 1XXGA 1B1ZA 1CQVA 1K52A 2SAKA 4HRSA 3HRDD 3PZ7A 2I2YA 3W9CB 3AE4B 3TEYA 1MPEA 1RYJA 5BMGA 2YEPF 4ITKA 5D7GA 1V1PB 4LK0M 1TYGB 4L1BA 3ZJUA 1XLNA 1QOAA 1ACCA 2LJIA 1ET9A 2WXNA 1JMLA 3VR9B 4ARCA 4KX6B 4HKQA 1QT9A 3P42A 4HKZE 1JW9D 3P4QB 2R61A 5FR3A 1DOXA 2K9XA 1GB4A 5HFYA 4XDCA 2PW9A 3O13A 2DWQA 2BYTA 1UWMA 2WDQB 1FCCC 1JWUD 1JQ4A 5TSSA 1SE4A 3LB8C 1I4XA 3B9JA 1FXAA 3Q8CA 4MH8A 1CZPA 4TSSA 1XLOA 3I57A 2MJEA 4HJGE 1ZOYB 2WDRB 1MVKA 3P1MA 2Y5CA 3SR6A 4TQ0A 2PVGC 1EM7A 1D5MC 2OHFA 5FK9C 3AV8A 3VQIA 1I7HA 3LYYA 1E0ZA 2J53A 1RWSA 2AX5A 3IT4B 3DWGC 1ESFA 2CJOA 4B0MA 2EKIA 3P4PB 2AQ3B 3BWUD 5MPOA 2N9LA 4GDLB 1DOYA 1NYRA 4JPSA 1SIJA 1AW7A 1IGCA 1L6UA 3FILB 1C77A 1DGJA 1B9RA 3FC4A 4J3OD 2WXGA 1QLBB 1JALA 1SB3C 1ZUD2 3ZJTA 3MC0B 1QOBA 1ZE3D 5BYRA 3TSSA 3AE7B 4OZAA 1WSPA 1EWYC 4C7YA 3U7ZA 4XWTA 4YSYB 2V0GA 2E6XA 1GOZA 4RFBA 1FXIA 1PDXA 3SFDB 4KGRA 1UNSA 1AN8A 1HZ5A 5G5HA 1CJEA 3AB5A 1E9MA 1ZPSA 3WCQA 3W5UB 2PMVA 5EE1A 2WDVB 1D6EC 4UDUC 1UUPA 3AE8B 4AQ7A 1IBXB 4MM3B 2FUG1 1BMLC 4HROA 4LTUA 3DWMA 2J42A 3MP9A 2LMCA 1L0VB 1QILA 1SSNA 2GRIA 2QMTA 1C76A 4GLSC 4A8XC 1QQRA 1PGAA 3MFGA 1YN5A 4YTMB 2BS3B 2KWDA 3NVVA 1FCLA 1WRIA 1CK1A 3NUHB 4NZLB 3T3NA 1F0ZA 1EWCA 4YWGG 1V1OA 2WXFA 2V4IB 5BYQA 5BMHA 1C4AA 1TKGA 1J7BA 2NMQA 2PIAA 4M0WA 3FAHA 4JE3B 4WWMA 3AE9B 3RPFC 3U2SC 2W82A 3BZDB 4WH4A 3OWEB 5D3DA 4OZBA 4RNAA 2IGGA 1E10A 4YT0B 4RF0A 1FMAD 3IT6B 1K50A 1QOGA 2WXRA 3B2GA 4ZRQA 1GPXA 1XF5L 5EE3A 2J4XA 1HA5A 2WLBA 4WQMA 3NVWA 2Z8LA 3TEZA 2K5PA 1TKEA 1KTKA 2LHDA 1EU4A 2QILA 2RDGA 2RDHA 2G9HD 2L83A 4RF1A 1QF6A 5HHDG 1TJEA 3BK1A 1XLQA 3E9SA 2PVOD 4YTNB 2HTME 2DYMA 2JYEA 2X38A 2W54A 1RM6C 1C4CA 1JROA 3IAM1 2K22A 4RGMA 3P4RB 2CJNA 1VR9A 1RFKA 3BVZA 2IJ0A 2JWUA 4IDIA 1STEA 1N62A 2G1EA 2TSSA 2JYTA 2ONQA 2WXHA 2LEKA 3P63A 1FNUA 3NS1A 3SEBA 5BMIA 1JWBD 1K53A 2KACA 5D3IB 2WU5B 4NAWB 2N7JA 1VZ8A 2KMMA 2E3TA 1PFDA 1FM0D 3EGRA 4MT5A 2WXIA 4WIPA 5C2TB 3P4SB 2VZKD 4HEA1 3U4EG 4RGNA 3AE6B 5AUKA 1A70A 1KF6B 3ZYYX 3KWVA 4RGTA 4YSZB 2DBYA 2GI9A 1JRPA 2I38A 2NTTA 4JWSC 4TMAB 4RH6A 1N63A 2RPVA 4P6VF 1YN3A 4YSXB 2WXPA 2IDYA 1FFUA 1AYFA 1SF0A 1BXTA 1IBXA 1ZP0B 5I4DA 4KKIA 5BYSA 1C78A 2VZKB 1HZ6A 1NEKB 2B76B 1TS5A 2DYOA 3AECB 4DXGA 2WXKA 1JWSD 2JQRB 1P7FA 2KQ4X 1FD6A 5EE9A 3LXFA 1T5XD 3N9YC 1D5XC 4OVZA 3TEXA 1ZXHA 2INNE 1TKYA 4ZHPA 3AN1A 2MEKA 3KWLA 4R3DA 1SXTA 2PTLA 1YMHE 5HI1A 2KN4A 2K3UA 4USAA 1YQ4B 4L2YA 5HG2A 1D5ZC 1FNWA 5GXGB 2JU6X 1OFFA 1M4VA 1L4ZB 3R2IA 2OEDA 1VLBA 5E6JA 2BTEA 1I4PA 1E7PB 2BS4B 4CQNA 3AE5B 3UI3A 2H89B 1IUEA 3VRAB 1VDVA 1FRRA 2Y3AA 2SEBD 2MH7A 5H8YE 1YJJA 2N0SB 2FE8A 1XCQL 4N59A 2W55A 4P16A 1L5PA 4NAMA 1VJKA 3BVGA 1XCTL 2KAJA 1J7AA 1UWXA 4XWWA 1VZ7A 3KQ4A 3IXSA 2IGHA 1V1PA 2INPE 4DXFA 4C7ZA 1ROEA 1IGDA 2XNAC 3BVMA 4ZOHC 4A90A 3AEEB 1WWTA 3B2FA 4REZA 3Q8FA 3GB1A 4OZCA 1UGJA 4A9AA 4US8A 2ZW1A 3BIID 4D2KA 1V97A 2PKOA 3E56A 4RCOA 3GS2A 1ZXIA 3IAS1 1L6VA 3V05A 2WXOA 1NI3A 2IPKD 3EUB2 5FKAC 2BW2A 3TUOA 5T8IA 1OQRA 1KFYB 1ZDXA 3AEBB 3AM9A 4IKGA 1I4GA 1JWAD 2WU2B 2Q5WD 3BK2A 2H88B 4PT5A 4XE0A 3EA6A 3HVDA 4RGOS 1MHHE 3PO0A 1FFVA 5H92C 2W3SA 4YTPB 3BYTB 3CWIA 4N58A 3BYYB 3L4PA 1N5WA 2JSVX 1GAQB 3Q8BA 4ZHOA 2QJLA 2BT6A 2RMMA 3ABVB 1TS2A 2Y5PA 3KLSX 4AS1A 4ZYSA 1KLUD 4A55A 1FNVA 4A6QA 2AQ2B 1N5XA 4H2AA 1HEZE 1SJHD 2GB1A 3FILA 2WXLA 1ENFA 4WURA 3Q8AA 3Q69A 1ZDVA 2YEPB 4WAFA 3TEWA 2QSDA 1FEHA 1F2RI 1NVID 2N9KA 4US9A 1PGBA 1KRHA 3AEAB 1N61A 4O1NA 1ET6A 2KDMA 1HQRD 3AMZA 4KKJA 2ON8A 2BBCA 5G5GA 4C56C 1XLPA 5AUIA 3NZ3A 2BB5A 1XO3A 3SFEB 1Q10A 1QOFA 3NVZA 3AE2B 1MI0A 4JX1C 2WNMA 2WP9B 1QKZA 3ETRA 1TZOA 1R7SA 2WXQA 1JCKB 1TY2A 2CU3A 2NTSA 4JWUC 1F2RC 1AWDA 3AEDB 3I9V1 1I4HA 3NVYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2LHD A;  4IOI E;  3UI3 A;  1FCC C;  1D4B A;  1YNT E;  2J52 A;  5HHD G;  4HJG E;  4KGS A;  1XCQ L;  1GB1 A;  1MVK A;  2LGI A;  2JZP A;  1XCT L;  2ZW0 A;  1EM7 A;  1UWX A;  1C9F A;  2IGH A;  2J53 A;  1IGD A;  4MAC A;  2IGD A;  2K0P A;  2JWU A;  3GB1 A;  4OZC A;  1KH0 A;  2N9L A;  5JXV A;  2ZW1 A;  2EEL A;  1IGC A;  4D2K A;  3FIL B;  2ONQ A;  5BMI A;  1K51 A;  1K53 A;  2KAC A;  4IKG A;  2N7J A;  4KGT A;  1MHH E;  2PLP A;  4OZA A;  3V3X A;  4KGR A;  1HZ5 A;  1PGX A;  2JSV X;  2RMM A;  2LUM A;  2GI9 A;  1IBX B;  2I38 A;  2JXT A;  2RPV A;  1HEZ E;  2GB1 A;  3FIL A;  3MP9 A;  2QMT A;  4GLS C;  1IBX A;  1PGA A;  2QSD A;  1F2R I;  2N9K A;  1HZ6 A;  1PGB A;  1MHX A;  2KWD A;  1P7E A;  2LHE A;  1FCL A;  2KDM A;  1K52 A;  1P7F A;  2KQ4 X;  2ON8 A;  5BMH A;  2I2Y A;  1FD6 A;  2NMQ A;  1MPE A;  5BMG A;  1ZXH A;  4WH4 A;  1Q10 A;  2PTL A;  4OZB A;  1MI0 A;  1YMH E;  2IGG A;  1JML A;  5HI1 A;  2KN4 A;  1QKZ A;  1K50 A;  1XF5 L;  4HKZ E;  5HG2 A;  2JU6 X;  1F2R C;  1GB4 A;  5HFY A;  2OED A;  2PW9 A; 
#chains in the Genus database with same CATH topology
 4GGQ A;  4W9I A;  3JYU A;  4IM0 A;  3DBL B;  1YNT E;  5C3J B;  1XD3 B;  3AE1 B;  4GXB A;  3MTN B;  3PRE A;  1NBF C;  1Y56 A;  1FIQ A;  1KLG D;  4HPP A;  1L2N A;  2BWE S;  2HTH A;  3ZNG C;  4WQO B;  2D5G A;  3V60 A;  2V3P A;  2M0A A;  4JIO U;  3RD2 A;  2EMT A;  3ZGZ A;  3EC8 A;  3R2T A;  3L13 A;  4ARI A;  2ZJD A;  1TS3 A;  3W1S A;  4GDK B;  4P7I A;  4L23 A;  3OG5 A;  2MJ3 A;  4E74 A;  4F7Z A;  3PZ8 A;  2CR5 A;  4XDD A;  1NEN B;  4HVB A;  1LO5 D;  3W2D A;  1PGX A;  4BKS D;  3MC9 A;  2V3N A;  2LUM A;  2LFI A;  2MJD A;  4NJC A;  2JXT A;  2WS3 B;  2WXJ A;  4KVG B;  4ZRP A;  1WFY A;  4FJZ A;  2M8S A;  3M62 B;  4GSW A;  1J8C A;  3N30 A;  2KQS A;  2XN9 C;  2QC8 A;  2CS4 A;  1FO4 A;  1P7E A;  1WZ3 A;  2LHE A;  3AH7 A;  1SE2 A;  2KD0 A;  1XXG A;  1E7U A;  2SAK A;  2XEW A;  3A33 B;  2QCZ A;  1WMH A;  4W9C A;  5D7G A;  3ZNZ B;  3DHI C;  2RD0 A;  2LAS A;  2KWV B;  3UIN B;  2LUE A;  2R61 A;  5FR3 A;  1DOX A;  1UF0 A;  4A3P A;  5HFY A;  4XDC A;  2PW9 A;  1JWU D;  4PS8 A;  1JQ4 A;  5TSS A;  1I4X A;  4MH8 A;  3RYT A;  2JPH A;  1WGY A;  1WJ6 A;  3QCA A;  4HDQ A;  1HTQ A;  4FHJ A;  3UIO B;  3TCA A;  4HPL B;  1D5M C;  1RWS A;  2KMA A;  4GN1 A;  4WJP A;  2CJO A;  3QAQ A;  3U7D A;  4B0M A;  2R2Q A;  1OTR B;  2N9L A;  2MRP A;  4ANU A;  1NYR A;  3OJ3 A;  3SU8 X;  1L6U A;  4HCN B;  4CO7 A;  1C77 A;  4AJY B;  2BGF A;  2KC2 A;  1JAL A;  1SB3 C;  3MC0 B;  3ALB A;  4FUL A;  3ZO5 B;  3JW0 X;  3Q3N C;  1EWY C;  2KLC A;  4ICV A;  2V0G A;  1GOZ A;  4KGR A;  1HZ5 A;  3ZIM A;  1E9M A;  5EE1 A;  2WDV B;  1UUP A;  3PRM B;  3C19 A;  4FJY A;  3N32 A;  1QIL A;  1SSN A;  2QMT A;  3GOE A;  4KSL C;  3MFG A;  2D3B A;  2BS3 B;  1WRI A;  3HIZ A;  4NZL B;  4PS3 A;  1F0Z A;  1V1O A;  1C4A A;  1TKG A;  4M0W A;  3AE9 B;  3RPF C;  1F52 A;  4WH4 A;  3HHM A;  3N20 C;  4RNA A;  2A5U A;  4KSK C;  1FMA D;  5EE3 A;  1YOV B;  2LRU A;  3L08 A;  1LGR A;  4AUQ C;  2RDH A;  2G9H D;  4ASW C;  1H8C A;  2MWS B;  2QHO A;  3ZRF A;  1QF6 A;  3BK1 A;  1BT0 A;  1XLQ A;  4AOF A;  3K9P B;  4YTN B;  2HTM E;  2IO0 B;  2RGF A;  3U30 A;  3QWZ B;  4K3C A;  1R4N I;  3P4R B;  1VR9 A;  1RFK A;  4XC2 A;  2KYW A;  4EUT A;  4FAD A;  3I5J C;  1Q0W B;  1WH3 A;  2KT7 A;  2TSS A;  2JYT A;  3N3K B;  3A9K A;  1GNU A;  1E8Z A;  5CHV C;  5BMI A;  1JWB D;  4M8M A;  2N7J A;  1FM0 D;  3BY4 B;  5C2T B;  3P4S B;  1WY8 A;  1QZE A;  3APC A;  1WMH B;  2KOX A;  3U4E G;  3UGB B;  4RGN A;  3VFK A;  4LNO A;  3AE6 B;  5AUK A;  3KWV A;  4CHK A;  4RGT A;  3VDZ A;  2DBY A;  1GC7 A;  4K1R B;  1JRP A;  2REX A;  2I38 A;  2NTT A;  3DBS A;  4RH6 A;  1N63 A;  2RPV A;  3CST A;  3QIJ A;  2WXP A;  1J19 A;  2IDY A;  2Z0E B;  1IBX A;  1BXT A;  1T0Q C;  1ZP0 B;  2MBB B;  4XYC A;  1C78 A;  4NQL B;  4DXG A;  4FBJ B;  1JWS D;  4K81 A;  1WIA A;  2JQR B;  5EE9 A;  3TEX A;  2NVU I;  3A9J B;  1ZXH A;  2INN E;  4ZHP A;  4KDI C;  1IP9 A;  2CHZ A;  2FCM A;  4USA A;  4MGZ E;  2WYQ A;  4FHK A;  5HG2 A;  1D5Z C;  1ZW7 A;  2HJ1 A;  1FNW A;  1L4Z B;  3R2I A;  2OED A;  1E7P B;  4CQN A;  2H89 B;  1IUE A;  3VRA B;  4FJV B;  1V49 A;  4BAX A;  4BZA A;  1E5W A;  4B95 A;  2FE8 A;  3PHW B;  2W55 A;  3KH0 A;  4DK5 A;  4NAM A;  3M63 B;  2NBU A;  1XCT L;  4P1B C;  2R2O A;  1S3S G;  2WWZ A;  1V97 A;  5CX3 A;  1L6V A;  3V05 A;  3TIX A;  2Z0D B;  5CTR C;  3RMK C;  2IPK D;  4HJK A;  1KFY B;  3AM9 A;  4IKG A;  2WU2 B;  2ZZP B;  4XE0 A;  3EA6 A;  4RGO S;  1GG3 A;  5H92 C;  4PK1 A;  3DVG Y;  5AZG A;  4N58 A;  1LQB A;  4W9H A;  5JZE B;  2BVC A;  1KJT A;  3L4P A;  2QJL A;  2KJH B;  3RZW C;  3ABV B;  1TS2 A;  1C1Y B;  4A55 A;  2BQQ A;  1N5X A;  3BIN A;  3FIL A;  2WXL A;  3T9L A;  3Q8A A;  1TGZ B;  4WAF A;  1F2R I;  1MG8 A;  2UWQ A;  4RM9 A;  4O1N A;  3IBE A;  4ANX A;  3DVN V;  1MFW A;  5CHW A;  4XX5 A;  4C56 C;  2KO3 A;  2VRR B;  1XO3 A;  1MI0 A;  4W9J A;  4MGI E;  1QKZ A;  3ETR A;  1V2Y A;  1TZO A;  2WXQ A;  4KV2 A;  4MM3 A;  3ENE A;  4JWU C;  1F2R C;  3AED B;  3AE3 B;  1D4B A;  1SIF A;  1WGK A;  1WYW B;  2QIE B;  3AEG B;  1J0G A;  2J52 A;  3RNA C;  3Q8E A;  3URY A;  4KGS A;  1GB1 A;  4GB9 A;  2JZP A;  2JXX A;  1YJI A;  4W9D A;  4YXD B;  2KN5 A;  3N1Z C;  1C9F A;  1DOI A;  1ISN A;  2ZVO A;  2N4F A;  4MAC A;  4DDI D;  3MJ5 A;  1KH0 A;  5JXV A;  3U8Z A;  3MHZ A;  2BYE A;  3HK0 A;  4ZYN A;  1GJZ A;  1K51 A;  4A3O A;  4W9K A;  4Q2J A;  2WXM A;  1T0R C;  1YQ3 B;  4OVU A;  2L32 A;  4M02 A;  1TS4 A;  4KGT A;  3ZQ4 A;  3VR8 B;  3R3M A;  2IO1 B;  4F1S A;  3GP7 A;  3R66 C;  1L0X B;  2O6V B;  1EF1 A;  1T3Q A;  2JUO A;  1C79 A;  1GC6 A;  2N9X A;  2DYB A;  4BBN C;  2AQ1 B;  4C80 A;  4CYE A;  1YD8 U;  1YN4 A;  4LLG M;  2KTF A;  3H8H A;  3W5V B;  1I4Q A;  2M19 A;  4MGK E;  4NAW A;  1V80 A;  1J7C A;  1WJU A;  2DLB A;  2M56 B;  4AWJ A;  3TL5 A;  4HRS A;  3HRD D;  3PZ7 A;  3Q6B A;  2I2Y A;  1MPE A;  5BMG A;  3SD5 A;  4LK0 M;  1TYG B;  4L1B A;  3ZJU A;  3RNB C;  1QOA A;  2LJI A;  3VXW A;  4ARC A;  4KX6 B;  3AU4 A;  2K9X A;  1GB4 A;  2BYT A;  3A1Q B;  1UWM A;  2WDQ B;  2LZ6 A;  4LCD E;  4NJ7 A;  1SE4 A;  2KDB A;  1YQB A;  4TSS A;  2KQ7 A;  1Y8R C;  1OEY J;  2ZCC A;  2KDF B;  2MJE A;  1TTN A;  4HPM B;  2WDR B;  1F9J A;  2Y5C A;  2G45 B;  2KFK A;  4JGH B;  2OHF A;  3VQI A;  4B6W A;  1KM7 A;  3LYY A;  2CKH B;  1E8Y A;  2AX5 A;  3IT4 B;  1WZ0 A;  5L83 A;  2LGS A;  3DWG C;  4C00 A;  4NPN A;  1SIJ A;  1AW7 A;  3FIL B;  1R4N B;  2PEA A;  1E90 A;  1ZUD 2;  3ZJT A;  3QC8 B;  3RUI B;  4PYU A;  5BYR A;  4C7Y A;  2I1J A;  4LNN A;  3SFD B;  1UNS A;  1CJE A;  3K9O B;  3WCQ A;  2W9N A;  2KXJ A;  4UDU C;  4MM3 B;  3PVL A;  2VH2 A;  4WJQ A;  2FUH B;  2KHW B;  3MP9 A;  1PQS A;  2LMC A;  3NG0 A;  3DBR I;  2VH1 A;  3ZTC A;  4A8X C;  2K39 A;  2AEH A;  1QQR A;  1PGA A;  3RNE C;  2L0F A;  4MSM B;  3V6C B;  2KWD A;  1FCL A;  3T3N A;  1EWC A;  2V4I B;  1UEL A;  3ZNH B;  2OJW A;  2PIA A;  3FAH A;  4EZJ A;  2W82 A;  5AEK B;  3R7Q A;  3QJZ A;  3OWE B;  1R4M I;  4HWI B;  3IT6 B;  1QOG A;  4ZRQ A;  3B2G A;  1GPX A;  1XF5 L;  2J4X A;  3RUL A;  1HA5 A;  4BVU C;  1V5O A;  3TEZ A;  1KTK A;  1EU4 A;  2QIL A;  3V6E B;  4NY0 A;  1TJE A;  2MBH A;  4ZRK A;  2ZNV C;  2JYE A;  2W54 A;  1RAX A;  3PSE B;  2JY6 A;  4MDK E;  3B1L X;  2NPT A;  3S2A A;  2KFJ A;  1V81 A;  2JWU A;  1WF9 A;  2KX0 A;  4HDO A;  4M01 A;  2V1Y A;  2M1M A;  4GMV A;  3AU5 A;  4HXD A;  4J6I A;  1VD2 A;  2LEK A;  3P63 A;  4GDL A;  1FXT B;  5D3I B;  2WU5 B;  4NAW B;  2JWZ A;  4BKT A;  1UBQ A;  3DBH B;  3VHT C;  1WX9 A;  3ZDM C;  5D2M B;  4MEL A;  2FCQ A;  1A70 A;  1KF6 B;  4URK A;  3WAN A;  1IYF A;  2DX5 B;  2ASQ A;  1TT5 B;  2LVP A;  2N1V A;  4FLH A;  2M0X A;  4P6V F;  3NJT A;  2V9H A;  4YSX B;  1AYF A;  1SF0 A;  2VZK B;  2HE7 A;  1YJ1 A;  1HZ6 A;  2LVO A;  2GLS A;  3AEC B;  4GOC A;  1V86 A;  2K8B A;  3LXF A;  1D5X C;  1TKY A;  2L8J A;  3KWL A;  5E6P A;  4R3D A;  4EOY A;  1X1M A;  2WDT B;  4L2Y A;  4MJS A;  5GXG B;  1OFF A;  2DEN B;  1WR6 E;  4ANV A;  2O6V D;  3T8M A;  2J0M A;  3PLU A;  2LXA A;  1VDV A;  1YJJ A;  3L54 A;  2J0J A;  1XCQ L;  4BBN F;  4BKS A;  1L5P A;  3BVG A;  3NY5 A;  3VH4 B;  2KAJ A;  1UWX A;  2EMS A;  2INP E;  3HM6 X;  2WGS A;  3BVM A;  1OEY A;  1Z5S B;  2NS5 A;  3LDZ E;  3H9D A;  4KIK A;  3E56 A;  3WIM A;  1ZXI A;  4I6P A;  3VUX A;  2K8C A;  2GOW A;  5JHA A;  4JL9 A;  1ZDX A;  3AEB B;  1WGH A;  1ZGU B;  3BK2 A;  2IO2 B;  4DWF A;  4LNI A;  2W3S A;  4YTP B;  3BYT B;  1GAQ B;  4ZHO A;  2RMM A;  1UZX B;  1WM2 A;  2Y5P A;  4G0N B;  2AQ2 B;  3VTV A;  3UIP B;  3RNF C;  3DBL I;  2YEP B;  1WX8 A;  2KAN A;  2QSD A;  1FEH A;  1PGB A;  3ZUN A;  3WA0 A;  1UH6 A;  4KZ0 A;  1XQQ A;  4DDG D;  2NPT B;  2N1W A;  3VTU A;  3NZ3 A;  2BB5 A;  3RNG C;  2PE6 B;  1TZ1 A;  1YX6 B;  1RFA A;  1RRB A;  1JCK B;  1TY2 A;  2WHI A;  3VAW A;  2KKC A;  4IOI E;  1V6E A;  3IHP C;  3JVZ X;  1SE3 A;  4EFO A;  2JRH A;  2KNB A;  3DVN U;  2HDE A;  3H7P A;  1C3T A;  1VCB A;  5LLI A;  3RFZ B;  5D94 A;  3WAM A;  1PYW D;  2ZW0 A;  4TUU A;  3ONS A;  4OW0 A;  2ZVN A;  2DAF A;  2MP2 A;  3NZU A;  2IGD A;  2J7Q B;  2V3S A;  2LJ5 A;  1T0S C;  2ICI A;  1C4P A;  4AP4 C;  2N7D A;  3O65 B;  2KX3 A;  5AZF A;  1L4D B;  1EO6 A;  1WX7 A;  5J17 A;  2B3A A;  1EU3 A;  3KYD D;  2WQY B;  3RI7 C;  4DQO C;  2PLP A;  3R8B A;  5LNK 1;  3HM3 A;  1BUI C;  1WE7 A;  4ICU A;  5DPS A;  2Y5B B;  4OHJ A;  4B0E A;  2QEJ C;  3HVZ A;  1OQQ A;  4DXA B;  1SJE D;  2UU7 A;  4N6E B;  2MHJ A;  1L0Y B;  2BS2 B;  3KUC B;  4ACF A;  2FBW B;  1HXY D;  2M17 A;  1NI2 A;  1DYQ A;  1N60 A;  2C7M B;  3DQV A;  2BB6 A;  3C8Y A;  1XEE A;  2WX0 A;  2MCN B;  1FRD A;  1SBB B;  3ZKJ C;  2JZZ A;  2L52 A;  1MHX A;  2W3R A;  2LGX A;  4M0W B;  3CMM B;  4MSQ B;  4DHJ B;  1VZ6 A;  2L1A A;  3ZJV A;  2DZM A;  3L0W B;  2K1F A;  1B1Z A;  1CQV A;  1K52 A;  3ZXR A;  3PTF C;  4W9E A;  3W9C B;  3AE4 B;  2IY0 B;  3D32 A;  1UD7 A;  5IKC M;  1XLN A;  1ACC A;  2WXN A;  3ECI A;  4HKQ A;  3WAO A;  5D6J B;  4XZ4 A;  1QT9 A;  3P42 A;  4HKZ E;  3Q3F A;  4KIK B;  3L10 B;  3NZS A;  4IWO A;  4M00 A;  3O13 A;  2DZJ A;  2CHX A;  2BF8 B;  1FCC C;  1Q1O A;  3LB8 C;  2FCS A;  2C5L C;  3I57 A;  3N1X C;  4HJG E;  3JSV A;  5IA7 A;  1MVK A;  1WM3 A;  4TQ0 A;  2PVG C;  5FK9 C;  2J53 A;  2K8H A;  3A9K B;  3X0W A;  2EKI A;  3P4P B;  2AQ3 B;  3BWU D;  5IP4 D;  1DOY A;  3PV1 A;  2KWU B;  5KHO A;  1E8X A;  1DGJ A;  2WXG A;  1QOB A;  1AAR A;  3Q3O C;  2BKF A;  3TSS A;  3AE7 B;  2UYZ B;  4XGA B;  3U7Z A;  4YSY B;  2M4N A;  2D11 A;  4RFB A;  1PDX A;  4E71 A;  1AN8 A;  1RLF A;  1V5T A;  3AB5 A;  1NDD A;  3AE8 B;  1IBX B;  1U4A A;  1WRD B;  1BML C;  2INC C;  4S0R A;  3DWM A;  4F8C B;  1C76 A;  2KDI A;  4GLS C;  1YN5 A;  2KJR A;  3PRP B;  5E6N A;  2C7N B;  2MA9 B;  3H7P B;  1CK1 A;  3NUH B;  5G55 A;  3APF A;  4JQW C;  4W9F A;  4YWG G;  5BYQ A;  2EKE C;  3VTW A;  4LNF A;  5BMH A;  4W9G A;  3W1S C;  4JE3 B;  2FIF A;  3U2S C;  3BZD B;  3NS8 A;  4OZB A;  2IGG A;  1E10 A;  2I1K A;  2BYV E;  2KVZ A;  4BFR A;  5IO9 A;  3DPD A;  2WXR A;  4K7W A;  3PPA A;  2K5P A;  2L83 A;  4RF1 A;  5HHD G;  3E9S A;  2GBK A;  3PLV A;  2KMC A;  3L16 A;  2K22 A;  2ZCB A;  4RGM A;  2CJN A;  3BVZ A;  2IJ0 A;  3KW5 B;  3ZRC A;  1STE A;  1N62 A;  1EF5 A;  2NR2 A;  2G1E A;  4IC7 B;  4G50 A;  2ONQ A;  2WXH A;  3R7R A;  3ZW3 A;  4LNK A;  1FNU A;  2DZK A;  3GE3 C;  3NS1 A;  3SEB A;  3ZLZ A;  1K53 A;  2X8X X;  1LM8 B;  2NBW B;  2AWT A;  2KMM A;  2JZ3 B;  1PFD A;  2E3T A;  2WXI A;  4WIP A;  5TR5 A;  3UF8 A;  4IM2 A;  2IY1 B;  4HEA 1;  2N9P C;  4I6N B;  1WGR A;  3ZYY X;  3EHV A;  5DPR A;  2GBN A;  4YSZ B;  3NOB A;  2IYD B;  4MGY E;  4JWS C;  4TMA B;  1KOT A;  2DNF A;  1TIF A;  5I4D A;  3I3T B;  3Q2A C;  3JSV B;  2B76 B;  1TS5 A;  2DYO A;  5GMV A;  4WJO A;  4MH0 E;  2WXK A;  1KLV A;  2KQ4 X;  3KUZ A;  2JT4 B;  3N9Y C;  1T5X D;  4OVZ A;  2NCN A;  2PTL A;  1WGG A;  2CHW A;  2KVR A;  1M4V A;  5E6J A;  1I4P A;  2BS4 B;  3AE5 B;  3UI3 A;  3ZVV A;  2OJR A;  1FRR A;  2Y3A A;  1SGH A;  2SEB D;  3QK0 A;  2MH7 A;  2K25 A;  2N0S B;  3UQA A;  1FPY A;  1VJK A;  1P98 A;  4XWW A;  1VZ7 A;  4C4V A;  1Q5W B;  2IGH A;  1V1P A;  3MC8 A;  4DXF A;  4G3X B;  3IFW B;  1ROE A;  4DHJ D;  1M94 A;  1IGD A;  4A90 A;  2KJ6 A;  4ZOH C;  2FCN A;  4BOZ B;  2J0K A;  3B2F A;  3Q8F A;  3GB1 A;  4OZC A;  1UGJ A;  2LVQ A;  4JLC A;  4A9A A;  3QQ8 B;  4US8 A;  3MHS D;  5EDS A;  2ZW1 A;  1TBE A;  3C0R B;  3IAS 1;  1NI3 A;  5FKA C;  3TUO A;  4K7S A;  1YX5 B;  1WXS A;  2HJ8 A;  1JWA D;  4PT5 A;  3DDC B;  3DHH C;  3PO0 A;  1F1H A;  3PZD A;  2N7E A;  1MJD A;  3CWI A;  3SHQ A;  3DOW A;  3BYY B;  3ZDT A;  2C60 A;  4WWN A;  2BT6 A;  4AJW A;  4IUM B;  1P9D U;  2JF5 A;  4AS1 A;  2K6Q A;  4TKN A;  1FNV A;  4II3 B;  4A6Q A;  2L00 B;  1MG4 A;  1HEZ E;  2GB1 A;  4DBG A;  1ENF A;  5FR6 A;  3Q69 A;  3QX1 A;  2KLG A;  3TEW A;  3Q3J A;  4US9 A;  1KRH A;  2MBE A;  2KDE B;  2MW5 A;  2IZV B;  1HQR D;  1EUV B;  1P1A A;  2BBC A;  5G5G A;  3DVG X;  3OAW A;  1A5R A;  1Q10 A;  1QOF A;  2WNM A;  2DAJ A;  3CF6 E;  3A9J A;  1R7S A;  4K7U A;  2RR9 A;  1CMX B;  3PT2 B;  2IND C;  3I9V 1;  1I4H A;  1I4R A;  2ZPN A;  1E6E B;  3T3O A;  3U52 E;  3CSF A;  2KC1 A;  1OGW A;  2LRW A;  2KFK B;  3VRB B;  3WAL A;  2RSU A;  3ML8 A;  3NRZ A;  2LGI A;  1SE9 A;  3P2B A;  2ACZ B;  4EE2 A;  2JX5 A;  5C23 A;  1WXM A;  3IVF A;  1I42 A;  5E6O A;  4S17 A;  4FXC A;  2LI5 A;  3AEF B;  4TQ1 A;  2LGY A;  2K0P A;  1JWM D;  1PUT A;  2EEL A;  2FNJ B;  3PGE A;  1WXA A;  1IPG A;  2CU1 A;  4LDT B;  1UBI A;  1VRA B;  3KVF B;  2DZI A;  2AL6 A;  2D3C A;  3V3X A;  3FKY A;  3WAP A;  3ZTD A;  1NYQ A;  1WYG A;  1WXQ A;  3UQB A;  1F77 A;  3NHE B;  2OOB B;  5LXI B;  3CIR B;  1SEB D;  2LXC A;  3OLM D;  3HUI A;  5EE0 A;  1V8C A;  2G4D B;  1TY0 A;  3VUY A;  3J9C A;  1T6B X;  2A4Z A;  2D3G A;  3TEY A;  1RYJ A;  3GZN I;  4C4V B;  2YEP F;  4ITK A;  1V1P B;  4ANW A;  3AI5 A;  1ET9 A;  4TV3 A;  1JML A;  1E8W A;  2O2V A;  3VR9 B;  2BWF A;  2GBM A;  3TBL D;  4BKG A;  5L95 C;  3ZXV A;  2C7H A;  1JW9 D;  1Z2M A;  3P4Q B;  2LGD A;  4WJN A;  2DWQ A;  3B9J A;  4EZK A;  1FXA A;  3Q8C A;  1CZP A;  3QAR A;  1XLO A;  5KHQ A;  1ZOY B;  3VUW A;  3KUD B;  2HD5 B;  3P1M A;  5AZH A;  1OQY A;  3SR6 A;  4NQK E;  4DHZ E;  2XK5 A;  4KDL B;  1EM7 A;  3RN9 C;  3V62 A;  1UGM A;  3AV8 A;  1I7H A;  1E0Z A;  4FN2 A;  2D3A A;  1ESF A;  2BPS A;  5MPO A;  4GDL B;  4JPS A;  3M3J A;  1IGC A;  1B9R A;  4A20 A;  3FC4 A;  2GMI C;  3LJ3 A;  4J3O D;  1QLB B;  2V4L A;  4NNJ B;  5J2R A;  1LXD A;  4EEW A;  5LXH A;  2BKR B;  2FID A;  1ZE3 D;  5G2N A;  4OZA A;  1WSP A;  4HK2 A;  3EEC A;  2FAZ A;  4XWT A;  2E6X A;  3TMP B;  1P0R A;  1FXI A;  1ZKH A;  1S1Q B;  1JRU A;  2XBB C;  5G5H A;  1ZPS A;  3W5U B;  2PMV A;  2AYO B;  1XT9 B;  1D6E C;  2PJH A;  3Q14 C;  1N6Z A;  4AQ7 A;  2FUG 1;  2O6V A;  3SDL C;  4ZDV A;  5JHB A;  4HRO A;  4LTU A;  2Z59 B;  4II2 B;  4X57 B;  2L0T A;  2GBJ A;  2J42 A;  1L0V B;  2GRI A;  4KZC A;  3DCG A;  2G4S A;  4YTM B;  3VVW B;  3NVV A;  2G3Q B;  5IN7 A;  4G11 A;  2KTR A;  2WXF A;  2IBI B;  1J7B A;  2NMQ A;  4WWM A;  3VH3 B;  4MJS B;  3GE8 C;  5D3D A;  4YT0 B;  4P1C C;  4RF0 A;  4IWQ A;  1K50 A;  3EFU A;  3KYC D;  2WLB A;  4WQM A;  3NVW A;  2Z8L A;  1TKE A;  2LHD A;  1D3Z A;  2RDG A;  3H7S A;  3V61 A;  3DBR B;  2MX2 A;  4HLE A;  3RCZ A;  3DBH I;  1G6J A;  4GIV A;  2D2Q A;  2PVO D;  3A1Q A;  1HTO A;  2DYM A;  2X38 A;  1RM6 C;  2YLM A;  2IO3 B;  1C4C A;  4OVV A;  1JRO A;  3IAM 1;  2DHZ A;  2N9E B;  2WX1 A;  2ZNV B;  3H6N A;  4IDI A;  1R4M B;  5BO4 B;  1H4R A;  2KWC A;  2MQJ A;  4WWO A;  4IG7 B;  1WR1 A;  1WI0 A;  1WJN A;  5IAA C;  2C9W B;  5DPT A;  3RT3 B;  2KAC A;  2MSE D;  4YL8 A;  3TJP A;  1VZ8 A;  4BOS C;  1P3Q U;  4MT5 A;  3EGR A;  2VZK D;  3AXC A;  2JVC A;  2L7R A;  4GU2 A;  4RMA A;  2BYF A;  1HE8 A;  1T0Y A;  4B9K A;  2O2V B;  2MBO A;  3I63 C;  2L3Z A;  2GI9 A;  2RDB C;  4N9F 4;  4ZRI A;  2AL3 A;  3N1Y C;  1YN3 A;  2K6D B;  4GDK A;  1FFU A;  3W1Y A;  4W9L A;  2LD9 A;  2LWP A;  2RPQ A;  4KKI A;  5BYS A;  3PS6 A;  1NEK B;  1K8R B;  1P7F A;  1FD6 A;  2XK5 B;  4HCP B;  4LJO B;  2D10 A;  3AN1 A;  4IWP A;  4LDT D;  2MEK A;  1WJ4 A;  1SXT A;  1YMH E;  1WXV A;  3M95 A;  5HI1 A;  5IOI A;  2KN4 A;  2K3U A;  5CHF A;  1YQ4 B;  3PHX B;  4LJP B;  2JU6 X;  1L7Y A;  3RZF A;  1VLB A;  2L05 A;  2BTE A;  4K3B A;  4WAA A;  2JRI B;  3RNC C;  4I6L B;  2GBR A;  2ZPY A;  5H8Y E;  4FA6 A;  4N59 A;  1WE6 A;  3QA8 A;  1GUA B;  3L17 A;  4P16 A;  5J18 A;  2MP2 B;  4PS7 A;  3A4S C;  1J7A A;  3KQ4 A;  3IXS A;  2KK8 A;  4C7Z A;  2XNA C;  3AEE B;  1WWT A;  4REZ A;  4E3C A;  4QAY A;  2MBQ A;  1WGD A;  3BII D;  2MLB A;  4IM3 A;  4D2K A;  3APD A;  2PKO A;  4RCO A;  5DCN A;  3GS2 A;  2WXO A;  3EUB 2;  3EFC A;  2BW2 A;  1LFD A;  5T8I A;  1OQR A;  2KZR A;  1I4G A;  2L76 A;  2Q5W D;  2H88 B;  3B0A A;  2PE9 A;  3HVD A;  1MHH E;  1FFV A;  2KTR B;  4NJ6 A;  4IW0 A;  3PRZ A;  1N5W A;  1V9J A;  2JSV X;  3Q8B A;  3DHG C;  2NBV B;  2D07 B;  4EZL A;  4PYZ A;  3KLS X;  5C1Z A;  4ZYS A;  4DHZ B;  1KLU D;  2PPH A;  3H1U A;  4H2A A;  1SJH D;  3OJ4 B;  4MEM A;  3QHT A;  4WUR A;  3MJW A;  1ZDV A;  4M8N A;  2YVC A;  3X23 A;  1YIW A;  3ZNI D;  1NVI D;  2N9K A;  1E7V A;  3AUL A;  5HKH A;  3AEA B;  3Q3M C;  1N61 A;  3A4R A;  1ET6 A;  2KDM A;  3AMZ A;  4KKJ A;  2ON8 A;  4WWP A;  4RM8 A;  5JH5 C;  2ZEQ A;  1XLP A;  1I35 A;  4EKU A;  5AUI A;  5DPW A;  3SFE B;  3NVZ A;  3AE2 B;  4JX1 C;  3B08 A;  2WP9 B;  3IG3 A;  4ZRJ A;  3GZN B;  3ML9 A;  2NTS A;  2CU3 A;  1AWD A;  2QDF A;  3NVY A; 
#chains in the Genus database with same CATH homology
 1I4R A;  4IOI E;  3AE3 B;  1E6E B;  3T3O A;  1D4B A;  1WGK A;  1SE3 A;  3U52 E;  2QIE B;  3AEG B;  1YNT E;  2J52 A;  5C3J B;  3AE1 B;  3VRB B;  1Y56 A;  2HDE A;  3Q8E A;  3URY A;  1FIQ A;  1KLG D;  4KGS A;  1GB1 A;  3NRZ A;  3RFZ B;  2LGI A;  2JZP A;  1YJI A;  2ACZ B;  1PYW D;  4EE2 A;  2JX5 A;  2ZW0 A;  2D5G A;  4YXD B;  2V3P A;  1C9F A;  2M0A A;  1DOI A;  4OW0 A;  3ZGZ A;  4FXC A;  4MAC A;  3AEF B;  2IGD A;  4TQ1 A;  2K0P A;  3MJ5 A;  1JWM D;  1KH0 A;  3R2T A;  5JXV A;  4ARI A;  1PUT A;  1C4P A;  2EEL A;  2ICI A;  1TS3 A;  3W1S A;  4GDK B;  1L4D B;  4L23 A;  3MHZ A;  1K51 A;  4Q2J A;  2WXM A;  2MJ3 A;  1EU3 A;  1YQ3 B;  2L32 A;  2WQY B;  1TS4 A;  4DQO C;  4KGT A;  2PLP A;  3PZ8 A;  3R8B A;  5LNK 1;  1VRA B;  4XDD A;  1BUI C;  3ZQ4 A;  3VR8 B;  1NEN B;  4OHJ A;  1LO5 D;  3V3X A;  3GP7 A;  3W2D A;  2QEJ C;  4B0E A;  3HVZ A;  1OQQ A;  1PGX A;  1NYQ A;  1SJE D;  1L0X B;  1WYG A;  1WXQ A;  1T3Q A;  4N6E B;  2V3N A;  1F77 A;  1C79 A;  2LUM A;  2LFI A;  1L0Y B;  2BS2 B;  2FBW B;  1HXY D;  3CIR B;  1SEB D;  2AQ1 B;  4C80 A;  1DYQ A;  1N60 A;  2MJD A;  4NJC A;  2JXT A;  2WS3 B;  3HUI A;  2WXJ A;  5EE0 A;  1V8C A;  4ZRP A;  2BB6 A;  3C8Y A;  1XEE A;  1YN4 A;  4LLG M;  1FRD A;  3H8H A;  1SBB B;  2XN9 C;  3W5V B;  1I4Q A;  1TY0 A;  2M19 A;  2L52 A;  1FO4 A;  1MHX A;  2W3R A;  3J9C A;  1P7E A;  2LHE A;  1VZ6 A;  1T6B X;  1J7C A;  2DLB A;  3AH7 A;  2M56 B;  1SE2 A;  2L1A A;  3ZJV A;  1XXG A;  1B1Z A;  1CQV A;  1K52 A;  2SAK A;  4HRS A;  3HRD D;  3PZ7 A;  2I2Y A;  3W9C B;  3AE4 B;  3TEY A;  1MPE A;  1RYJ A;  5BMG A;  2YEP F;  4ITK A;  5D7G A;  1V1P B;  4LK0 M;  1TYG B;  4L1B A;  3ZJU A;  1XLN A;  1QOA A;  1ACC A;  2LJI A;  1ET9 A;  2WXN A;  1JML A;  3VR9 B;  4ARC A;  4KX6 B;  4HKQ A;  1QT9 A;  3P42 A;  4HKZ E;  1JW9 D;  3P4Q B;  2R61 A;  5FR3 A;  1DOX A;  2K9X A;  1GB4 A;  5HFY A;  4XDC A;  2PW9 A;  3O13 A;  2DWQ A;  2BYT A;  1UWM A;  2WDQ B;  1FCC C;  1JWU D;  1JQ4 A;  5TSS A;  1SE4 A;  3LB8 C;  1I4X A;  3B9J A;  1FXA A;  3Q8C A;  4MH8 A;  1CZP A;  4TSS A;  1XLO A;  3I57 A;  2MJE A;  4HJG E;  1ZOY B;  2WDR B;  1MVK A;  3P1M A;  2Y5C A;  3SR6 A;  4TQ0 A;  2PVG C;  1EM7 A;  1D5M C;  2OHF A;  5FK9 C;  3AV8 A;  3VQI A;  1I7H A;  3LYY A;  1E0Z A;  2J53 A;  1RWS A;  2AX5 A;  3IT4 B;  3DWG C;  1ESF A;  2CJO A;  4B0M A;  2EKI A;  3P4P B;  2AQ3 B;  3BWU D;  5MPO A;  2N9L A;  4GDL B;  1DOY A;  1NYR A;  4JPS A;  1SIJ A;  1AW7 A;  1IGC A;  1L6U A;  3FIL B;  1C77 A;  1DGJ A;  1B9R A;  3FC4 A;  4J3O D;  2WXG A;  1QLB B;  1JAL A;  1SB3 C;  1ZUD 2;  3ZJT A;  3MC0 B;  1QOB A;  1ZE3 D;  5BYR A;  3TSS A;  3AE7 B;  4OZA A;  1WSP A;  1EWY C;  4C7Y A;  3U7Z A;  4XWT A;  4YSY B;  2V0G A;  2E6X A;  1GOZ A;  4RFB A;  1FXI A;  1PDX A;  3SFD B;  4KGR A;  1UNS A;  1AN8 A;  1HZ5 A;  5G5H A;  1CJE A;  3AB5 A;  1E9M A;  1ZPS A;  3WCQ A;  3W5U B;  2PMV A;  5EE1 A;  2WDV B;  1D6E C;  4UDU C;  1UUP A;  3AE8 B;  4AQ7 A;  1IBX B;  4MM3 B;  2FUG 1;  1BML C;  4HRO A;  4LTU A;  3DWM A;  2J42 A;  3MP9 A;  2LMC A;  1L0V B;  1QIL A;  1SSN A;  2GRI A;  2QMT A;  1C76 A;  4GLS C;  4A8X C;  1QQR A;  1PGA A;  3MFG A;  1YN5 A;  4YTM B;  2BS3 B;  2KWD A;  3NVV A;  1FCL A;  1WRI A;  1CK1 A;  3NUH B;  4NZL B;  3T3N A;  1F0Z A;  1EWC A;  4YWG G;  1V1O A;  2WXF A;  2V4I B;  5BYQ A;  5BMH A;  1C4A A;  1TKG A;  1J7B A;  2NMQ A;  2PIA A;  4M0W A;  3FAH A;  4JE3 B;  4WWM A;  3AE9 B;  3RPF C;  3U2S C;  2W82 A;  3BZD B;  4WH4 A;  3OWE B;  5D3D A;  4OZB A;  4RNA A;  2IGG A;  1E10 A;  4YT0 B;  4RF0 A;  1FMA D;  3IT6 B;  1K50 A;  1QOG A;  2WXR A;  3B2G A;  4ZRQ A;  1GPX A;  1XF5 L;  5EE3 A;  2J4X A;  1HA5 A;  2WLB A;  4WQM A;  3NVW A;  2Z8L A;  3TEZ A;  2K5P A;  1TKE A;  1KTK A;  2LHD A;  1EU4 A;  2QIL A;  2RDG A;  2RDH A;  2G9H D;  2L83 A;  4RF1 A;  1QF6 A;  5HHD G;  1TJE A;  3BK1 A;  1XLQ A;  3E9S A;  2PVO D;  4YTN B;  2HTM E;  2DYM A;  2JYE A;  2X38 A;  2W54 A;  1RM6 C;  1C4C A;  1JRO A;  3IAM 1;  2K22 A;  4RGM A;  3P4R B;  2CJN A;  1VR9 A;  1RFK A;  3BVZ A;  2IJ0 A;  2JWU A;  4IDI A;  1STE A;  1N62 A;  2G1E A;  2TSS A;  2JYT A;  2ONQ A;  2WXH A;  2LEK A;  3P63 A;  1FNU A;  3NS1 A;  3SEB A;  5BMI A;  1JWB D;  1K53 A;  2KAC A;  5D3I B;  2WU5 B;  4NAW B;  2N7J A;  1VZ8 A;  2KMM A;  2E3T A;  1PFD A;  1FM0 D;  3EGR A;  4MT5 A;  2WXI A;  4WIP A;  5C2T B;  3P4S B;  2VZK D;  4HEA 1;  3U4E G;  4RGN A;  3AE6 B;  5AUK A;  1A70 A;  1KF6 B;  3ZYY X;  3KWV A;  4RGT A;  4YSZ B;  2DBY A;  2GI9 A;  1JRP A;  2I38 A;  2NTT A;  4JWS C;  4TMA B;  4RH6 A;  1N63 A;  2RPV A;  4P6V F;  1YN3 A;  4YSX B;  2WXP A;  2IDY A;  1FFU A;  1AYF A;  1SF0 A;  1BXT A;  1IBX A;  1ZP0 B;  5I4D A;  4KKI A;  5BYS A;  1C78 A;  2VZK B;  1HZ6 A;  1NEK B;  2B76 B;  1TS5 A;  2DYO A;  3AEC B;  4DXG A;  2WXK A;  1JWS D;  2JQR B;  1P7F A;  2KQ4 X;  1FD6 A;  5EE9 A;  3LXF A;  1T5X D;  3N9Y C;  1D5X C;  4OVZ A;  3TEX A;  1ZXH A;  2INN E;  1TKY A;  4ZHP A;  3AN1 A;  2MEK A;  3KWL A;  4R3D A;  1SXT A;  2PTL A;  1YMH E;  5HI1 A;  2KN4 A;  2K3U A;  4USA A;  1YQ4 B;  4L2Y A;  5HG2 A;  1D5Z C;  1FNW A;  5GXG B;  2JU6 X;  1OFF A;  1M4V A;  1L4Z B;  3R2I A;  2OED A;  1VLB A;  5E6J A;  2BTE A;  1I4P A;  1E7P B;  2BS4 B;  4CQN A;  3AE5 B;  3UI3 A;  2H89 B;  1IUE A;  3VRA B;  1VDV A;  1FRR A;  2Y3A A;  2SEB D;  2MH7 A;  5H8Y E;  1YJJ A;  2N0S B;  2FE8 A;  1XCQ L;  4N59 A;  2W55 A;  4P16 A;  1L5P A;  4NAM A;  1VJK A;  3BVG A;  1XCT L;  2KAJ A;  1J7A A;  1UWX A;  4XWW A;  1VZ7 A;  3KQ4 A;  3IXS A;  2IGH A;  1V1P A;  2INP E;  4DXF A;  4C7Z A;  1ROE A;  1IGD A;  2XNA C;  3BVM A;  4ZOH C;  4A90 A;  3AEE B;  1WWT A;  3B2F A;  4REZ A;  3Q8F A;  3GB1 A;  4OZC A;  1UGJ A;  4A9A A;  4US8 A;  2ZW1 A;  3BII D;  4D2K A;  1V97 A;  2PKO A;  3E56 A;  4RCO A;  3GS2 A;  1ZXI A;  3IAS 1;  1L6V A;  3V05 A;  2WXO A;  1NI3 A;  2IPK D;  3EUB 2;  5FKA C;  2BW2 A;  3TUO A;  5T8I A;  1OQR A;  1KFY B;  1ZDX A;  3AEB B;  3AM9 A;  4IKG A;  1I4G A;  1JWA D;  2WU2 B;  2Q5W D;  3BK2 A;  2H88 B;  4PT5 A;  4XE0 A;  3EA6 A;  3HVD A;  4RGO S;  1MHH E;  3PO0 A;  1FFV A;  5H92 C;  2W3S A;  4YTP B;  3BYT B;  3CWI A;  4N58 A;  3BYY B;  3L4P A;  1N5W A;  2JSV X;  1GAQ B;  3Q8B A;  4ZHO A;  2QJL A;  2BT6 A;  2RMM A;  3ABV B;  1TS2 A;  2Y5P A;  3KLS X;  4AS1 A;  4ZYS A;  1KLU D;  4A55 A;  1FNV A;  4A6Q A;  2AQ2 B;  1N5X A;  4H2A A;  1HEZ E;  1SJH D;  2GB1 A;  3FIL A;  2WXL A;  1ENF A;  4WUR A;  3Q8A A;  3Q69 A;  1ZDV A;  2YEP B;  4WAF A;  3TEW A;  2QSD A;  1FEH A;  1F2R I;  1NVI D;  2N9K A;  4US9 A;  1PGB A;  1KRH A;  3AEA B;  1N61 A;  4O1N A;  1ET6 A;  2KDM A;  1HQR D;  3AMZ A;  4KKJ A;  2ON8 A;  2BBC A;  5G5G A;  4C56 C;  1XLP A;  5AUI A;  3NZ3 A;  2BB5 A;  1XO3 A;  3SFE B;  1Q10 A;  1QOF A;  3NVZ A;  3AE2 B;  1MI0 A;  4JX1 C;  2WNM A;  2WP9 B;  1QKZ A;  3ETR A;  1TZO A;  1R7S A;  2WXQ A;  1JCK B;  1TY2 A;  2CU3 A;  2NTS A;  4JWU C;  1F2R C;  1AWD A;  3AED B;  3I9V 1;  1I4H A;  3NVY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...