1K52A

Monomeric protein l b1 domain with a k54g mutation
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
72
structure length
72
Chain Sequence
b'MHHHHHHAMEEVTIKANLIFANGSTQTAEFKGTFEKATSEAYAYADTLKKDNGEWTVDVADGGYTLNIKFAG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Protein L
publication title Single-site mutations induce 3D domain swapping in the B1 domain of protein L from Peptostreptococcus magnus.
pubmed doi rcsb
source organism Finegoldia magna
molecule tags Protein binding
total genus 20
structure length 72
sequence length 72
chains with identical sequence B
ec nomenclature
pdb deposition date 2001-10-09
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.10 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 1k52A00
1XCQL 1EM7A 2OEDA 2IGHA 4HJGE 2N7JA 2J52A 2KACA 1P7EA 1GB4A 1D4BA 1JMLA 1MI0A 2KWDA 1YNTE 4D2KA 1MHHE 4KGTA 5BMGA 2LGIA 2RPVA 1HZ5A 1HEZE 1YMHE 2IGGA 1IGCA 2LHEA 2GB1A 1MPEA 1XF5L 2JXTA 2PTLA 4IOIE 1K50A 3UI3A 2ON8A 1IBXB 2ZW0A 1PGXA 1IBXA 2RMMA 2ZW1A 5HI1A 3V3XA 1F2RC 1KH0A 3MP9A 1K53A 1Q10A 1PGBA 4HKZE 1FCLA 2LHDA 2KN4A 2JSVX 2GI9A 1C9FA 2LUMA 2EELA 4GLSC 4KGSA 4OZAA 5HHDG 5HG2A 1GB1A 2N9LA 2N9KA 4OZBA 4WH4A 2QMTA 1F2RI 2I38A 2J53A 1FD6A 1ZXHA 4KGRA 2QSDA 2KDMA 1UWXA 1PGAA 1MHXA 5JXVA 4IKGA 2ONQA 1XCTL 1QKZA 1FCCC 2JZPA 1K52A 2JU6X 5BMIA 2NMQA 1HZ6A 2PLPA 5HFYA 2K0PA 1MVKA 1P7FA 2I2YA 2IGDA 3FILB 3FILA 1K51A 4OZCA 2KQ4X 2PW9A 2JWUA 3GB1A 4MACA 1IGDA 5BMHA
chains in the Genus database with same CATH superfamily
3IFWB 2Z0DB 1WXAA 2MP2A 3PPAA 2UYZB 1FNVA 1EM7A 3D32A 2L1AA 2CU1A 2KACA 1P3QU 3E56A 1GB4A 3VUXA 4ARCA 1EF5A 1WXSA 2JZ3B 2ZVOA 3I9V1 3PVLA 2DZKA 2L8JA 4YWGG 1EU3A 1AARA 1E10A 2IGGA 4PYUA 1ACCA 3L10B 3V05A 3RNEC 1JQ4A 1KF6B 4TUUA 4BKSA 1UD7A 3PZDA 4TMAB 1JWMD 2FBWB 1TGZB 3UGBB 3T3NA 4KVGB 1UELA 3U30A 3ZYYX 4KIKB 4M02A 3WAOA 2BS4B 2KZRA 5E6JA 3DHGC 4HXDA 1ISNA 4CQNA 2Z8LA 5AZFA 4IM2A 4P1CC 1YIWA 3QHTA 4K7UA 1SSNA 4FJVB 4XGAB 4B0MA 2I38A 2J53A 2LASA 3ENEA 1ROEA 2ZPYA 1GOZA 2ONQA 3TEYA 1D5MC 1QZEA 2KTFA 4I6LB 3KW5B 4J3OD 4GMVA 4GB9A 2INDC 2CU3A 3N9YC 3LXFA 4PS8A 2MCNB 2LVOA 4CHKA 2I2YA 4ZRJA 2HJ1A 2BPSA 5DPRA 2FCMA 1UGMA 4HWIB 3PZ7A 3H8HA 1SB3C 2JXXA 2K5PA 2KMAA 2HE7A 4JGHB 4FN2A 1V2YA 4HJGE 1TS4A 4GXBA 4RCOA 4REZA 5CX3A 4IUMB 1IPGA 1XLOA 5TSSA 1V81A 3TEZA 4EKUA 2LUEA 4LTUA 2K39A 3RN9C 3MJ5A 5BO4B 4CYEA 2JX5A 2N7EA 1WM2A 4HDQA 4EEWA 1KLGD 1ZPSA 3Q3FA 2K22A 1L4DB 2R61A 4JQWC 1X1MA 4DBGA 4DK5A 3UQBA 4JLCA 4M01A 4WAAA 2PTLA 2RDBC 3B1LX 4NJCA 2QJLA 3VUWA 2RMMA 3DOWA 1ET6A 4RM8A 3A4SC 2L76A 3B2GA 3PT2B 1XT9B 1KH0A 3RUIB 2ZCBA 2C60A 5LLIA 4LLGM 2NPTA 3P4PB 4NY0A 3NJTA 1YJ1A 1KJTA 2JWZA 3PTFC 2E6XA 4BFRA 3Q69A 4RF1A 1KLUD 4A90A 2N9LA 1WMHB 5T8IA 4FHJA 2V4LA 1FRDA 1WR1A 3HM3A 1N6ZA 1HTQA 4URKA 2FNJB 4DXFA 4EFOA 1VZ7A 2V3PA 4JWSC 5G5HA 1FEHA 1UH6A 4K7SA 1STEA 3EECA 5EDSA 2EKEC 1MG4A 3DBSA 3AEAB 2FCSA 2JU6X 3RULA 1RM6C 3C0RB 3RZWC 2PLPA 1ZUD2 1NI2A 3AU5A 4LNIA 4M8NA 5DCNA 3VRAB 3DHIC 1WSPA 3ZNID 3ML9A 1SE9A 3BIID 3PO0A 2KVZA 2QDFA 4YTMB 3ZJVA 1AN8A 1DGJA 3I57A 1JRPA 5IP4D 2HD5B 3TMPB 1WWTA 2OEDA 1ZGUB 1S3SG 3ABVB 1M4VA 1BUIC 4KV2A 4A3OA 3IAS1 4MDKE 4RGTA 1Q1OA 3AE9B 1JWBD 4W9GA 4XC2A 1HZ5A 3RD2A 4ANUA 4B0EA 4PYZA 2RSUA 3ZTCA 3PLUA 4RMAA 4IOIE 2AL3A 5IN7A 1IBXA 2NVUI 3EUB2 4YL8A 2UWQA 4TQ0A 5D3DA 1Q10A 1KTKA 3UIOB 1VLBA 2VH2A 2D5GA 1C9FA 1I7HA 4KSLC 4MSMB 1GB1A 4XYCA 3Q8EA 2X8XX 3I3TB 1F2RI 4BKSD 2V1YA 1FD6A 3RNCC 3A33B 2BT6A 3DCGA 3ZNGC 2INCC 2QSDA 1VR9A 2NBVB 4WIPA 1ZW7A 3M62B 1PYWD 3I63C 4LNOA 4US8A 4II2B 2JT4B 1SGHA 3PGEA 1I4HA 3V60A 1K52A 3ALBA 3NZ3A 2NBUA 2GOWA 1WH3A 4KKJA 3K9OB 4L23A 4ZRQA 3K9PB 2ICIA 3KYCD 4FJZA 1HQRD 2BQQA 1LM8B 1FRRA 1LGRA 1OGWA 3KQ4A 2KC1A 2KO3A 4JL9A 3MHSD 4DXGA 2WXFA 4ZYSA 4HDOA 4W9HA 3ZO5B 4XZ4A 3PHWB 3ZXVA 1V5OA 2I1KA 1CJEA 2DYMA 1XLQA 4DHZB 1FFUA 3HK0A 4W9DA 4MJSA 2HJ8A 2D3GA 2KD0A 1V1PA 1UGJA 4KGTA 4NAMA 5DPWA 2M4NA 1HEZE 3M95A 4HLEA 1V80A 3RFZB 1OEYJ 2WXPA 1TZ1A 3W5UB 1WX8A 1MPEA 1SF0A 2BYFA 2GRIA 2OJRA 1IBXB 3BVMA 2NCNA 2CS4A 4C7YA 3Q6BA 2KX0A 3DBRI 3EGRA 1ZXIA 4WJNA 2FIDA 2KMMA 5FKAC 2EKIA 4ACFA 3ETRA 2OHFA 3EFUA 2W3SA 1VDVA 2Y3AA 3IHPC 2PMVA 2GBMA 4LJPB 4NJ6A 3NVYA 4OZAA 5G55A 3ZNZB 3HVDA 3N1ZC 1CMXB 1RYJA 3MHZA 2N9KA 3C8YA 4IW0A 4C00A 2QMTA 3NS1A 1C77A 3SU8X 2UU7A 1P98A 3C19A 4LDTD 3Q8BA 4IC7B 1WE6A 3WIMA 2JPHA 1GG3A 3KUDB 2K6DB 5LXIB 4A9AA 2BB5A 3Q3OC 4RFBA 3P4QB 1FXIA 2D11A 4K3CA 1D3ZA 2K1FA 2DBYA 3QIJA 5JH5C 1MVKA 1FO4A 1OQYA 4ICVA 1WIAA 3BK2A 3IBEA 2N9XA 3TIXA 3AXCA 2Z0EB 2M17A 2FAZA 4YXDB 2DHZA 4MGYE 1I4QA 1I4PA 2IY1B 5BMHA 3AU4A 3IVFA 1BMLC 1ET9A 1N61A 2FUHB 2N7JA 4MJSB 5AZHA 3N20C 3GE8C 4EOYA 2WNMA 2IBIB 3B2FA 4GDLA 3RMKC 2KDEB 1R7SA 2PE9A 2DZMA 1K8RB 1E7PB 1PQSA 2L52A 2J7QB 4PK1A 1TYGB 3MJWA 1V9JA 3ZIMA 1TT5B 2WWZA 3BYTB 5J2RA 3A1QA 2IDYA 4M00A 1FMAD 3MC9A 2WGSA 1IP9A 3ECIA 2BYTA 3U7ZA 1I4GA 4GIVA 1WRDB 2W3RA 4MGZE 4KGSA 2GMIC 4KSKC 4GOCA 3AEFB 3EHVA 2KMCA 2V3NA 1YQ3B 4W9JA 3H1UA 1SJHD 4R3DA 5CHVC 4GSWA 1YN5A 2M0XA 4IKGA 3Q2AC 2WXQA 4KIKA 4LCDE 4DWFA 2WLBA 4QAYA 1L5PA 2YEPB 3HM6X 1J19A 1WGHA 2K0PA 1DOIA 3P2BA 1YJIA 2KWUB 3DVNU 3TL5A 4OHJA 4IWPA 1DOYA 1E6EB 4KDLB 4ZRPA 3R8BA 5DPSA 1TTNA 3L54A 2E3TA 4XE0A 4IDIA 4A20A 2O2VB 3T3OA 3DBLI 2KXJA 2W54A 2X38A 2RPQA 2XK5B 3DVGY 1N62A 3V6CB 2WXKA 4HPMB 1KFYB 1D4BA 2MQJA 2PPHA 4CO7A 2H88B 2DAJA 3EC8A 4EZKA 2LVPA 2KFJA 4NNJB 2WDRB 1NVID 3IT4B 3Q3MC 3VVWB 3A9JA 5CHWA 3A1QB 4IG7B 2JXTA 4GU2A 2D3CA 2IJ0A 1WJ4A 1PGXA 3OWEB 3L08A 3ONSA 2PKOA 3BWUD 2O6VB 3MP9A 2H89B 1N5XA 2EMSA 1PFDA 2IO0B 2MW5A 4HK2A 2KN4A 4GGQA 2GI9A 3KWVA 3ZKJC 1E8ZA 4MT5A 1Q5WB 4KX6B 2KDBA 2LRUA 4M0WA 1T0YA 4A55A 2FUG1 2Q5WD 2ZNVC 1L6VA 3PREA 1TY2A 2DZIA 2KDMA 4JX1C 2MJEA 1HTOA 2FIFA 2CHWA 2LFIA 2D2QA 4N59A 4E74A 3WALA 2GBJA 2WXMA 1FPYA 4ASWC 1HZ6A 2WP9B 1JWSD 5C2TB 2MWSB 2K6QA 4UDUC 3ZUNA 2Y5PA 1WMHA 2BS3B 1NYRA 4NPNA 3FILA 1R4MB 5C3JB 3Q3JA 3QQ8B 3BY4B 3KYDD 2I1JA 1GAQB 5D2MB 1IGDA 1C4PA 3PRPB 3CF6E 4HCNB 3T9LA 4HCPB 4HPPA 3AV8A 3OG5A 4BAXA 2G4SA 2JRHA 3QX1A 1WJ6A 4RM9A 1SE3A 1CZPA 5BMGA 3A9JB 1E0ZA 5EE1A 4AUQC 4FXCA 2KAJA 1Z2MA 5MPOA 3N1XC 2BF8B 1JWUD 1NBFC 1FIQA 1FXAA 4M8MA 2L32A 2WDQB 4BOZB 4MH8A 4FLHA 1IYFA 2D3AA 2AL6A 2INNE 4MM3A 4K81A 2MBOA 3DPDA 4F8CB 2G45B 4ZRKA 1PGBA 3I5JC 1R4NB 4HKZE 1V97A 3R66C 2RGFA 4C56C 2WYQA 2DENB 2EELA 4AQ7A 5HG2A 4GDKB 4M0WB 2N7DA 2WXHA 1E9MA 4OZBA 2NS5A 1RFKA 2NTTA 5C23A 2AEHA 3IAM1 2K9XA 2D3BA 2V4IB 5G5GA 3P63A 1ZDXA 3E9SA 1HXYD 3B08A 4BZAA 3KH0A 3QWZB 4RGMA 5AUKA 2GBKA 1P7FA 2C7MB 2KYWA 3FILB 3DWMA 5GXGB 1WZ3A 2JYTA 1T5XD 3APFA 2K8BA 3V61A 2NR2A 3VRBB 3GB1A 3AMZA 3Q8CA 3L4PA 3PRMB 1XQQA 1AW7A 1J8CA 2MEKA 1XCQL 4HRSA 2OOBB 2KQ7A 3LB8C 3KUCB 2PIAA 3N30A 1OQQA 4ZYNA 1GUAB 2KFKB 4ANVA 3N3KB 3X0WA 2LD9A 1TKYA 5C1ZA 3IXSA 1WXQA 3DVGX 1T0RC 2LHEA 1C1YB 1P9DU 3NS8A 3RNGC 2RD0A 4LNKA 1K50A 1WYGA 1VJKA 1TS5A 1LFDA 2RR9A 1WZ0A 3VXWA 1TBEA 4MM3B 4G11A 2R2QA 2WHIA 2BGFA 1GNUA 4WQOB 2LMCA 1WGGA 2RDHA 4IM3A 4K1RB 3KUZA 3NVZA 2BTEA 3W1SA 2M19A 2IO2B 2V0GA 3W2DA 2MBBB 2ZZPB 3RCZA 4MH0E 1EU4A 2BB6A 1WE7A 4II3B 3R7QA 1L0VB 1WJUA 4FHKA 3DQVA 1TIFA 2LVQA 2ZJDA 1J7CA 3TUOA 5D3IB 2ACZB 1Q0WB 4L2YA 4PT5A 3AULA 1NENB 3RNBC 2AQ1B 2NMQA 3OLMD 1ZDVA 1E5WA 1VZ8A 5AUIA 4H2AA 1XD3B 1C79A 2C5LC 3AE3B 2REXA 2CJOA 1U4AA 3H7PA 4G3XB 4RF0A 5IOIA 3QK0A 4ANXA 2N9EB 4X57B 3RI7C 1QT9A 2KN5A 1L2NA 4MACA 1WI0A 3JW0X 2XN9C 1GC6A 5E6PA 3R3MA 2JUOA 3ZTDA 4A8XC 1IUEA 5EE0A 3H6NA 3TBLD 1KLVA 4ICUA 2MJ3A 3NHEB 1C78A 2L00B 4BKGA 1DOXA 1YN4A 3CWIA 1N60A 2LI5A 3UINB 3CSTA 5EE3A 1YJJA 2MLBA 2BWFA 5L95C 2MBQA 2AQ3B 4GN1A 1E7VA 3ZGZA 5LXHA 4YSXB 4W9LA 2WS3B 4EUTA 4PS3A 4A6QA 2ZW1A 1MG8A 3DBRB 4L1BA 1VRAB 3TEXA 2A5UA 3AB5A 2LZ6A 5CTRC 3HIZA 1D5XC 3O13A 3QA8A 3AN1A 4N58A 2ZCCA 3GZNB 2M8SA 3W1YA 3B9JA 1E8YA 3VFKA 4XWWA 1UBQA 2MRPA 4TKNA 3SHQA 1J7AA 4BBNF 5J17A 4PS7A 5JXVA 2SEBD 4Q2JA 2YEPF 1GJZA 3CSFA 4G0NB 3AE4B 3VTUA 1YX6B 1YQ4B 4ZRIA 2LXCA 3KWLA 3H7PB 4ZDVA 3MFGA 3JVZX 3WAPA 3LDZE 5H92C 2LJIA 2MA9B 2J0MA 4NQLB 2LGYA 3Q14C 3AI5A 2LXAA 3W1SC 2WX1A 4IM0A 4AJYB 4S17A 2QILA 3NG0A 4WURA 1TKGA 2KWCA 2LGSA 4WJPA 3QCAA 1JMLA 4XDCA 1V6EA 1YNTE 1YX5B 3GP7A 3UIPB 2KHWB 2DX5B 3P4RB 2O2VA 3RZFA 1HE8A 1TZOA 5HKHA 3U7DA 3NOBA 2WDVB 3Q8FA 1I4RA 2JF5A 2PVGC 2MHJA 4W9KA 5D7GA 3DDCB 5BYSA 2N1VA 5HI1A 1JRUA 2XK5A 1GC7A 5G2NA 2EMTA 3PRZA 2GBRA 2KJRA 2KLCA 1BXTA 2KJ6A 5I4DA 2N0SB 4JPSA 3NVVA 1EUVB 4WQMA 4JWUC 4I6NB 1WXMA 1NDDA 5HHDG 2CKHB 1PUTA 1YN3A 2MBEA 1WGRA 5DPTA 1QQRA 3U8ZA 1ZXHA 1I42A 3AH7A 2B76B 5LNK1 4W9CA 4FA6A 2AWTA 2O6VA 4IWQA 1WY8A 2VZKB 1RRBA 2JZPA 4TQ1A 4ZHOA 2AX5A 4YSZB 2LRWA 3AE8B 2V9HA 1WF9A 2PE6B 5CHFA 4KDIC 2Y5BB 2WDTB 1V49A 4A3PA 4YT0B 3HVZA 4P7IA 1M94A 1D6EC 1JROA 3ZRFA 3W9CB 4TV3A 2DWQA 2BBCA 5D94A 3DVNV 3QC8B 3KLSX 4YTNB 4DDID 4TSSA 2IY0B 2PW9A 4OVUA 2DAFA 2K8CA 4KZ0A 4JE3B 1H4RA 3ZDMC 1JWAD 2GBNA 3VAWA 4WWOA 2IGHA 1ZOYB 5J18A 2XEWA 4DDGD 2J52A 3ML8A 3OJ4B 2J0JA 1UNSA 3EA6A 3BYYB 2KWDA 4E3CA 4ZHPA 4FULA 2K8HA 1FM0D 3DBHB 4BKTA 3HRDD 2CHZA 1L7YA 1SEBD 1IGCA 1FNUA 3RNFC 4MGKE 4OVVA 1JCKB 2N9PC 4G50A 4MEMA 4LNFA 1EWCA 1XEEA 1L0YB 5KHQA 1A70A 4NAWA 2R2OA 4ANWA 1K53A 4K7WA 5JZEB 1V86A 1PDXA 3H9DA 2WXNA 3PV1A 3VH3B 2JSVX 4BBNC 1UWMA 2WQYB 2DLBA 4GLSC 2FCQA 3L0WB 1UZXB 2SAKA 3SEBA 1P1AA 5H8YE 1V1OA 3N32A 4KGRA 1XLNA 5IA7A 1MHXA 2L0FA 4WJQA 3JSVA 2M0AA 2LEKA 1CK1A 1TY0A 4N9F4 5BMIA 1WGKA 5EE9A 1XLPA 1FNWA 2M1MA 1SE2A 4GDKA 2PVOD 2KOXA 1QOBA 1YQBA 1E7UA 4S0RA 1K51A 2GLSA 3ZXRA 4HVBA 2KTRB 3CIRB 2AQ2B 2MSED 3RT3B 4C4VA 2W55A 2MBHA 1DYQA 1P0RA 1ZP0B 2VZKD 1UF0A 1WGYA 3L17A 1ZE3D 1KOTA 2WXOA 5JHAA 3RPFC 5FR6A 4HROA 2INPE 2J4XA 4MGIE 1F1HA 3U52E 4P16A 1XF5L 1D5ZC 1YD8U 3UI3A 3MC8A 2BYVE 2LGDA 3ZLZA 2G1EA 2KK8A 4B9KA 2BVCA 2ZEQA 1XXGA 1SBBB 3WCQA 1EF1A 3V3XA 2CHXA 4NAWB 3ZJTA 1WGDA 3IT6B 2ZVNA 1RLFA 4F1SA 2KWVB 2KFKA 1T6BX 4FADA 1Y56A 3TCAA 2N4FA 2KNBA 1WFYA 1WRIA 2L05A 2KJHB 2ASQA 3PS6A 3HUIA 3S2AA 1YOVB 1QOAA 3DHHC 3AEBB 1R4MI 1V8CA 5BYQA 4W9FA 3JSVB 2LWPA 4WWMA 3M63B 4WAFA 3RNAC 1WM3A 3A9KA 2MP2B 1VZ6A 1FFVA 4OW0A 1G6JA 1E8WA 3M3JA 3V6EB 1I4XA 5AEKB 3ZQ4A 4RGNA 1SIJA 2D10A 3P42A 1L0XB 4C4VB 2RDGA 1T0QC 3AE1B 3AECB 2JWUA 4IWOA 3WAMA 2O6VD 1BT0A 4P6VF 3WANA 2DZJA 4FJYA 2V3SA 2WX0A 4WJOA 3NY5A 1T0SC 2YLMA 3NRZA 1MI0A 4K3BA 3H7SA 2L7RA 2XNAC 3VH4B 2D07B 5KHOA 3WA0A 3AM9A 2LGIA 1EO6A 2JYEA 1R4NI 4O1NA 2N1WA 4ITKA 4FBJB 2BW2A 3R2TA 4MSQB 4RGOS 2KX3A 1TS2A 4AOFA 1A5RA 1V5TA 3KVFB 3NZSA 1RWSA 1TJEA 2LJ5A 1SE4A 4EZJA 2KC2A 1WYWB 1NI3A 2KANA 4OVZA 1UUPA 4B95A 1F77A 1KM7A 3OAWA 3BVGA 3VQIA 1RFAA 3PLVA 3FAHA 1VCBA 4J6IA 2C7NB 3Q3NC 4I6PA 4ZOHC 4YTPB 3JYUA 3APDA 3A9KB 3HHMA 1FXTB 3PZ8A 1MFWA 2BKFA 3SFDB 1N63A 1UBIA 1H8CA 3CMMB 2MH7A 2VRRB 1QILA 2YVCA 1QOGA 4DQOC 2BS2B 4EE2A 2MJDA 1GPXA 2KQ4X 4MELA 4LNNA 1F0ZA 3BK1A 1XO3A 3TJPA 4US9A 1SXTA 2CR5A 4LK0M 3B0AA 4HEA1 1AWDA 4LDTB 5TR5A 1P7EA 1KRHA 5L83A 2HTHA 4E71A 2AYOB 2NPTB 1NEKB 1MHHE 4NZLB 3MC0B 2BKRB 3TSSA 3VR8B 3QARA 3SDLC 3SFEB 2WXIA 1J7BA 2ZW0A 3VHTC 3P1MA 2B3AA 2K3UA 3AEDB 1OEYA 1B1ZA 1F2RC 1QF6A 2JY6A 4ARIA 2KT7A 3NZUA 5D6JB 5IO9A 2LHDA 2HTME 3LYYA 4HJKA 1JW9D 1TKEA 2WXJA 2WU5B 2LUMA 4BOSC 4WWNA 3VR9B 5E6OA 1I35A 2IYDB 1WXVA 3L13A 2JQRB 3W5VB 1L4ZB 2JZZA 2XBBC 1UWXA 2WXLA 1XCTL 2Y5CA 1LO5D 2BYEA 3GS2A 4YSYB 3ZRCA 2KLGA 3L16A 1LXDA 3VTVA 5BYRA 2NTSA 4OZCA 2L83A 2G9HD 1F9JA 2C9WB 3APCA 2BWES 1E8XA 4DHJB 2J42A 2HDEA 2KQSA 3AEGB 2KKCA 4AWJA 4KKIA 3FC4A 1JALA 5FK9C 1RAXA 5IKCM 3ZNHB 1C4AA 4C80A 3N1YC 2Z59B 2RPVA 3AEEB 4NQKE 5GMVA 1J0GA 3NVWA 1SJED 1ZKHA 3U4EG 2A4ZA 3ZJUA 2L0TA 3GZNI 2J0KA 2ON8A 1EWYC 1Z5SB 2WXRA 1N5WA 1MJDA 3O65B 1C3TA 3ZW3A 2C7HA 2DYOA 4XWTA 5E6NA 2G4DB 1T3QA 3DWGC 2K25A 4DHZE 2DYBA 3GOEA 4WH4A 2ZPNA 3X23A 5JHBA 3OJ3A 1F52A 2W9NA 3NUHB 2IO3B 3T8MA 2WXGA 1PGAA 1ESFA 1QKZA 2W82A 3AE7B 2KDIA 2FCNA 1S1QB 2M56B 3ZVVA 3MTNB 4RH6A 5IAAC 3VDZA 2G3QB 1V1PB 2IGDA 4RNAA 2OJWA 3IG3A 4USAA 2VH1A 3BVZA 4KZCA 3V62A 3Q8AA 2PJHA 3BINA 2JVCA 3J9CA 2L3ZA 1L6UA 4AJWA 2MX2A 3BZDB 3LJ3A 1C76A 1E90A 1OTRB 4D2KA 2JRIB 3R7RA 4P1BC 3R2IA 2KTRA 1WX7A 1YMHE 4NJ7A 3URYA 2FE8A 2GB1A 3DBLB 1NYQA 3AE6B 3ZDTA 3PSEB 2TSSA 3FKYA 4WWPA 3TEWA 1C4CA 4DHJD 4JIOU 3UF8A 1Y8RC 1LQBA 1WR6E 1QOFA 3GE3C 4HPLB 1WX9A 3AE2B 4AP4C 5FR3A 1OFFA 1FCLA 1QLBB 4F7ZA 5AZGA 4XX5A 3QAQA 1OQRA 3QJZA 2QEJC 1AYFA 4N6EB 1CQVA 2IZVB 2QIEB 3PHXB 1VD2A 4LJOB 4C7ZA 4HKQA 2IPKD 3P4SB 3A4RA 3EFCA 3UQAA 2DNFA 2KDFB 4BVUC 1FCCC 4EZLA 2KVRA 1ENFA 3VUYA 1TS3A 5HFYA 1B9RA 2QC8A 4AS1A 2QHOA 3RYTA 2ZNVB 3SD5A 3AE5B 4B6WA 4DXAB 4GDLB 3SR6A 4W9EA 1HA5A 2IO1B 1SIFA 3U2SC 2LGXA 2PEAA 3DBHI 2NBWB 4W9IA 2QCZA 1WJNA 2CJNA 2WU2B 4XDDA 3VTWA
chains in the Genus database with same CATH topology
2XN9C 1BMLC 4P6VF 1ET9A 1N61A 1FNVA 1EM7A 2N7JA 4A8XC 2L1AA 1IUEA 5EE0A 2KACA 3E56A 1GB4A 4ARCA 3NRZA 1MI0A 2WNMA 2XNAC 2MJ3A 3I9V1 1C78A 3B2FA 1DOXA 1YN4A 3CWIA 3AM9A 1N60A 1R7SA 2LGIA 4YWGG 2JYEA 1E7PB 5EE3A 1YJJA 2L52A 4O1NA 4ITKA 1EU3A 1E10A 2BW2A 2IGGA 3R2TA 1ACCA 1TYGB 3V05A 4RGOS 1TS2A 2AQ3B 3BYTB 2IDYA 1JQ4A 3ZGZA 1KF6B 4YSXB 2WS3B 4TMAB 1FMAD 1JWMD 2FBWB 4A6QA 1RWSA 1TJEA 2ZW1A 1SE4A 2BYTA 3T3NA 3U7ZA 4L1BA 3ZYYX 1VRAB 3TEXA 1I4GA 1NI3A 3AB5A 2W3RA 4OVZA 1UUPA 2BS4B 1F77A 1D5XC 5E6JA 3O13A 4CQNA 3AN1A 2Z8LA 3BVGA 4N58A 4KGSA 3B9JA 3VQIA 4XWWA 3AEFB 1SSNA 3FAHA 4B0MA 2V3NA 1YQ3B 2I38A 2J53A 1SJHD 4ZOHC 4R3DA 1ROEA 1J7AA 4YTPB 1YN5A 1GOZA 5JXVA 2SEBD 4IKGA 2ONQA 3TEYA 1D5MC 4Q2JA 2WXQA 2YEPF 4J3OD 2WLBA 3PZ8A 1L5PA 2CU3A 3N9YC 3LXFA 2YEPB 3SFDB 1N63A 2MH7A 3AE4B 2K0PA 1DOIA 1QILA 1YQ4B 2I2YA 3KWLA 1YJIA 1QOGA 4OHJA 4DQOC 3MFGA 1DOYA 1E6EB 4ZRPA 2BS2B 3R8BA 2MJDA 4EE2A 1GPXA 5H92C 2LJIA 2KQ4X 3PZ7A 2E3TA 3H8HA 1SB3C 4IDIA 4XE0A 1F0ZA 3BK1A 1XO3A 2K5PA 3T3OA 4US9A 1SXTA 2W54A 2QILA 4LK0M 2X38A 4WURA 4HEA1 1AWDA 4HJGE 1TKGA 1TS4A 4RCOA 1N62A 4REZA 1P7EA 2WXKA 1XLOA 1KRHA 1KFYB 1JMLA 5TSSA 1D4BA 3TEZA 4XDCA 2H88B 4LTUA 1YNTE 3GP7A 1NEKB 1MHHE 3MJ5A 2JX5A 4NZLB 2WDRB 1KLGD 1ZPSA 1NVID 2K22A 1L4DB 2R61A 3IT4B 3MC0B 3TSSA 3VR8B 3P4RB 3SFEB 2WXIA 1TZOA 2JXTA 2PTLA 1J7BA 4NJCA 2IJ0A 2WDVB 3Q8FA 1I4RA 1PGXA 2QJLA 2ZW0A 3P1MA 2PVGC 2RMMA 5D7GA 2K3UA 3OWEB 1ET6A 3AEDB 5BYSA 1B1ZA 5HI1A 1F2RC 3B2GA 1KH0A 2PKOA 1QF6A 3BWUD 3MP9A 2H89B 1BXTA 4ARIA 4LLGM 1N5XA 1PFDA 5I4DA 3P4PB 2N0SB 4JPSA 3NVVA 2LHDA 2KN4A 2HTME 3LYYA 4WQMA 4JWUC 1JW9D 2GI9A 3KWVA 1TKEA 2E6XA 2WXJA 2WU5B 2LUMA 3Q69A 4RF1A 5HHDG 4MT5A 1KLUD 1PUTA 4A90A 1YN3A 4KX6B 2N9LA 3VR9B 4M0WA 5T8IA 4A55A 2FUG1 1QQRA 2Q5WD 1FRDA 2JQRB 3W5VB 1L4ZB 1ZXHA 1L6VA 4DXFA 3AH7A 1TY2A 2KDMA 4JX1C 2MJEA 1UWXA 1VZ7A 2V3PA 2B76B 4JWSC 5G5HA 5LNK1 1FEHA 2WXLA 1XCTL 2LFIA 1STEA 4N59A 2Y5CA 2VZKB 2JZPA 1LO5D 4TQ1A 2WXMA 4ZHOA 2AX5A 3GS2A 3AE8B 2JU6X 3AEAB 4YSZB 1RM6C 1HZ6A 4YSYB 2WP9B 2PLPA 1ZUD2 1JWSD 5C2TB 4YT0B 4UDUC 3VRAB 2Y5PA 1WSPA 3HVZA 2BS3B 1NYRA 1D6EC 1JROA 3FILA 3W9CB 5BYRA 2NTSA 5C3JB 4OZCA 2DWQA 2BBCA 3BIID 2L83A 3PO0A 2G9HD 3KLSX 4YTNB 4YTMB 3ZJVA 4TSSA 1AN8A 2PW9A 1DGJA 1GAQB 1IGDA 3I57A 1C4PA 1JRPA 2J42A 2HDEA 4JE3B 1JWAD 3AEGB 1WWTA 4KKIA 2OEDA 2IGHA 1ZOYB 3FC4A 1JALA 3AV8A 5FK9C 3ABVB 2J52A 1C4AA 1M4VA 1UNSA 1BUIC 3EA6A 3BYYB 3IAS1 2KWDA 4RGTA 4C80A 1SE3A 4ZHPA 3AE9B 1JWBD 1CZPA 5BMGA 1FM0D 2RPVA 3AEEB 1HZ5A 3HRDD 1SEBD 3NVWA 1SJED 4B0EA 1E0ZA 5EE1A 1IGCA 3U4EG 1FNUA 3ZJUA 4FXCA 2KAJA 4IOIE 5MPOA 2ON8A 1JCKB 1JWUD 1EWYC 1FIQA 1FXAA 1IBXA 2WXRA 3EUB2 2L32A 2WDQB 1N5WA 4MH8A 1EWCA 1XEEA 1L0YB 1A70A 2INNE 4TQ0A 1K53A 1Q10A 5D3DA 1KTKA 1PGBA 2DYOA 4XWTA 1VLBA 4HKZE 1V97A 1PDXA 2WXNA 4C56C 1T3QA 2JSVX 3DWGC 1UWMA 2D5GA 1C9FA 2WQYB 2EELA 4AQ7A 2DLBA 4GLSC 5HG2A 1I7HA 4GDKB 1GB1A 2SAKA 1E9MA 2WXHA 4OZBA 4WH4A 3SEBA 3Q8EA 1RFKA 1F2RI 5H8YE 1FD6A 1V1OA 3NUHB 2NTTA 2BT6A 1XLNA 4KGRA 2QSDA 1VR9A 4WIPA 1PYWD 2WXGA 1PGAA 1ESFA 1MHXA 3IAM1 1QKZA 2K9XA 2M0AA 2W82A 4US8A 2V4IB 2LEKA 5G5GA 3P63A 1CK1A 1ZDXA 3AE7B 1TY0A 1I4HA 1K52A 3E9SA 1WGKA 3NZ3A 2M56B 1HXYD 5BMIA 4RH6A 5EE9A 1XLPA 1FNWA 4KKJA 1SE2A 4RGMA 5AUKA 2PVOD 1V1PB 1P7FA 4L23A 1QOBA 4ZRQA 2IGDA 4RNAA 2ICIA 3FILB 3DWMA 5GXGB 4USAA 2JYTA 1T5XD 1K51A 3BVZA 1HQRD 3CIRB 2AQ2B 3Q8AA 1FRRA 3VRBB 3GB1A 3AMZA 3KQ4A 2W55A 3Q8CA 3L4PA 1DYQA 3J9CA 4DXGA 2WXFA 4ZYSA 1AW7A 1ZP0B 2MEKA 1XCQL 2VZKD 4HRSA 1L6UA 1CJEA 2DYMA 1XLQA 3LB8C 2PIAA 3BZDB 1FFUA 1OQQA 1ZE3D 1C76A 1V1PA 2WXOA 3RPFC 4D2KA 1UGJA 4HROA 4KGTA 4NAMA 2INPE 1TKYA 2J4XA 3R2IA 1HEZE 3IXSA 1YMHE 3RFZB 1WXQA 2WXPA 3URYA 3W5UB 2FE8A 3U52E 2LHEA 2GB1A 4P16A 1MPEA 1SF0A 1XF5L 1NYQA 2GRIA 3AE6B 1D5ZC 1K50A 1WYGA 2TSSA 3UI3A 1IBXB 1VJKA 3BVMA 3TEWA 1C4CA 1TS5A 2G1EA 4C7YA 1XXGA 1SBBB 3WCQA 3V3XA 1QOFA 1ZXIA 3EGRA 4MM3B 4NAWB 3ZJTA 3IT6B 2KMMA 5FKAC 2EKIA 3AE2B 2LMCA 2RDHA 1T6BX 5FR3A 3NVZA 2BTEA 1OFFA 3ETRA 2OHFA 1FCLA 2W3SA 1VDVA 2Y3AA 2PMVA 1Y56A 3W1SA 2M19A 1QLBB 2V0GA 1WRIA 3W2DA 3NVYA 4OZAA 3HVDA 1RYJA 1OQRA 3MHZA 2N9KA 3C8YA 3HUIA 2QMTA 3NS1A 1EU4A 2BB6A 1C77A 2QEJC 1AYFA 1QOAA 4N6EB 1CQVA 1L0VB 2QIEB 3AEBB 1V8CA 5BYQA 3Q8BA 1J7CA 4C7ZA 4WWMA 4HKQA 2IPKD 3P4SB 3TUOA 4WAFA 5D3IB 2ACZB 4L2YA 4PT5A 4A9AA 1FCCC 1VZ6A 2BB5A 1NENB 1FFVA 4OW0A 2AQ1B 4RFBA 1ENFA 2NMQA 1ZDVA 1TS3A 1FXIA 3P4QB 1VZ8A 5HFYA 1B9RA 4AS1A 2DBYA 5AUIA 1I4XA 1MVKA 3AE5B 4H2AA 1FO4A 1C79A 3ZQ4A 4GDLB 3SR6A 4RGNA 3AE3B 1HA5A 3BK2A 2CJOA 1SIJA 3U2SC 3P42A 1L0XB 4YXDB 4RF0A 2RDGA 3AE1B 2CJNA 3AECB 1I4QA 2JWUA 1QT9A 2WU2B 4MACA 1I4PA 4XDDA 5BMHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1XCQ L;  1EM7 A;  2OED A;  2IGH A;  4HJG E;  2N7J A;  2J52 A;  2KAC A;  1P7E A;  1GB4 A;  1D4B A;  1JML A;  1MI0 A;  2KWD A;  1YNT E;  4D2K A;  1MHH E;  4KGT A;  5BMG A;  2LGI A;  2RPV A;  1HZ5 A;  1HEZ E;  1YMH E;  2IGG A;  1IGC A;  2LHE A;  2GB1 A;  1MPE A;  1XF5 L;  2JXT A;  2PTL A;  4IOI E;  1K50 A;  3UI3 A;  2ON8 A;  1IBX B;  2ZW0 A;  1PGX A;  1IBX A;  2RMM A;  2ZW1 A;  5HI1 A;  3V3X A;  1F2R C;  1KH0 A;  3MP9 A;  1K53 A;  1Q10 A;  1PGB A;  4HKZ E;  1FCL A;  2LHD A;  2KN4 A;  2JSV X;  2GI9 A;  1C9F A;  2LUM A;  2EEL A;  4GLS C;  4KGS A;  4OZA A;  5HHD G;  5HG2 A;  1GB1 A;  2N9L A;  2N9K A;  4OZB A;  4WH4 A;  2QMT A;  1F2R I;  2I38 A;  2J53 A;  1FD6 A;  1ZXH A;  4KGR A;  2QSD A;  2KDM A;  1UWX A;  1PGA A;  1MHX A;  5JXV A;  4IKG A;  2ONQ A;  1XCT L;  1QKZ A;  1FCC C;  2JZP A;  1K52 A;  2JU6 X;  5BMI A;  2NMQ A;  1HZ6 A;  2PLP A;  5HFY A;  2K0P A;  1MVK A;  1P7F A;  2I2Y A;  2IGD A;  3FIL B;  3FIL A;  1K51 A;  4OZC A;  2KQ4 X;  2PW9 A;  2JWU A;  3GB1 A;  4MAC A;  1IGD A;  5BMH A; 
#chains in the Genus database with same CATH topology
 3IFW B;  2Z0D B;  1WXA A;  2MP2 A;  3PPA A;  2UYZ B;  1FNV A;  1EM7 A;  3D32 A;  2L1A A;  2CU1 A;  2KAC A;  1P3Q U;  3E56 A;  1GB4 A;  3VUX A;  4ARC A;  1EF5 A;  1WXS A;  2JZ3 B;  2ZVO A;  3I9V 1;  3PVL A;  2DZK A;  2L8J A;  4YWG G;  1EU3 A;  1AAR A;  1E10 A;  2IGG A;  4PYU A;  1ACC A;  3L10 B;  3V05 A;  3RNE C;  1JQ4 A;  1KF6 B;  4TUU A;  4BKS A;  1UD7 A;  3PZD A;  4TMA B;  1JWM D;  2FBW B;  1TGZ B;  3UGB B;  3T3N A;  4KVG B;  1UEL A;  3U30 A;  3ZYY X;  4KIK B;  4M02 A;  3WAO A;  2BS4 B;  2KZR A;  5E6J A;  3DHG C;  4HXD A;  1ISN A;  4CQN A;  2Z8L A;  5AZF A;  4IM2 A;  4P1C C;  1YIW A;  3QHT A;  4K7U A;  1SSN A;  4FJV B;  4XGA B;  4B0M A;  2I38 A;  2J53 A;  2LAS A;  3ENE A;  1ROE A;  2ZPY A;  1GOZ A;  2ONQ A;  3TEY A;  1D5M C;  1QZE A;  2KTF A;  4I6L B;  3KW5 B;  4J3O D;  4GMV A;  4GB9 A;  2IND C;  2CU3 A;  3N9Y C;  3LXF A;  4PS8 A;  2MCN B;  2LVO A;  4CHK A;  2I2Y A;  4ZRJ A;  2HJ1 A;  2BPS A;  5DPR A;  2FCM A;  1UGM A;  4HWI B;  3PZ7 A;  3H8H A;  1SB3 C;  2JXX A;  2K5P A;  2KMA A;  2HE7 A;  4JGH B;  4FN2 A;  1V2Y A;  4HJG E;  1TS4 A;  4GXB A;  4RCO A;  4REZ A;  5CX3 A;  4IUM B;  1IPG A;  1XLO A;  5TSS A;  1V81 A;  3TEZ A;  4EKU A;  2LUE A;  4LTU A;  2K39 A;  3RN9 C;  3MJ5 A;  5BO4 B;  4CYE A;  2JX5 A;  2N7E A;  1WM2 A;  4HDQ A;  4EEW A;  1KLG D;  1ZPS A;  3Q3F A;  2K22 A;  1L4D B;  2R61 A;  4JQW C;  1X1M A;  4DBG A;  4DK5 A;  3UQB A;  4JLC A;  4M01 A;  4WAA A;  2PTL A;  2RDB C;  3B1L X;  4NJC A;  2QJL A;  3VUW A;  2RMM A;  3DOW A;  1ET6 A;  4RM8 A;  3A4S C;  2L76 A;  3B2G A;  3PT2 B;  1XT9 B;  1KH0 A;  3RUI B;  2ZCB A;  2C60 A;  5LLI A;  4LLG M;  2NPT A;  3P4P B;  4NY0 A;  3NJT A;  1YJ1 A;  1KJT A;  2JWZ A;  3PTF C;  2E6X A;  4BFR A;  3Q69 A;  4RF1 A;  1KLU D;  4A90 A;  2N9L A;  1WMH B;  5T8I A;  4FHJ A;  2V4L A;  1FRD A;  1WR1 A;  3HM3 A;  1N6Z A;  1HTQ A;  4URK A;  2FNJ B;  4DXF A;  4EFO A;  1VZ7 A;  2V3P A;  4JWS C;  5G5H A;  1FEH A;  1UH6 A;  4K7S A;  1STE A;  3EEC A;  5EDS A;  2EKE C;  1MG4 A;  3DBS A;  3AEA B;  2FCS A;  2JU6 X;  3RUL A;  1RM6 C;  3C0R B;  3RZW C;  2PLP A;  1ZUD 2;  1NI2 A;  3AU5 A;  4LNI A;  4M8N A;  5DCN A;  3VRA B;  3DHI C;  1WSP A;  3ZNI D;  3ML9 A;  1SE9 A;  3BII D;  3PO0 A;  2KVZ A;  2QDF A;  4YTM B;  3ZJV A;  1AN8 A;  1DGJ A;  3I57 A;  1JRP A;  5IP4 D;  2HD5 B;  3TMP B;  1WWT A;  2OED A;  1ZGU B;  1S3S G;  3ABV B;  1M4V A;  1BUI C;  4KV2 A;  4A3O A;  3IAS 1;  4MDK E;  4RGT A;  1Q1O A;  3AE9 B;  1JWB D;  4W9G A;  4XC2 A;  1HZ5 A;  3RD2 A;  4ANU A;  4B0E A;  4PYZ A;  2RSU A;  3ZTC A;  3PLU A;  4RMA A;  4IOI E;  2AL3 A;  5IN7 A;  1IBX A;  2NVU I;  3EUB 2;  4YL8 A;  2UWQ A;  4TQ0 A;  5D3D A;  1Q10 A;  1KTK A;  3UIO B;  1VLB A;  2VH2 A;  2D5G A;  1C9F A;  1I7H A;  4KSL C;  4MSM B;  1GB1 A;  4XYC A;  3Q8E A;  2X8X X;  3I3T B;  1F2R I;  4BKS D;  2V1Y A;  1FD6 A;  3RNC C;  3A33 B;  2BT6 A;  3DCG A;  3ZNG C;  2INC C;  2QSD A;  1VR9 A;  2NBV B;  4WIP A;  1ZW7 A;  3M62 B;  1PYW D;  3I63 C;  4LNO A;  4US8 A;  4II2 B;  2JT4 B;  1SGH A;  3PGE A;  1I4H A;  3V60 A;  1K52 A;  3ALB A;  3NZ3 A;  2NBU A;  2GOW A;  1WH3 A;  4KKJ A;  3K9O B;  4L23 A;  4ZRQ A;  3K9P B;  2ICI A;  3KYC D;  4FJZ A;  1HQR D;  2BQQ A;  1LM8 B;  1FRR A;  1LGR A;  1OGW A;  3KQ4 A;  2KC1 A;  2KO3 A;  4JL9 A;  3MHS D;  4DXG A;  2WXF A;  4ZYS A;  4HDO A;  4W9H A;  3ZO5 B;  4XZ4 A;  3PHW B;  3ZXV A;  1V5O A;  2I1K A;  1CJE A;  2DYM A;  1XLQ A;  4DHZ B;  1FFU A;  3HK0 A;  4W9D A;  4MJS A;  2HJ8 A;  2D3G A;  2KD0 A;  1V1P A;  1UGJ A;  4KGT A;  4NAM A;  5DPW A;  2M4N A;  1HEZ E;  3M95 A;  4HLE A;  1V80 A;  3RFZ B;  1OEY J;  2WXP A;  1TZ1 A;  3W5U B;  1WX8 A;  1MPE A;  1SF0 A;  2BYF A;  2GRI A;  2OJR A;  1IBX B;  3BVM A;  2NCN A;  2CS4 A;  4C7Y A;  3Q6B A;  2KX0 A;  3DBR I;  3EGR A;  1ZXI A;  4WJN A;  2FID A;  2KMM A;  5FKA C;  2EKI A;  4ACF A;  3ETR A;  2OHF A;  3EFU A;  2W3S A;  1VDV A;  2Y3A A;  3IHP C;  2PMV A;  2GBM A;  4LJP B;  4NJ6 A;  3NVY A;  4OZA A;  5G55 A;  3ZNZ B;  3HVD A;  3N1Z C;  1CMX B;  1RYJ A;  3MHZ A;  2N9K A;  3C8Y A;  4IW0 A;  4C00 A;  2QMT A;  3NS1 A;  1C77 A;  3SU8 X;  2UU7 A;  1P98 A;  3C19 A;  4LDT D;  3Q8B A;  4IC7 B;  1WE6 A;  3WIM A;  2JPH A;  1GG3 A;  3KUD B;  2K6D B;  5LXI B;  4A9A A;  2BB5 A;  3Q3O C;  4RFB A;  3P4Q B;  1FXI A;  2D11 A;  4K3C A;  1D3Z A;  2K1F A;  2DBY A;  3QIJ A;  5JH5 C;  1MVK A;  1FO4 A;  1OQY A;  4ICV A;  1WIA A;  3BK2 A;  3IBE A;  2N9X A;  3TIX A;  3AXC A;  2Z0E B;  2M17 A;  2FAZ A;  4YXD B;  2DHZ A;  4MGY E;  1I4Q A;  1I4P A;  2IY1 B;  5BMH A;  3AU4 A;  3IVF A;  1BML C;  1ET9 A;  1N61 A;  2FUH B;  2N7J A;  4MJS B;  5AZH A;  3N20 C;  3GE8 C;  4EOY A;  2WNM A;  2IBI B;  3B2F A;  4GDL A;  3RMK C;  2KDE B;  1R7S A;  2PE9 A;  2DZM A;  1K8R B;  1E7P B;  1PQS A;  2L52 A;  2J7Q B;  4PK1 A;  1TYG B;  3MJW A;  1V9J A;  3ZIM A;  1TT5 B;  2WWZ A;  3BYT B;  5J2R A;  3A1Q A;  2IDY A;  4M00 A;  1FMA D;  3MC9 A;  2WGS A;  1IP9 A;  3ECI A;  2BYT A;  3U7Z A;  1I4G A;  4GIV A;  1WRD B;  2W3R A;  4MGZ E;  4KGS A;  2GMI C;  4KSK C;  4GOC A;  3AEF B;  3EHV A;  2KMC A;  2V3N A;  1YQ3 B;  4W9J A;  3H1U A;  1SJH D;  4R3D A;  5CHV C;  4GSW A;  1YN5 A;  2M0X A;  4IKG A;  3Q2A C;  2WXQ A;  4KIK A;  4LCD E;  4DWF A;  2WLB A;  4QAY A;  1L5P A;  2YEP B;  3HM6 X;  1J19 A;  1WGH A;  2K0P A;  1DOI A;  3P2B A;  1YJI A;  2KWU B;  3DVN U;  3TL5 A;  4OHJ A;  4IWP A;  1DOY A;  1E6E B;  4KDL B;  4ZRP A;  3R8B A;  5DPS A;  1TTN A;  3L54 A;  2E3T A;  4XE0 A;  4IDI A;  4A20 A;  2O2V B;  3T3O A;  3DBL I;  2KXJ A;  2W54 A;  2X38 A;  2RPQ A;  2XK5 B;  3DVG Y;  1N62 A;  3V6C B;  2WXK A;  4HPM B;  1KFY B;  1D4B A;  2MQJ A;  2PPH A;  4CO7 A;  2H88 B;  2DAJ A;  3EC8 A;  4EZK A;  2LVP A;  2KFJ A;  4NNJ B;  2WDR B;  1NVI D;  3IT4 B;  3Q3M C;  3VVW B;  3A9J A;  5CHW A;  3A1Q B;  4IG7 B;  2JXT A;  4GU2 A;  2D3C A;  2IJ0 A;  1WJ4 A;  1PGX A;  3OWE B;  3L08 A;  3ONS A;  2PKO A;  3BWU D;  2O6V B;  3MP9 A;  2H89 B;  1N5X A;  2EMS A;  1PFD A;  2IO0 B;  2MW5 A;  4HK2 A;  2KN4 A;  4GGQ A;  2GI9 A;  3KWV A;  3ZKJ C;  1E8Z A;  4MT5 A;  1Q5W B;  4KX6 B;  2KDB A;  2LRU A;  4M0W A;  1T0Y A;  4A55 A;  2FUG 1;  2Q5W D;  2ZNV C;  1L6V A;  3PRE A;  1TY2 A;  2DZI A;  2KDM A;  4JX1 C;  2MJE A;  1HTO A;  2FIF A;  2CHW A;  2LFI A;  2D2Q A;  4N59 A;  4E74 A;  3WAL A;  2GBJ A;  2WXM A;  1FPY A;  4ASW C;  1HZ6 A;  2WP9 B;  1JWS D;  5C2T B;  2MWS B;  2K6Q A;  4UDU C;  3ZUN A;  2Y5P A;  1WMH A;  2BS3 B;  1NYR A;  4NPN A;  3FIL A;  1R4M B;  5C3J B;  3Q3J A;  3QQ8 B;  3BY4 B;  3KYD D;  2I1J A;  1GAQ B;  5D2M B;  1IGD A;  1C4P A;  3PRP B;  3CF6 E;  4HCN B;  3T9L A;  4HCP B;  4HPP A;  3AV8 A;  3OG5 A;  4BAX A;  2G4S A;  2JRH A;  3QX1 A;  1WJ6 A;  4RM9 A;  1SE3 A;  1CZP A;  5BMG A;  3A9J B;  1E0Z A;  5EE1 A;  4AUQ C;  4FXC A;  2KAJ A;  1Z2M A;  5MPO A;  3N1X C;  2BF8 B;  1JWU D;  1NBF C;  1FIQ A;  1FXA A;  4M8M A;  2L32 A;  2WDQ B;  4BOZ B;  4MH8 A;  4FLH A;  1IYF A;  2D3A A;  2AL6 A;  2INN E;  4MM3 A;  4K81 A;  2MBO A;  3DPD A;  4F8C B;  2G45 B;  4ZRK A;  1PGB A;  3I5J C;  1R4N B;  4HKZ E;  1V97 A;  3R66 C;  2RGF A;  4C56 C;  2WYQ A;  2DEN B;  2EEL A;  4AQ7 A;  5HG2 A;  4GDK B;  4M0W B;  2N7D A;  2WXH A;  1E9M A;  4OZB A;  2NS5 A;  1RFK A;  2NTT A;  5C23 A;  2AEH A;  3IAM 1;  2K9X A;  2D3B A;  2V4I B;  5G5G A;  3P63 A;  1ZDX A;  3E9S A;  1HXY D;  3B08 A;  4BZA A;  3KH0 A;  3QWZ B;  4RGM A;  5AUK A;  2GBK A;  1P7F A;  2C7M B;  2KYW A;  3FIL B;  3DWM A;  5GXG B;  1WZ3 A;  2JYT A;  1T5X D;  3APF A;  2K8B A;  3V61 A;  2NR2 A;  3VRB B;  3GB1 A;  3AMZ A;  3Q8C A;  3L4P A;  3PRM B;  1XQQ A;  1AW7 A;  1J8C A;  2MEK A;  1XCQ L;  4HRS A;  2OOB B;  2KQ7 A;  3LB8 C;  3KUC B;  2PIA A;  3N30 A;  1OQQ A;  4ZYN A;  1GUA B;  2KFK B;  4ANV A;  3N3K B;  3X0W A;  2LD9 A;  1TKY A;  5C1Z A;  3IXS A;  1WXQ A;  3DVG X;  1T0R C;  2LHE A;  1C1Y B;  1P9D U;  3NS8 A;  3RNG C;  2RD0 A;  4LNK A;  1K50 A;  1WYG A;  1VJK A;  1TS5 A;  1LFD A;  2RR9 A;  1WZ0 A;  3VXW A;  1TBE A;  4MM3 B;  4G11 A;  2R2Q A;  2WHI A;  2BGF A;  1GNU A;  4WQO B;  2LMC A;  1WGG A;  2RDH A;  4IM3 A;  4K1R B;  3KUZ A;  3NVZ A;  2BTE A;  3W1S A;  2M19 A;  2IO2 B;  2V0G A;  3W2D A;  2MBB B;  2ZZP B;  3RCZ A;  4MH0 E;  1EU4 A;  2BB6 A;  1WE7 A;  4II3 B;  3R7Q A;  1L0V B;  1WJU A;  4FHK A;  3DQV A;  1TIF A;  2LVQ A;  2ZJD A;  1J7C A;  3TUO A;  5D3I B;  2ACZ B;  1Q0W B;  4L2Y A;  4PT5 A;  3AUL A;  1NEN B;  3RNB C;  2AQ1 B;  2NMQ A;  3OLM D;  1ZDV A;  1E5W A;  1VZ8 A;  5AUI A;  4H2A A;  1XD3 B;  1C79 A;  2C5L C;  3AE3 B;  2REX A;  2CJO A;  1U4A A;  3H7P A;  4G3X B;  4RF0 A;  5IOI A;  3QK0 A;  4ANX A;  2N9E B;  4X57 B;  3RI7 C;  1QT9 A;  2KN5 A;  1L2N A;  4MAC A;  1WI0 A;  3JW0 X;  2XN9 C;  1GC6 A;  5E6P A;  3R3M A;  2JUO A;  3ZTD A;  4A8X C;  1IUE A;  5EE0 A;  3H6N A;  3TBL D;  1KLV A;  4ICU A;  2MJ3 A;  3NHE B;  1C78 A;  2L00 B;  4BKG A;  1DOX A;  1YN4 A;  3CWI A;  1N60 A;  2LI5 A;  3UIN B;  3CST A;  5EE3 A;  1YJJ A;  2MLB A;  2BWF A;  5L95 C;  2MBQ A;  2AQ3 B;  4GN1 A;  1E7V A;  3ZGZ A;  5LXH A;  4YSX B;  4W9L A;  2WS3 B;  4EUT A;  4PS3 A;  4A6Q A;  2ZW1 A;  1MG8 A;  3DBR B;  4L1B A;  1VRA B;  3TEX A;  2A5U A;  3AB5 A;  2LZ6 A;  5CTR C;  3HIZ A;  1D5X C;  3O13 A;  3QA8 A;  3AN1 A;  4N58 A;  2ZCC A;  3GZN B;  2M8S A;  3W1Y A;  3B9J A;  1E8Y A;  3VFK A;  4XWW A;  1UBQ A;  2MRP A;  4TKN A;  3SHQ A;  1J7A A;  4BBN F;  5J17 A;  4PS7 A;  5JXV A;  2SEB D;  4Q2J A;  2YEP F;  1GJZ A;  3CSF A;  4G0N B;  3AE4 B;  3VTU A;  1YX6 B;  1YQ4 B;  4ZRI A;  2LXC A;  3KWL A;  3H7P B;  4ZDV A;  3MFG A;  3JVZ X;  3WAP A;  3LDZ E;  5H92 C;  2LJI A;  2MA9 B;  2J0M A;  4NQL B;  2LGY A;  3Q14 C;  3AI5 A;  2LXA A;  3W1S C;  2WX1 A;  4IM0 A;  4AJY B;  4S17 A;  2QIL A;  3NG0 A;  4WUR A;  1TKG A;  2KWC A;  2LGS A;  4WJP A;  3QCA A;  1JML A;  4XDC A;  1V6E A;  1YNT E;  1YX5 B;  3GP7 A;  3UIP B;  2KHW B;  2DX5 B;  3P4R B;  2O2V A;  3RZF A;  1HE8 A;  1TZO A;  5HKH A;  3U7D A;  3NOB A;  2WDV B;  3Q8F A;  1I4R A;  2JF5 A;  2PVG C;  2MHJ A;  4W9K A;  5D7G A;  3DDC B;  5BYS A;  2N1V A;  5HI1 A;  1JRU A;  2XK5 A;  1GC7 A;  5G2N A;  2EMT A;  3PRZ A;  2GBR A;  2KJR A;  2KLC A;  1BXT A;  2KJ6 A;  5I4D A;  2N0S B;  4JPS A;  3NVV A;  1EUV B;  4WQM A;  4JWU C;  4I6N B;  1WXM A;  1NDD A;  5HHD G;  2CKH B;  1PUT A;  1YN3 A;  2MBE A;  1WGR A;  5DPT A;  1QQR A;  3U8Z A;  1ZXH A;  1I42 A;  3AH7 A;  2B76 B;  5LNK 1;  4W9C A;  4FA6 A;  2AWT A;  2O6V A;  4IWQ A;  1WY8 A;  2VZK B;  1RRB A;  2JZP A;  4TQ1 A;  4ZHO A;  2AX5 A;  4YSZ B;  2LRW A;  3AE8 B;  2V9H A;  1WF9 A;  2PE6 B;  5CHF A;  4KDI C;  2Y5B B;  2WDT B;  1V49 A;  4A3P A;  4YT0 B;  3HVZ A;  4P7I A;  1M94 A;  1D6E C;  1JRO A;  3ZRF A;  3W9C B;  4TV3 A;  2DWQ A;  2BBC A;  5D94 A;  3DVN V;  3QC8 B;  3KLS X;  4YTN B;  4DDI D;  4TSS A;  2IY0 B;  2PW9 A;  4OVU A;  2DAF A;  2K8C A;  4KZ0 A;  4JE3 B;  1H4R A;  3ZDM C;  1JWA D;  2GBN A;  3VAW A;  4WWO A;  2IGH A;  1ZOY B;  5J18 A;  2XEW A;  4DDG D;  2J52 A;  3ML8 A;  3OJ4 B;  2J0J A;  1UNS A;  3EA6 A;  3BYY B;  2KWD A;  4E3C A;  4ZHP A;  4FUL A;  2K8H A;  1FM0 D;  3DBH B;  4BKT A;  3HRD D;  2CHZ A;  1L7Y A;  1SEB D;  1IGC A;  1FNU A;  3RNF C;  4MGK E;  4OVV A;  1JCK B;  2N9P C;  4G50 A;  4MEM A;  4LNF A;  1EWC A;  1XEE A;  1L0Y B;  5KHQ A;  1A70 A;  4NAW A;  2R2O A;  4ANW A;  1K53 A;  4K7W A;  5JZE B;  1V86 A;  1PDX A;  3H9D A;  2WXN A;  3PV1 A;  3VH3 B;  2JSV X;  4BBN C;  1UWM A;  2WQY B;  2DLB A;  4GLS C;  2FCQ A;  3L0W B;  1UZX B;  2SAK A;  3SEB A;  1P1A A;  5H8Y E;  1V1O A;  3N32 A;  4KGR A;  1XLN A;  5IA7 A;  1MHX A;  2L0F A;  4WJQ A;  3JSV A;  2M0A A;  2LEK A;  1CK1 A;  1TY0 A;  4N9F 4;  5BMI A;  1WGK A;  5EE9 A;  1XLP A;  1FNW A;  2M1M A;  1SE2 A;  4GDK A;  2PVO D;  2KOX A;  1QOB A;  1YQB A;  1E7U A;  4S0R A;  1K51 A;  2GLS A;  3ZXR A;  4HVB A;  2KTR B;  3CIR B;  2AQ2 B;  2MSE D;  3RT3 B;  4C4V A;  2W55 A;  2MBH A;  1DYQ A;  1P0R A;  1ZP0 B;  2VZK D;  1UF0 A;  1WGY A;  3L17 A;  1ZE3 D;  1KOT A;  2WXO A;  5JHA A;  3RPF C;  5FR6 A;  4HRO A;  2INP E;  2J4X A;  4MGI E;  1F1H A;  3U52 E;  4P16 A;  1XF5 L;  1D5Z C;  1YD8 U;  3UI3 A;  3MC8 A;  2BYV E;  2LGD A;  3ZLZ A;  2G1E A;  2KK8 A;  4B9K A;  2BVC A;  2ZEQ A;  1XXG A;  1SBB B;  3WCQ A;  1EF1 A;  3V3X A;  2CHX A;  4NAW B;  3ZJT A;  1WGD A;  3IT6 B;  2ZVN A;  1RLF A;  4F1S A;  2KWV B;  2KFK A;  1T6B X;  4FAD A;  1Y56 A;  3TCA A;  2N4F A;  2KNB A;  1WFY A;  1WRI A;  2L05 A;  2KJH B;  2ASQ A;  3PS6 A;  3HUI A;  3S2A A;  1YOV B;  1QOA A;  3DHH C;  3AEB B;  1R4M I;  1V8C A;  5BYQ A;  4W9F A;  3JSV B;  2LWP A;  4WWM A;  3M63 B;  4WAF A;  3RNA C;  1WM3 A;  3A9K A;  2MP2 B;  1VZ6 A;  1FFV A;  4OW0 A;  1G6J A;  1E8W A;  3M3J A;  3V6E B;  1I4X A;  5AEK B;  3ZQ4 A;  4RGN A;  1SIJ A;  2D10 A;  3P42 A;  1L0X B;  4C4V B;  2RDG A;  1T0Q C;  3AE1 B;  3AEC B;  2JWU A;  4IWO A;  3WAM A;  2O6V D;  1BT0 A;  4P6V F;  3WAN A;  2DZJ A;  4FJY A;  2V3S A;  2WX0 A;  4WJO A;  3NY5 A;  1T0S C;  2YLM A;  3NRZ A;  1MI0 A;  4K3B A;  3H7S A;  2L7R A;  2XNA C;  3VH4 B;  2D07 B;  5KHO A;  3WA0 A;  3AM9 A;  2LGI A;  1EO6 A;  2JYE A;  1R4N I;  4O1N A;  2N1W A;  4ITK A;  4FBJ B;  2BW2 A;  3R2T A;  4MSQ B;  4RGO S;  2KX3 A;  1TS2 A;  4AOF A;  1A5R A;  1V5T A;  3KVF B;  3NZS A;  1RWS A;  1TJE A;  2LJ5 A;  1SE4 A;  4EZJ A;  2KC2 A;  1WYW B;  1NI3 A;  2KAN A;  4OVZ A;  1UUP A;  4B95 A;  1F77 A;  1KM7 A;  3OAW A;  3BVG A;  3VQI A;  1RFA A;  3PLV A;  3FAH A;  1VCB A;  4J6I A;  2C7N B;  3Q3N C;  4I6P A;  4ZOH C;  4YTP B;  3JYU A;  3APD A;  3A9K B;  3HHM A;  1FXT B;  3PZ8 A;  1MFW A;  2BKF A;  3SFD B;  1N63 A;  1UBI A;  1H8C A;  3CMM B;  2MH7 A;  2VRR B;  1QIL A;  2YVC A;  1QOG A;  4DQO C;  2BS2 B;  4EE2 A;  2MJD A;  1GPX A;  2KQ4 X;  4MEL A;  4LNN A;  1F0Z A;  3BK1 A;  1XO3 A;  3TJP A;  4US9 A;  1SXT A;  2CR5 A;  4LK0 M;  3B0A A;  4HEA 1;  1AWD A;  4LDT B;  5TR5 A;  1P7E A;  1KRH A;  5L83 A;  2HTH A;  4E71 A;  2AYO B;  2NPT B;  1NEK B;  1MHH E;  4NZL B;  3MC0 B;  2BKR B;  3TSS A;  3VR8 B;  3QAR A;  3SDL C;  3SFE B;  2WXI A;  1J7B A;  2ZW0 A;  3VHT C;  3P1M A;  2B3A A;  2K3U A;  3AED B;  1OEY A;  1B1Z A;  1F2R C;  1QF6 A;  2JY6 A;  4ARI A;  2KT7 A;  3NZU A;  5D6J B;  5IO9 A;  2LHD A;  2HTM E;  3LYY A;  4HJK A;  1JW9 D;  1TKE A;  2WXJ A;  2WU5 B;  2LUM A;  4BOS C;  4WWN A;  3VR9 B;  5E6O A;  1I35 A;  2IYD B;  1WXV A;  3L13 A;  2JQR B;  3W5V B;  1L4Z B;  2JZZ A;  2XBB C;  1UWX A;  2WXL A;  1XCT L;  2Y5C A;  1LO5 D;  2BYE A;  3GS2 A;  4YSY B;  3ZRC A;  2KLG A;  3L16 A;  1LXD A;  3VTV A;  5BYR A;  2NTS A;  4OZC A;  2L83 A;  2G9H D;  1F9J A;  2C9W B;  3APC A;  2BWE S;  1E8X A;  4DHJ B;  2J42 A;  2HDE A;  2KQS A;  3AEG B;  2KKC A;  4AWJ A;  4KKI A;  3FC4 A;  1JAL A;  5FK9 C;  1RAX A;  5IKC M;  3ZNH B;  1C4A A;  4C80 A;  3N1Y C;  2Z59 B;  2RPV A;  3AEE B;  4NQK E;  5GMV A;  1J0G A;  3NVW A;  1SJE D;  1ZKH A;  3U4E G;  2A4Z A;  3ZJU A;  2L0T A;  3GZN I;  2J0K A;  2ON8 A;  1EWY C;  1Z5S B;  2WXR A;  1N5W A;  1MJD A;  3O65 B;  1C3T A;  3ZW3 A;  2C7H A;  2DYO A;  4XWT A;  5E6N A;  2G4D B;  1T3Q A;  3DWG C;  2K25 A;  4DHZ E;  2DYB A;  3GOE A;  4WH4 A;  2ZPN A;  3X23 A;  5JHB A;  3OJ3 A;  1F52 A;  2W9N A;  3NUH B;  2IO3 B;  3T8M A;  2WXG A;  1PGA A;  1ESF A;  1QKZ A;  2W82 A;  3AE7 B;  2KDI A;  2FCN A;  1S1Q B;  2M56 B;  3ZVV A;  3MTN B;  4RH6 A;  5IAA C;  3VDZ A;  2G3Q B;  1V1P B;  2IGD A;  4RNA A;  2OJW A;  3IG3 A;  4USA A;  2VH1 A;  3BVZ A;  4KZC A;  3V62 A;  3Q8A A;  2PJH A;  3BIN A;  2JVC A;  3J9C A;  2L3Z A;  1L6U A;  4AJW A;  2MX2 A;  3BZD B;  3LJ3 A;  1C76 A;  1E90 A;  1OTR B;  4D2K A;  2JRI B;  3R7R A;  4P1B C;  3R2I A;  2KTR A;  1WX7 A;  1YMH E;  4NJ7 A;  3URY A;  2FE8 A;  2GB1 A;  3DBL B;  1NYQ A;  3AE6 B;  3ZDT A;  3PSE B;  2TSS A;  3FKY A;  4WWP A;  3TEW A;  1C4C A;  4DHJ D;  4JIO U;  3UF8 A;  1Y8R C;  1LQB A;  1WR6 E;  1QOF A;  3GE3 C;  4HPL B;  1WX9 A;  3AE2 B;  4AP4 C;  5FR3 A;  1OFF A;  1FCL A;  1QLB B;  4F7Z A;  5AZG A;  4XX5 A;  3QAQ A;  1OQR A;  3QJZ A;  2QEJ C;  1AYF A;  4N6E B;  1CQV A;  2IZV B;  2QIE B;  3PHX B;  1VD2 A;  4LJO B;  4C7Z A;  4HKQ A;  2IPK D;  3P4S B;  3A4R A;  3EFC A;  3UQA A;  2DNF A;  2KDF B;  4BVU C;  1FCC C;  4EZL A;  2KVR A;  1ENF A;  3VUY A;  1TS3 A;  5HFY A;  1B9R A;  2QC8 A;  4AS1 A;  2QHO A;  3RYT A;  2ZNV B;  3SD5 A;  3AE5 B;  4B6W A;  4DXA B;  4GDL B;  3SR6 A;  4W9E A;  1HA5 A;  2IO1 B;  1SIF A;  3U2S C;  2LGX A;  2PEA A;  3DBH I;  2NBW B;  4W9I A;  2QCZ A;  1WJN A;  2CJN A;  2WU2 B;  4XDD A;  3VTW A; 
#chains in the Genus database with same CATH homology
 2XN9 C;  1BML C;  4P6V F;  1ET9 A;  1N61 A;  1FNV A;  1EM7 A;  2N7J A;  4A8X C;  2L1A A;  1IUE A;  5EE0 A;  2KAC A;  3E56 A;  1GB4 A;  4ARC A;  3NRZ A;  1MI0 A;  2WNM A;  2XNA C;  2MJ3 A;  3I9V 1;  1C78 A;  3B2F A;  1DOX A;  1YN4 A;  3CWI A;  3AM9 A;  1N60 A;  1R7S A;  2LGI A;  4YWG G;  2JYE A;  1E7P B;  5EE3 A;  1YJJ A;  2L52 A;  4O1N A;  4ITK A;  1EU3 A;  1E10 A;  2BW2 A;  2IGG A;  3R2T A;  1ACC A;  1TYG B;  3V05 A;  4RGO S;  1TS2 A;  2AQ3 B;  3BYT B;  2IDY A;  1JQ4 A;  3ZGZ A;  1KF6 B;  4YSX B;  2WS3 B;  4TMA B;  1FMA D;  1JWM D;  2FBW B;  4A6Q A;  1RWS A;  1TJE A;  2ZW1 A;  1SE4 A;  2BYT A;  3T3N A;  3U7Z A;  4L1B A;  3ZYY X;  1VRA B;  3TEX A;  1I4G A;  1NI3 A;  3AB5 A;  2W3R A;  4OVZ A;  1UUP A;  2BS4 B;  1F77 A;  1D5X C;  5E6J A;  3O13 A;  4CQN A;  3AN1 A;  2Z8L A;  3BVG A;  4N58 A;  4KGS A;  3B9J A;  3VQI A;  4XWW A;  3AEF B;  1SSN A;  3FAH A;  4B0M A;  2V3N A;  1YQ3 B;  2I38 A;  2J53 A;  1SJH D;  4ZOH C;  4R3D A;  1ROE A;  1J7A A;  4YTP B;  1YN5 A;  1GOZ A;  5JXV A;  2SEB D;  4IKG A;  2ONQ A;  3TEY A;  1D5M C;  4Q2J A;  2WXQ A;  2YEP F;  4J3O D;  2WLB A;  3PZ8 A;  1L5P A;  2CU3 A;  3N9Y C;  3LXF A;  2YEP B;  3SFD B;  1N63 A;  2MH7 A;  3AE4 B;  2K0P A;  1DOI A;  1QIL A;  1YQ4 B;  2I2Y A;  3KWL A;  1YJI A;  1QOG A;  4OHJ A;  4DQO C;  3MFG A;  1DOY A;  1E6E B;  4ZRP A;  2BS2 B;  3R8B A;  2MJD A;  4EE2 A;  1GPX A;  5H92 C;  2LJI A;  2KQ4 X;  3PZ7 A;  2E3T A;  3H8H A;  1SB3 C;  4IDI A;  4XE0 A;  1F0Z A;  3BK1 A;  1XO3 A;  2K5P A;  3T3O A;  4US9 A;  1SXT A;  2W54 A;  2QIL A;  4LK0 M;  2X38 A;  4WUR A;  4HEA 1;  1AWD A;  4HJG E;  1TKG A;  1TS4 A;  4RCO A;  1N62 A;  4REZ A;  1P7E A;  2WXK A;  1XLO A;  1KRH A;  1KFY B;  1JML A;  5TSS A;  1D4B A;  3TEZ A;  4XDC A;  2H88 B;  4LTU A;  1YNT E;  3GP7 A;  1NEK B;  1MHH E;  3MJ5 A;  2JX5 A;  4NZL B;  2WDR B;  1KLG D;  1ZPS A;  1NVI D;  2K22 A;  1L4D B;  2R61 A;  3IT4 B;  3MC0 B;  3TSS A;  3VR8 B;  3P4R B;  3SFE B;  2WXI A;  1TZO A;  2JXT A;  2PTL A;  1J7B A;  4NJC A;  2IJ0 A;  2WDV B;  3Q8F A;  1I4R A;  1PGX A;  2QJL A;  2ZW0 A;  3P1M A;  2PVG C;  2RMM A;  5D7G A;  2K3U A;  3OWE B;  1ET6 A;  3AED B;  5BYS A;  1B1Z A;  5HI1 A;  1F2R C;  3B2G A;  1KH0 A;  2PKO A;  1QF6 A;  3BWU D;  3MP9 A;  2H89 B;  1BXT A;  4ARI A;  4LLG M;  1N5X A;  1PFD A;  5I4D A;  3P4P B;  2N0S B;  4JPS A;  3NVV A;  2LHD A;  2KN4 A;  2HTM E;  3LYY A;  4WQM A;  4JWU C;  1JW9 D;  2GI9 A;  3KWV A;  1TKE A;  2E6X A;  2WXJ A;  2WU5 B;  2LUM A;  3Q69 A;  4RF1 A;  5HHD G;  4MT5 A;  1KLU D;  1PUT A;  4A90 A;  1YN3 A;  4KX6 B;  2N9L A;  3VR9 B;  4M0W A;  5T8I A;  4A55 A;  2FUG 1;  1QQR A;  2Q5W D;  1FRD A;  2JQR B;  3W5V B;  1L4Z B;  1ZXH A;  1L6V A;  4DXF A;  3AH7 A;  1TY2 A;  2KDM A;  4JX1 C;  2MJE A;  1UWX A;  1VZ7 A;  2V3P A;  2B76 B;  4JWS C;  5G5H A;  5LNK 1;  1FEH A;  2WXL A;  1XCT L;  2LFI A;  1STE A;  4N59 A;  2Y5C A;  2VZK B;  2JZP A;  1LO5 D;  4TQ1 A;  2WXM A;  4ZHO A;  2AX5 A;  3GS2 A;  3AE8 B;  2JU6 X;  3AEA B;  4YSZ B;  1RM6 C;  1HZ6 A;  4YSY B;  2WP9 B;  2PLP A;  1ZUD 2;  1JWS D;  5C2T B;  4YT0 B;  4UDU C;  3VRA B;  2Y5P A;  1WSP A;  3HVZ A;  2BS3 B;  1NYR A;  1D6E C;  1JRO A;  3FIL A;  3W9C B;  5BYR A;  2NTS A;  5C3J B;  4OZC A;  2DWQ A;  2BBC A;  3BII D;  2L83 A;  3PO0 A;  2G9H D;  3KLS X;  4YTN B;  4YTM B;  3ZJV A;  4TSS A;  1AN8 A;  2PW9 A;  1DGJ A;  1GAQ B;  1IGD A;  3I57 A;  1C4P A;  1JRP A;  2J42 A;  2HDE A;  4JE3 B;  1JWA D;  3AEG B;  1WWT A;  4KKI A;  2OED A;  2IGH A;  1ZOY B;  3FC4 A;  1JAL A;  3AV8 A;  5FK9 C;  3ABV B;  2J52 A;  1C4A A;  1M4V A;  1UNS A;  1BUI C;  3EA6 A;  3BYY B;  3IAS 1;  2KWD A;  4RGT A;  4C80 A;  1SE3 A;  4ZHP A;  3AE9 B;  1JWB D;  1CZP A;  5BMG A;  1FM0 D;  2RPV A;  3AEE B;  1HZ5 A;  3HRD D;  1SEB D;  3NVW A;  1SJE D;  4B0E A;  1E0Z A;  5EE1 A;  1IGC A;  3U4E G;  1FNU A;  3ZJU A;  4FXC A;  2KAJ A;  4IOI E;  5MPO A;  2ON8 A;  1JCK B;  1JWU D;  1EWY C;  1FIQ A;  1FXA A;  1IBX A;  2WXR A;  3EUB 2;  2L32 A;  2WDQ B;  1N5W A;  4MH8 A;  1EWC A;  1XEE A;  1L0Y B;  1A70 A;  2INN E;  4TQ0 A;  1K53 A;  1Q10 A;  5D3D A;  1KTK A;  1PGB A;  2DYO A;  4XWT A;  1VLB A;  4HKZ E;  1V97 A;  1PDX A;  2WXN A;  4C56 C;  1T3Q A;  2JSV X;  3DWG C;  1UWM A;  2D5G A;  1C9F A;  2WQY B;  2EEL A;  4AQ7 A;  2DLB A;  4GLS C;  5HG2 A;  1I7H A;  4GDK B;  1GB1 A;  2SAK A;  1E9M A;  2WXH A;  4OZB A;  4WH4 A;  3SEB A;  3Q8E A;  1RFK A;  1F2R I;  5H8Y E;  1FD6 A;  1V1O A;  3NUH B;  2NTT A;  2BT6 A;  1XLN A;  4KGR A;  2QSD A;  1VR9 A;  4WIP A;  1PYW D;  2WXG A;  1PGA A;  1ESF A;  1MHX A;  3IAM 1;  1QKZ A;  2K9X A;  2M0A A;  2W82 A;  4US8 A;  2V4I B;  2LEK A;  5G5G A;  3P63 A;  1CK1 A;  1ZDX A;  3AE7 B;  1TY0 A;  1I4H A;  1K52 A;  3E9S A;  1WGK A;  3NZ3 A;  2M56 B;  1HXY D;  5BMI A;  4RH6 A;  5EE9 A;  1XLP A;  1FNW A;  4KKJ A;  1SE2 A;  4RGM A;  5AUK A;  2PVO D;  1V1P B;  1P7F A;  4L23 A;  1QOB A;  4ZRQ A;  2IGD A;  4RNA A;  2ICI A;  3FIL B;  3DWM A;  5GXG B;  4USA A;  2JYT A;  1T5X D;  1K51 A;  3BVZ A;  1HQR D;  3CIR B;  2AQ2 B;  3Q8A A;  1FRR A;  3VRB B;  3GB1 A;  3AMZ A;  3KQ4 A;  2W55 A;  3Q8C A;  3L4P A;  1DYQ A;  3J9C A;  4DXG A;  2WXF A;  4ZYS A;  1AW7 A;  1ZP0 B;  2MEK A;  1XCQ L;  2VZK D;  4HRS A;  1L6U A;  1CJE A;  2DYM A;  1XLQ A;  3LB8 C;  2PIA A;  3BZD B;  1FFU A;  1OQQ A;  1ZE3 D;  1C76 A;  1V1P A;  2WXO A;  3RPF C;  4D2K A;  1UGJ A;  4HRO A;  4KGT A;  4NAM A;  2INP E;  1TKY A;  2J4X A;  3R2I A;  1HEZ E;  3IXS A;  1YMH E;  3RFZ B;  1WXQ A;  2WXP A;  3URY A;  3W5U B;  2FE8 A;  3U52 E;  2LHE A;  2GB1 A;  4P16 A;  1MPE A;  1SF0 A;  1XF5 L;  1NYQ A;  2GRI A;  3AE6 B;  1D5Z C;  1K50 A;  1WYG A;  2TSS A;  3UI3 A;  1IBX B;  1VJK A;  3BVM A;  3TEW A;  1C4C A;  1TS5 A;  2G1E A;  4C7Y A;  1XXG A;  1SBB B;  3WCQ A;  3V3X A;  1QOF A;  1ZXI A;  3EGR A;  4MM3 B;  4NAW B;  3ZJT A;  3IT6 B;  2KMM A;  5FKA C;  2EKI A;  3AE2 B;  2LMC A;  2RDH A;  1T6B X;  5FR3 A;  3NVZ A;  2BTE A;  1OFF A;  3ETR A;  2OHF A;  1FCL A;  2W3S A;  1VDV A;  2Y3A A;  2PMV A;  1Y56 A;  3W1S A;  2M19 A;  1QLB B;  2V0G A;  1WRI A;  3W2D A;  3NVY A;  4OZA A;  3HVD A;  1RYJ A;  1OQR A;  3MHZ A;  2N9K A;  3C8Y A;  3HUI A;  2QMT A;  3NS1 A;  1EU4 A;  2BB6 A;  1C77 A;  2QEJ C;  1AYF A;  1QOA A;  4N6E B;  1CQV A;  1L0V B;  2QIE B;  3AEB B;  1V8C A;  5BYQ A;  3Q8B A;  1J7C A;  4C7Z A;  4WWM A;  4HKQ A;  2IPK D;  3P4S B;  3TUO A;  4WAF A;  5D3I B;  2ACZ B;  4L2Y A;  4PT5 A;  4A9A A;  1FCC C;  1VZ6 A;  2BB5 A;  1NEN B;  1FFV A;  4OW0 A;  2AQ1 B;  4RFB A;  1ENF A;  2NMQ A;  1ZDV A;  1TS3 A;  1FXI A;  3P4Q B;  1VZ8 A;  5HFY A;  1B9R A;  4AS1 A;  2DBY A;  5AUI A;  1I4X A;  1MVK A;  3AE5 B;  4H2A A;  1FO4 A;  1C79 A;  3ZQ4 A;  4GDL B;  3SR6 A;  4RGN A;  3AE3 B;  1HA5 A;  3BK2 A;  2CJO A;  1SIJ A;  3U2S C;  3P42 A;  1L0X B;  4YXD B;  4RF0 A;  2RDG A;  3AE1 B;  2CJN A;  3AEC B;  1I4Q A;  2JWU A;  1QT9 A;  2WU2 B;  4MAC A;  1I4P A;  4XDD A;  5BMH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...