1K52A

Monomeric protein l b1 domain with a k54g mutation
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
72
structure length
72
Chain Sequence
b'MHHHHHHAMEEVTIKANLIFANGSTQTAEFKGTFEKATSEAYAYADTLKKDNGEWTVDVADGGYTLNIKFAG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Protein L
molecule tags Protein binding
source organism Finegoldia magna
publication title Single-site mutations induce 3D domain swapping in the B1 domain of protein L from Peptostreptococcus magnus.
pubmed doi rcsb
total genus 20
structure length 72
sequence length 72
chains with identical sequence B
ec nomenclature
pdb deposition date 2001-10-09
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.10 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 1k52A00
1XCQL 1D4BA 4GLSC 1HZ6A 2ZW0A 4KGTA 1F2RI 2KACA 4D2KA 2ON8A 1MHHE 1JMLA 2GI9A 1ZXHA 2KN4A 2K0PA 2JXTA 2JSVX 1PGXA 1MI0A 2JU6X 1IGCA 2KWDA 1IGDA 2NMQA 1MHXA 1PGAA 2PTLA 1HEZE 1MPEA 1K50A 1QKZA 1F2RC 1EM7A 2EELA 2KDMA 2N7JA 4IOIE 5JXVA 2LUMA 4KGSA 4OZAA 2LGIA 1K51A 3V3XA 5BMHA 2IGGA 2N9LA 2QSDA 5HG2A 2N9KA 2KQ4X 2PLPA 2JWUA 5HFYA 1GB1A 4OZCA 1MVKA 2ZW1A 4WH4A 1GB4A 1IBXA 1P7EA 2I2YA 2ONQA 1P7FA 1FCLA 3MP9A 3FILA 2J52A 2I38A 4HJGE 4MACA 2LHDA 5BMGA 5BMIA 5HHDG 2QMTA 2PW9A 1K53A 1PGBA 4OZBA 2OEDA 1YNTE 1K52A 1KH0A 4KGRA 5HI1A 1XF5L 3FILB 3UI3A 4HKZE 4IKGA 2IGHA 2J53A 1IBXB 1FD6A 2RPVA 3GB1A 2IGDA 1FCCC 1Q10A 2GB1A 2JZPA 2RMMA 1C9FA 1HZ5A 1YMHE 1XCTL 1UWXA 2LHEA
chains in the Genus database with same CATH superfamily
4G50A 2MBBB 1XLNA 4A9AA 3ZNHB 1XCQL 1KFYB 1HE8A 2N7DA 1V1OA 2B76B 1ZPSA 1RFAA 1WXQA 2KO3A 3ZRCA 5CHVC 4P16A 2DNFA 2JSVX 4RF0A 1CJEA 1ZW7A 4GOCA 4MGKE 2KD0A 2QHOA 3RNAC 2KTRB 2CU3A 2LI5A 1UH6A 2DYBA 3NZUA 3QWZB 4NY0A 4WWOA 4ANXA 1AW7A 1MPEA 1NI3A 1RYJA 1QKZA 3ZVVA 4ZRKA 3U4EG 5J18A 4C7YA 2Z0DB 1IYFA 1PFDA 2FBWB 2LUMA 2IPKD 2LGYA 4WJOA 3R7RA 2ZPYA 4G11A 3ZYYX 2WU5B 3A9KA 5L95C 1WZ3A 4RFBA 3Q6BA 5HKHA 2GLSA 5IP4D 2M4NA 4DDGD 2VH1A 2JZZA 2MJ3A 2MWSB 1WE7A 1ZXIA 1WX9A 2EMTA 4WH4A 1GB4A 1VCBA 2WXHA 4M0WA 1FCLA 1KRHA 3SEBA 2J52A 4HJGE 4MEMA 4RGMA 3DDCB 2ZEQA 3VTUA 2MHJA 5DCNA 4BOSC 1KLGD 1P98A 4W9GA 2YLMA 1E9MA 3AEFB 3AMZA 1UGMA 4FLHA 4HRSA 3C0RB 4M8NA 3MFGA 2WWZA 3SD5A 2IGDA 4H2AA 1C9FA 1FNWA 1IUEA 1YMHE 2VRRB 3EECA 2E6XA 2KACA 2JXXA 3ABVB 3X23A 2CHXA 1EUVB 4E74A 3ZNGC 4XWTA 2AL3A 3MTNB 3VR9B 2MA9B 1C76A 2Z59B 2ZCBA 4TQ1A 2IO1B 4A3OA 3PZ8A 4HKQA 3L13A 4GU2A 3E9SA 2KJRA 3PZ7A 2K3UA 4NPNA 4XX5A 4YSXB 2RGFA 3I3TB 3J9CA 1XQQA 1OQYA 2WXOA 3VTWA 2I1JA 2K8CA 3ZKJC 1VZ8A 4HDOA 1BXTA 1MG4A 2AQ3B 1XD3B 3IT6B 3D32A 5TR5A 4FHJA 1ACCA 3M3JA 1C3TA 3GZNI 2ZNVC 2RD0A 1NEKB 1E8WA 1TZOA 1M94A 4HEA1 4MGYE 3LDZE 3KQ4A 2PW9A 2LVPA 2WDQB 1EWCA 1PGBA 1QOBA 2LMCA 3VUWA 2OEDA 2KYWA 2BYVE 3RZFA 2LD9A 3PZDA 1XXGA 5DPSA 3KW5B 4N9F4 5C1ZA 2D3CA 3TJPA 5JH5C 1KOTA 3M62B 4NAWA 4N58A 1V9JA 1C78A 3PLUA 3PLVA 2AWTA 1TT5B 1I35A 2HE7A 4JPSA 4NJ6A 3JW0X 1UZXB 2CKHB 3MJ5A 4NNJB 2SEBD 3B2GA 4C4VB 4DBGA 3SFEB 2L1AA 3P42A 3H7PA 3R2IA 1WH3A 1YQ3B 2WDVB 3DCGA 4II3B 4I6NB 4MELA 1TIFA 2BBCA 3QAQA 1HTQA 1V1PA 4YTPB 1LXDA 2BWFA 2AX5A 2L52A 3U2SC 2KQSA 1J19A 1SE2A 4MH0E 2JT4B 3QK0A 4W9DA 4IOIE 2CS4A 4A90A 3N32A 5G5GA 4HPPA 1VDVA 4YL8A 4A8XC 2DBYA 4WAAA 3IAM1 4EKUA 3NVVA 4IM3A 1ET6A 1XLPA 1H4RA 1OEYJ 1EF5A 4LNIA 5L83A 3DWMA 2GBNA 4GIVA 1M4VA 3R3MA 4K3CA 2NCNA 2V3NA 1WJUA 4YTNB 3IHPC 3U8ZA 4EFOA 1DOYA 3V6EB 5BMIA 1QILA 2KTFA 4C4VA 1ENFA 4XGAB 2JYTA 2QDFA 4HROA 1L2NA 2WXPA 2IZVB 2K5PA 2KFKA 5EE3A 3W9CB 4GDLA 2KFJA 4IKGA 4S17A 3IT4B 3T9LA 1SGHA 3MJWA 1IPGA 3PS6A 4EZLA 3A1QB 2JZPA 4XYCA 4DDID 3QHTA 4PYZA 3RNGC 2INPE 3P2BA 1I4QA 3L54A 4FULA 2Z0EB 4A55A 2CHWA 1YN5A 3RNFC 2QCZA 1MHHE 4K7SA 2KK8A 3BYTB 2L32A 1I4HA 4HWIB 4PK1A 1VZ7A 3AN1A 2M1MA 1LO5D 3LXFA 2Q5WD 1WSPA 1IGCA 2LRUA 2KWDA 1IGDA 1N63A 1IP9A 2KJ6A 1B1ZA 1FMAD 1N62A 3AV8A 3U7DA 1U4AA 2WXNA 3QA8A 3BVZA 2N1VA 2OJWA 3P4QB 3EA6A 1CQVA 1AARA 5FKAC 1WM3A 2LEKA 1WJ4A 3P1MA 4NQLB 3WAPA 2K6DB 4XC2A 4C56C 3H8HA 3WANA 1GB1A 1FFVA 5IO9A 4M8MA 1T0QC 4RGOS 3BK1A 3DQVA 1I4XA 2O6VB 3PVLA 1SF0A 2PKOA 1ZOYB 1S3SG 2ACZB 3SU8X 4AJYB 5EDSA 4M00A 1E7PB 2G3QB 1BUIC 2BF8B 2W82A 3TCAA 3NVWA 2KWCA 4ANVA 5HHDG 4FJZA 2A5UA 3T3NA 3AEAB 1UNSA 1FXAA 3RNBC 3L10B 3ONSA 4KGRA 5MPOA 1YQ4B 4XDCA 1RAXA 1WX8A 3Q8BA 3N20C 2WYQA 1V80A 1WE6A 2JRHA 2RMMA 3L08A 4ZOHC 3I63C 2KZRA 4QAYA 3H6NA 2NBWB 4ZHPA 2PIAA 1KF6B 3IG3A 3U30A 1E10A 4O1NA 5D2MB 4ASWC 1ZXHA 2RSUA 1LQBA 4BZAA 1YQBA 4DXAB 3HVZA 4US9A 2PE9A 1UUPA 2O6VA 2BYTA 4WIPA 4KSLC 1EU4A 1VZ6A 1UGJA 3BYYB 2B3AA 2MJEA 3ZUNA 1OQQA 3SFDB 1CZPA 1V81A 1F2RC 1FRRA 1TKGA 2DZIA 2EELA 4PS3A 3N1XC 3ZNZB 3PGEA 3OG5A 1C4PA 3A33B 4TKNA 1AN8A 1DOIA 2IGGA 2N9LA 4IUMB 3Q8EA 2AL6A 1HA5A 5LXHA 3Q3JA 5BYQA 1V97A 2PLPA 4OVZA 4GXBA 1R4NI 4G3XB 4DXGA 2KWUB 4BKSA 4UDUC 2MP2B 4PS7A 2LASA 3PV1A 3RT3B 2KTRA 3ZJTA 4REZA 1E8ZA 3FILA 4YTMB 3TEYA 2V1YA 4GDLB 2DLBA 1YD8U 1F52A 4OZBA 3KUCB 4JGHB 3FC4A 2MSED 3RNCC 1WGKA 2FUG1 3N30A 5GXGB 2PVGC 3TEZA 1YX6B 1E7UA 2BW2A 3QQ8B 1V8CA 3R8BA 1YJJA 2IYDB 2OJRA 3ENEA 2XK5A 3OJ4B 2AYOB 3HHMA 3URYA 3O13A 2LJIA 3MC9A 2DZJA 2FE8A 1C4CA 3RD2A 2GBRA 3CSTA 3PRPB 2PEAA 2ON8A 3C8YA 4MDKE 3L0WB 3VUXA 2V4LA 2BS3B 1SB3C 2PMVA 1D5XC 4GN1A 5AZHA 3KYDD 4C00A 2J7QB 2J0JA 3W1YA 5DPWA 2KDBA 2KC2A 3MC0B 1ZDXA 1SEBD 2X8XX 3GE3C 4YSYB 1E7VA 4OHJA 2V4IB 1XO3A 4IM0A 2DYMA 2N7JA 1TY0A 1VD2A 3DBHI 4OZAA 1GJZA 5KHQA 4J6IA 1WMHA 1KLVA 1JRUA 2VZKD 1WGGA 2JY6A 1I42A 2K8BA 2IO2B 1D6EC 4LDTD 3DHIC 4IWOA 2K8HA 2KVZA 3PRZA 4PYUA 4A20A 1I4GA 2ZVOA 2GOWA 4B9KA 2FAZA 3BIID 2LHDA 3TUOA 1WMHB 4P1CC 1TY2A 3QIJA 1PDXA 1J0GA 4HPLB 3AB5A 2K22A 1J7BA 1F0ZA 2PE6B 1CK1A 1WXAA 5G55A 2D2QA 4HLEA 4W9IA 2HJ8A 3OLMD 3W5UB 1OEYA 3IBEA 2MBQA 2WXGA 1KJTA 1NI2A 2L0FA 2LXCA 4WJNA 5H92C 2GB1A 4DHJD 5BYRA 2QILA 2WLBA 4TSSA 5C2TB 2LHEA 3B9JA 2KLGA 1L0VB 2LZ6A 1YOVB 4KGTA 3CSFA 1YIWA 1HTOA 2D3GA 4D2KA 2KANA 4IWQA 1YJIA 5AUKA 1N5XA 4P6VF 3NVYA 3V62A 1V6EA 3DHGC 3C19A 2J42A 1MI0A 5C3JB 4OW0A 1F77A 1QLBB 1JW9D 3VDZA 1HEZE 3ZGZA 1T0YA 4NZLB 4EEWA 2KDMA 4ZRIA 2MW5A 1YJ1A 3WCQA 2HD5B 4MM3B 4LCDE 1XLQA 1SE9A 3V3XA 3SDLC 2N9PC 1FRDA 3H9DA 3H7SA 2WDRB 3NOBA 2D07B 2IO0B 2KQ4X 2JWUA 3N1YC 2ZW1A 3VAWA 3AEBB 2MP2A 4R3DA 1QF6A 1JWMD 3AE9B 4IWPA 3ZDMC 4BKGA 2H89B 3VTVA 3ZXVA 1FXTB 2D10A 4YXDB 3AULA 1JWUD 2C7HA 3ZO5B 4PS8A 1GOZA 3UQAA 2FCNA 1A5RA 4TMAB 2EKEC 2JVCA 2KDEB 3Q8AA 3ZQ4A 2L83A 1Z2MA 1Z5SB 2BB6A 5D94A 4JLCA 1OQRA 3ZXRA 3EGRA 3DVGY 2KHWB 3AE1B 4ICUA 1FD6A 1RM6C 3PPAA 5JHBA 1C4AA 2K6QA 4MGIE 4ARCA 5AZFA 1TKYA 3ZLZA 4MH8A 3AE7B 1KM7A 4AQ7A 2JRIB 1BMLC 1WIAA 5EE0A 2WX0A 1XEEA 2BKRB 4LJOB 2LVOA 5AEKB 4W9KA 4BBNF 4BVUC 2BYEA 4WWNA 3KLSX 1STEA 3A1QA 1WYWB 2WS3B 2WU2B 1K50A 3T8MA 2WQYB 4KZCA 2N7EA 2G4DB 1WRIA 3U52E 1X1MA 3ML8A 2DWQA 2Y5PA 1MG8A 1T0SC 2EMSA 3Q3NC 3AECB 2R61A 5EE1A 5CHFA 2QSDA 3RZWC 1R4MB 3PT2B 1A70A 3AEDB 1L6VA 1L0XB 2RDGA 3VQIA 3SHQA 1IBXA 2C5LC 2JPHA 2WXIA 4K81A 2V9HA 4LLGM 4F7ZA 1WY8A 4BOZB 1V86A 1TS4A 4W9HA 3AM9A 4LNOA 1P9DU 4MT5A 2DZKA 1I7HA 1WX7A 1R4NB 1V5TA 3MC8A 1WFYA 3RNEC 4LK0M 3PRMB 2IGHA 2J53A 3VXWA 2BS2B 5CHWA 5FK9C 1ET9A 1AYFA 2IBIB 2D11A 1XCTL 4RGTA 4K7WA 3DVNV 5J2RA 1WXVA 1V1PB 1JROA 4YWGG 2W3SA 4ANWA 4KIKB 3RI7C 2DX5B 1TTNA 2MRPA 1N61A 2W55A 3P4RB 2LVQA 3NRZA 3W5VB 4RH6A 5C23A 3RCZA 4DK5A 2YVCA 4WQMA 3PSEB 2MCNB 1P3QU 4W9JA 5FR6A 4DWFA 4LTUA 4KIKA 3DBLI 1JWBD 2KQ7A 1K51A 2X38A 2NBUA 2REXA 5LNK1 3KWLA 2JF5A 2Z8LA 4K7UA 1ZE3D 2O2VB 2GBJA 2HTHA 4FJYA 1MVKA 2QJLA 3SR6A 2WXJA 4K3BA 4W9FA 1VR9A 2BVCA 3V61A 2HTME 1WGYA 2KMMA 2R2QA 4DXFA 2K1FA 4B95A 2OHFA 4DHZE 3UGBB 1TJEA 3O65B 2ZVNA 4BKTA 4WJPA 2N1WA 4LNNA 1ESFA 2IO3B 1NYRA 4JX1C 3GZNB 2EKIA 4WQOB 1WXMA 3HRDD 3V60A 2N9XA 1Y56A 3AE5B 2FIFA 1YX5B 1V5OA 3AXCA 2M8SA 4P1BC 1T5XD 4RCOA 1P0RA 4XDDA 4HPMB 4BFRA 4HVBA 4ZHOA 1WRDB 1BT0A 2RPVA 2INCC 1Q5WB 3M95A 4MSQB 3AE6B 2JX5A 4HK2A 3HM6X 2I1KA 3AEEB 4GLSC 5E6NA 3VVWB 4EZJA 4A6QA 2ZZPB 3CIRB 2WHIA 4GB9A 1KTKA 1RFKA 3A9JB 4RNAA 4HXDA 4NAWB 1CMXB 2JZ3B 2KXJA 2NMQA 3IVFA 5E6OA 2C7MB 3K9PB 2GBKA 1AWDA 5I4DA 4ZRJA 5JXVA 1ZGUB 2D3BA 1QQRA 1GNUA 3UIPB 4I6PA 4TQ0A 1EF1A 2CU1A 4GMVA 2IY0B 1Y8RC 5HG2A 4M02A 2LUEA 2KX3A 3FKYA 4IDIA 4M0WB 3VFKA 1QOGA 2ZCCA 4NJCA 3PO0A 2AQ2B 4BAXA 3QCAA 2IDYA 1SE3A 3L17A 2FUHB 2QMTA 4B0EA 4EUTA 1L7YA 3BY4B 4ANUA 3AEGB 1F9JA 3NHEB 2KKCA 2IY1B 1NVID 3NZ3A 3DOWA 2RDHA 3Q3MC 3ZJVA 4B0MA 4URKA 1WF9A 4AWJA 4USAA 1GC7A 4RGNA 3ZTDA 1FFUA 3I57A 3Q2AC 1TBEA 4CO7A 1FCCC 2L3ZA 1G6JA 3AI5A 1MJDA 3GE8C 1D5MC 3S2AA 1TZ1A 2WXFA 3NUHB 4KDLB 2JUOA 1VRAB 1D4BA 4C7ZA 1SJHD 2FIDA 4CQNA 3BINA 1GPXA 2LXAA 4FA6A 2K0PA 5GMVA 4NJ7A 2JU6X 1JWAD 3JSVA 2PVOD 4FXCA 3AE4B 2W9NA 2BB5A 1GC6A 1MHXA 2K9XA 1C79A 2PTLA 3Q8FA 4FJVB 3E56A 1Q0WB 1JQ4A 1S1QB 3VH3B 1L5PA 4E71A 2BQQA 1L4DB 3WIMA 4ACFA 2WX1A 4XZ4A 1ZUD2 2KDFB 1V2YA 2O2VA 1WWTA 1GUAB 3TSSA 3DBLB 1FNUA 5HFYA 3AE3B 4KZ0A 3AU4A 3EFUA 4XE0A 4B6WA 2KAJA 2J0MA 2A4ZA 3MHZA 4RM9A 3DBSA 1E5WA 1L0YB 1TS5A 3L4PA 3MP9A 3V05A 4DHJB 1EU3A 3RULA 2L7RA 4CYEA 4HCNB 2NR2A 3Q14C 5CX3A 4E3CA 4AS1A 2FCQA 2LGDA 1K52A 2V3SA 4YSZB 1FIQA 5JHAA 2KN5A 3LB8C 2QIEB 3NZSA 4HKZE 2GRIA 1F1HA 2L05A 1Q1OA 3AH7A 3W1SA 4AP4C 4HDQA 1I4RA 2WXKA 3PHXB 2BGFA 2KC1A 1YN4A 1QZEA 2O6VD 1TKEA 2YEPB 4LDTB 1J7AA 5E6PA 1WR6E 4W9EA 3ZRFA 1WI0A 2XN9C 1JALA 4DHZB 1N60A 3VUYA 4RF1A 3OAWA 3APFA 1J8CA 3T3OA 5J17A 2NS5A 4L1BA 3WA0A 3ALBA 5EE9A 5BYSA 4KGSA 2GMIC 1T0RC 1ZKHA 3H1UA 5TSSA 1WM2A 2INNE 2NPTA 2DYOA 2W54A 4BKSD 3OWEB 4NAMA 2DAFA 1QOFA 2WGSA 4GGQA 2LGXA 1DGJA 4AOFA 2INDC 2LRWA 1FO4A 1MFWA 3LYYA 3RMKC 2KOXA 5IA7A 1FEHA 2L76A 1LM8B 3RPFC 4JL9A 3NVZA 4KV2A 3QARA 2V0GA 1E8YA 2WXQA 4US8A 1UBQA 3H7PB 2C7NB 3A9JA 2K25A 3W1SC 4Q2JA 2BS4B 3N9YC 3KVFB 1D3ZA 2RR9A 1JCKB 3APDA 5DPRA 4EZKA 4PT5A 3I5JC 2KX0A 4TV3A 3KUDB 4JIOU 3HUIA 1TS3A 4OVVA 1LGRA 1YNTE 1UELA 1E8XA 3VHTC 1KH0A 3NJTA 1SE4A 5CTRC 3UF8A 5HI1A 1SBBB 2BPSA 3FILB 2MLBA 5G2NA 1GAQB 2UU7A 2G1EA 2G45B 1WJ6A 2UYZB 4JWUC 1I4PA 2JQRB 3ECIA 1SSNA 4ARIA 1NYQA 1HZ6A 2BWES 2ZW0A 1F2RI 1OTRB 3BVMA 1UF0A 1C1YB 3NG0A 1NBFC 2E3TA 2NPTB 2R2OA 3ETRA 1QOAA 1E6EB 1QT9A 2KVRA 2QC8A 3KH0A 3WALA 1WZ0A 4YT0B 2DHZA 2L8JA 4MGZE 3I9V1 2BT6A 1EWYC 3V6CB 4RM8A 4F1SA 3JVZX 3DBRI 4KX6B 1V49A 1WXSA 4WJQA 1TYGB 3CMMB 2CHZA 2ICIA 5FR3A 2G4SA 1ISNA 4ZRQA 2MBEA 3EUB2 2J4XA 4A3PA 5H8YE 3NS1A 3AE8B 2N9KA 4KKIA 3DHHC 3ZDTA 1H8CA 4HCPB 4G0NB 3KUZA 4IM2A 5G5HA 2TSSA 3TEWA 2I2YA 4S0RA 1P7FA 2DENB 1RLFA 2C9WB 4N59A 2GBMA 2D3AA 1OFFA 2K39A 3FAHA 2WXMA 4AJWA 2CJOA 2VZKB 4GSWA 3RFZB 3ZW3A 1HQRD 2IJ0A 4JE3B 2KMCA 2AEHA 3HK0A 2KT7A 5D7GA 2QEJC 4IW0A 4EE2A 4F8CB 3U7ZA 1TGZB 1UWXA 3IXSA 3Q3OC 3Q8CA 3PREA 3L16A 1ZDVA 3DWGC 5IKCM 1E0ZA 1J7CA 2GI9A 3ZJUA 3UINB 5JZEB 3B2FA 1VLBA 4FN2A 3VR8B 4ZRPA 3P4PB 2DZMA 3LJ3A 2BYFA 4IC7B 3HIZA 2KJHB 3TMPB 4WWPA 2FCMA 2J0KA 3BWUD 2ZJDA 4J3OD 1LFDA 3QC8B 3ZTCA 1L4ZB 2Y5BB 4KSKC 3DVGX 4KVGB 3JSVB 2RDBC 2FCSA 3A4RA 2HDEA 2LGIA 5AUIA 1PQSA 1DOXA 2NTSA 2UWQA 3UQBA 2NTTA 1YN3A 1JRPA 2M0XA 3N1ZC 3DBHB 2L00B 1WJNA 1OGWA 2V3PA 5AZGA 4ICVA 2MH7A 1K8RB 1JWSD 4HJKA 2MJDA 3VH4B 2W3RA 4IG7B 3RN9C 3KYCD 3R7QA 4I6LB 4MACA 4W9CA 3EHVA 3EFCA 2LGSA 3HVDA 1K53A 2HJ1A 1WYGA 2LFIA 3APCA 4GDKA 3M63B 3BZDB 2FNJB 3WAMA 3R66C 2BKFA 1N5WA 3UI3A 1SIJA 2ZNVB 5IN7A 4MSMB 4M01A 1Q10A 3CWIA 3JYUA 5DPTA 2XK5B 1T6BX 1XLOA 2ZPNA 3ZIMA 2Y3AA 2PPHA 2Y5CA 4WAFA 3ZNID 2DAJA 4ZYSA 4JQWC 1FXIA 3PHWB 3VRAB 1JMLA 2NBVB 2JXTA 1NDDA 4WURA 1PGXA 4WWMA 1HXYD 2WNMA 1ROEA 3MHSD 2MBOA 3GS2A 3R2TA 1DYQA 1P1AA 4FBJB 2VH2A 3QX1A 2JYEA 2WXRA 2KLCA 2WDTB 4LNFA 1ZP0B 1KLUD 3RYTA 1EM7A 2MBHA 1FM0D 1WGHA 4MJSA 3NS8A 1UD7A 2WP9B 2M17A 2C60A 2M0AA 2OOBB 4LJPB 4AUQC 4OZCA 2NVUI 3CF6E 4TUUA 4N6EB 2MX2A 3WAOA 5BO4B 5T8IA 2N9EB 4W9LA 2CJNA 3QJZA 1C77A 5D3IB 1T3QA 3P4SB 2KNBA 4MM3A 4BBNC 2XEWA 4X57B 2LJ5A 1FNVA 1SXTA 1PUTA 1UBIA 4II2B 4XWWA 1XF5L 1WGDA 3OJ3A 4RMAA 3UIOB 3PTFC 1IBXB 2AQ1B 4LNKA 3TBLD 3B1LX 1SIFA 3Q3FA 3TEXA 4OVUA 5LLIA 3N3KB 3B0AA 1WR1A 3RUIB 1XT9B 3DVNU 4EOYA 5IOIA 3DBRB 1L6UA 5D6JB 3BVGA 4ZYNA 3TL5A 2KN4A 4DQOC 3DPDA 1RWSA 1UWMA 1D5ZC 4MJSB 2XBBC 2SAKA 2MEKA 5IAAC 4L2YA 3Q69A 1PGAA 2N4FA 1EO6A 3BK2A 3EC8A 4FHKA 3X0WA 3IFWB 2D5GA 1SJED 1TS2A 4P7IA 1R4MI 2N0SB 5KHOA 1E90A 5BMHA 2CR5A 4KDIC 5D3DA 1RRBA 3B08A 2M56B 4ZDVA 3HM3A 2BTEA 2ASQA 2KFKB 2KMAA 4NQKE 2H88B 4C80A 1PYWD 1P7EA 3TIXA 2YEPF 4ITKA 3NY5A 2ONQA 2MQJA 1R7SA 3P63A 1NENB 2I38A 3GOEA 1WGRA 4JWSC 3AU5A 3ML9A 2XNAC 3AE2B 5BMGA 2KDIA 1GG3A 2RPQA 5LXIB 3IAS1 3GP7A 4L23A 3KWVA 3K9OB 3W2DA 3VRBB 4KKJA 3A9KB 2M19A 4GDKB 4FADA 4K1RB 1FPYA 4CHKA 2G9HD 2KWVB 3A4SC 1N6ZA 3GB1A 2JWZA 2L0TA 1VJKA 2WXLA 1B9RA 1HZ5A 2PJHA 2LWPA 5E6JA
chains in the Genus database with same CATH topology
1XLNA 4A9AA 4ZHPA 1V1PB 1SSNA 1XCQL 4ARIA 4B0EA 1KFYB 1NYQA 1HZ6A 2ZW0A 1F2RI 2PIAA 1KF6B 1JROA 4YWGG 1V1OA 2B76B 2W3SA 1ZPSA 1E10A 4O1NA 3BVMA 1WXQA 1ZXHA 2E3TA 3ETRA 4P16A 2JSVX 4RF0A 3HVZA 1QOAA 1CJEA 1N61A 2W55A 1E6EB 4US9A 1UUPA 1QT9A 2BYTA 3P4RB 4YT0B 4WIPA 1EU4A 3NRZA 3W5VB 1VZ6A 2CU3A 3I9V1 2BT6A 4RH6A 1UGJA 1EWYC 3BYYB 4WQMA 2MJEA 1AW7A 1MPEA 1NI3A 1RYJA 1OQQA 4KX6B 3SFDB 1QKZA 1CZPA 1F2RC 3U4EG 1FRRA 1TKGA 4C7YA 2EELA 1TYGB 1PFDA 2FBWB 2LUMA 4LTUA 2IPKD 1C4PA 1JWBD 2ICIA 1AN8A 1DOIA 1K51A 2WU5B 3ZYYX 5FR3A 2X38A 2IGGA 2N9LA 4ZRQA 4RFBA 5LNK1 3KWLA 3Q8EA 1HA5A 3EUB2 2Z8LA 2J4XA 5H8YE 3NS1A 3AE8B 1ZE3D 5BYQA 2N9KA 1V97A 2PLPA 4KKIA 4OVZA 1MVKA 2QJLA 3SR6A 2WXJA 4DXGA 2MJ3A 1VR9A 1ZXIA 4UDUC 2HTME 4WH4A 1GB4A 5G5HA 2KMMA 4DXFA 2TSSA 3TEWA 2OHFA 2I2YA 3ZJTA 1TJEA 1P7FA 2WXHA 4N59A 4REZA 4M0WA 1FCLA 1KRHA 3FILA 2J52A 3SEBA 1OFFA 4YTMB 4HJGE 4RGMA 3TEYA 3FAHA 4GDLB 2DLBA 1KLGD 1ESFA 2WXMA 4OZBA 1NYRA 2CJOA 4JX1C 2VZKB 2EKIA 3RFZB 3FC4A 1E9MA 1WGKA 2FUG1 3AEFB 3AMZA 3HRDD 3AE5B 1Y56A 5GXGB 4HRSA 1HQRD 2IJ0A 2PVGC 4JE3B 4RCOA 3TEZA 1T5XD 3MFGA 4XDDA 4ZHOA 2RPVA 5D7GA 2IGDA 2BW2A 2QEJC 1V8CA 3R8BA 4H2AA 4EE2A 1C9FA 3U7ZA 1YJJA 1FNWA 1IUEA 1YMHE 3AE6B 2JX5A 1UWXA 3URYA 3IXSA 2LJIA 3O13A 2FE8A 1C4CA 3Q8CA 3AEEB 4GLSC 2E6XA 2KACA 4A6QA 3ABVB 1ZDVA 2ON8A 3DWGC 3C8YA 1E0ZA 3CIRB 4XWTA 1J7CA 2GI9A 3ZJUA 2BS3B 1SB3C 2PMVA 1D5XC 3B2FA 1VLBA 1KTKA 1RFKA 3VR9B 3VR8B 1C76A 4RNAA 4TQ1A 3P4PB 4ZRPA 3PZ8A 4NAWB 4HKQA 2NMQA 3MC0B 1ZDXA 1SEBD 4YSYB 3BWUD 4J3OD 3E9SA 4OHJA 2V4IB 1L4ZB 1AWDA 1XO3A 2DYMA 3PZ7A 2K3UA 5I4DA 2N7JA 1TY0A 4YSXB 5JXVA 4OZAA 3J9CA 2HDEA 2LGIA 1QQRA 2WXOA 5AUIA 1DOXA 2NTSA 4TQ0A 2NTTA 2VZKD 1VZ8A 1YN3A 1JRPA 5HG2A 1D6EC 1BXTA 2AQ3B 2V3PA 3IT6B 4IDIA 2MH7A 1QOGA 1JWSD 1I4GA 2MJDA 1ACCA 2W3RA 4NJCA 3PO0A 1NEKB 2AQ2B 1TZOA 3BIID 4MACA 2LHDA 4HEA1 3TUOA 2IDYA 1TY2A 1SE3A 1PDXA 2QMTA 2PW9A 3HVDA 3KQ4A 3AB5A 2K22A 1K53A 2WDQB 1J7BA 1EWCA 1PGBA 1WYGA 2LFIA 1F0ZA 1CK1A 1QOBA 2LMCA 3AEGB 2OEDA 3BZDB 1NVID 1XXGA 3NZ3A 2RDHA 3ZJVA 3W5UB 1N5WA 4B0MA 3UI3A 1SIJA 4USAA 2WXGA 4RGNA 1FFUA 4N58A 3I57A 1FCCC 5H92C 1C78A 1Q10A 2GB1A 5BYRA 1D5MC 2QILA 2WLBA 2WXFA 3CWIA 4TSSA 5C2TB 1T6BX 1XLOA 2LHEA 3B9JA 2Y3AA 3NUHB 1L0VB 1VRAB 4JPSA 2Y5CA 1D4BA 4KGTA 3MJ5A 4WAFA 4C7ZA 1SJHD 4ZYSA 4D2KA 2SEBD 3B2GA 1FXIA 1YJIA 5AUKA 4CQNA 1N5XA 4P6VF 1GPXA 3NVYA 3SFEB 2L1AA 3P42A 1JMLA 3VRAB 3R2IA 1YQ3B 2K0PA 2WDVB 2JXTA 2J42A 4WURA 2BBCA 1PGXA 1MI0A 2JU6X 1JWAD 4WWMA 1HXYD 2WNMA 5C3JB 1V1PA 1ROEA 2PVOD 4OW0A 4YTPB 4FXCA 3GS2A 3AE4B 2BB5A 1F77A 1QLBB 1JW9D 3R2TA 1DYQA 2AX5A 1MHXA 2K9XA 1C79A 2L52A 2PTLA 3U2SC 1HEZE 3Q8FA 3E56A 3ZGZA 2JYEA 1SE2A 2WXRA 1JQ4A 4NZLB 1L5PA 1ZP0B 1KLUD 1EM7A 2KDMA 4IOIE 1L4DB 1FM0D 3WCQA 4A90A 2WP9B 1ZUD2 4MM3B 1XLQA 5G5GA 3V3XA 1VDVA 4A8XC 1FRDA 2DBYA 2M0AA 1WWTA 3TSSA 2WDRB 3IAM1 1FNUA 5HFYA 2KQ4X 3AE3B 2JWUA 1ET6A 3NVVA 1XLPA 4OZCA 2ZW1A 4XE0A 3AEBB 3DWMA 2KAJA 4R3DA 3MHZA 1M4VA 4N6EB 1QF6A 1JWMD 5T8IA 2V3NA 3AE9B 4YTNB 2CJNA 1L0YB 1TS5A 3L4PA 3MP9A 3V05A 1C77A 5D3IB 1T3QA 2H89B 3P4SB 1DOYA 1EU3A 5BMIA 4YXDB 1QILA 1JWUD 1GOZA 1ENFA 4AS1A 1FNVA 1SXTA 1K52A 2JYTA 1PUTA 4YSZB 4TMAB 1FIQA 3Q8AA 4HROA 2WXPA 2L83A 3ZQ4A 4XWWA 1XF5L 3LB8C 2QIEB 2K5PA 2BB6A 4HKZE 5EE3A 3W9CB 1OQRA 2GRIA 3EGRA 4IKGA 3AE1B 3IT4B 2AQ1B 1IBXB 1FD6A 1RM6C 3AH7A 3W1SA 1I4RA 3TEXA 2WXKA 2JZPA 1C4AA 4ARCA 2INPE 1TKYA 4MH8A 3AE7B 1L6UA 4AQ7A 1I4QA 4A55A 1YN4A 3BVGA 1TKEA 1YN5A 2YEPB 1J7AA 1MHHE 1BMLC 5EE0A 2KN4A 4DQOC 3BYTB 1XEEA 2L32A 1I4HA 1RWSA 1VZ7A 1UWMA 3AN1A 2XN9C 1D5ZC 1JALA 1LO5D 3LXFA 2Q5WD 1N60A 2SAKA 1WSPA 2MEKA 1IGCA 4L2YA 4RF1A 2KWDA 3Q69A 3KLSX 1STEA 1IGDA 1N63A 3T3OA 1PGAA 1B1ZA 1FMAD 1N62A 2WS3B 2WU2B 3AV8A 3BK2A 4L1BA 1K50A 2WXNA 2WQYB 3BVZA 5EE9A 3U52E 1WRIA 2D5GA 3P4QB 1SJED 1TS2A 3EA6A 4KGSA 5BYSA 2N0SB 1CQVA 5FKAC 5TSSA 2DWQA 2LEKA 2Y5PA 5BMHA 2INNE 3P1MA 2DYOA 2W54A 3OWEB 4NAMA 5D3DA 3AECB 4C56C 2M56B 2R61A 5EE1A 3H8HA 1QOFA 2BTEA 2QSDA 1DGJA 1GB1A 1FFVA 2H88B 1A70A 3AEDB 4RGOS 3BK1A 1FO4A 1L6VA 1L0XB 3LYYA 1I4XA 1FEHA 4C80A 1PYWD 2RDGA 3VQIA 3RPFC 1IBXA 1SF0A 2PKOA 1P7EA 3NVZA 2WXIA 2V0GA 2YEPF 2WXQA 4ITKA 4US8A 1ZOYB 2ONQA 2ACZB 1R7SA 3P63A 1NENB 4LLGM 1E7PB 2I38A 1BUIC 4Q2JA 4JWSC 2BS4B 3N9YC 2XNAC 3AE2B 2W82A 5BMGA 3NVWA 1TS4A 1JCKB 5HHDG 3IAS1 3AM9A 3T3NA 3GP7A 4PT5A 3AEAB 1UNSA 4MT5A 4L23A 1FXAA 3KWVA 1I7HA 3VRBB 3W2DA 3HUIA 4KKJA 2M19A 1TS3A 4GDKB 1YNTE 4LK0M 1KH0A 4KGRA 1SE4A 5MPOA 5HI1A 1SBBB 3FILB 1YQ4B 4XDCA 2G9HD 1GAQB 2IGHA 2J53A 3Q8BA 2G1EA 2BS2B 3GB1A 5FK9C 1ET9A 4JWUC 1AYFA 1I4PA 1VJKA 2WXLA 2JQRB 1B9RA 2RMMA 4ZOHC 1HZ5A 1XCTL 5E6JA 4RGTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1XCQ L;  1D4B A;  4GLS C;  1HZ6 A;  2ZW0 A;  4KGT A;  1F2R I;  2KAC A;  4D2K A;  2ON8 A;  1MHH E;  1JML A;  2GI9 A;  1ZXH A;  2KN4 A;  2K0P A;  2JXT A;  2JSV X;  1PGX A;  1MI0 A;  2JU6 X;  1IGC A;  2KWD A;  1IGD A;  2NMQ A;  1MHX A;  1PGA A;  2PTL A;  1HEZ E;  1MPE A;  1K50 A;  1QKZ A;  1F2R C;  1EM7 A;  2EEL A;  2KDM A;  2N7J A;  4IOI E;  5JXV A;  2LUM A;  4KGS A;  4OZA A;  2LGI A;  1K51 A;  3V3X A;  5BMH A;  2IGG A;  2N9L A;  2QSD A;  5HG2 A;  2N9K A;  2KQ4 X;  2PLP A;  2JWU A;  5HFY A;  1GB1 A;  4OZC A;  1MVK A;  2ZW1 A;  4WH4 A;  1GB4 A;  1IBX A;  1P7E A;  2I2Y A;  2ONQ A;  1P7F A;  1FCL A;  3MP9 A;  3FIL A;  2J52 A;  2I38 A;  4HJG E;  4MAC A;  2LHD A;  5BMG A;  5BMI A;  5HHD G;  2QMT A;  2PW9 A;  1K53 A;  1PGB A;  4OZB A;  2OED A;  1YNT E;  1K52 A;  1KH0 A;  4KGR A;  5HI1 A;  1XF5 L;  3FIL B;  3UI3 A;  4HKZ E;  4IKG A;  2IGH A;  2J53 A;  1IBX B;  1FD6 A;  2RPV A;  3GB1 A;  2IGD A;  1FCC C;  1Q10 A;  2GB1 A;  2JZP A;  2RMM A;  1C9F A;  1HZ5 A;  1YMH E;  1XCT L;  1UWX A;  2LHE A; 
#chains in the Genus database with same CATH topology
 4G50 A;  2MBB B;  1XLN A;  4A9A A;  3ZNH B;  1XCQ L;  1KFY B;  1HE8 A;  2N7D A;  1V1O A;  2B76 B;  1ZPS A;  1RFA A;  1WXQ A;  2KO3 A;  3ZRC A;  5CHV C;  4P16 A;  2DNF A;  2JSV X;  4RF0 A;  1CJE A;  1ZW7 A;  4GOC A;  4MGK E;  2KD0 A;  2QHO A;  3RNA C;  2KTR B;  2CU3 A;  2LI5 A;  1UH6 A;  2DYB A;  3NZU A;  3QWZ B;  4NY0 A;  4WWO A;  4ANX A;  1AW7 A;  1MPE A;  1NI3 A;  1RYJ A;  1QKZ A;  3ZVV A;  4ZRK A;  3U4E G;  5J18 A;  4C7Y A;  2Z0D B;  1IYF A;  1PFD A;  2FBW B;  2LUM A;  2IPK D;  2LGY A;  4WJO A;  3R7R A;  2ZPY A;  4G11 A;  3ZYY X;  2WU5 B;  3A9K A;  5L95 C;  1WZ3 A;  4RFB A;  3Q6B A;  5HKH A;  2GLS A;  5IP4 D;  2M4N A;  4DDG D;  2VH1 A;  2JZZ A;  2MJ3 A;  2MWS B;  1WE7 A;  1ZXI A;  1WX9 A;  2EMT A;  4WH4 A;  1GB4 A;  1VCB A;  2WXH A;  4M0W A;  1FCL A;  1KRH A;  3SEB A;  2J52 A;  4HJG E;  4MEM A;  4RGM A;  3DDC B;  2ZEQ A;  3VTU A;  2MHJ A;  5DCN A;  4BOS C;  1KLG D;  1P98 A;  4W9G A;  2YLM A;  1E9M A;  3AEF B;  3AMZ A;  1UGM A;  4FLH A;  4HRS A;  3C0R B;  4M8N A;  3MFG A;  2WWZ A;  3SD5 A;  2IGD A;  4H2A A;  1C9F A;  1FNW A;  1IUE A;  1YMH E;  2VRR B;  3EEC A;  2E6X A;  2KAC A;  2JXX A;  3ABV B;  3X23 A;  2CHX A;  1EUV B;  4E74 A;  3ZNG C;  4XWT A;  2AL3 A;  3MTN B;  3VR9 B;  2MA9 B;  1C76 A;  2Z59 B;  2ZCB A;  4TQ1 A;  2IO1 B;  4A3O A;  3PZ8 A;  4HKQ A;  3L13 A;  4GU2 A;  3E9S A;  2KJR A;  3PZ7 A;  2K3U A;  4NPN A;  4XX5 A;  4YSX B;  2RGF A;  3I3T B;  3J9C A;  1XQQ A;  1OQY A;  2WXO A;  3VTW A;  2I1J A;  2K8C A;  3ZKJ C;  1VZ8 A;  4HDO A;  1BXT A;  1MG4 A;  2AQ3 B;  1XD3 B;  3IT6 B;  3D32 A;  5TR5 A;  4FHJ A;  1ACC A;  3M3J A;  1C3T A;  3GZN I;  2ZNV C;  2RD0 A;  1NEK B;  1E8W A;  1TZO A;  1M94 A;  4HEA 1;  4MGY E;  3LDZ E;  3KQ4 A;  2PW9 A;  2LVP A;  2WDQ B;  1EWC A;  1PGB A;  1QOB A;  2LMC A;  3VUW A;  2OED A;  2KYW A;  2BYV E;  3RZF A;  2LD9 A;  3PZD A;  1XXG A;  5DPS A;  3KW5 B;  4N9F 4;  5C1Z A;  2D3C A;  3TJP A;  5JH5 C;  1KOT A;  3M62 B;  4NAW A;  4N58 A;  1V9J A;  1C78 A;  3PLU A;  3PLV A;  2AWT A;  1TT5 B;  1I35 A;  2HE7 A;  4JPS A;  4NJ6 A;  3JW0 X;  1UZX B;  2CKH B;  3MJ5 A;  4NNJ B;  2SEB D;  3B2G A;  4C4V B;  4DBG A;  3SFE B;  2L1A A;  3P42 A;  3H7P A;  3R2I A;  1WH3 A;  1YQ3 B;  2WDV B;  3DCG A;  4II3 B;  4I6N B;  4MEL A;  1TIF A;  2BBC A;  3QAQ A;  1HTQ A;  1V1P A;  4YTP B;  1LXD A;  2BWF A;  2AX5 A;  2L52 A;  3U2S C;  2KQS A;  1J19 A;  1SE2 A;  4MH0 E;  2JT4 B;  3QK0 A;  4W9D A;  4IOI E;  2CS4 A;  4A90 A;  3N32 A;  5G5G A;  4HPP A;  1VDV A;  4YL8 A;  4A8X C;  2DBY A;  4WAA A;  3IAM 1;  4EKU A;  3NVV A;  4IM3 A;  1ET6 A;  1XLP A;  1H4R A;  1OEY J;  1EF5 A;  4LNI A;  5L83 A;  3DWM A;  2GBN A;  4GIV A;  1M4V A;  3R3M A;  4K3C A;  2NCN A;  2V3N A;  1WJU A;  4YTN B;  3IHP C;  3U8Z A;  4EFO A;  1DOY A;  3V6E B;  5BMI A;  1QIL A;  2KTF A;  4C4V A;  1ENF A;  4XGA B;  2JYT A;  2QDF A;  4HRO A;  1L2N A;  2WXP A;  2IZV B;  2K5P A;  2KFK A;  5EE3 A;  3W9C B;  4GDL A;  2KFJ A;  4IKG A;  4S17 A;  3IT4 B;  3T9L A;  1SGH A;  3MJW A;  1IPG A;  3PS6 A;  4EZL A;  3A1Q B;  2JZP A;  4XYC A;  4DDI D;  3QHT A;  4PYZ A;  3RNG C;  2INP E;  3P2B A;  1I4Q A;  3L54 A;  4FUL A;  2Z0E B;  4A55 A;  2CHW A;  1YN5 A;  3RNF C;  2QCZ A;  1MHH E;  4K7S A;  2KK8 A;  3BYT B;  2L32 A;  1I4H A;  4HWI B;  4PK1 A;  1VZ7 A;  3AN1 A;  2M1M A;  1LO5 D;  3LXF A;  2Q5W D;  1WSP A;  1IGC A;  2LRU A;  2KWD A;  1IGD A;  1N63 A;  1IP9 A;  2KJ6 A;  1B1Z A;  1FMA D;  1N62 A;  3AV8 A;  3U7D A;  1U4A A;  2WXN A;  3QA8 A;  3BVZ A;  2N1V A;  2OJW A;  3P4Q B;  3EA6 A;  1CQV A;  1AAR A;  5FKA C;  1WM3 A;  2LEK A;  1WJ4 A;  3P1M A;  4NQL B;  3WAP A;  2K6D B;  4XC2 A;  4C56 C;  3H8H A;  3WAN A;  1GB1 A;  1FFV A;  5IO9 A;  4M8M A;  1T0Q C;  4RGO S;  3BK1 A;  3DQV A;  1I4X A;  2O6V B;  3PVL A;  1SF0 A;  2PKO A;  1ZOY B;  1S3S G;  2ACZ B;  3SU8 X;  4AJY B;  5EDS A;  4M00 A;  1E7P B;  2G3Q B;  1BUI C;  2BF8 B;  2W82 A;  3TCA A;  3NVW A;  2KWC A;  4ANV A;  5HHD G;  4FJZ A;  2A5U A;  3T3N A;  3AEA B;  1UNS A;  1FXA A;  3RNB C;  3L10 B;  3ONS A;  4KGR A;  5MPO A;  1YQ4 B;  4XDC A;  1RAX A;  1WX8 A;  3Q8B A;  3N20 C;  2WYQ A;  1V80 A;  1WE6 A;  2JRH A;  2RMM A;  3L08 A;  4ZOH C;  3I63 C;  2KZR A;  4QAY A;  3H6N A;  2NBW B;  4ZHP A;  2PIA A;  1KF6 B;  3IG3 A;  3U30 A;  1E10 A;  4O1N A;  5D2M B;  4ASW C;  1ZXH A;  2RSU A;  1LQB A;  4BZA A;  1YQB A;  4DXA B;  3HVZ A;  4US9 A;  2PE9 A;  1UUP A;  2O6V A;  2BYT A;  4WIP A;  4KSL C;  1EU4 A;  1VZ6 A;  1UGJ A;  3BYY B;  2B3A A;  2MJE A;  3ZUN A;  1OQQ A;  3SFD B;  1CZP A;  1V81 A;  1F2R C;  1FRR A;  1TKG A;  2DZI A;  2EEL A;  4PS3 A;  3N1X C;  3ZNZ B;  3PGE A;  3OG5 A;  1C4P A;  3A33 B;  4TKN A;  1AN8 A;  1DOI A;  2IGG A;  2N9L A;  4IUM B;  3Q8E A;  2AL6 A;  1HA5 A;  5LXH A;  3Q3J A;  5BYQ A;  1V97 A;  2PLP A;  4OVZ A;  4GXB A;  1R4N I;  4G3X B;  4DXG A;  2KWU B;  4BKS A;  4UDU C;  2MP2 B;  4PS7 A;  2LAS A;  3PV1 A;  3RT3 B;  2KTR A;  3ZJT A;  4REZ A;  1E8Z A;  3FIL A;  4YTM B;  3TEY A;  2V1Y A;  4GDL B;  2DLB A;  1YD8 U;  1F52 A;  4OZB A;  3KUC B;  4JGH B;  3FC4 A;  2MSE D;  3RNC C;  1WGK A;  2FUG 1;  3N30 A;  5GXG B;  2PVG C;  3TEZ A;  1YX6 B;  1E7U A;  2BW2 A;  3QQ8 B;  1V8C A;  3R8B A;  1YJJ A;  2IYD B;  2OJR A;  3ENE A;  2XK5 A;  3OJ4 B;  2AYO B;  3HHM A;  3URY A;  3O13 A;  2LJI A;  3MC9 A;  2DZJ A;  2FE8 A;  1C4C A;  3RD2 A;  2GBR A;  3CST A;  3PRP B;  2PEA A;  2ON8 A;  3C8Y A;  4MDK E;  3L0W B;  3VUX A;  2V4L A;  2BS3 B;  1SB3 C;  2PMV A;  1D5X C;  4GN1 A;  5AZH A;  3KYD D;  4C00 A;  2J7Q B;  2J0J A;  3W1Y A;  5DPW A;  2KDB A;  2KC2 A;  3MC0 B;  1ZDX A;  1SEB D;  2X8X X;  3GE3 C;  4YSY B;  1E7V A;  4OHJ A;  2V4I B;  1XO3 A;  4IM0 A;  2DYM A;  2N7J A;  1TY0 A;  1VD2 A;  3DBH I;  4OZA A;  1GJZ A;  5KHQ A;  4J6I A;  1WMH A;  1KLV A;  1JRU A;  2VZK D;  1WGG A;  2JY6 A;  1I42 A;  2K8B A;  2IO2 B;  1D6E C;  4LDT D;  3DHI C;  4IWO A;  2K8H A;  2KVZ A;  3PRZ A;  4PYU A;  4A20 A;  1I4G A;  2ZVO A;  2GOW A;  4B9K A;  2FAZ A;  3BII D;  2LHD A;  3TUO A;  1WMH B;  4P1C C;  1TY2 A;  3QIJ A;  1PDX A;  1J0G A;  4HPL B;  3AB5 A;  2K22 A;  1J7B A;  1F0Z A;  2PE6 B;  1CK1 A;  1WXA A;  5G55 A;  2D2Q A;  4HLE A;  4W9I A;  2HJ8 A;  3OLM D;  3W5U B;  1OEY A;  3IBE A;  2MBQ A;  2WXG A;  1KJT A;  1NI2 A;  2L0F A;  2LXC A;  4WJN A;  5H92 C;  2GB1 A;  4DHJ D;  5BYR A;  2QIL A;  2WLB A;  4TSS A;  5C2T B;  2LHE A;  3B9J A;  2KLG A;  1L0V B;  2LZ6 A;  1YOV B;  4KGT A;  3CSF A;  1YIW A;  1HTO A;  2D3G A;  4D2K A;  2KAN A;  4IWQ A;  1YJI A;  5AUK A;  1N5X A;  4P6V F;  3NVY A;  3V62 A;  1V6E A;  3DHG C;  3C19 A;  2J42 A;  1MI0 A;  5C3J B;  4OW0 A;  1F77 A;  1QLB B;  1JW9 D;  3VDZ A;  1HEZ E;  3ZGZ A;  1T0Y A;  4NZL B;  4EEW A;  2KDM A;  4ZRI A;  2MW5 A;  1YJ1 A;  3WCQ A;  2HD5 B;  4MM3 B;  4LCD E;  1XLQ A;  1SE9 A;  3V3X A;  3SDL C;  2N9P C;  1FRD A;  3H9D A;  3H7S A;  2WDR B;  3NOB A;  2D07 B;  2IO0 B;  2KQ4 X;  2JWU A;  3N1Y C;  2ZW1 A;  3VAW A;  3AEB B;  2MP2 A;  4R3D A;  1QF6 A;  1JWM D;  3AE9 B;  4IWP A;  3ZDM C;  4BKG A;  2H89 B;  3VTV A;  3ZXV A;  1FXT B;  2D10 A;  4YXD B;  3AUL A;  1JWU D;  2C7H A;  3ZO5 B;  4PS8 A;  1GOZ A;  3UQA A;  2FCN A;  1A5R A;  4TMA B;  2EKE C;  2JVC A;  2KDE B;  3Q8A A;  3ZQ4 A;  2L83 A;  1Z2M A;  1Z5S B;  2BB6 A;  5D94 A;  4JLC A;  1OQR A;  3ZXR A;  3EGR A;  3DVG Y;  2KHW B;  3AE1 B;  4ICU A;  1FD6 A;  1RM6 C;  3PPA A;  5JHB A;  1C4A A;  2K6Q A;  4MGI E;  4ARC A;  5AZF A;  1TKY A;  3ZLZ A;  4MH8 A;  3AE7 B;  1KM7 A;  4AQ7 A;  2JRI B;  1BML C;  1WIA A;  5EE0 A;  2WX0 A;  1XEE A;  2BKR B;  4LJO B;  2LVO A;  5AEK B;  4W9K A;  4BBN F;  4BVU C;  2BYE A;  4WWN A;  3KLS X;  1STE A;  3A1Q A;  1WYW B;  2WS3 B;  2WU2 B;  1K50 A;  3T8M A;  2WQY B;  4KZC A;  2N7E A;  2G4D B;  1WRI A;  3U52 E;  1X1M A;  3ML8 A;  2DWQ A;  2Y5P A;  1MG8 A;  1T0S C;  2EMS A;  3Q3N C;  3AEC B;  2R61 A;  5EE1 A;  5CHF A;  2QSD A;  3RZW C;  1R4M B;  3PT2 B;  1A70 A;  3AED B;  1L6V A;  1L0X B;  2RDG A;  3VQI A;  3SHQ A;  1IBX A;  2C5L C;  2JPH A;  2WXI A;  4K81 A;  2V9H A;  4LLG M;  4F7Z A;  1WY8 A;  4BOZ B;  1V86 A;  1TS4 A;  4W9H A;  3AM9 A;  4LNO A;  1P9D U;  4MT5 A;  2DZK A;  1I7H A;  1WX7 A;  1R4N B;  1V5T A;  3MC8 A;  1WFY A;  3RNE C;  4LK0 M;  3PRM B;  2IGH A;  2J53 A;  3VXW A;  2BS2 B;  5CHW A;  5FK9 C;  1ET9 A;  1AYF A;  2IBI B;  2D11 A;  1XCT L;  4RGT A;  4K7W A;  3DVN V;  5J2R A;  1WXV A;  1V1P B;  1JRO A;  4YWG G;  2W3S A;  4ANW A;  4KIK B;  3RI7 C;  2DX5 B;  1TTN A;  2MRP A;  1N61 A;  2W55 A;  3P4R B;  2LVQ A;  3NRZ A;  3W5V B;  4RH6 A;  5C23 A;  3RCZ A;  4DK5 A;  2YVC A;  4WQM A;  3PSE B;  2MCN B;  1P3Q U;  4W9J A;  5FR6 A;  4DWF A;  4LTU A;  4KIK A;  3DBL I;  1JWB D;  2KQ7 A;  1K51 A;  2X38 A;  2NBU A;  2REX A;  5LNK 1;  3KWL A;  2JF5 A;  2Z8L A;  4K7U A;  1ZE3 D;  2O2V B;  2GBJ A;  2HTH A;  4FJY A;  1MVK A;  2QJL A;  3SR6 A;  2WXJ A;  4K3B A;  4W9F A;  1VR9 A;  2BVC A;  3V61 A;  2HTM E;  1WGY A;  2KMM A;  2R2Q A;  4DXF A;  2K1F A;  4B95 A;  2OHF A;  4DHZ E;  3UGB B;  1TJE A;  3O65 B;  2ZVN A;  4BKT A;  4WJP A;  2N1W A;  4LNN A;  1ESF A;  2IO3 B;  1NYR A;  4JX1 C;  3GZN B;  2EKI A;  4WQO B;  1WXM A;  3HRD D;  3V60 A;  2N9X A;  1Y56 A;  3AE5 B;  2FIF A;  1YX5 B;  1V5O A;  3AXC A;  2M8S A;  4P1B C;  1T5X D;  4RCO A;  1P0R A;  4XDD A;  4HPM B;  4BFR A;  4HVB A;  4ZHO A;  1WRD B;  1BT0 A;  2RPV A;  2INC C;  1Q5W B;  3M95 A;  4MSQ B;  3AE6 B;  2JX5 A;  4HK2 A;  3HM6 X;  2I1K A;  3AEE B;  4GLS C;  5E6N A;  3VVW B;  4EZJ A;  4A6Q A;  2ZZP B;  3CIR B;  2WHI A;  4GB9 A;  1KTK A;  1RFK A;  3A9J B;  4RNA A;  4HXD A;  4NAW B;  1CMX B;  2JZ3 B;  2KXJ A;  2NMQ A;  3IVF A;  5E6O A;  2C7M B;  3K9P B;  2GBK A;  1AWD A;  5I4D A;  4ZRJ A;  5JXV A;  1ZGU B;  2D3B A;  1QQR A;  1GNU A;  3UIP B;  4I6P A;  4TQ0 A;  1EF1 A;  2CU1 A;  4GMV A;  2IY0 B;  1Y8R C;  5HG2 A;  4M02 A;  2LUE A;  2KX3 A;  3FKY A;  4IDI A;  4M0W B;  3VFK A;  1QOG A;  2ZCC A;  4NJC A;  3PO0 A;  2AQ2 B;  4BAX A;  3QCA A;  2IDY A;  1SE3 A;  3L17 A;  2FUH B;  2QMT A;  4B0E A;  4EUT A;  1L7Y A;  3BY4 B;  4ANU A;  3AEG B;  1F9J A;  3NHE B;  2KKC A;  2IY1 B;  1NVI D;  3NZ3 A;  3DOW A;  2RDH A;  3Q3M C;  3ZJV A;  4B0M A;  4URK A;  1WF9 A;  4AWJ A;  4USA A;  1GC7 A;  4RGN A;  3ZTD A;  1FFU A;  3I57 A;  3Q2A C;  1TBE A;  4CO7 A;  1FCC C;  2L3Z A;  1G6J A;  3AI5 A;  1MJD A;  3GE8 C;  1D5M C;  3S2A A;  1TZ1 A;  2WXF A;  3NUH B;  4KDL B;  2JUO A;  1VRA B;  1D4B A;  4C7Z A;  1SJH D;  2FID A;  4CQN A;  3BIN A;  1GPX A;  2LXA A;  4FA6 A;  2K0P A;  5GMV A;  4NJ7 A;  2JU6 X;  1JWA D;  3JSV A;  2PVO D;  4FXC A;  3AE4 B;  2W9N A;  2BB5 A;  1GC6 A;  1MHX A;  2K9X A;  1C79 A;  2PTL A;  3Q8F A;  4FJV B;  3E56 A;  1Q0W B;  1JQ4 A;  1S1Q B;  3VH3 B;  1L5P A;  4E71 A;  2BQQ A;  1L4D B;  3WIM A;  4ACF A;  2WX1 A;  4XZ4 A;  1ZUD 2;  2KDF B;  1V2Y A;  2O2V A;  1WWT A;  1GUA B;  3TSS A;  3DBL B;  1FNU A;  5HFY A;  3AE3 B;  4KZ0 A;  3AU4 A;  3EFU A;  4XE0 A;  4B6W A;  2KAJ A;  2J0M A;  2A4Z A;  3MHZ A;  4RM9 A;  3DBS A;  1E5W A;  1L0Y B;  1TS5 A;  3L4P A;  3MP9 A;  3V05 A;  4DHJ B;  1EU3 A;  3RUL A;  2L7R A;  4CYE A;  4HCN B;  2NR2 A;  3Q14 C;  5CX3 A;  4E3C A;  4AS1 A;  2FCQ A;  2LGD A;  1K52 A;  2V3S A;  4YSZ B;  1FIQ A;  5JHA A;  2KN5 A;  3LB8 C;  2QIE B;  3NZS A;  4HKZ E;  2GRI A;  1F1H A;  2L05 A;  1Q1O A;  3AH7 A;  3W1S A;  4AP4 C;  4HDQ A;  1I4R A;  2WXK A;  3PHX B;  2BGF A;  2KC1 A;  1YN4 A;  1QZE A;  2O6V D;  1TKE A;  2YEP B;  4LDT B;  1J7A A;  5E6P A;  1WR6 E;  4W9E A;  3ZRF A;  1WI0 A;  2XN9 C;  1JAL A;  4DHZ B;  1N60 A;  3VUY A;  4RF1 A;  3OAW A;  3APF A;  1J8C A;  3T3O A;  5J17 A;  2NS5 A;  4L1B A;  3WA0 A;  3ALB A;  5EE9 A;  5BYS A;  4KGS A;  2GMI C;  1T0R C;  1ZKH A;  3H1U A;  5TSS A;  1WM2 A;  2INN E;  2NPT A;  2DYO A;  2W54 A;  4BKS D;  3OWE B;  4NAM A;  2DAF A;  1QOF A;  2WGS A;  4GGQ A;  2LGX A;  1DGJ A;  4AOF A;  2IND C;  2LRW A;  1FO4 A;  1MFW A;  3LYY A;  3RMK C;  2KOX A;  5IA7 A;  1FEH A;  2L76 A;  1LM8 B;  3RPF C;  4JL9 A;  3NVZ A;  4KV2 A;  3QAR A;  2V0G A;  1E8Y A;  2WXQ A;  4US8 A;  1UBQ A;  3H7P B;  2C7N B;  3A9J A;  2K25 A;  3W1S C;  4Q2J A;  2BS4 B;  3N9Y C;  3KVF B;  1D3Z A;  2RR9 A;  1JCK B;  3APD A;  5DPR A;  4EZK A;  4PT5 A;  3I5J C;  2KX0 A;  4TV3 A;  3KUD B;  4JIO U;  3HUI A;  1TS3 A;  4OVV A;  1LGR A;  1YNT E;  1UEL A;  1E8X A;  3VHT C;  1KH0 A;  3NJT A;  1SE4 A;  5CTR C;  3UF8 A;  5HI1 A;  1SBB B;  2BPS A;  3FIL B;  2MLB A;  5G2N A;  1GAQ B;  2UU7 A;  2G1E A;  2G45 B;  1WJ6 A;  2UYZ B;  4JWU C;  1I4P A;  2JQR B;  3ECI A;  1SSN A;  4ARI A;  1NYQ A;  1HZ6 A;  2BWE S;  2ZW0 A;  1F2R I;  1OTR B;  3BVM A;  1UF0 A;  1C1Y B;  3NG0 A;  1NBF C;  2E3T A;  2NPT B;  2R2O A;  3ETR A;  1QOA A;  1E6E B;  1QT9 A;  2KVR A;  2QC8 A;  3KH0 A;  3WAL A;  1WZ0 A;  4YT0 B;  2DHZ A;  2L8J A;  4MGZ E;  3I9V 1;  2BT6 A;  1EWY C;  3V6C B;  4RM8 A;  4F1S A;  3JVZ X;  3DBR I;  4KX6 B;  1V49 A;  1WXS A;  4WJQ A;  1TYG B;  3CMM B;  2CHZ A;  2ICI A;  5FR3 A;  2G4S A;  1ISN A;  4ZRQ A;  2MBE A;  3EUB 2;  2J4X A;  4A3P A;  5H8Y E;  3NS1 A;  3AE8 B;  2N9K A;  4KKI A;  3DHH C;  3ZDT A;  1H8C A;  4HCP B;  4G0N B;  3KUZ A;  4IM2 A;  5G5H A;  2TSS A;  3TEW A;  2I2Y A;  4S0R A;  1P7F A;  2DEN B;  1RLF A;  2C9W B;  4N59 A;  2GBM A;  2D3A A;  1OFF A;  2K39 A;  3FAH A;  2WXM A;  4AJW A;  2CJO A;  2VZK B;  4GSW A;  3RFZ B;  3ZW3 A;  1HQR D;  2IJ0 A;  4JE3 B;  2KMC A;  2AEH A;  3HK0 A;  2KT7 A;  5D7G A;  2QEJ C;  4IW0 A;  4EE2 A;  4F8C B;  3U7Z A;  1TGZ B;  1UWX A;  3IXS A;  3Q3O C;  3Q8C A;  3PRE A;  3L16 A;  1ZDV A;  3DWG C;  5IKC M;  1E0Z A;  1J7C A;  2GI9 A;  3ZJU A;  3UIN B;  5JZE B;  3B2F A;  1VLB A;  4FN2 A;  3VR8 B;  4ZRP A;  3P4P B;  2DZM A;  3LJ3 A;  2BYF A;  4IC7 B;  3HIZ A;  2KJH B;  3TMP B;  4WWP A;  2FCM A;  2J0K A;  3BWU D;  2ZJD A;  4J3O D;  1LFD A;  3QC8 B;  3ZTC A;  1L4Z B;  2Y5B B;  4KSK C;  3DVG X;  4KVG B;  3JSV B;  2RDB C;  2FCS A;  3A4R A;  2HDE A;  2LGI A;  5AUI A;  1PQS A;  1DOX A;  2NTS A;  2UWQ A;  3UQB A;  2NTT A;  1YN3 A;  1JRP A;  2M0X A;  3N1Z C;  3DBH B;  2L00 B;  1WJN A;  1OGW A;  2V3P A;  5AZG A;  4ICV A;  2MH7 A;  1K8R B;  1JWS D;  4HJK A;  2MJD A;  3VH4 B;  2W3R A;  4IG7 B;  3RN9 C;  3KYC D;  3R7Q A;  4I6L B;  4MAC A;  4W9C A;  3EHV A;  3EFC A;  2LGS A;  3HVD A;  1K53 A;  2HJ1 A;  1WYG A;  2LFI A;  3APC A;  4GDK A;  3M63 B;  3BZD B;  2FNJ B;  3WAM A;  3R66 C;  2BKF A;  1N5W A;  3UI3 A;  1SIJ A;  2ZNV B;  5IN7 A;  4MSM B;  4M01 A;  1Q10 A;  3CWI A;  3JYU A;  5DPT A;  2XK5 B;  1T6B X;  1XLO A;  2ZPN A;  3ZIM A;  2Y3A A;  2PPH A;  2Y5C A;  4WAF A;  3ZNI D;  2DAJ A;  4ZYS A;  4JQW C;  1FXI A;  3PHW B;  3VRA B;  1JML A;  2NBV B;  2JXT A;  1NDD A;  4WUR A;  1PGX A;  4WWM A;  1HXY D;  2WNM A;  1ROE A;  3MHS D;  2MBO A;  3GS2 A;  3R2T A;  1DYQ A;  1P1A A;  4FBJ B;  2VH2 A;  3QX1 A;  2JYE A;  2WXR A;  2KLC A;  2WDT B;  4LNF A;  1ZP0 B;  1KLU D;  3RYT A;  1EM7 A;  2MBH A;  1FM0 D;  1WGH A;  4MJS A;  3NS8 A;  1UD7 A;  2WP9 B;  2M17 A;  2C60 A;  2M0A A;  2OOB B;  4LJP B;  4AUQ C;  4OZC A;  2NVU I;  3CF6 E;  4TUU A;  4N6E B;  2MX2 A;  3WAO A;  5BO4 B;  5T8I A;  2N9E B;  4W9L A;  2CJN A;  3QJZ A;  1C77 A;  5D3I B;  1T3Q A;  3P4S B;  2KNB A;  4MM3 A;  4BBN C;  2XEW A;  4X57 B;  2LJ5 A;  1FNV A;  1SXT A;  1PUT A;  1UBI A;  4II2 B;  4XWW A;  1XF5 L;  1WGD A;  3OJ3 A;  4RMA A;  3UIO B;  3PTF C;  1IBX B;  2AQ1 B;  4LNK A;  3TBL D;  3B1L X;  1SIF A;  3Q3F A;  3TEX A;  4OVU A;  5LLI A;  3N3K B;  3B0A A;  1WR1 A;  3RUI B;  1XT9 B;  3DVN U;  4EOY A;  5IOI A;  3DBR B;  1L6U A;  5D6J B;  3BVG A;  4ZYN A;  3TL5 A;  2KN4 A;  4DQO C;  3DPD A;  1RWS A;  1UWM A;  1D5Z C;  4MJS B;  2XBB C;  2SAK A;  2MEK A;  5IAA C;  4L2Y A;  3Q69 A;  1PGA A;  2N4F A;  1EO6 A;  3BK2 A;  3EC8 A;  4FHK A;  3X0W A;  3IFW B;  2D5G A;  1SJE D;  1TS2 A;  4P7I A;  1R4M I;  2N0S B;  5KHO A;  1E90 A;  5BMH A;  2CR5 A;  4KDI C;  5D3D A;  1RRB A;  3B08 A;  2M56 B;  4ZDV A;  3HM3 A;  2BTE A;  2ASQ A;  2KFK B;  2KMA A;  4NQK E;  2H88 B;  4C80 A;  1PYW D;  1P7E A;  3TIX A;  2YEP F;  4ITK A;  3NY5 A;  2ONQ A;  2MQJ A;  1R7S A;  3P63 A;  1NEN B;  2I38 A;  3GOE A;  1WGR A;  4JWS C;  3AU5 A;  3ML9 A;  2XNA C;  3AE2 B;  5BMG A;  2KDI A;  1GG3 A;  2RPQ A;  5LXI B;  3IAS 1;  3GP7 A;  4L23 A;  3KWV A;  3K9O B;  3W2D A;  3VRB B;  4KKJ A;  3A9K B;  2M19 A;  4GDK B;  4FAD A;  4K1R B;  1FPY A;  4CHK A;  2G9H D;  2KWV B;  3A4S C;  1N6Z A;  3GB1 A;  2JWZ A;  2L0T A;  1VJK A;  2WXL A;  1B9R A;  1HZ5 A;  2PJH A;  2LWP A;  5E6J A; 
#chains in the Genus database with same CATH homology
 1XLN A;  4A9A A;  4ZHP A;  1V1P B;  1SSN A;  1XCQ L;  4ARI A;  4B0E A;  1KFY B;  1NYQ A;  1HZ6 A;  2ZW0 A;  1F2R I;  2PIA A;  1KF6 B;  1JRO A;  4YWG G;  1V1O A;  2B76 B;  2W3S A;  1ZPS A;  1E10 A;  4O1N A;  3BVM A;  1WXQ A;  1ZXH A;  2E3T A;  3ETR A;  4P16 A;  2JSV X;  4RF0 A;  3HVZ A;  1QOA A;  1CJE A;  1N61 A;  2W55 A;  1E6E B;  4US9 A;  1UUP A;  1QT9 A;  2BYT A;  3P4R B;  4YT0 B;  4WIP A;  1EU4 A;  3NRZ A;  3W5V B;  1VZ6 A;  2CU3 A;  3I9V 1;  2BT6 A;  4RH6 A;  1UGJ A;  1EWY C;  3BYY B;  4WQM A;  2MJE A;  1AW7 A;  1MPE A;  1NI3 A;  1RYJ A;  1OQQ A;  4KX6 B;  3SFD B;  1QKZ A;  1CZP A;  1F2R C;  3U4E G;  1FRR A;  1TKG A;  4C7Y A;  2EEL A;  1TYG B;  1PFD A;  2FBW B;  2LUM A;  4LTU A;  2IPK D;  1C4P A;  1JWB D;  2ICI A;  1AN8 A;  1DOI A;  1K51 A;  2WU5 B;  3ZYY X;  5FR3 A;  2X38 A;  2IGG A;  2N9L A;  4ZRQ A;  4RFB A;  5LNK 1;  3KWL A;  3Q8E A;  1HA5 A;  3EUB 2;  2Z8L A;  2J4X A;  5H8Y E;  3NS1 A;  3AE8 B;  1ZE3 D;  5BYQ A;  2N9K A;  1V97 A;  2PLP A;  4KKI A;  4OVZ A;  1MVK A;  2QJL A;  3SR6 A;  2WXJ A;  4DXG A;  2MJ3 A;  1VR9 A;  1ZXI A;  4UDU C;  2HTM E;  4WH4 A;  1GB4 A;  5G5H A;  2KMM A;  4DXF A;  2TSS A;  3TEW A;  2OHF A;  2I2Y A;  3ZJT A;  1TJE A;  1P7F A;  2WXH A;  4N59 A;  4REZ A;  4M0W A;  1FCL A;  1KRH A;  3FIL A;  2J52 A;  3SEB A;  1OFF A;  4YTM B;  4HJG E;  4RGM A;  3TEY A;  3FAH A;  4GDL B;  2DLB A;  1KLG D;  1ESF A;  2WXM A;  4OZB A;  1NYR A;  2CJO A;  4JX1 C;  2VZK B;  2EKI A;  3RFZ B;  3FC4 A;  1E9M A;  1WGK A;  2FUG 1;  3AEF B;  3AMZ A;  3HRD D;  3AE5 B;  1Y56 A;  5GXG B;  4HRS A;  1HQR D;  2IJ0 A;  2PVG C;  4JE3 B;  4RCO A;  3TEZ A;  1T5X D;  3MFG A;  4XDD A;  4ZHO A;  2RPV A;  5D7G A;  2IGD A;  2BW2 A;  2QEJ C;  1V8C A;  3R8B A;  4H2A A;  4EE2 A;  1C9F A;  3U7Z A;  1YJJ A;  1FNW A;  1IUE A;  1YMH E;  3AE6 B;  2JX5 A;  1UWX A;  3URY A;  3IXS A;  2LJI A;  3O13 A;  2FE8 A;  1C4C A;  3Q8C A;  3AEE B;  4GLS C;  2E6X A;  2KAC A;  4A6Q A;  3ABV B;  1ZDV A;  2ON8 A;  3DWG C;  3C8Y A;  1E0Z A;  3CIR B;  4XWT A;  1J7C A;  2GI9 A;  3ZJU A;  2BS3 B;  1SB3 C;  2PMV A;  1D5X C;  3B2F A;  1VLB A;  1KTK A;  1RFK A;  3VR9 B;  3VR8 B;  1C76 A;  4RNA A;  4TQ1 A;  3P4P B;  4ZRP A;  3PZ8 A;  4NAW B;  4HKQ A;  2NMQ A;  3MC0 B;  1ZDX A;  1SEB D;  4YSY B;  3BWU D;  4J3O D;  3E9S A;  4OHJ A;  2V4I B;  1L4Z B;  1AWD A;  1XO3 A;  2DYM A;  3PZ7 A;  2K3U A;  5I4D A;  2N7J A;  1TY0 A;  4YSX B;  5JXV A;  4OZA A;  3J9C A;  2HDE A;  2LGI A;  1QQR A;  2WXO A;  5AUI A;  1DOX A;  2NTS A;  4TQ0 A;  2NTT A;  2VZK D;  1VZ8 A;  1YN3 A;  1JRP A;  5HG2 A;  1D6E C;  1BXT A;  2AQ3 B;  2V3P A;  3IT6 B;  4IDI A;  2MH7 A;  1QOG A;  1JWS D;  1I4G A;  2MJD A;  1ACC A;  2W3R A;  4NJC A;  3PO0 A;  1NEK B;  2AQ2 B;  1TZO A;  3BII D;  4MAC A;  2LHD A;  4HEA 1;  3TUO A;  2IDY A;  1TY2 A;  1SE3 A;  1PDX A;  2QMT A;  2PW9 A;  3HVD A;  3KQ4 A;  3AB5 A;  2K22 A;  1K53 A;  2WDQ B;  1J7B A;  1EWC A;  1PGB A;  1WYG A;  2LFI A;  1F0Z A;  1CK1 A;  1QOB A;  2LMC A;  3AEG B;  2OED A;  3BZD B;  1NVI D;  1XXG A;  3NZ3 A;  2RDH A;  3ZJV A;  3W5U B;  1N5W A;  4B0M A;  3UI3 A;  1SIJ A;  4USA A;  2WXG A;  4RGN A;  1FFU A;  4N58 A;  3I57 A;  1FCC C;  5H92 C;  1C78 A;  1Q10 A;  2GB1 A;  5BYR A;  1D5M C;  2QIL A;  2WLB A;  2WXF A;  3CWI A;  4TSS A;  5C2T B;  1T6B X;  1XLO A;  2LHE A;  3B9J A;  2Y3A A;  3NUH B;  1L0V B;  1VRA B;  4JPS A;  2Y5C A;  1D4B A;  4KGT A;  3MJ5 A;  4WAF A;  4C7Z A;  1SJH D;  4ZYS A;  4D2K A;  2SEB D;  3B2G A;  1FXI A;  1YJI A;  5AUK A;  4CQN A;  1N5X A;  4P6V F;  1GPX A;  3NVY A;  3SFE B;  2L1A A;  3P42 A;  1JML A;  3VRA B;  3R2I A;  1YQ3 B;  2K0P A;  2WDV B;  2JXT A;  2J42 A;  4WUR A;  2BBC A;  1PGX A;  1MI0 A;  2JU6 X;  1JWA D;  4WWM A;  1HXY D;  2WNM A;  5C3J B;  1V1P A;  1ROE A;  2PVO D;  4OW0 A;  4YTP B;  4FXC A;  3GS2 A;  3AE4 B;  2BB5 A;  1F77 A;  1QLB B;  1JW9 D;  3R2T A;  1DYQ A;  2AX5 A;  1MHX A;  2K9X A;  1C79 A;  2L52 A;  2PTL A;  3U2S C;  1HEZ E;  3Q8F A;  3E56 A;  3ZGZ A;  2JYE A;  1SE2 A;  2WXR A;  1JQ4 A;  4NZL B;  1L5P A;  1ZP0 B;  1KLU D;  1EM7 A;  2KDM A;  4IOI E;  1L4D B;  1FM0 D;  3WCQ A;  4A90 A;  2WP9 B;  1ZUD 2;  4MM3 B;  1XLQ A;  5G5G A;  3V3X A;  1VDV A;  4A8X C;  1FRD A;  2DBY A;  2M0A A;  1WWT A;  3TSS A;  2WDR B;  3IAM 1;  1FNU A;  5HFY A;  2KQ4 X;  3AE3 B;  2JWU A;  1ET6 A;  3NVV A;  1XLP A;  4OZC A;  2ZW1 A;  4XE0 A;  3AEB B;  3DWM A;  2KAJ A;  4R3D A;  3MHZ A;  1M4V A;  4N6E B;  1QF6 A;  1JWM D;  5T8I A;  2V3N A;  3AE9 B;  4YTN B;  2CJN A;  1L0Y B;  1TS5 A;  3L4P A;  3MP9 A;  3V05 A;  1C77 A;  5D3I B;  1T3Q A;  2H89 B;  3P4S B;  1DOY A;  1EU3 A;  5BMI A;  4YXD B;  1QIL A;  1JWU D;  1GOZ A;  1ENF A;  4AS1 A;  1FNV A;  1SXT A;  1K52 A;  2JYT A;  1PUT A;  4YSZ B;  4TMA B;  1FIQ A;  3Q8A A;  4HRO A;  2WXP A;  2L83 A;  3ZQ4 A;  4XWW A;  1XF5 L;  3LB8 C;  2QIE B;  2K5P A;  2BB6 A;  4HKZ E;  5EE3 A;  3W9C B;  1OQR A;  2GRI A;  3EGR A;  4IKG A;  3AE1 B;  3IT4 B;  2AQ1 B;  1IBX B;  1FD6 A;  1RM6 C;  3AH7 A;  3W1S A;  1I4R A;  3TEX A;  2WXK A;  2JZP A;  1C4A A;  4ARC A;  2INP E;  1TKY A;  4MH8 A;  3AE7 B;  1L6U A;  4AQ7 A;  1I4Q A;  4A55 A;  1YN4 A;  3BVG A;  1TKE A;  1YN5 A;  2YEP B;  1J7A A;  1MHH E;  1BML C;  5EE0 A;  2KN4 A;  4DQO C;  3BYT B;  1XEE A;  2L32 A;  1I4H A;  1RWS A;  1VZ7 A;  1UWM A;  3AN1 A;  2XN9 C;  1D5Z C;  1JAL A;  1LO5 D;  3LXF A;  2Q5W D;  1N60 A;  2SAK A;  1WSP A;  2MEK A;  1IGC A;  4L2Y A;  4RF1 A;  2KWD A;  3Q69 A;  3KLS X;  1STE A;  1IGD A;  1N63 A;  3T3O A;  1PGA A;  1B1Z A;  1FMA D;  1N62 A;  2WS3 B;  2WU2 B;  3AV8 A;  3BK2 A;  4L1B A;  1K50 A;  2WXN A;  2WQY B;  3BVZ A;  5EE9 A;  3U52 E;  1WRI A;  2D5G A;  3P4Q B;  1SJE D;  1TS2 A;  3EA6 A;  4KGS A;  5BYS A;  2N0S B;  1CQV A;  5FKA C;  5TSS A;  2DWQ A;  2LEK A;  2Y5P A;  5BMH A;  2INN E;  3P1M A;  2DYO A;  2W54 A;  3OWE B;  4NAM A;  5D3D A;  3AEC B;  4C56 C;  2M56 B;  2R61 A;  5EE1 A;  3H8H A;  1QOF A;  2BTE A;  2QSD A;  1DGJ A;  1GB1 A;  1FFV A;  2H88 B;  1A70 A;  3AED B;  4RGO S;  3BK1 A;  1FO4 A;  1L6V A;  1L0X B;  3LYY A;  1I4X A;  1FEH A;  4C80 A;  1PYW D;  2RDG A;  3VQI A;  3RPF C;  1IBX A;  1SF0 A;  2PKO A;  1P7E A;  3NVZ A;  2WXI A;  2V0G A;  2YEP F;  2WXQ A;  4ITK A;  4US8 A;  1ZOY B;  2ONQ A;  2ACZ B;  1R7S A;  3P63 A;  1NEN B;  4LLG M;  1E7P B;  2I38 A;  1BUI C;  4Q2J A;  4JWS C;  2BS4 B;  3N9Y C;  2XNA C;  3AE2 B;  2W82 A;  5BMG A;  3NVW A;  1TS4 A;  1JCK B;  5HHD G;  3IAS 1;  3AM9 A;  3T3N A;  3GP7 A;  4PT5 A;  3AEA B;  1UNS A;  4MT5 A;  4L23 A;  1FXA A;  3KWV A;  1I7H A;  3VRB B;  3W2D A;  3HUI A;  4KKJ A;  2M19 A;  1TS3 A;  4GDK B;  1YNT E;  4LK0 M;  1KH0 A;  4KGR A;  1SE4 A;  5MPO A;  5HI1 A;  1SBB B;  3FIL B;  1YQ4 B;  4XDC A;  2G9H D;  1GAQ B;  2IGH A;  2J53 A;  3Q8B A;  2G1E A;  2BS2 B;  3GB1 A;  5FK9 C;  1ET9 A;  4JWU C;  1AYF A;  1I4P A;  1VJK A;  2WXL A;  2JQR B;  1B9R A;  2RMM A;  4ZOH C;  1HZ5 A;  1XCT L;  5E6J A;  4RGT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...