1K5GA

Crystal structure of ran-gdp-alfx-ranbp1-rangap complex
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
206
structure length
206
Chain Sequence
QVQFKLVLVGDGGTGKTTFVKRHLTGEFEKKYVATLGVEVHPLVFHTNRGPIKFNVWDTAGQEKFGGLRDGYYIQAQCAIIMFDVTSRVTYKNVPNWHRDLVRVCENIPIVLCGNKVDIKDRKVKAKSIVFHRKKNLQYYDISAKSNYNFEKPFLWLARKLIGDPNLEFVAMPALAPPEVVMDPALAAQYEHDLEVAQTTALPDED
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title RanGAP mediates GTP hydrolysis without an arginine finger.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein/signaling activator
molecule keywords GTP-binding nuclear protein RAN
total genus 56
structure length 206
sequence length 206
chains with identical sequence D, G, J
ec nomenclature
pdb deposition date 2001-10-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1k5gA00
3W9YA 3KFXA 4KSBA 1A4RA 1R0ZA 1JR6A 5TMPA 3OIWA 1Z6GA 2ZS7A 3B1VA 1KI2A 2D62A 1G3RA 1WDTA 1UKYA 4EJSB 3RC8A 3FVQA 3EW9A 5LBIA 1KSFX 2XGJA 4QM6A 1Q1EA 3REFA 1Z06A 4DSNA 3FHCB 4BWYA 1QDEA 4Z8YA 2EFGA 2ZVPX 4DSOA 3B9QA 3A1UA 4Q7KA 4WIAA 1P4SA 3GLFA 2QSZA 5BXQC 4DLYA 2I1VB 3BK7A 4IDHA 1TNDA 5JEEA 3C5HA 4KITB 1SVKA 1ZU5A 4PC2A 1RJ9A 4QHYA 3AEZA 2R8RA 5IK2D 2O8FB 3QPVA 5G53C 1QF9A 3WNDA 1XFAA 5LB2A 5FOTA 1HTWA 4D80A 2MMCA 3PV0A 5EXSA 2XSZD 4C0AC 2WSMA 4C2UA 1ZU4A 2P0EA 2GJSA 3NEJA 1AKYA 1G291 2D4HA 3EARA 4XVQA 1S0UA 4RCZA 1NMYA 3CX7A 4M4SA 1JQJC 2R2AA 2HJVA 3R20A 2W0MA 1JALA 1E1QA 2H8KA 1CRPA 4LI0A 1JBKA 1AK2A 1D8TA 1W5SA 2CHQA 1Z6XA 1KI6B 4X8LA 1GOTA 4PQYA 2QI9C 2RGDA 4FCTA 3ZD6A 3T1QA 3O8CA 1MH1A 2ZYTX 4KLZA 1JEEA 2VP0A 2DBYA 1OXVA 4LBZA 4HLQB 1I4TD 2J9RA 3QXCA 1G6HA 4UNNA 5FH9A 4AIIA 3THXB 2B21A 1MO6A 3PQCA 3UWOA 2J0QA 5IDVA 5C18A 3RS5A 2YC2C 4Q1AA 4EPXA 1YZGA 2BKUA 3HYTA 3K70C 3TK1A 1SKYE 2AR7A 2ZRBA 3LW8A 1R0XA 2OAQ1 1VG0B 2FU5C 3DEFA 4UJ5A 5B30A 2QQEA 5EXXA 1DAEA 1JPNA 1T5IA 1XB2A 3B1YA 1E2LA 3H4MA 4BQSA 3LDAA 4QFMA 4CGZA 3BS4A 3GLFE 4QGHA 3DM9B 3FDIA 2ZI3A 2RGXA 4CEIA 1W0JA 4UKDA 1XPOA 1OIVA 1E0AA 1NVXQ 3KQLA 2FEOA 1T8UA 4OQXA 4WAUA 1P72A 3TLXA 2CBZA 2WKPA 3KKOA 1NRJB 4M1TA 1KY2A 3EC2A 3LBHA 1H8EA 3TNFA 4ZIRA 1M7HA 2E1RA 1Z0KA 3EASA 3B8HA 5TV2A 2YZ2A 3K8YA 1SVOA 2P5TB 3UATA 1P9RA 4JSTA 4FINA 3H84A 1XTKA 4US1R 4LHZA 4UNRA 4ARZB 1CS4C 1V43A 2GK7A 1OXUA 2RHDA 4HLDA 1ZD9A 3WY9A 2GCOA 2Z43A 4HAZA 3BGWA 1F2UA 2W6JA 4NYJR 2ZRDA 4IOKA 4OK5A 2WPDA 3A1VA 4ZV4A 4G5GA 3FFBA 3SE0A 2VTKA 4NH0A 2XNSA 5FTMA 5BYJA 4DSTA 2QSYA 5G40A 4M21A 5CLQA 4ZKDA 2WSSA 5AJYA 1GL9B 1RZ3A 1DG3A 2WTUA 1FW6A 2K5UA 3ZVRA 4CEJB 1UBGA 1VKJA 4QBIA 4Q4HA 4MYUA 1E32A 4PR0A 2J5XA 2CNWD 2GZHA 4RD1A 3B6EA 3AVUA 4F4JA 1T0HB 4JJZA 2F43B 1NBMD 2C9CA 1QBKC 1W2GA 2XB4A 3H2YA 1XD9A 3IIMA 5FI0B 2DB3A 4TMTA 2VIIA 3PITA 2QRNA 2IF2A 5J4LA 4MGIR 3QOFA 4BLPA 3EC1A 3RWOA 5GJBA 4BLTA 1MV5A 2GRJA 4RKEA 4DLRA 2PLRA 1FPMA 1N3BA 4OBEA 3U3JA 3R7WA 3V9PA 5FUYA 1OXTA 2ZXUA 4AKHA 5CJPA 2ZYUX 1M2OB 3QKSA 1GKYA 1CKEA 3UXMA 4A8JC 1RIFA 2PZGA 4RZ3A 1P2SA 2QMOA 1COWA 2B7CA 4KFSA 1Z83A 2WMOB 2EFHB 1F5NA 5HCNA 3TUJC 1UKEA 3TVTA 2FEMA 5C4GB 1XPUA 5JS7A 5DN6A 3E70C 3E5HA 1NLYA 4FMDF 4HAWA 1R2QA 1K8RA 3HU2A 1X8KA 1N5KA 4S35A 4BZQA 2O8DB 4IOMA 3RANA 4B3XA 5FOSA 4MA4A 3CX6A 2F1IA 3AVTA 1JQLB 1VCIA 1TF5A 2EWVA 4E09A 2GWHA 4G0NA 1S9DA 3A4LA 3IIKA 1KO1A 3KL4A 3NHBA 3PUZA 2DR3A 3PR1A 4KBGA 2B92A 1H8HD 1LB1B 5EJEA 4WZ6A 2QN6A 4TT3A 1EESA 1QHHB 4DLZA 3AUYA 4DC9A 1ZNYA 1NF3A 5CB6A 3W6OA 1XXHA 4OJQA 2H18A 2ZPTX 3THWA 3QEOA 2V7QD 1ZUNB 5J4HA 1U0HC 3ZGXA 1S1CA 1XZPA 4MRSA 2ZRCA 2X1VA 4G01B 4OHVA 4YMVA 2Q6TA 1TQ4A 3GLIE 3NHAA 4DRZA 4ZDKA 2BV3A 1NJGA 4BUJA 1AJEA 1KJWA 1DPFA 5DYGA 3JVVA 4NMMA 2F3RA 1UEIA 1P2UA 3BAFA 3G82C 4MRNA 2IBMA 2OFXA 3KJHA 3T15A 3QKRA 1OYYA 4LV5B 1MRSA 2WWHA 3TH5A 1N5JA 4B35A 4BLOA 1P6XA 4BE7B 4US0R 2F9LA 3OIUA 1E9AA 2HUPA 4HYYA 3MG9A 4RFVA 1HURA 1MO4A 4TWZA 1KO5A 3IHLA 2WWYA 3K70B 1KK0A 1W4RA 2FFQA 4LJ4A 2NO7A 3LXXA 1ONBA 4C0JA 2GESA 4EJSA 1XCPA 6Q21A 1CJVC 1HEIA 1RRCA 1OSNA 4IW3B 4IDPA 4C0LA 1GRNA 4HB4A 1KNXA 1NIPA 2H57A 1FTSA 1XTJA 4PAMA 1OH6A 1OFTA 1NN1A 4OK6A 1ZJ6A 1WQ1R 1BYUA 2ZI5A 4A4DA 1JJ7A 4TLEA 5JBQA 4KSCA 3CH4B 2ZUBA 3U61B 4WBSA 4FWTA 2CL7X 4JVMA 2KI5A 1XWIA 4IVPA 4LJ6A 4JYBA 2CJWA 1VCOA 4NE2A 1LS1A 2XXAA 1R5NA 2XNDA 1SZPA 2RCNA 2W83A 2ZJYA 3OHMA 4MGZR 3VU9A 4PAOA 5EZ6B 4DT1A 1XP8A 4LJYA 3U7GA 2MMGA 3M0EA 4MRPA 1W7AA 1I2DA 3E2IA 4TZ0A 3L82B 2F9MA 3GEEA 3W90A 3FMPB 3TR0A 3VHLB 4D0NA 1OH5A 3K0FB 4JLNA 1ELOA 2YWGA 3IDQA 3EAQA 1W44A 5HPYB 2RMKA 1U99A 1GRRA 4A6PA 4BFVA 1QG2A 1W0KD 3ETLA 1U0JA 5DI3A 4YMWA 2CHVA 2QPOA 2W2TA 3PIRA 2IC5A 5FL7D 1CBUA 2C2HA 1IQPA 1ZUHA 1EFRD 2C99A 3EWAA 4EQ6A 4OJKA 1W4BA 5EZ5A 4URZR 4LHWA 1G7CA 4JKYA 4E22A 5EE3A 1ZM9A 4AURA 4IHQA 2F1HA 4D0GA 2A78A 4RVCA 2XOKA 4ARZA 3CBQA 4S2EA 4EPRA 4P31A 3OEHD 1Z3IX 1YVDA 1GNPA 1US8B 5DH9A 4GNKA 3L0SA 3T5DA 1CR2A 5HKKA 1WE2A 2CLSA 4B73A 1CLUA 4C0BA 2KB0A 2JDIA 2GCPA 3F8TA 4Q1EA 2PCLA 1HT2E 1M6NA 2W2XA 2O8BA 4ZDJA 2BVNA 1OF1A 2ZVQX 5EUMA 4A0GA 1AS0A 5DNYB 4PPNA 5KDOA 1DAKA 2H92A 2FSGA 2FGJA 1FZQA 5E3HA 1L7VC 2ZI6A 1OT3A 2VP5A 3K0AA 2XTNA 5EXPA 3WBKA 3F3YA 4YXWA 2G1JA 1IY1A 2EVWX 3BB4A 4NCJA 2CL6X 2QRZA 2A5FA 5AUPB 1DG1G 1ANKA 2ZUCA 2ZUDA 1JR3A 1NLZA 4CW7A 2GK6A 2Z4RA 4FWIB 2ZEJA 4NCKA 3Q3JB 2X2FA 3QPUA 2GJAA 3GLFB 1FUKA 1YZUA 3AF0A 4M1YA 1VHTA 2KSQA 3AVQA 1J90A 4PSAA 2B7BA 3AF4A 3PEUA 3T5GA 3LQRA 1ZUIA 3TJZA 4BRWA 2C04A 4ZCIA 2LKDA 5JMTA 4D6PA 2ZRHA 3U2QA 1Q3HA 1GSIA 1J70A 1FOEB 4PPGA 2IXGA 4B2LA 3WRYC 3RC3A 2IYYA 1AM4D 2JLRA 4Q4HB 4V0KA 2VO1A 3WHLA 3TSZA 4TZ6A 1RFLA 1XJ0A 4QRHA 4A0HA 1UF9A 2ZJ8A 5HZHA 3ZIAD 4XWKA 4PHFA 3AV0B 2BKEA 2ZRNA 2N1BA 4QHTA 1A2KC 2O8DA 1RJ9B 3KJGA 2HCJB 4GBMA 4DXAA 4OI4A 4P32A 4EFLA 4KCGA 1TF7A 4XD7A 5KPJA 1QHYA 3W8NA 2BC9A 2NO9A 4MITA 5JCPA 4TMVA 3B13B 4QGAA 4GSYA 4RKFA 2OXRA 4IOLA 4DCSA 4B6FA 4NYMR 3RDPA 1N6RA 1G6OA 2QUZA 1CF4A 3QKTA 3I73A 1JECA 2GJ9A 2J0UA 3QIAA 4PPFA 5FOXA 3W3ZB 1E2FA 5CITA 4Q19A 4MYHA 1O3YA 3KB1A 2Q3HA 4UQOA 3EZ6A 1E9DA 3QXJA 4L15A 3LVRE 1R0WA 4A0FA 2OV2A 2OILA 5AJZA 1PV4A 1NI3A 1K5DA 1NKSA 4FD2A 3EIEA 1R5BA 1P2VA 5AUOB 4V0MA 3E1SA 5JI2E 4BFYA 1XMJA 3PUYA 5KDLA 1PLJA 5ELXA 3CPEA 3T35A 3QKRB 1OB2A 2ZYVX 3ZVMA 1R7RA 3GLIB 1UAAA 4D4KA 2ODNA 1XTIA 4PPQA 1ZCBA 5JWHA 2A5GA 2C77A 1RYFA 1GIAA 1YR6A 2ZREA 4F92B 5JFGA 521PA 1XXHB 4OQNA 4L9SA 5DHAA 1NKTA 1VHLA 1U9IC 5JECA 1SVSA 3OF5A 1F2UB 2OCAA 4RD2A 4B3DA 3LLUA 4U5XA 2IS2A 1DE0A 3MWLA 5J5CA 1OKKD 4V0LA 1VYUA 2YNMA 2BM1A 5BQ5A 2WJYA 5CYOA 3DOEA 2B6HA 2JLQA 4NYMQ 2HT6A 2FWRA 2WWXA 4TL7A 3AKYA 3L8ZA 2OBNA 3FMOB 4H1VA 5KSOA 4XVUA 4IEEA 4IOJA 3T34A 3QBTA 1W49A 3VR6A 5JJKA 1OFUX 3WMGA 1Q0UA 1E1RA 3CPJB 4M2LA 4LGMA 2R9VA 4DWJA 2ZAMA 1XEXB 1IN7A 1Z0JA 2P6RA 4R7ZA 4DEYA 1XTQA 3VU9B 2J7KA 4PHGA 3MWYW 1GG2A 5FTKA 3ICQB 3TSWA 3Q7PA 2CVFA 2DWPA 4FMDB 5TARA 3VTKA 1NY6A 5G3ZA 3ADKA 3B9PA 4HI0E 4D4MA 1AA9A 2HCBA 2W00A 1ZIPA 4NP6A 4W5WA 4TYPA 4DZZA 2V8OA 1U94A 1CR4A 1YRBA 1KI8A 2P6UA 3GJ8A 3J81k 1H8HA 1Q21A 4LC0A 1XMSA 3WHKA 5KHOC 3DZDA 3MWJA 3QKSB 4JKIA 2EU8A 1IXRC 3WNCA 1AS2A 2R6DA 3VKGA 4LRWA 1B0UA 1HH4A 1LTQA 3TAHA 2VF7A 5HR5A 3TKLA 2QPAA 2WM9B 4HLUC 2GEVA 4XVRA 3WP0A 3T1OA 2ZS9A 3DDCA 3KZ1E 4M53A 3HU3A 2D3WA 1Q1QA 1EG7A 3NBXX 4QJ4A 1LY1A 2G88A 5GJCA 5C46F 1EFUA 4FCWA 3SFVA 1A7JA 2NIPA 3MRSA 2IEYA 1N6HA 1J8YF 3K0FA 3K0CA 4Q48A 4JL5A 1E9BA 2W58A 1S2MA 1KDOA 1CJKC 2AL7A 3QUSA 1Z28A 1N5IA 4DBLC 1BIFA 2EYUA 1CJUC 3QG5A 2ZE7A 3EZ9A 3QJYA 2UKDA 3VHXA 4TYNA 4QBFA 2W6ID 4URWR 5AUQA 2ZITA 3QXXA 621PA 3B60A 3IIJA 1U0LA 4P4SB 4KHZA 1YKSA 4BEBA 2B8WA 2EWWA 1RYHA 4TYWA 2JLSA 3GEHA 1M1YE 4LY6A 4AK9A 4CT5A 2ODEA 3WYGA 1D5CA 1SVWA 3WYAA 2BMJA 4D4JA 2HXYA 1TEVA 5B58C 2OESA 1KSJA 1KTVA 2ERXA 2F3TA 2REBA 5D3MA 5HTKA 2IXEA 5L8VA 2XITA 3DHWC 5JS8A 2P2LA 3PJRA 4AKGA 1SXJB 3DMDA 4ZCLA 2A30A 4XWAA 4A1FA 5CK5A 4B48A 4OQFA 3LFUA 5K8LA 3VKHA 2DYKA 4H9GA 4QBGB 5K8IA 1X8JA 2QENA 1WB9A 1TQ2A 2KWIA 2ONJA 2EW1A 2RH5A 4C9BA 4QGFA 2QL6A 1DAFA 2R6FA 1IAQA 1YU9A 3ZLJA 3ZVNA 4PO9A 3CRRA 5B2ZA 1CR0A 1WF3A 1YR7A 4MRRA 2QORA 1Z6YA 4UNPA 4CF7A 4EPYA 2VLIA 2IYUA 3FHOA 3NH9A 4XWOA 2NZJA 2XJ9A 3X1YA 1UM8A 3EXAA 2XB2A 1ZMXA 2OBMA 2QY9A 3ZVLA 5FUWA 3R9IA 1DADA 2WOOA 1NG1A 4PO8A 1TU4A 1MKYA 2E9SA 4TL9A 4Q4LA 4CYMA 3CB4A 4IVRA 2AX4A 4JL6A 1F2TB 5IRCD 3BH7A 4QNMA 2BOVA 2VHUA 4L4UA 4LC1A 2FFHA 3K09A 2AFHE 4XOIA 3SU8A 3QY0A 3LWNA 4MYCA 2ERYA 3CH5A 3IBYA 4TMXA 1OXSC 3FMFA 4WVFA 4AG5A 4PAQA 2HYIC 3AVOA 2O5VA 4URVR 3Q8XB 5H1YA 3K1JA 5FPKA 3MD0A 4W5HA 3I1FA 1IY2A 2JIZD 3THOA 3A8TA 2FPLA 3D3QA 2O8EA 1XEWX 1KJYA 3X1XA 3SI7A 1TUEA 5HKKD 2JLZA 1G8HA 1P62B 3I32A 2JDID 3GJ3A 2GNOA 1D2EA 2V4ZA 4JLAA 5JSZA 2FG5A 2FPMA 3VX3A 4PTLA 3AKCA 4PC1A 2HEIA 1MT0A 4DHEA 2PJRA 4Q02A 5CLLA 4B71A 4MH0R 5LDDC 5GADl 4F93B 1P75A 1TU3A 2GDJA 1CRQA 3CRVA 4G5RA 5P21A 4A15A 3IO5A 4KODA 2QNRA 1P73A 1IHUA 2WZQA 3NWJA 3RHFA 1ZAKA 4JLBA 1UEJA 5UKDA 4DDTA 5C4MA 5HCIA 3ADBA 2WJIA 2EFCB 2IT1A 5KNBA 4LV8B 4FN5A 3IPYA 3QENA 3U3RA 2AXPA 2Q21A 2ZRPA 4LPSA 1PLKA 1XJCA 5AR1A 1GTVA 2VP4A 2ZRFA 2ZSDA 3CLVA 3IUYA 3LD9A 4XH9B 5FBRB 3U3KA 2CLDX 1HQYE 2QG6A 4B2IA 3NC1C 4IFBA 1OB5A 3QVUA 1DS6A 4OHWA 3SFZA 2JLYA 2WSSD 1XD2B 4HDOB 4WW0A 1XEXA 3FGNA 3V4RA 1ZCAA 2ODBA 4GL2A 2HT1A 1XRJA 1XTSA 1UDXA 1AIPA 1JXOA 4DCTA 5BN5A 1D9XA 2FMXA 3T1VA 4EQ6B 2D2FA 4XD7D 4I1VA 3P1JA 1J99A 4MGKR 4PC3A 1IBRA 1WP9A 3QPWA 3RLFA 1QHSA 2YOGA 1JAIA 1G5TA 1EX6A 3WP1B 4ZKEA 5FTNA 1BOFA 1GL6A 4BEJA 2IYQA 2QPTA 1CU1A 2ANCA 1IN6A 4URYR 2FGKA 2X8AA 4O3MA 1P9WA 1NBME 3SYLA 2GKSA 1DO2A 1FX0A 2QAGC 3UK6A 4D82A 3U4QB 4TTQA 2O8CB 2ZSBA 1W4CA 3QXHA 4IXMA 3SEAA 2IF0A 4F91B 3A4NA 3NXSA 4KLNA 4LCBA 4Q00A 2DFNA 3RRYA 2ZU0C 1E2NA 3LLMA 4MDEA 3AVYA 3U44A 2Q3FA 3GCGA 4YMUA 2NO6A 4Q1DA 4LBVA 3GPLA 1AKEA 1S9HA 3FB4A 4BLRA 1E9RA 1OIXA 2DFTA 2VSXA 1WBDA 4AKIA 1YZNA 1UKZA 2V54A 3KTAA 5TDHA 3TUIC 2NGRA 4GOJA 4C4PA 3FWYA 2REOA 1E79A 3H86A 4LOAA 2GF0A 2G77B 2JIZA 3A1WA 2ZS8A 4JLPA 4TLCA 3SJZA 3FFAA 4BZXA 3EZFA 3PUWA 1SVLA 1T3LA 3U3OA 4OHXA 2JEOA 2ZJ2A 4DB2A 1G64A 3A1SA 4B76A 4M9QA 1HYQA 1XBTA 2XZLA 1E2JA 1OKKA 4B34A 5JRJA 5L3SB 4ZCMA 3RS2A 4YONB 2MSDB 5JI3E 1KO8A 2DPXA 2KJQA 4HDCA 2V7QA 2FSFA 1IN5A 3C7KA 3NKVA 3THYB 3LVQE 1E94E 1DVRA 3OFND 4YDHB 3ZYCA 4G1UC 4KI0A 1QZXA 2FV8A 3NBFA 3GFTA 2ECKA 2GZDA 3UIEA 4CT4B 2BWJA 2NZ8A 3SR0A 1WCV1 3DOFA 1GRQA 2H5EA 5AJXA 5KOYA 5SZJA 2WHXA 4I99A 3CKLA 2JAQA 1AGPA 1KSGA 3V00A 2AHOA 2ZR7A 4MRVA 5JJIA 1Q44A 2CE7A 3P4XA 4JVLA 3IPXA 1QHGA 4O2RA 3W5IA 2ZANA 3BH0A 2GEUA 4RCYA 3GLHA 3ZZTA 1LF0A 2BCJQ 4JLJA 5AWFC 1XDBA 2C78A 1E2PA 3QBVA 4ON9A 4GFDA 4RZ2A 1WBBA 1M34E 3EIHA 1N5LA 4KBFA 4A2WA 2CEAA 4FMCF 5DYIA 3BXZA 4W5JA 1TUIA 3D6TB 2P5SA 4HUQB 2QU8A 3TBKA 2GXUA 3AF1A 1E3MA 3IEUA 1IN8A 4AYTA 3I92A 5KSPA 3KUCA 2ZJZA 3BFVA 4ESVA 3ZQJA 1WXQA 4KAXA 1AZSC 3AP3A 1UBCA 2XNDD 1G8PA 2LCFA 1Z5ZA 4C0SA 3TR5A 1NN3A 1UPTA 3FOZA 5H8WA 2VHTA 3BBPA 3JZAA 4I81A 2QMUA 1E2GA 5H70A 2VRWA 5AUNB 1M7BA 3EA0A 4PQFA 5L3VA 2NPIA 1XPRA 3JVUA 2IYVA 3CRW1 5KYKA 3KXLA 5TY0A 3WNBA 4B74A 4RZUA 4WZAE 2JJ1D 2GJKA 1ZINA 3PXGA 5KSYA 5SZHB 2W6IA 4LYHA 1X6VA 4MGYR 3CUEF 2WPDD 1ZM7A 5EE9A 4JT4A 3Q9LA 5J4KA 2WWFA 4B3CA 3A58B 1HY3A 1K6MA 1IXSB 3I4LA 2QTFA 2TMKA 3CF2A 1HT1E 2CE2X 3LBNA 3CF6R 4HLUA 2C9OA 4TLAA 4HAVA 3TVDA 4B6EA 1G4AE 1W1WA 3M4YA 1KY3A 1L4YA 3DPUA 4JYCA 1J2JA 1U81A 2BMEA 2VL7A 4JLOA 2PMDA 3GLHE 4Z1MA 4M1SA 4Q5IA 1QVRA 1TL7C 3NH6A 4LJ5A 4PSKA 3K53A 5D3QA 2J3EA 4CEIB 2WWGA 1HV8A 2BM0A 2ZR0A 4Q9LA 1D9ZA 1WRBA 4JLVA 4EPTA 1EXMA 4R71A 2D7CA 2QAGB 2ZI9A 5CYPA 3WBJA 2VH5R 4C0HA 4A82A 5CB8A 3BRWD 1E9EA 2QROA 5CDFA 1KMHA 3PCRB 2FX3A 1U8ZA 3LA6A 2IUSA 3CPHA 1E99A 3PEYA 3KJIA 4M9ZA 2OO7A 4POAA 2V6JA 2BMDA 2LWIA 4YLGA 3CONA 3DMNA 4IEIA 2OFOA 1G19A 5EP2A 2DHRA 4GP7A 1Z8FA 1OH7A 2OUKA 2VQSA 4PQRA 4A92A 1Z22A 4KV9A 5GJVC 1NVVQ 1P2TA 2BDTA 2YKGA 3NEYA 3NDBB 2BBTA 4FI3C 4PZLA 2A7QA 3C5CA 3G5UA 1HE8B 4XTRA 5KU1A 4L8GA 4TLBA 4M22A 1GILA 1KI7A 1E0SA 3W5JA 2DY1A 5EP1A 4BGDA 4BRUA 1XD2A 2O8CA 2V1UA 2AWOA 1Q20A 1SVMA 4KO8A 2PT5A 3H1TA 3MMPA 1F60A 4TT3D 3VX4A 1E0KA 1GKUB 2ZTSA 1L2TA 1A1VA 4EDHA 4XSHA 1D2NA 2X77A 3AP1A 1G20E 4MKHA 1VECA 3U6KA 3TGPA 3IGFA 1ZVQA 2AN9A 3GJ4A 2VSOA 2PCJA 4PZYA 2FJUA 3MJHA 4CEHB 3CIOA 1VCNA 4D4LA 4NU0A 3HDTA 4C3ZA 4B44A 1RVDA 2NTYC 1ZC4A 4JLKA 4CVNA 3T06B 1CJTC 1E98A 3QKUA 1NY5A 4JJKA 3NBYC 2ZSAA 4OI2A 2R6GA 5CDFE 2C5LA 4BLSA 4XSGA 4H1UA 3ZH9B 1KO7A 2QM8A 4LYAA 3IKJA 2KE5A 3MSXA 2JJ1A 1E69A 1KDPA 2YWHA 1CULC 3PEVA 2FNAA 1ZNZA 3W3AA 4M8NE 4NCIA 4C7OB 1QRAA 2WBLC 3KJEA 2IS1A 1VIYA 4U7DA 5C2JB 2I4IA 2JLXA 2HXSA 5DSZA 4C30A 1BO6A 1SHZA 4GT1A 3B1ZA 1ODFA 4OK3A 5LPNA 4Z54A 4V0NA 3U7FB 2CCKA 2ZI7A 3DKVA 5L3RA 1Y3AA 3PVSA 5B57C 3VR2A 1VPLA 3MAAC 2ATXA 2WIBA 2RGNA 2IS4A 5DISB 1KI6A 5FI1B 4JLMA 4P0TA 3SBEA 3L0OA 5BWMA 1XF9A 2PJZA 1IXZA 1NN5A 3L0IB 2W0SA 3TQFA 1FTNA 3JZMA 3KKNA 3MFYA 1IN4A 2O0JA 2E87A 2IW3A 4J0QA 1W5TA 2O8EB 4ZIRB 3CM0A 1E2EA 4NBSA 4JT2A 1PVOA 4DB4A 1G3UA 2OLJA 1RRGA 4M0LA 4N0DA 4PXAA 2VHCA 3UMFA 1NG9A 3L43A 1E9FA 5CK4A 4F38A 2GXSA 2WJVA 1W0KA 5E95A 3EPKA 3OZXA 5FUVA 1P7CA 1U2RA 4DLUA 2WV9A 4NYJQ 5EE0A 3SQWA 2D06A 1TAGA 3T12A 3Q85A 2IYZA 1ZM4A 2BCGY 2J7PA 4HAXA 1VYTA 3ZS9A 4TQ9A 2J87A 2I1QA 4LHXA 4RD0A 3GLGE 4MUAA 5CM8B 4IDOA 4BFTA 3LX5A 2F55A 1G41A 3WMFA 1U8YA 1W48A 3OEHA 2X2EA 1EWQA 2GCOB 4XIGS 2QT1A 2CCJA 1C9KA 3IQXA 3GEIA 1A5TA 1S3GA 3OIYA 4TYYA 3OEEA 3N2EA 5J40A 3I62A 4MDFA 2GILA 4BFSA 5M04A 2NG1A 3HWSA 5G41A 421PA 4CZ2A 1G5RA 4IXNA 5FR1A 1MABB 4TSFD 1Z0IA 1G7TA 4HLCA 5EP3A 2OG2A 2GXQA 1XCMA 4CEJA 1II8B 1AS3A 3I8XA 3NG1A 2IUUA 2MSCB 3OFNA 4JZKA 3X1DA 3CZQA 3ND9A 4NYIQ 3LNCA 1JR3D 2C8VA 3IHWA 3HYRA 4F4CA 4DCUA 1ZRHA 2W2VA 4P33A 5E7JA 3HR8A 1TADA 4G5QA 5HE8A 3RS0A 3VNUA 2DFLA 4JBWA 1PUIA 1E2IA 1TX4B 1KK1A 1XCGB 121PA 3BB1A 3LX8A 4Q9KA 3RNLA 1VIAA 1RC8A 2Z4SA 1UJ2A 4TQUS 4M1WA 2GAAA 1E4VA 2ANBA 5K8TA 4ZDIA 4HATA 3MJRA 3ZD7A 3ADDA 2YHSA 2RKOA 3SN6A 4V02A 1T9HA 3BORA 3OE7A 3SYKA 1MR3F 4GMDA 1T6NA 2IYSA 5AK0A 4MKFA 4DJTA 2A5YB 3A6PC 1Z47A 2DCUA 4HSEA 4JS0A 3KKPA 3IILA 2BMFA 3RRNA 4NDZA 2NO1A 2XX3A 4DCVA 1VYVA 1XJQA 2UVQA 4ACBA 2IHYA 1FX0B 1BH2A 2ZJ5A 1MO5A 3U4QA 4BLQA 2IYTA 1FP7A 3I72A 1SQ5A 2BEJA 3AKEA 3QEJA 5FTJA 2ORWA 2QGNA 4HUTA 1OHHA 1K5GA 2OZEA 2VA8A 1ZD8A 2WWWA 1LF5A 4RZXA 1UADA 2PEYA 2QGZA 4R2IA 1GDDA 1DARA 4OKSA 1SXJC 4Q4JB 4LJ7A 3I5XA 4CDGA 3H0KA 2FA9A 4NKRA 1I2MA 3R7WB 3ZZUA 3D7MA 4ITRC 4QOSA 3W6PA 2AD1A 4G3XA 4AI6A 4D81A 3O8DA 4G5OA 1KI3A 3THYA 4Q01A 1R0YA 5G3YA 4KVGA 221PA 3MGCA 3AKDA 4A0RA 1KDTA 2VF8A 2IL1A 1N2CE 1BS1A 3THWB 3L2OB 1ETUA 2Q9BA 5FL3A 4M1MA 3OESA 4CEHA 4NZYA 1QG4A 2BBSA 1NJFA 1M8PA 1N6LA 5L3SA 1X3SA 4WXRA 4D0LB 4BFXA 3K70D 3FTQA 4N1AA 4QM7A 2Q3MA 4XJXA 4GZLA 4QL3A 1KYIA 3RABA 4PX9A 1LW7A 2WJHA 3Q5EA 1RRPA 2WJJA 4BZPA 3CR7A 5JJLA 2QAJA 2KBEA 3CX8A 4LJAA 2IWHA 4GPTA 4OQMA 2AD5A 3RSLA 4R98A 2P67A 3GLHB 4HZUB 2J0SA 3HJNA 3GJ7A 4B3GA 2XTZA 1CJMA 3KFVA 3K9GA 2FSHA 3FE2A 1G21E 3KQUA 3NDPA 4GOKA 2Y8EA 4NCHA 3QNUA 4AD8A 1FNNA 3LH5A 1ZNXA 3UMSA 4IFEA 1S1MA 2XZOA 2IYRA 2V1XA 1YZQA 4HB0A 2V3CC 4HZIA 3GJ0A 4Q1BA 2QQ0A 2F6RA 1SULA 3S1AA 4R2HA 4A8JB 3UANA 2N46A 3LAWA 3K0CC 2ZE5A 4OHZA 2PH1A 2XAUA 3FKSD 4RFSA 2GETA 4US2R 1Z63A 4K46A 1HE1C 1KIMA 4EAQA 2YOFA 3C4JA 1E1RD 1X1RA 2AK3A 2CJWB 1TQDA 1F3OA 1OJLA 2GA8A 3TAUA 3AVWA 4I1UA 1JXMA 4I1OA 1N6PA 2XXAB 1KK3A 4HB2A 3VNVA 4D25A 2ZJAA 1G7SA 1GNRA 1PUJA 1EX7A 3C15C 3RSOA 2ZETA 1JEDA 1YHNA 2Z5FA 3FMIA 3SOPA 4HAYA 5F98A 4DUGD 4A6XA 3SJAA 4UNQA 4E5UA 2H7VA 1NMZA 1Z0AA 2CMKA 1KDRA 4HDQB 1BMFD 5BW8A 2QTHA 3CO5A 1MOZA 3LRPA 4M1OA 3R8CA 2DWOA 2OE2A 2PBRA 3EZ7A 5HE9A 1N6OA 2NO0A 1U8AA 2D2EA 1II9A 4K8OA 3VAAA 4B32A 3QI2A 5FBWB 5CIWA 1HQCA 3AQ4A 2F7SA 3RYTC 1DO0A 3QF4B 2AK2A 1GAJA 4LHYA 3GMTA 3QVVA 1Z2AA 2B8TA 3C16C 4LYFA 4I1SA 1E9SA 1XX6A 4B75A 1OLOA 4Z8XA 1CIPA 4X8OA 2JA1A 4Z51A 2ODWA 1UKVY 2YYZA 4EFMA 721PA 4Q9JA 2RGCA 2IYLD 4GRAA 4PSVA 2QBYA 1CP2A 1N6NA 2Z0MA 2WKRA 3P26A 5H68A 3EA5A 5A5GA 4A2PA 4OYHA 1F6BA 4YDSA 3DM5A 2ONKA 2ZYWX 2XEXA 2RGBA 5DE3A 1KMHB 3VQTA 2PMKA 2R62A 2VP6A 2C03A 4B3FX 4ASUD 1J7KA 1X86B 3EIQA 5JZVA 3TMKA 3TRFA 1GFIA 2WICA 2XTMA 2ZRKA 3ECCA 1OFHA 4PHTA 2QP4A 4E03A 2R6CA 2FOLA 1F48A 5L3QA 4KXFB 5IF9A 1R10A 2CHGA 1PJRA 2WAXA 2ZRGA 5FOVA 2O8BB 1N25A 4DDVA 1GZSA 2J46A 1U9IA 2HF9A 1MO3A 4AWXA 2ZRIA 3K0SA 2A2ZA 1R6BX 2VHQA 4NCNA 4C2TA 3AF2A 3D8BA 4A9AA 4TMWA 1E0JA 3TUZC 1E4YA 1S96A 3REGA 3I8SA 2AFIE 4TLDA 1UFQA 2EFEB 2ZSEA 1Q1BA 3KKQA 1E79D 3IO3A 1W36D 3AVVA 3VR1A 1G18A 3U7EB 4Y0VA 1TQ6A 5EP4A 4DKXA 5GJWC 1E2QA 5AJWA 3WYFA 1YR8A 2HLDA 2AKYA 2OCBA 3DVLA 3KXKA 2JJ8A 4QKQA 1FQJA 1M74A 3BD9A 3TW8B 5KNCA 3IBGA 2HV8A 2IYWA 1J8MF 5GVRA 2J59A 3KX2A 3B7GA 5FFMA 1RE0A 1NVUQ 1KZ7B 4BPBA 3IEVA 1E2MA 4V03A 1RRFA 3TW4A 3QQ5A 5FUXA 3VMFA 3FKSA 5F9FA 3UKDA 2N42A 2RGEA 1COWD 3M1IA 4EJSC 2ASEA 5DN6D 3O47A 2FZ4A 5J47A 1G9XA 3SC3A 1G8YA 4Q1CA 1BKDR 1NIJA 1KO4A 1XMVA 4JSYA 4U00A 2IX3A 1GM5A 2OXCA 4YC7A 3BJIC 3KXIA 1TEXA 4Q7MB 4TTRA 5F2EA 3OAAD 3A4MA 2JJ2D 2DWQA 3MCAA 2Z83A 3W6NA 2V6IA 2R65A 4YQFA 4BFUA 2P65A 2C98A 3HP1A 3GJ6A 4JBYA 4W7SA 1G17A 1RKBA 2UZ3A 3CNNA 5JEDA 2QMHA 2WOJA 4MYTA 3BFXA 4GZMA 4NHOA 3OEED 1I4DD 3B1WA 1KJZA 2RGGA 3GFOA 2ZRAA 4YMSA 2C9YA 3SS8A 4C7OA 4L9WA 3KQHA 5FPSA 4TQAA 4ABYA 1VMAA 2IA5A 1T8TA 1D2MA 1G8FA 4UJ3A 1SGWA 1N0VC 4RY2A 4URXR 4JBXA 4NTZA 4Q4AA 4BASA 3UPUA 4I4LA 3Q5DA 1KMQA 2R6AA 4KFRA 1OFIA 1SHKA 2BJVA 4PO1A 3GLIA 3IQWA 1ZBDA 1PLLA 3D31A 4QC2A 4Q9IA 2OFWA 3SNHA 3U7HB 2QT0A 2JCSA 1DAMA 3KQNA 3NTUA 4LBYA 5E7IA 5A4JA 3QE0A 3GLGB 5IT5A 2GHIA 3GD7A 3LBIA 2OHFA 2ZI4A 4W9MC 5FBLB 4NYIR 4QBHA 3RVBA 2ZE6A 3OE7D 4GMXA 2RB4A 3F0TA 4DDWA 5KUTA 1DAGA 4KYIB 5TXGA 4ERNA 1G4UR 1SVIA 2PEZA 3B1XA 4LDJA 4B47A 4B3BA 3GJXC 3K9NA 2PX0A 2ZJBA 4PZZA 4ACAA 4QNRA 1TMKA 1Z6AA 4LPKA 2ZQ5A 5SZIA 2CXXA 3PEWA 1KKLA 4HZUA 2GCNA 5BYKA 1XZQA 3WXMA 3DL0A 821PA 1OXXK 4BECA 1S4QA 3ZZ0A 2PZEA 4ZDWA 1UDWA 4LV6A 5GVSA 3ZQ6A 1XEWY 4L16A 2ZAOA 4G5SA 3F5FA 4Z1MD 4LYJA 2PL3A 1ZW6A 4Q66C 2V55B 3GFPA 4AYXA 3ICEA 4JVNA 3AP2A 5ANRB 1SXJE 2EQBA 4RD6A 4Q7LA 5DIFA 2H16A 1MABA 3I61A 1QVAA 2ATVA 3C8UA 4YMTA 1R4AA 1Q57A 3PG5A 2QZ4A 2GAOA 4TTPA 5EXTA 4AKEA 3PFIA 5EUQB 4DIEA 2A9KA 3LQQA 4JIMA 5CM9C 1C4OA 2YVUA 4V0ME 5HZKA 4LWZA 3B2EA 4LX0A 3RWMB 3EX7C 4LUCA 1IY0A 2F1RA 1TF2A 2W6JD 3AB3A 4FXPA 3PUXA 3RS7A 2PZFA 3U60B 4IDNA 1N0WA 5FPHA 2OM2A 4LBWA 1SKQA 1ESMA 1JJVA 1BYIA 4Q47A 1U90A 1NP6A 4F4IA 1EFRA 4NL4H 3BFKA 4DLTA 1DOAA 4ZO4A 4MKGA 3P20A 2LKCA 2QEQA 2Q9AA 3SZRA 4KU4A 2JJ2A 1KKMA 1FQKA 1GVNB 2XOKD 1KZGB 2CNWA 3QF7A 1S8FA 4FMCB 2BBOA 3BE4A 3N70A 4GI7A 4GP6A 3L0PA 5L3QB 1H65A 4PANA 3RRZA 1P60A 5C1BA 1AZTA 3MLEA 5J4VA 3ZDQA 4DLVA 8OHMA 4R9UC 2G1KA 2GBLC 3SHFA 5FTLA 1OW3B 2CLCX 4NPHA 1G3QA 2A3RA 3BOSA 4A2QA 3EZ2A 2G0TA 4YXWD 5BN4A 5E7MA 2VYFA 3GP8A 4Q4JA 3T1TA 1W4AA 2VHJA 4TMKA 4N3NA 5KNDA 1L4UA 3CR8A 4NONA 1SXJA 5FOUA 1JR3E 3A37A 2OAP1 3FYHA 1KSHA 1Q22A 4LJ9A 1EFTA 1XU4A 1JAHA 4KFUA 3ZJYA 5JHHB 4JMPA 1G3IA 2CL0X 2WIAA 1NNEA 1KAOA 2J0UB 2NPFA 1N6KA 1CEEA 2ZROA 4Q21A 3U6BA 2AXNA 2J41A 2OCYC 3NBZC 2VEDA 1WA5A 3GQBA 4DUGA 1LFDB 1HUQA 4KJZA 1G8GA 2PX3A 2IEZA 1A82A 2PLFA 1P5ZB 2QTVB 1LS6A 1OIWA 5KTYA 4OI0A 2OLKA 4DLSA 3KKMA 3VKWA 3UMRA 5CIQA 1UBFA 1G7RA 2FFBA 1N0UA 4EUNA 4IRUB 4RSGA 3QG1A 4KFTA 3AGQA 4EPWA 1TPZA 2JLWA 4QJ5A 4P4TA 3TQCA 4DDUA 2YWFA 1I4LD 4MQBA 3I5YA 1EFHA 1KNQA 2DFKB 1E2HA 1T3SA 1RW4A 4UNSA 1P3JA 2IYXA 3Q72A 3X1WA 4BFWA 1F2TA 1CXZA 3AGPA 2P3SA 4QJ3A 3EG5A 2BEKA 1AQYA 3PENA 3P27A 1NSFA 4TYQA 1FFHA 1EWRA 1YJ5A 1DBSA 1JNYA 3NIBA 5F3WB 2QP9X 2ZIAA 1OV4A 2FPKA 4XTCS 3S1AB 4A8JA 2FH5B 5KO2A 4UXHA 5SZKB 1SKYB 2ZRLA 1KI1A 3CWQA 1P61B 3ASYA 1R5OA 3RRMA 2A5JA 3LY5A 2O8FA 4HEJA 3B85A 5LB4A 3VR3A 3FHTA 2PT7A 3Q7QA 4IVQA 3L8YA 3LW7A 1IOZA 2WJGA 2JATA 5FPYA 1W2HA 2A5DA 5A0FA 3TE6A 3PUVA 3NVAA 2FN4A 1KI4A 1FP6A 1W46A 3EPLA 1LNZA 1YQTA 5DHFA 1KAGA 3SDZA 3DO6A 2ZE8A 4X8HA 5E4FA 1L8QA 5JRZA 4RFSB 1E96A 2QMEA 2JLUA 3SJBA 4EPVA 1JB1A 1AQUA 1GUAA 1II0A 3QXSA 4DVGA 1NMXA 5LD2B 4HUQA 1T4GA 1X1SA 4TMZA 2BBWA 4Q18A 5JSZB 1DAHA 2WMNB 2HLDD 4PHHA 2REXB 1V5WA 1LV7A 5BN3A 2JASA 3QSYA 4B33A 5KDDA 2XSZA 2G6BA 1IM2A 1GNQA 4OHYA 2RGAA 4Q4AB 4Q03A 3RAPR 3EPHA 2FSIA 2OCPA 4TSFA 1Z29A 1N6IA 3ASZA 4LJ8A 3U3MA 3LXRA 2VP9A 3C41J 1E1QD 2C95A 4L5BA 2VBCA 1T0JB 2Q9CA 2QBYB 1FNMA 1A2BA 2O0HA 1E9CA 1SXJD 3HU1A 3QF4A 1Q3TA 3CNOA 1VG1A 3ND8A 2MSEB 3AVXA 1Q12A 2BJWA 4TL6A 4II7A 5FL7A 2XZPA 2F43A 1W47A 2V9PA 3SBDA 4M9SA 1VDZA 4DEXA 5JWRA 2YV5A 1D6JA 3ADCA 4P4UA 3OAAA 4P4SA 5EQTA 4RD3A 1NLFA 4WOPA 1G1MA 3K9LA 2KBFA 3BC1A 1M7GA 5FBVB 5JWOA 2CK3D 1WMSA 3ONWA 3W8RA 3B78A 2ZSFA 2WVJA 4GOXA 5D3MB 4E07A 4O0MA 4M1KA 4WA7A 4RJLA 1O87A 4AYWA 2GTPA 4A36A 5IHPA 4EKDA 3U44B 3UG7A 4DIDA 4C0QC 4B43A 5K8UA 1OHHD 3BH6A 4IDQA 1AGRA 2EFDB 1VTKA 3MWKA 1DELA 3OIVA 1W36C 5DO9A 4PFSA 3NC0C 2ORVA 1W0JD 3KTAB 3LO5A 3P4YA 2GXAA 2YOHA 2YC4C 3ZS8A 2WAYA 1ZC3A 2IUTA 4IJMA 3A1TA 1MRNA 2RGNC 1OYWA 4P3YA 3CNLA 2RHMA 3BERA 2QM7A 5CJ2A 1T5LA 2QE7A 4UXJA 3SQXA 4Q9HA 1ZYUA 5B64A 4GDFA 2ZU6A 3AH8A 1HA3A 5FPTA 1IONA 5DGXA 2WWIA 4DLWA 2R44A 1NVVR 3FPAA 3U5ZB 4RD4A 2O52A 3SHWA 2OBLA 1CTQA 1XNJA 4EIWA 2D7DA 1B23P 2ZM5A 4EFNA 4M9XA 3VR4A 3TSOA 3AF3A 3M6AA 1OH8A 1VG9B 1JPJA 3K09C 1G16A 2NOAA 5EE5B 2JLVA 2HDNB 2SHKA 2EYQA 5KPDA 3ZIAA 1EFCA 1KGDA 3T61A 2HF8A 2X19A 1YZTA 5KSZA 4ZPXA 1KK2A 1G5PA 1QHNA 1NBMA 3HPQA 1OE0A 2YWEA 2FZLA 4MUBA 3P32A 2HJGA 3W34A 1QHIA 1IJFA 1GP2A 1FMJA 1T91A 2VPPA 4LHVA 5TVKA 2AWNA 4FCVA 1KI9A 1ZIOA 2J1LA 4D26A 1Z6TA 3WMEA 1R8SA 5DI9A 4X8MA 2FFAA 3THXA 1LVGA 1OPXA 2CDNA 3B5JA 1Q1ZA 1UBEA 1E6CA 1T3HA 1XD8A 2OSBA 4URUR 1KOFA 4AG6A 3BIFA 2HYDA 3FKQA 3K9HA 2G3YA 5FBQB 1YZKA 2ZRMA 2WKQA 3KQKA 1QHHA 1U98A 2J0VA 3SJCA 3VR5A 3V4FA 4DCNA 1GL7A 5JHGB 3AM1A 2FDCA 4KYUA 2OT3B 2UZIR 4FW9A 4U02A 2IK8A 1VCMA 2ORIA 2J7PD 1YR9A 2ZR9A 4V0OA 3GLGA 3TIFA 2BIFA 2BHRA 3KUDA 3N2IA 5F9HA 1NN0A 3CRQA 2H17A 4Q7JB 3BB3A 5LD2C 1DTSA 3O8RA 4TL8A 2GEDA 1XEFA 4AC9A 1P9NA 3K0EA 4D2IA 1RPZA 4OQLA 3CW2A 3CRMA 2H1LA 1BMFA 3MUFA 1IJEA 1VG8A 4DLXA 2VSFA 2IWRA 4LZZA 2RAPA 2CK3A 4OL0A 2YINC 3SYNA 1DAIA 2IHBA 5EE1A 4LK2A 1ZD1A 5IK2A 2G9NA 4PC7A 1FMLA 1S3SA 1GITA 2Q0HA 3DZ8A 3RS3A 1NVWQ 2QA5A 2P6NA 2OEPA 3B82A 4TN1A 4O25A 4DT1B 1R8QA 1EK0A 1YZLA 2GVZC 2ZRJA 3GJ5A 3RS4A 2G83A 2IS6A 4WZBE 1JI0A 2YJTD 3UG6A 5DLQC 5J4YA 3WRXC 1DEKA 2QAGA 4QGGA 3CWZA 4BFZA 4HAUA 5JCZA 2FE4A 4K81B 3X1ZA 1Z07A 1Z2CA 3N5CA 4O2LA 1Z0FA 4N0EA 1FUUA 2NMVA 3C14C 3G0HA 1Z0DA 1YE8A 2JGNA 3O8BA 4HB3A 2CCGA 1G3MA 4LSGA 2NQ2C 1ZNWA 4IKEA 2CVHA 2QE7D 4FIDA 1E2DA 4MKIA 4ASUA 1NSTA 2ZJOA 2D74A 2GZAA 3AVPA 1E2KA 4Y0AA 1PZNA 4DSUA 2AKAB 4OI1A 3BWDD 4B2PA 4QG7A 3R9WA 4C0KA 3R9XA 2IXFA 2GBLA 4PC6A 1Z08A 1TTTA 2I3BA 4ILEA 4WXPA 1CR1A 3KDSE 1NL3A 4QXAA 5FR2A 1YRAA 3AUXA 1ESNA 2O0KA 3I3SR 4F7WA 1X8LA 5TB5A 1W36B 2C96A 3KB2A 1C1YA 4JLDA 2GVDC 1ZP6A 4AY2A 5DI3B 3X2SA 3LV8A 1XTRA 4Q1FA 4KVAA 1QHXA 4ESHA 4ZI2A 2G0NA 3VFDA 3K0AB 1ZM2A 3EWSA 3UWKA 5JLJA 4JL8A 2GJ8A 1II8A 2L0XA 2F1JA 1H8ED 1AN0A 3CZPA 2J45A 4CRWB 1EGAA 2FF7A 3A36A 5AJVB 4CIDA 3HPRA 3HR7A 1XMIA 3CF0A 4JVSB 4UXIA 5FOWA 3EPJA 1GKIA 2VP2A 3R8FA 1FL9A 3DKPA 4ZI3A 1US8A 2XJ4A 1KHTA 2QP3A 4QHSA 1Y63A 2GF9A 1GWNA 1XXHE 1ZM3A 4FMBB 2Z6VA
chains in the Genus database with same CATH superfamily
2D1TA 3KFXA 2E7ZA 3ORHA 1KPIA 4MP8A 1A4RA 1R0ZA 2Y93A 4KSBA 4YHHB 4ODIA 3PIDA 1JR6A 5TMPA 1Z6GA 1Z4NA 3B1VA 1KI2A 1U8EA 1QGED 5I45A 5IVKA 4UUAA 2PAAA 3I5AA 1G3RA 1NNLA 2NUPA 3JATA 1EYZA 1HE2A 2O2CA 1D04A 2X42A 1TQ8A 3FVQA 1TDJA 4CQMD 3RC8A 1GTJ1 3R41A 1DKRA 3OT1B 2J67A 4L2IB 3GYGA 4DSNA 1WDWB 1OAOA 2M6LA 1PGQA 3HJRA 5DYNA 4FSDA 1QDEA 1IMJA 4BWYA 2MYNA 2ZVPX 3VZRA 1QP0A 3LOQA 4HVCA 1NASA 3E1KA 3IQFA 1EZ4A 1TMOA 4WIAA 5IVPA 3GLIB 3LI2A 2GZ3A 2P9TA 2QSZA 3USCS 2H11A 3JASA 1IC6A 3D5EA 5JEEA 2F4VB 3DXXA 3HJBA 4Y98A 1NX9A 1AF4A 2GNAA 1SUIA 3WNDA 5G53C 3V1YA 3QLTA 3ZQ4A 5FOTA 2MMCA 1X0VA 3QUCA 5T5QA 3V8NA 4C2UA 5JJBA 1JPUA 2HB6A 4LW8A 1HX7A 1BMTA 1FDUA 3HEMA 1RAAA 2PY6A 2XDYA 1QZUA 1S0UA 1QIEA 1NMYA 4M4SA 1QH0A 3RYCA 2BHTA 1Y1QA 2R2AA 4CPDA 2BSAA 3ZH2A 2ODAA 2W0MA 2H8KA 3CFYA 4LHSA 4H27A 2JF0A 4TROA 3VNRA 3FB1A 3TE7A 2YBEA 3HNRA 1TMGE 2WB4A 5AKHA 2LDBA 1XDWA 1Z6XA 4ZI7B 1AQIA 3OMLA 2A4KA 4K6GA 4W1PA 2Q7DA 3WGKA 5JRDS 5K5EA 1T8SA 1MH1A 1SXGA 4R51A 4NXNB 4A8HA 2NV0A 4FXOA 4CETA 4L07A 2Z8YA 2D3TA 2ZR8A 4LBZA 5E1OA 1FQWA 3CQ9A 3IA7A 1KEEB 2JH9A 2CZCA 2RHLA 4GNRA 3UHOA 2VDPB 3U39A 1L4EA 2C88A 1GKKA 3GLTA 2B21A 1RPNA 1PO7A 2WTNA 2PRIA 1XKQA 2O05A 1J1UA 1VGQA 3MUOA 1MHPA 3GGSA 4KMMA 4DC1A 3K4PA 3NAQA 1YULA 1NWHA 3P2KA 1BXGA 3TK1A 4F3CA 3QTBA 1QMGA 2JVKA 2ZRBA 2I2WA 3CTMA 3QYFA 4KXXA 3ZWDA 5B30A 3JRWA 2CFCA 2WE7A 2QQEA 3QNWA 4ENRA 1DAEA 3AFOA 4BVGA 1E6UA 3IL2A 3DP7A 3K0BA 4PLGA 2Y67A 4ALJA 1QO0A 3FRJA 4CGZA 3AONB 3HN7A 3EG9A 5CCEA 1L7PA 3QHPA 4L8LA 4PG7A 4FEAA 3VDNB 4NC9A 4Q4CA 4CEIA 3D8HA 4UKDA 3PDJA 2CUKA 4EYQA 3KV3O 5BSVA 2FEOA 4OQXA 3TLXA 4F21A 2CBZA 3H6KA 4U7GA 4M1TA 1A9XB 2DHCA 3AV3A 3EC2A 1H8EA 3V2IA 3FJYA 1STOA 3B8HA 2DLDA 3O75A 4H3SA 3T3MB 3K8YA 2P5TB 3I1YA 3UATA 1C7ZA 1MC4A 1XTKA 4NEHB 3JYNA 5BSEA 2XT0A 3TOSA 1CS4C 3OTOB 2GX6A 2FEAA 1GA1A 2RHCA 3ZWOA 2GPJA 3TIGA 3WY9A 1B0PA 3RAEC 3X3HA 2C4KA 2NUTB 3FPJA 3ZNNA 3NIFB 1SHTX 2ZRDA 2E1PA 4IOKA 3PGXA 4DYDA 1P1CA 1XRRA 3A1VA 4ZV4A 1PT9A 1Z34A 3FFBA 3ANMA 2VTKA 1QONA 2IQIA 1NYLA 3DFFA 4GLBA 4Y1RA 1CC1S 4IHJA 5BYJA 4RA6A 1E7QA 1U0TA 2YHIA 4DSTA 5K9ZA 2I76A 5K3OA 3I1IA 3E8MA 4HDRA 1Z62A 3U4HA 3LCUA 4CQMA 5LP6F 1RZ3A 3K92A 1DG3A 3O3MB 4MWCA 4QXQA 2K5UA 4JP5A 1EH5A 4A27A 1KJIA 1UBGA 1SC3A 4Y6RA 1D2HA 2OB2A 2ZYRA 3NNDA 4HQRA 1FJ2A 4MYUA 3CLRC 2J5XA 1UJBA 2CNWD 4RD1A 3VTFA 3B6EA 4DXDA 1YMVA 3KSDO 1T0HB 3VSAA 2F43B 3JWGA 1UMDA 1RCUA 2EDAA 4EW1A 3H2YA 1TC1A 5AIBA 2DB3A 3SX0A 3LUBA 2QRNA 3R0XA 5GJBA 1R50A 4BLTA 4X61A 5CD9A 2AVDA 3I52A 4YX9A 3KELA 2GRJA 3IKVA 5JASA 5LYJF 1LZKA 4HNGA 2PLRA 4UCWA 1FFBA 3K2BA 4IILA 5LLSA 4OBEA 3U3JA 1Q14A 3FNHA 1ZIXA 4KIGA 3WS7A 5JDIC 1DRWA 5EJ7A 3A1EA 2IRWA 3MWGA 4M54A 5EINA 3VU3A 1A5SB 2QR5A 5KTKA 2PSDA 5KQGA 2RHHA 2ZYUX 5KNDD 2YWXA 3WQSB 1CS0A 3DF7A 3QKSA 3WIBA 2I7VA 2W9XA 1I6MA 2ODPA 4KLCA 1KAMA 1COWA 1BD3A 1T0UA 1Z83A 5BUZA 2EFHB 4BCBA 5JXIA 5D85A 1UKEA 3D5TA 2FEMA 2E5FA 3TVTA 1UIMA 2AZMA 4AN4A 3E5HA 3ZUGA 4MUNA 1SH7A 3UJCA 1K8RA 3F9CA 3R77A 4PIVA 5CW2A 1X1QA 3HRIA 4S35A 1LA2A 5FFNA 3G3EA 3KR1A 3HU5A 4BZQA 4EG4A 1ECFA 4MUKA 4KQ9A 1SCIA 4BGUA 1QWSA 4FB5A 1VCIA 4TXNA 3SBOA 1TF5A 2EWVA 1EHIA 4G0NA 3PYMA 4YMHA 1CRWG 2D5CA 1KO1A 1OLUA 2AW5A 1J4AA 2XVZA 3IDZA 3O31A 4MJLA 3RFUA 1HNWB 3TKAA 4KBGA 3PQFA 2B92A 1ISRA 3K9QO 1VJTA 3HSSA 4MW6A 3DMFA 1DAPA 2Q4RA 2VJBA 2XUKA 2RGWA 3HE3A 4GQIA 3RU2A 4WLOA 1BTOA 5I7SA 2CT8A 2VT3A 3O74A 3EEYA 1ZNYA 1PTJA 3Q41A 2V96A 4JDPA 1QGUA 3WGYA 3BA1A 3GZNA 1EUCA 4X92A 1BHJA 3MA0A 4X7PA 3NVKI 5F4ZA 2V7QD 5IF3A 2G1UA 3OT1A 5C8XA 3CWCA 4P3KA 4BGVA 1C0KA 5J4HA 1GZVA 2X1VA 2QTTA 3K31A 2Q6TA 5G0TA 5C53B 3JQAA 3IMGA 3NHAA 3K5IA 1M1NB 4HQLA 4RORA 3IQZA 1R16A 2E4ZA 4COKA 1ZFNA 3ZZMA 4NMMA 3M1LA 1RZUA 5JZ9A 3BAFA 5E9AA 4H08A 4BNFA 2MSLA 3NJ8A 5L95A 1TLTA 4WKOA 5TGDA 3MGGA 1CUDA 1I8TA 1LXCA 1OYYA 1SCDA 1SBZA 2AW3A 2FZVA 2QI9F 2YMLA 1HETA 4MV3A 5IAGA 1N5JA 1ZHFA 5AW7A 4DV0B 2BMVA 1RADA 4RXUA 2FQYA 4JASB 1R15A 1MO4A 1A8HA 2X5OA 4KE6A 4FP9A 3IHLA 2WWYA 1N7JA 1WSAA 4EJSA 3H5LA 5LCXA 1VE6A 4G0ZA 3ENQA 1N8SA 3ETEA 4IQGA 1NTRA 4IJVA 4FYMA 4UUPA 4KXLA 4EUHA 2WK1A 3C0KA 1H0HA 4HB4A 1IE3A 4G1EB 1FTSA 1P2DA 4PAMA 1OH6A 3S7TA 2GKOA 2G72A 1B93A 1MORA 3KOZA 2VK2A 1TRHA 1BAPA 5E2IA 1BYUA 1XYVA 1Z4IA 3PNQA 3M4JA 1JJ7A 3TQOA 4KSCA 3K6SA 5DW3A 4HYEA 3FAKA 4FWTA 3EXHA 5L6MB 1W5FA 1IQRA 4JVMA 3VAYA 5B36A 3SGLA 2O2JA 2VRCA 2WNIA 5EPUA 4AJJA 3A2NA 4MWDA 1V47A 2YWBA 4FT4A 4CF5A 5KYNA 3G6WA 5CB4A 1LS1A 3GUHA 1RZRA 2XXAA 1R5NA 2H2DA 1ISPA 2XNDA 3CB2A 4U2KA 4ZQFA 2A94A 4C29A 3OHMA 5IXJA 2I7TA 1C1HA 1SM4A 4J2TA 3ABIA 4U3JB 1O0CA 2AG5A 3Q7SA 1UWCA 3PPVA 2ZUSA 5LDGA 4DT1A 3T3OA 3U7GA 5JO9A 2RHTA 1RU3A 2YYSA 1W7AA 1RI4A 1I2DA 4IG9A 1QIJA 4R2JA 4TZ0A 4GKAA 4LECA 3VHLB 2J3KA 4BUZA 1X94A 4JI8B 1H0RA 1DEOA 1RMQA 2BE9A 2C3UA 3K0FB 5IFLA 2QIOA 3IDQA 3SHOA 1L5WA 4B85A 1Z9BA 2VZ9A 2RMKA 5HKOA 1GRRA 2CLOB 2Z5LA 5EZQA 1T6XA 2WUFA 2OFFA 5BR8B 4P9NA 3JQFA 4L75A 5IJXA 2CHVA 3GPBA 3OC0A 5DT2A 3IE1A 1ABFA 5EZYA 1ISHA 1IQPA 1PDOA 4G6ZA 4OJKA 4J91A 2DGDA 5EZ5A 4BJHB 4URZR 2RAUA 4CTNA 1XZMA 3WB1A 1MGPA 2NYVA 4KQIA 2PXCA 1ZM9A 4QBTA 4E22A 1EVQA 1FK8A 4IHQA 5M34A 3O93A 5GZ1A 3KSRA 1NP3A 4OG2A 5FRDA 3KOMA 3WLEA 1J56A 2LE0A 5D7NA 1FRZA 5J2TA 1N1MA 1R00A 2BMWA 1Z3IX 2ZJ3A 1GNPA 3M9LA 1LWOA 4GNKA 4KYVA 4CN8A 1Q0RA 1R1DA 5K09A 2ZJFA 1OFVA 2KB0A 1W1UA 2YW9A 1MB9A 1ZD3A 1M6NA 2PWAA 2W6ZA 2OBFA 2YASA 4GXTA 3UWSA 2BVNA 4N7BA 4EX6A 5AQ1A 4A0GA 4I9FA 3VC1A 5DNYB 1PR5A 4HSGA 5DVZA 1DAKA 1YL5A 4L8WB 1KAEA 2FGJA 1P7VA 1L7VC 1NG9A 3LF1A 1LSOA 2XTNA 1KY4A 1ORVA 2G1JA 4L4XA 2XVAA 3LT5A 2G40A 2QRZA 3UAGA 5LMUB 1EGMB 2WIFA 5AUPB 1FFWA 2ZUCA 4FI3F 3N2KA 5JD6A 1LCIA 1M10A 2G8NA 4J43A 5FHRA 4MYDA 5C1IA 1ES9A 4CW7A 2BELA 2GK6A 5HQTA 1LPBB 1ULAA 2Z4RA 4NCKA 5EWJB 2X2FA 3BIWA 4DWWA 2GJAA 1KKUA 3DCNA 4CLHA 1ONNA 3GLFB 4WEQA 3EXFB 4N65A 3RF7A 2R84A 3QW4B 4IUBS 3S1LA 1O54A 4F06A 5CBPA 5BW5A 1F3LA 3S2IA 4FGWA 4MVJM 3U9TA 1D09A 4PSAA 4TTTS 5K0EA 5KTPA 1BNCA 2EV9A 5C8DA 1NURA 3PEUA 2V7XA 3RREA 3LQRA 1T5DX 4I6JA 5C0OE 2WWTA 2Q2VA 4D8VA 3AYXB 1GSIA 1UL1X 2YHIB 3TMYA 2BFEB 5ISMA 3IXQA 1NQAO 5CD1A 4YREA 3LPDA 4ARCA 1Q50A 2C9MA 4PIPA 3V55A 3C3WA 4B2LA 2HKIA 3DAOA 2QL9A 1UWLA 5ALOA 5EFOA 5LYYA 4NCAA 3M4NA 3VBEA 2OXEA 4X1KB 4RGQA 3WHLA 1TCUA 1XDZA 1NI4A 3CNHA 1C5KA 1JA9A 3B1FA 3STYA 1RFLA 3E0XA 3QBDA 2YRWA 3TPFA 2ZJ8A 1H6DA 5HZHA 2QRUA 5CCXA 1UMDB 1WCWA 2QSJA 3SSNA 3A6HA 1KEUA 3NETA 4KXQA 1P7YA 3N2GA 1NQTA 4E30A 5BV8A 4C21A 3DFIA 5JO0A 5AKIA 1NVAA 3IOMA 1TQHA 4EFLA 5KVSA 1JPVA 1E1YA 2O5CA 3KJXA 1W8DA 2VRBA 1HZZA 3BSYA 3GGCA 3W8NA 2BC9A 3B3GA 3VDMA 4TMVA 1DFHA 4QGAA 3WL5A 2VDWA 4GSYA 1Y6JA 5FLEX 1RBZA 4N5DA 5T8KA 5C8YF 2DY0A 1P91A 2QUZA 1N2OA 3QELA 2J32A 3QKTA 3HKCB 2CMDA 4YJFA 1P1IA 3QIAA 4PPFA 2OV1A 5HFAA 4BJ3A 3U7JA 2FW1A 2EHJA 1M2VB 2QR2A 3A3NA 4LTDA 2VF5X 1W87A 4EZEA 4AQYB 1H6CA 2WYVA 1QCYA 3EMBA 2OC4A 1E9DA 4IMIB 4MKZA 1JHXA 1SUEA 2QRKA 5GWXA 3L8MA 3JQ8A 1LV8A 3UK0A 3WXBA 4RQAA 3EG9B 3N8GA 3OZ7A 4ZAFA 3ZWNA 2OV2A 2YMQA 2VR1A 1CEXA 3I53A 2OHOA 4RIEA 5CB4F 5K0BA 5KBYA 4PG8A 2VXCA 1KQFA 2Z6AA 3HL0A 4H0NA 4TWJA 1ZJWA 1DZ3A 2ORYA 3MOIA 3KQWA 1EDDA 1R5BA 3GK3A 3AK4A 4UMDA 1OZGA 1KR2A 1YB5A 3E1SA 3T1NA 4A16A 5JI2E 3ASUA 4TWBA 1QIMA 3CPEA 3T35A 3E8XA 3QKRB 2RG7A 4E5PA 3ACCA 3GPDG 2D1FA 4LRXA 5KC9A 2I4LA 5G0SA 5IUKC 4EA8A 1WPGA 3PNMA 4D4KA 2B1QA 4I5FA 1GU0A 3RGWS 4TS4A 1OVMA 1RYFA 2ZREA 1BQEA 5I3CA 5JFGA 3GF4A 3OJLA 2J3DA 3OTWA 1VLVA 4OQNA 5LBTA 2WUVA 3T3EA 1VM6A 1L4BA 2FK7A 5CA1B 3G2JA 4B3DA 2OCAA 1ZOLA 5J5CA 1UBHS 1OKKD 1BX3A 3P0JA 4HX5A 3FJ1A 3RSCA 3K35A 2VPQA 3OHSX 3CLKA 4LNAA 2JLQA 3EQ8A 4NYMQ 4TL7A 3AKYA 2Z8XA 3OPQA 1TK9A 1M6VB 1OQAA 4MR8B 4H1VA 5KSOA 2JFXA 5HKAA 2HBRA 5DM0A 4LJRA 5AJUA 4IOJA 5JALA 1K7SN 1NXOA 2PT9A 2YWCA 2WC1A 2ZYHA 3ITNA 5IWAB 3PB3A 3F5QA 1FBNA 4G56A 4P36A 1E1RA 3HNOA 2GNPA 1NMSA 1YRYE 3U9LA 1R0LA 4DLNA 4UUMA 4G07A 3QFHA 3GJTA 4AVYA 4R7ZA 1V96A 2WTXA 3HJHA 1I7NA 3KWMA 4PHGA 5F7ZA 1LTKA 1GG2A 1Y0BA 2V74B 3MWYW 4BN0A 1ICIA 1YQUA 1FTYA 1C9JA 1I3CA 1UR5A 1YVEI 5LWHA 3ZXSA 1KYZA 3L01A 3KPUA 4RHTA 1NV9A 1KEZA 4GU5A 4XKJA 2VAMA 2W00A 2GERA 3SD7A 1LDEA 3W7AA 3ZEAA 2RKWA 3L92A 4U0KA 2WILA 5ICFA 1IXKA 1K7FB 3ZI0A 3J81k 4A0QA 3R3SA 4HJXA 4Y18A 5KHOC 2CXNA 3NHPA 4CF3A 4FYWA 2CXHA 3DZDA 4NNOA 2QVLA 2R6JA 5K8JB 5EIBC 4CDMA 2EU8A 1IFXA 1AS2A 3EXIA 3H8WA 3IUQA 4C04A 1O03A 2D1RA 4IKPA 4INJA 4WUVA 4CV0A 3Q8WA 2EW8A 2JKZA 4PYOA 1Z6QA 5LYJB 1SEVA 2EZUA 4UVHA 5KYWA 4U7HA 4UQPA 4GECA 3DKRA 5HR5A 3TKLA 3W05A 2HSDA 2IYPA 1M0EA 2ZS9A 3D7KA 3I9V1 1OWPA 3KZ1E 2XCUA 4OKNA 2G88A 2GM4A 1EFUA 3AR5A 2NLOA 2FZEA 4EJ2A 4QXOA 1QC5A 5CVEA 3F96A 4IBOA 3G8AA 3K0FA 4I9UA 4N49A 4YMIA 1Y5NA 3CEMA 3K0CA 5TNXA 5IULC 4JL5A 1Z73A 3A9RA 1DQSA 2AX3A 3ZV3A 2AEFA 1G5IA 3WAKA 1WKCA 2EYUA 2X5JO 3A9SA 5K8UA 4TYNA 1Q0TA 3LC7O 1J1IA 2W6ID 5AUQA 5JY1A 2ZITA 5CR9A 4BVJA 4CKYA 3IIJA 2LXNA 2PGDA 621PA 2NU9A 2G9VA 2AOWA 2XEDA 3O38A 1XMOB 1O58A 3GQBB 1H9CA 3RT7A 1K0UA 3AUAA 3UJPA 3RJZA 1OA1A 4BAUA 1TYDE 3ZHVA 3DOIA 4M7RA 2XA9A 4XCVA 1KERA 4MPRA 1I2ZA 1XIVA 4CT5A 2ODEA 4X20A 1SVWA 3T7DA 3WYAA 2BMJA 2H3HA 3C1UA 4UZFA 5BWNA 3G0OA 3TD6A 2OESA 3ZJUA 1GUYA 2REBA 5HTKA 2CNBA 3P9IA 4QXRA 3ZDFA 5LZ5A 1G2OA 2IXEA 3JQRA 4IKOA 2FUG6 2P2LA 3LIPA 1EB9A 5LQKA 3PJRA 3AEYA 4AKGA 3LMKA 5HK8A 4B48A 3DMDA 4A1FA 3LWBA 4XWAA 3RKUA 5CK5A 4OQFA 2G71A 1E63A 1WSBA 1F14A 1WPQA 3LFUA 4H9GA 4QBGB 1X8JA 4EW6A 2QENA 2YS7A 3HM9A 4ZTUB 1G8KA 1TQ2A 1VC2A 2ONJA 2PUBA 2GFHA 2RH5A 3NNSA 4C9BA 2QL6A 3WNVA 3ZW8A 3UNXA 2QTVA 3KU4A 1S3FA 4CM8B 2HK6A 2YVKA 4J4BA 4FEEA 5C7LO 2QORA 5LNK1 4P93A 2HU7A 2R00A 2IYUA 3FHOA 3SEFA 2NZJA 2Q4EA 4V0QA 4ZQEA 4QPCA 1JHRA 5EWJA 2F3UA 2CDCA 3G5TA 5EKXA 3ZVLA 3KYDA 1A77A 3P0IA 2WOOA 4BVBA 3FOEC 2PUFA 3K4QA 4PO8A 2JAPA 3EOBI 3EN0A 4CCYA 1V7PC 1TU4A 5J2UB 4TL9A 2JFGA 4Q4LA 3CB4A 2JGDA 3MJVA 2VJNA 5IRCD 1T0PA 4BKQA 2BFCA 4NEQA 4R1SA 3MBIA 4GICA 4LC1A 3KXPA 4BU0A 1LRLA 3SU8A 3G2NA 4MYCA 3CH5A 3P9KA 3W9SA 4ETMA 4TMXA 3ZK9A 2G04A 2C0PA 4X66B 2YS6A 1PFVA 2C5AA 3DMHA 2O5VA 1GUFA 4NESA 3Q8XB 3N9IA 3G79A 5TPZA 3ZWVA 3MD0A 4QPNA 4DG9A 2P77A 4TRNA 2O8EA 3E6AA 3OX2A 1XEWX 4HJRA 3HDVA 3WADA 2CXTA 3DHEA 3SICE 5HKKD 1G8HA 4DMKA 5ETJA 2JDID 2VDOB 3GJ3A 4OTZA 1D2EA 1U7TA 1ISFA 1Z4JA 2VFAA 2VJCA 2WAMA 1TIBA 3F47A 4JLAA 3TX6A 4TZKA 2FG5A 3ZWKA 3OFVA 4Q37A 5JSZA 4EHKA 4JA2A 4Q24A 2JI7A 5BSMA 4N76A 4TKLA 4DHEA 4BU1A 2BGUA 2JVJA 3RO7A 4RM3A 4B71A 3IIEA 2VKTA 3ZDBA 1BDJA 2PSSA 4F93B 1P75A 5AXCA 1QIHA 3CRVA 2WQ6A 4G5RA 5P21A 2GJ4A 3IO5A 2F4NA 4MDHA 3CURA 3PD7A 5K3BA 3QLVA 4X93A 2FSVC 1EUDA 2AOUB 5I7FA 2CXSA 2QNRA 3RWBA 1NOKA 4J90A 2WZQA 2HFJA 1JE0A 3BQ9A 2Y3IA 2IY8A 1REQA 3LDHA 2PN1A 5UKDA 1YAJA 4PNPA 3QFTA 5HCIA 3TWOA 4UPEA 3IOYA 5HDQA 1WDLA 1KWGA 5FFFA 1QLWA 1YC5A 2ZAYA 4PBRA 3AM3A 1WB6A 2FWNA 4DCOA 3WHPA 5FD8A 3LBFA 4IR7A 4B7CA 1T8RA 5TIIA 1L5QA 3IJPA 3U3RA 5A1TA 2Q21A 2IZ7A 1D4ZA 3CIFA 1QNFA 2OGZA 3UCXA 4B8ZA 4DWVA 2VP4A 2ZSDA 5ALRA 4GEKA 4RETA 5AQEA 2Y66A 4DR4B 3WB0A 3VA7A 1DJLA 1ESDA 2I6UA 2QG6A 3KO8A 3UW3A 5LOVA 5DBEX 3RSZA 4MO2A 3WYNA 4AO8A 4F12A 2WSSD 2D54A 5BMVF 3LECA 3KD3A 4ARVA 4JJFA 1IBLB 1THGA 1XAJA 3AHDA 1MB0A 3FSRA 4HDOB 4CG1A 1OX6A 4EZBA 1ODKA 3EUWA 1GU1A 3OJFA 4PM4A 5I7VA 4B3RB 1WXEA 3N05A 1VL1A 1ZCAA 1U3GA 4XUCA 4GL2A 5BV2P 2FW8A 5H81A 1SK9A 2H65A 2JANA 2JCYA 4ZA2A 5CA1A 3FCUB 1W6UA 2PSJA 4R0VA 2F8MA 3CZAA 3W6UA 3LYLA 2CV1A 5JYEA 5B37A 2V0NA 2D2FA 2YXDA 4XD7D 4PC3A 1WP9A 4IIJF 1QHSA 5KX5B 1JAIA 1VJ1A 2PPLA 4MR7B 1EX6A 5EVJA 3SKVA 2VXBA 4BEJA 2IYQA 3UXHA 2IOHA 3KZNA 4CQLB 1A9QA 3MB8A 1NW3A 1VL8A 1NBME 1RMTA 2EZTA 1JLSA 1UBTS 2GKSA 1M0SA 1SHUX 1ZCJA 4RJJA 1FX0A 2A0WA 4PX2A 3U4QB 1Y3BE 4TTQA 1I36A 1MU0A 1I3OA 2ZSBA 3I37X 4ITUA 4IXMA 2C1XA 5JPIA 1DKQA 1FSGA 1LRJA 1Q2UA 4DV7B 1TCCA 3A4NA 2ZUVA 1Q0SA 1XJWA 4LCBA 4XB6B 2ACEA 1Y6QA 3UN1A 4Q82A 2SKEA 4LY9A 4OJYA 3O91A 3NANA 2EBUA 2NO5A 3AO0B 4INZA 2AJTA 4Z2AA 3GCGA 1G66A 1GV0A 1UK8A 2WYOA 5EIAA 5K0CA 1NW5A 1URPA 4LBVA 1FYWA 5JMOA 1QR2A 4BLRA 4G25A 2VSXA 2QZZA 1O9BA 3R9KA 2PZ8A 2NGRA 4CM5A 4G4IA 1I14A 1Z33A 5KNBH 1UANA 3FWYA 4X85A 2GF0A 3A1WA 3CISA 1YIOA 5AVYA 1ZLXA 3H2GA 4C6SA 2P41A 3EZXA 5TT0A 3B38A 1X7ZB 1NI4B 2QN2A 4H7FA 2PVCA 3BIXA 3BTVA 5G2OA 4OHXA 4R3UC 2DKNA 2JEOA 2ZIUB 1Z4LA 2BH9A 2HMWA 2ZJ2A 3FWPA 3RJTA 4A26A 5KCZA 1XNHA 3GYBA 4H6PA 1HYQA 5A4AA 4TMFA 2LV8A 2BI7A 1HEUA 3GRCA 1JIKA 3H5TA 2PVPA 1RYBA 3NAZA 4FHFA 1ZJYA 3JAMA 1K3TA 4WECA 3AIIA 2VYQA 3BMXA 4TTAA 1W5EA 2CFTA 3L7YA 3L7NA 2IZ5A 3OCYA 4F4FA 1VKHA 3KVNA 4HDCA 2FSFA 4DIUA 3C7KA 4D3SA 4YWHA 1E94E 1U0RA 1RHKA 2IY7A 3LIIA 4KI0A 3U4GA 4JN6B 5A1JA 3MS2A 3UEOA 3F9RA 1TU0A 2FV8A 3VR6D 3W2GA 4WT7A 1VJGA 1ZIYA 3R0VA 1H1LB 4D9BA 4EHBA 2BGIA 3H5NA 5LC1A 4EI8A 2BWJA 1QRRA 1YCDA 2NZ8A 3QFRA 2R8XA 5JSUA 3L07A 1WCV1 1G4HA 1PR0A 4OHRA 4G23A 1FS4A 1T1JA 1OFUA 4G0OA 4D8UA 1O95C 3GT4A 2BEVA 3UZUA 4KWHA 2OSVA 2EP8A 4LDZA 4JAVC 2FMIA 3GDOA 3JV7A 4L2IA 4MJ7A 4MVJI 4N3BA 3WYDA 1CY0A 4RVNA 1XTZA 3RIYA 5JCJA 2GEUA 2Q0SA 2Q50A 1NUSA 3GLHA 2XF2A 2HRZA 4IGFA 2JB9A 4MB0A 1M6VA 4RV4A 3LUFA 3JASB 2H1IA 3FYCA 5AWFC 1UIRA 2IFTA 3FJOA 1E2PA 3WIEA 3IUPA 2X0NA 4NEGA 4LF4B 4RBNA 3EIHA 1E5LA 1N5LA 4YP1A 1YB2A 4UC0A 1OILA 2FMHA 2ZBDA 4W5JA 4XIIA 5DYIA 4AT1A 1QO0D 2VZLA 3D6TB 2J6HA 2P5SA 4HUQB 3LA8A 3LX4A 3TBKA 2M9MA 2GXUA 2QUJA 3DW3X 3LPAA 4AYTA 2J5KA 5H5JA 3U4DA 1FFGA 2GM5A 2YJ4A 1XTPA 2XRFA 1V8OA 4WI1A 1UBCA 4LZAA 4RU1A 4GD3Q 3WSVA 1JEQA 1G8PA 3ZGNA 1KQGA 1NN3A 4DANA 4ZMSA 5TR9A 4X1IA 3AU9A 5ALTA 1FFCA 4H0FA 3JZAA 1EUYA 4C4YA 2FPGA 1DINA 3CVOA 3D4NA 3KYDB 4G24A 5H70A 3DC7A 4YV0A 5C7YA 3KBOA 2O8EB 3F4BA 3TIIA 5DHPA 3EVNA 4QX6A 1RZVA 1HORA 5KNBA 3DB1A 4I55B 2X8BA 1VI5A 2COEA 1GN9A 2WU0A 3FI9A 3OI7A 3JYHA 4LYHA 1RP1A 1XF1A 4LZNA 4R84A 2NXCA 4BV3A 2WPDD 4XIJA 4EY4A 4Z4FA 1NDHA 5BWCA 1I33A 3X0DA 4XFKA 3FDZA 3UV7A 2I80A 3FPCA 2O3UA 1HY3A 4KQKA 4OSEA 5FWAA 3DGFC 3PWZA 1PYDA 4I5GA 2ZKLA 4PG6A 4B6QA 4ER6A 1CP3A 2NV2B 1PX2A 3RYIA 2A9QA 1HT1E 3V1KA 4EGFA 4EW3A 4J9UE 3TTVA 1TJ4A 2R5WA 2QPLA 1W30A 2WD9A 1G21B 4L6CA 2EKQA 4K6KA 4LWPA 5LQDA 1ENPA 1QC5B 1R3DA 2GFIA 3PKIA 1G4AE 3M4YA 2HRCA 4B6EA 3DVRX 4PAGA 4CI9A 3OQOA 5MF6A 5FULA 5T3YA 1KIFA 1AK1A 5EG5A 5HZGA 4Q5IA 4XCQA 4LRSB 1JU9A 3DHVA 3O3OB 4PSKA 1C7FA 1DJPA 5EXDA 2PX5A 4KG7A 1WHSB 2XKKA 1EXWA 2ZR0A 4FS3A 3BL8A 1A9XA 4TYMA 4JLVA 3L6CA 1OXBB 5LA6F 4DM4A 2YUTA 3BRWD 1E9EA 5CDFA 4DA4A 3PCRB 1DC7A 2FX3A 4P7BA 5ILQA 2HOQA 1DBQA 2BEUA 3MSCA 4JB8A 4RWEA 2DUWA 1XQYA 3BIJA 3QBJA 5DM60 3PE6A 5ALVA 5IKMA 3PEYA 3H97A 4HAOA 4POAA 2Q2WA 3LHDA 1C7IA 2V6JA 1B41A 3NPAA 3C4QA 4DJFC 4HH0A 4DQKA 4WKGA 1GUBA 4R81A 3GEGA 2XMRA 3DMNA 3HWX1 3Q6IA 4H4DA 1FSZA 1G19A 1FFSA 2JGJA 3F4KA 3TRIA 1HT3A 1Z8FA 3NBAA 4NPAA 4J0EA 3RS9A 4RH1A 4A82A 1BQ4A 3BHIA 1NVVQ 3VJMA 1NXTA 3ZEIA 2GLUA 1IPEA 4CM9D 5A3RA 4Y67A 3WIOA 1QXSA 1GPLA 1Y37A 3C5CA 4NJMB 3SIRA 4DNOA 4CM8A 5KU1A 2IH5A 2I99A 3T0FA 2ONCA 3BHJA 3SPXA 1P2GA 4FGZA 3W5JA 2DY1A 4DLLA 4BGDA 3UXYA 1OC2A 1XD2A 5DRTA 2PVSA 1PRYA 4HMOA 2JFYA 2GM3A 5TQ0B 3MQ2A 1A9TA 3RC1A 3RUIA 1F60A 2H3EA 1WLYA 5ESRA 1RLUA 3BTOA 3GLKA 1E0KA 3VHXB 3VX4A 4CE6A 1UMCA 2RD2A 1NF2A 2JKVA 2WJZB 2X77A 4NOMA 3K0HA 1G20E 1MC8A 3DBHA 4M89A 2QMYA 1O97D 4IJ6A 3GJ4A 3VOSA 2LZ0A 4RKQA 4MV5A 1ZA2A 1SU6A 4AF7A 4P2GA 5AW2A 3LCCA 3ZWBA 1VCNA 5ALIA 3MMSA 3EIFA 3HCEA 4CDNA 5CX1A 5L7WA 1A88A 4II3A 5JNLA 1X1TA 3AOEC 3M4XA 1FDSA 4B44A 2M98A 1Z7EA 2NTYC 3GH1A 4U7FA 1H6AA 1UQRA 1DQRA 1E98A 1A50B 4AZSA 1R4NA 2DULA 4FEYA 2ZSAA 2C4UA 4UEJA 4HWTA 1Q7BA 4GWLA 3F49S 3JX9A 1Z36A 4LE2A 4KH0A 1ZSNA 3ZH9B 4B5KA 4J1QA 1U0EA 1HRKA 2AN5A 3ZW7A 2KE5A 3MQ4A 4CCYB 4D3XA 1BX1A 1KDPA 1LUAA 3CMCO 1IWBB 4M8NE 2XNKA 1U11A 5DASA 3PQ3A 1ZK1A 5FWXB 4BVLA 5JAZA 4Q12A 4TGLA 2OP1A 3UFBA 3TLYA 4X90A 4U7DA 4YJKA 3TPZA 4A6DA 5TQVA 1ESZA 4MR9A 1C8KA 4MVJG 3DTVB 4MQMA 4C30A 1SHZA 1ZRMA 2VJOA 3ROXA 5ALSA 1SK8A 1XZFA 3KOXA 4EHIA 3OA2A 3T9FA 3HABA 3C6ZA 3DR3A 3DUFB 4Z54A 4V0NA 1MX9A 5DNEA 5IASA 2GGSA 5C5CA 2PBLA 3QVXA 1JDPA 3WQHA 3DKVA 5L3RA 5E3IA 1Y3AA 1T24A 1MT3A 2Y6UA 3D6VA 3Q4GA 4RDHA 3UMJA 5B57C 4MA0A 2IKSA 1GQ2A 1N5MA 4QYTA 2P11A 3TLGA 5FI1B 1E3JA 2DSNA 3C3PA 4P0TA 5BWMA 3KUUA 2FB9A 5KQRA 1OBCA 1ONOA 3N2ZB 1S2GA 4H1TA 3H0CA 2VTVA 5KNCD 2MIIA 1U1FA 4KR0A 2W0SA 4TTSA 4Z53A 1XL0A 4KQMA 1V39A 3JZMA 1MOPA 1QYIA 4IWNA 1DXHA 2E87A 3KLBA 5FLXA 5AW3A 2I55A 1XAHA 1W9MA 4JT2A 2HHJA 4PTZA 3ZBQA 5GINE 4M0LA 5CLIA 4JC4A 1K68A 1Z4QA 2JARA 3EYWA 3BWMA 4QYIA 3L43A 5DGCA 4I3GA 4G0VA 4Z9FA 1H2EA 2N9UA 4X71A 4YRQA 3SKXA 3USES 2D06A 2QJTA 3VDRA 1V9LA 1TAGA 1ZM4A 3A6GA 2BCGY 4YUYA 1VYTA 3CC8A 3TCNA 2I1QA 3NOQA 1WD5A 3GLGE 4IH9A 1JDUA 1GGHA 4O1MA 3UT6A 3JAWA 2B4KA 4HD8A 3H83A 3WKCA 1ECBA 5K8CA 3M6LA 4LCEA 3VSDA 4LY0A 1H2WA 2NQ8A 3LX5A 1M2EA 4PLWA 1U8YA 4XYBA 1W48A 2HU2A 2QTWB 3AL0C 5JTUA 3OM0A 2QT1A 3MILA 1GPH1 1D2GA 2FEPA 1C9KA 4HXYA 4LCJA 3HFRA 5IP5A 5E4JA 2C7GA 1A5TA 1S3GA 1NQWA 1DOZA 4OXNA 2GILA 2NG1A 3JQQA 5KREA 5D5QA 3LCRA 4CZ2A 1ONPA 2J5QA 4IXNA 1H4TA 1MABB 2FQXA 2PDAA 3T5AA 5KNDH 5KZMB 2P90A 2CC2A 2GFQA 4MARA 2OG2A 1ZH4A 4LVUA 3QMWA 1NVDA 4EL0A 1AS3A 1DIRA 3I8XA 4OGKA 4EF4A 2J3IA 3OBBA 1NFFA 2A1TS 1KBZA 1T9BA 2W2OA 3LNCA 3ND9A 4NYIQ 2PANA 1CDEA 3IHWA 1C9YA 2FWAA 3HBJA 3X2FA 1Z7WA 2I33A 2I3DA 2W2KB 3G23A 3KZVA 4G5QA 5HE8A 3RS0A 3CT6A 5DNDA 1PUIA 2N0SA 2R7NA 1PR4A 3LX8A 3RFXA 3UWDA 2Q7OE 1C9MA 1TA4A 3RNLA 2RE8A 1OX4B 3C3XA 3IULA 4JWTA 1BVHA 2UXDB 2BY4A 5K8TA 2NSDA 3LZCA 5M3BA 3TZEA 4ZDIA 3HXQA 3MJRA 3ZD7A 3SDBA 1VSUA 1OAOC 3TNYA 2OV4A 3GJSA 2FUCA 1MR3F 2UVPA 5AK0A 2IYSA 3RFFA 2XVMA 2AGVA 4MKFA 4GKJB 2A5YB 1Z47A 3OPVA 4UDNA 5FNZA 9LDTA 2KMLA 5JDIA 5JMPA 3QOYA 2AN4A 4LTNA 3TTSA 2HQ1A 2IHYA 1JKIA 1HDZA 1MO5A 3IEPA 2B4RO 3G88A 4MVXA 4BLQA 4DG5A 1PGJA 3S68A 3QEJA 1GT6A 1JDBC 5FTJA 3BHMA 5IKPA 1L5RA 3E3OA 2ORWA 1FC0A 3CX3A 1E1NA 3HN6A 4H35A 2J3JA 4EKIA 5KQLA