1K5GA

Crystal structure of ran-gdp-alfx-ranbp1-rangap complex
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
206
structure length
206
Chain Sequence
QVQFKLVLVGDGGTGKTTFVKRHLTGEFEKKYVATLGVEVHPLVFHTNRGPIKFNVWDTAGQEKFGGLRDGYYIQAQCAIIMFDVTSRVTYKNVPNWHRDLVRVCENIPIVLCGNKVDIKDRKVKAKSIVFHRKKNLQYYDISAKSNYNFEKPFLWLARKLIGDPNLEFVAMPALAPPEVVMDPALAAQYEHDLEVAQTTALPDED
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title RanGAP mediates GTP hydrolysis without an arginine finger.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein/signaling activator
molecule keywords GTP-binding nuclear protein RAN
total genus 56
structure length 206
sequence length 206
chains with identical sequence D, G, J
ec nomenclature
pdb deposition date 2001-10-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1k5gA00
2GHIA 4EPYA 2KBEA 3N5CA 4HB2A 1AGRA 3UKDA 1VCIA 1NLYA 4PHFA 5GADl 3AVUA 4I4LA 5EE0A 2GBLC 3B6EA 2FE4A 5DO9A 2ZR9A 4Z1MD 5CB6A 2CK3D 5CYPA 2QP9X 3CZQA 1BYIA 1II0A 4N0DA 5JECA 4HB3A 4E22A 3EPHA 1RC8A 3QXSA 3I5XA 1ETUA 2P67A 4FMDB 2OLJA 1ZM3A 1P3JA 1TF5A 2IEYA 3KL4A 2BM1A 2IL1A 3WY9A 1NIJA 1ZJ6A 2XSZA 4L5BA 2IX3A 3AH8A 4HZUB 4BFUA 1E0AA 4Q4LA 5DGXA 4Z54A 5JSZA 2NIPA 4OI0A 1AKYA 1ZP6A 1IXRC 3IILA 2BMDA 2GF0A 3M4YA 4JVNA 4P3YA 4XVRA 1VHTA 1IONA 1GIAA 4BWYA 4D6PA 2C96A 4B44A 1CJMA 3GFPA 4PPGA 1SVWA 2B8WA 1M7GA 2JATA 1NN0A 1SHZA 2R9VA 3QUSA 4TYPA 4URXR 2JLQA 4B32A 2WMOB 4M53A 5GJVC 3TQCA 4LHVA 4FWIB 1OIXA 4FMCF 3B1ZA 2FNAA 4FCVA 4JL5A 4TYWA 3EARA 1DAFA 4URVR 3RSOA 4ASUA 2C2HA 4FCWA 5D3QA 2D7CA 2OCYC 1YVDA 2YZ2A 5HZKA 1W0KD 4NYJQ 1F5NA 4AURA 2F55A 1LTQA 3JZMA 1XJQA 3RC3A 4QJ4A 4MRNA 1AQUA 2V7QD 4PC7A 4V03A 3PG5A 3GLFA 1XMJA 4K46A 1XEXB 4C0SA 2X77A 3T12A 3MRSA 2A5JA 3MWLA 1V43A 2AWNA 3AVQA 1UADA 1Z63A 4Q7LA 2FX3A 4EPVA 1MABB 4G5SA 4H1VA 4BECA 1R4AA 2GCNA 3CWZA 4BFXA 3RWOA 3G0HA 3Q72A 2RGBA 5EUMA 4D2IA 1OIVA 5TB5A 4LGMA 3FHOA 3GLHA 4Q48A 4XVQA 2OG2A 5F98A 1E2HA 4UNRA 1DAKA 1LW7A 2W0SA 2ZUBA 2P6RA 2DWOA 2C9CA 2IEZA 2VSXA 5JS7A 1G5PA 3EWSA 2CLSA 4POAA 1OXUA 3LDAA 2ZIAA 3WYAA 5C4MA 4CGZA 1RJ9B 1W0KA 3U7EB 4BGDA 2YHSA 1AKEA 2QAGC 2ZSFA 3TVDA 1XJ0A 4NYMR 1KAGA 4JBXA 1ESNA 1KAOA 1KTVA 3GLFB 4NONA 1C9KA 1JBKA 4DLSA 4CYMA 3CIOA 1N0WA 2HCJB 3KQNA 4AY2A 1A5TA 4M21A 4Q4HB 1BS1A 2R6CA 4KFSA 1M1YE 3I4LA 4ZI2A 2FWRA 4NE2A 1AJEA 2P6NA 5E7MA 4TLDA 3DKVA 4HAUA 4US1R 4IKEA 2BWJA 4QHSA 2CEAA 2JIZD 3G82C 4GOKA 2VP6A 2R8RA 1W44A 3GLHB 2JDID 2VA8A 4FMCB 2QUZA 1SHKA 2ORWA 3RRYA 1Z6TA 2BCJQ 3FKSA 4OI2A 1Q12A 3BOSA 1T9HA 2PCLA 5AUPB 2D7DA 3UWOA 4M8NE 2N1BA 3EC1A 1EFRD 2WSMA 2ZRLA 3QPWA 4HATA 4IOLA 1KI9A 1RE0A 1XEFA 4XJXA 3NKVA 2XXAB 4MYTA 1GAJA 5BN3A 2CXXA 2OBMA 3D8BA 5B64A 3CO5A 3PEWA 3LVRE 6Q21A 1WXQA 4BFZA 1ZD8A 2JLUA 4QM6A 1PUIA 4LJYA 5JHGB 2PZGA 1G6HA 4AIIA 5FOSA 4DCTA 2O8BA 2F6RA 1T0JB 4OHZA 3OHMA 1VYVA 3SZRA 1F2UA 1E4YA 4A92A 3ADCA 4RSGA 4LY6A 5CDFE 3SI7A 3VR1A 4N1AA 3VHXA 1US8B 4KCGA 1G41A 1DE0A 4OHXA 4XSHA 3RS7A 2DR3A 2ZI9A 4KO8A 4OQMA 5TARA 1T8TA 4OJQA 1NMZA 1GFIA 3B1XA 4MQBA 3K9GA 3QEJA 4OBEA 1P75A 1DADA 4EFLA 1TX4B 3D7MA 3L0PA 3LAWA 2NPFA 4KV9A 2AN9A 2QMOA 2W6JA 4EPWA 3IHLA 8OHMA 5K8UA 1Z29A 2ZUDA 2VP9A 3NEYA 4BFTA 2CCGA 2RHMA 1UBFA 2ODBA 2VBCA 3B7GA 3QBTA 4C0BA 2GKSA 4YMVA 1IN8A 1ZUNB 1E3MA 5KYKA 2MMCA 1EESA 3EZ7A 1E4VA 4M9XA 2JASA 3OFND 1JNYA 3LXXA 5KHOC 4U7DA 1J70A 2XZLA 1U0JA 4B76A 1G5RA 4CW7A 2O8DA 3WP0A 3TW8B 4LPKA 4A9AA 1EWRA 2GJ8A 2J3EA 2JLXA 1W47A 2NOAA 4URUR 5EXSA 3OIVA 1E2DA 1II9A 2YWHA 1M34E 3AF3A 1CEEA 5BYJA 2JLSA 3OZXA 5FFMA 1Z0DA 1FL9A 3R7WB 4KAXA 4DUGD 4I81A 1DARA 3IQWA 4D4MA 1UF9A 4QL3A 4TMVA 1E1RA 1TQ6A 4D4KA 1U0HC 3BWDD 4TQ9A 2IUUA 3MUFA 2JEOA 2FFQA 1S9DA 2R6GA 1M7HA 1P9RA 4P4SB 2QGZA 2WTUA 3DPUA 4QRHA 4JL8A 2ZREA 3UMRA 3EZFA 3FHTA 2ZYTX 4Q9IA 5CIWA 1S1CA 2ZU0C 3LFUA 3NWJA 5FR2A 1TUEA 4E5UA 3KXIA 1NG1A 1GP2A 4YXWD 1ZCBA 1P5ZB 3SDZA 3THXA 1KK0A 2Q3HA 3T5GA 3KQUA 2WJHA 4QM7A 1Q3TA 3CB4A 1KOFA 2DFKB 1KO7A 2WWXA 2XNDA 1CR2A 3EIHA 2QE7D 3LQRA 3RS0A 1ZUIA 2GXUA 2OXRA 4ON9A 3FWYA 3QVVA 1N5KA 2F1JA 1KSJA 1NBME 3DKPA 4PO8A 4B33A 1H8HD 4MRSA 4IFBA 1D9ZA 2EWWA 4DCNA 5KDDA 4DLUA 1HE1C 3I61A 2O8DB 2NG1A 4C2UA 1MABA 1GG2A 5FBRB 3WXMA 3F0TA 1E2KA 1TAGA 4DRZA 4KFTA 4XSGA 1Q21A 2J5XA 5EUQB 4ARZA 4AKGA 3A58B 4B6FA 3FKQA 5JWOA 4Q21A 1G7SA 3IO3A 4GZLA 2WKRA 3SYLA 4DDWA 5C46F 3FYHA 5L3SB 4RCYA 3MWJA 5K8TA 2QPAA 4GT1A 1NBMD 1QVAA 2J45A 3R9IA 4OHWA 4ITRC 5B58C 4NYIR 3PEUA 3V4RA 3OESA 4MDEA 2J59A 1Z3IX 2HV8A 3MSXA 3LXRA 2Z4SA 4IOJA 1D6JA 1G7TA 2YOFA 3CH5A 1SKYB 3R20A 1E2MA 3B5JA 1YZNA 4XD7D 4L9SA 2AWOA 5BWMA 1E2FA 4LUCA 4XWKA 3QJYA 2ZM5A 4PHTA 3BB3A 2X8AA 5BN5A 1TMKA 1E6CA 821PA 1T4GA 4BEJA 4Q1DA 2RB4A 2Q9BA 3P4YA 3TRFA 1GVNB 5KTYA 2FSGA 4QOSA 5C1BA 2D2EA 1VG9B 2ZS7A 3A8TA 2BVNA 1Z0JA 3PR1A 1MV5A 1L2TA 2XZPA 2ZRHA 4DJTA 2N46A 2WHXA 4H9GA 5L3RA 2IYWA 3GQBA 1G8GA 4MGZR 2W2TA 5G41A 4ESHA 2WWGA 5EXTA 3HPQA 3LBIA 1R5BA 5JZVA 4JLOA 1M74A 1NVUQ 3AVXA 5FR1A 1AIPA 3AVYA 3CPEA 5EE1A 1D2NA 2HUPA 3BAFA 1PLLA 3FMIA 4WAUA 3RRMA 2J0UA 1KI1A 1ZAKA 4LWZA 4Q4AB 4AYTA 2FU5C 4PSKA 4Z8YA 3RS2A 3CF2A 1COWD 3C4JA 3VKHA 3KB2A 1SVIA 4OK3A 2ZR7A 4XH9B 4I1OA 5FTJA 4ZIRB 2LKDA 2WOOA 3UG6A 3AQ4A 2QNRA 3U3MA 1XPUA 2R44A 1NL3A 2GCOB 2QRZA 2IBMA 1U2RA 4LJ6A 4LV5B 5A5GA 4UJ3A 1K6MA 2QP4A 1E9BA 4ZPXA 2FF7A 4U5XA 1KKMA 3U44B 3CM0A 3HYRA 4JLMA 2ZYUX 1QHNA 4B75A 3AGPA 3QSYA 2FEMA 3PEYA 2OESA 2O8CB 421PA 2P5SA 1U94A 1XZQA 2V55B 2BKEA 2P6UA 1JAHA 1XMSA 4V0NA 3AM1A 3B13B 5FOUA 5HCNA 3D31A 3R9XA 2Z4RA 3ADBA 3HPRA 1E2PA 2PT5A 3FKSD 2NMVA 5FOVA 5DLQC 2WAXA 2W2XA 1Q1EA 4LOAA 1I2DA 2FEOA 2QZ4A 3ZD6A 4Q1AA 1QG2A 1N5IA 3EAQA 4J0QA 4JBWA 3UATA 1U9IA 3KJHA 3UPUA 1KKLA 4ZIRA 3DZDA 2CHVA 1EWQA 4FI3C 4W7SA 3A1UA 1ZNYA 1S1MA 3EIQA 1S3SA 2OCPA 4A8JC 2QTHA 1G3RA 2O0KA 3ICQB 1W5TA 1DVRA 1U0LA 3KXKA 5KSPA 2F3TA 1RW4A 4BRWA 4X8HA 1SZPA 5FBQB 4TZ6A 4DUGA 2RH5A 4DSNA 4MH0R 1KMHB 1ESMA 3QPVA 2WIAA 5KUTA 4RFVA 2JA1A 5HE9A 1B0UA 2QMHA 1OXXK 4TSFD 2WOJA 4BLPA 2QAGA 1IN4A 1WQ1R 3GLIE 3K1JA 1CJUC 4LJ5A 2J41A 2OEPA 2XSZD 4KJZA 4ZO4A 3PV0A 3U7HB 3AVVA 3AV0B 4B2LA 2J9RA 4BLQA 3P27A 2VP2A 1JI0A 2G88A 4JJZA 3RRNA 5HPYB 1E0SA 1FNNA 5JI3E 1E9FA 2CJWA 4G5RA 3U60B 3RS3A 4EJSA 1GNRA 1BMFD 2BKUA 4Q9JA 2ATVA 2OILA 2ZJBA 1OXTA 5J5CA 1VYUA 1TNDA 3RANA 1OYYA 1YZTA 1KSGA 4AG5A 2K5UA 2CLCX 2H16A 1T8UA 5HKKD 1OW3B 4OK6A 4PTLA 2BJWA 1V5WA 1HH4A 4LYAA 4PAOA 2W83A 2QAGB 3AF2A 3M0EA 4FCTA 4US2R 4CEJA 1GUAA 4JKYA 1GITA 4YMUA 5JCZA 2CVHA 1ZM4A 4KITB 1N6HA 5L3QA 5JMTA 5CK5A 4MKGA 3BBPA 2MSCB 2A5GA 3WHKA 2LCFA 2V6IA 4URYR 4V0KA 1PVOA 3AP1A 1G18A 1HT1E 2OLKA 4B2PA 2P5TB 3JZAA 5B30A 3LW8A 2GCPA 4AD8A 4DCSA 5AR1A 3A37A 2B7CA 1TU3A 1Z0AA 4KI0A 4TTRA 2ZTSA 4D4JA 3PJRA 5F2EA 3K9LA 2D4HA 4R2IA 4HAYA 2GJ9A 3C5HA 1WRBA 4TMWA 1NRJB 1AS2A 2H92A 4OHVA 4M1MA 2PT7A 1QHYA 4EDHA 1JEEA 4ZCLA 2QPTA 3GLIA 2YKGA 1EFUA 221PA 4G5GA 5F3WB 3TSWA 3VNUA 4G5OA 4MKIA 1QHHA 3EXAA 4TN1A 1J90A 3T34A 4HEJA 2YC2C 5H70A 4YXWA 1G4UR 2EFGA 2WICA 2BC9A 3PCRB 2X1VA 1KO1A 4JYBA 2OT3B 2P0EA 4NTZA 5M04A 1QRAA 2HT1A 3TUZC 3AF0A 2IUTA 1KZ7B 3K0AB 4MRRA 2ZSEA 1NG9A 5F9HA 2GCOA 3HU2A 3VR2A 3ZVMA 2ZITA 1XXHA 4I1VA 4RKEA 2GRJA 2QM7A 3IHWA 4NBSA 3ZS8A 2G3YA 2BBOA 2QA5A 3ZZUA 4HUTA 4TMTA 2HLDD 1KSHA 1CR1A 1PJRA 2H1LA 1DELA 3CPHA 3I8XA 1RRCA 3GLGB 4Q1EA 3U7FB 5DI3B 3TUIC 4LV6A 3R8CA 2BM0A 3U4QA 3H4MA 3WYGA 1GKYA 2NGRA 2IW3A 4B34A 4B3GA 3QOFA 5FTMA 1OJLA 4AKIA 3OF5A 2N42A 1HTWA 1ZC4A 3U61B 2HXSA 1GZSA 3BB1A 4PHHA 2ZRFA 1NMXA 3EC2A 4GMDA 4P32A 1U99A 2VSFA 3I73A 3OIYA 1GTVA 3HDTA 4WZBE 3VR4A 1E1QD 3PQCA 2O8CA 1AZTA 4W5JA 4YDSA 4B47A 3B1VA 4L16A 2NO7A 3KXLA 4EPRA 1W4AA 1DAIA 1JXMA 3FVQA 3I92A 4A15A 4Q5IA 1W2GA 521PA 3KFXA 3ND8A 3SYKA 1K5GA 4PPFA 2JLYA 2XOKD 1T3SA 2MMGA 1S0UA 1G8HA 2A5FA 5DE3A 3WMEA 1E79D 4IDPA 4MGKR 1HQYE 2NTYC 4A82A 3NG1A 3PUXA 4BLRA 1H8ED 1KJWA 1DTSA 2OBNA 3TW4A 3IQXA 2V3CC 2OO7A 3QKTA 4C7OA 4P4TA 5DSZA 1HY3A 1FTNA 1NP6A 1SXJE 1R7RA 1U9IC 5JJLA 3V4FA 2CE2X 2OAP1 4F4IA 2PX3A 2ZRAA 1XD2B 2QP3A 3EZ6A 4FMDF 4PC3A 3Q85A 2GZDA 4OQLA 2BEJA 3MAAC 1VCOA 1A7JA 4NYIQ 1W36D 1EFTA 1FFHA 1CTQA 1DAMA 4TLEA 4KYIB 2ZE6A 2VEDA 1UJ2A 5IK2D 3W6OA 1I2MA 5AJWA 1KY2A 3VR6A 4GP7A 3TE6A 1D9XA 1KYIA 4D4LA 2OFOA 1EFRA 4BZXA 2C04A 1KZGB 1VECA 2CE7A 4V0LA 1OKKD 1PUJA 3L8YA 4LJ7A 1MO4A 3Q7QA 2ERYA 4HAVA 2QT1A 2CL7X 5CM8B 3KJGA 4OQNA 4QJ5A 2V1XA 2W0MA 3NHAA 2AXNA 4ACBA 4RD1A 4IDOA 2CHGA 2NZJA 3THOA 3Q3JB 3Q5EA 121PA 3RS4A 2PJZA 3CR7A 1BYUA 3KTAB 4TMKA 1XPOA 3LQQA 4MRPA 5ANRB 1NSFA 5G3ZA 1SKYE 2F9LA 2MSEB 4DBLC 1JPNA 1L8QA 1RRPA 2D62A 1N6KA 2QMUA 2QMEA 1NN3A 1S4QA 3ZGXA 1ZIOA 2AHOA 4CRWB 1XMIA 1JQLB 1M8PA 4QGFA 4YONB 4PFSA 4LCBA 2VHQA 2OCAA 2ZI6A 2A5DA 1MR3F 4NKRA 4BEBA 4PZYA 4CVNA 5FPSA 2DWPA 4PQYA 2ZEJA 3G5UA 2ATXA 2WVJA 3BERA 5CIQA 3T5DA 3GP8A 2GEVA 2FSHA 2Q0HA 1FUUA 4WVFA 1P4SA 4WA7A 2VF7A 4GOXA 5AJXA 2IYSA 1T91A 1ZNXA 4C9BA 3IPYA 2DBYA 4TL6A 1G8FA 2BBTA 1XF9A 2YINC 1TF2A 2A3RA 1Z0FA 3GJ8A 1NVVQ 1PZNA 3OE7D 1QHHB 1VTKA 1GRQA 4M1YA 1OV4A 4Q4JB 3AUXA 2VL7A 4CZ2A 2C5LA 1F6BA 2GEDA 3W90A 5J4KA 2QU8A 1W48A 2GJAA 3HP1A 4BFYA 1W7AA 4EIWA 5JWRA 2I4IA 3IBGA 1N0VC 1XMVA 3LWNA 4C0QC 4LYHA 3RYTC 3MG9A 2J7PA 4GSYA 1KO8A 1TPZA 4EQ6B 4LYFA 4FWTA 4DKXA 2BCGY 1A82A 3C7KA 2OZEA 3ZVRA 2R65A 4CT5A 1IN6A 3CLVA 4TT3A 3KDSE 4W5WA 2GZAA 4QBIA 1ZC3A 3OEHD 3NC1C 3TAUA 5FPKA 1P9WA 1ZM2A 1P62B 2EQBA 3ZJYA 2VP5A 3OIWA 4X8OA 3ZIAD 5JEDA 4Q00A 2D06A 4AG6A 2PX0A 3EG5A 3FGNA 4OI1A 3LX8A 4RD2A 3W5IA 5GJWC 3ONWA 2J0VA 1OLOA 4L4UA 2RGGA 4LBYA 1CRPA 3VX3A 2CJWB 1G16A 1N6IA 2QN6A 4MUBA 1Z83A 5GVSA 3IEVA 1JR6A 2FSIA 3IKJA 3LLMA 4OYHA 4Q4JA 4OJKA 5FBVB 1IQPA 4NCHA 3ETLA 3WBKA 1DPFA 3SC3A 5K8LA 3SJCA 2IWHA 3CX7A 4NMMA 3B78A 4Q01A 3SBDA 1XD9A 4PZLA 4EJSB 2JLVA 3MJRA 5BW8A 3DHWC 1Z47A 4JLVA 1X6VA 1G1MA 1E2NA 2EW1A 2IYTA 2IC5A 1KNXA 4G1UC 4PC1A 2OAQ1 1GL7A 1NIPA 1E79A 2BBWA 1FTSA 4JLPA 3ASZA 1NLZA 1UKYA 1IJFA 2H7VA 4M1SA 1HV8A 3E1SA 4NHOA 4C0LA 3ZD7A 5AUQA 1G19A 2G77B 2XB4A 2IT1A 1W36B 4GP6A 3NHBA 2C8VA 2RGEA 2QSYA 1HURA 2F1RA 2PBRA 3VMFA 4R7ZA 1YZLA 1II8B 2PL3A 2PZFA 3K8YA 1IM2A 2OUKA 1YHNA 3UWKA 4P4UA 1KDTA 3KKOA 1UDXA 2WKPA 1U98A 4IHQA 2V4ZA 3EA0A 2YWEA 1R0ZA 1E2LA 5E3HA 2ZJ2A 1NSTA 721PA 3WNDA 2JAQA 1T3HA 1YR7A 2KJQA 2QE7A 3SQWA 2VIIA 1KSFX 2ZRMA 1O3YA 3ECCA 3PXGA 3CPJB 5AJVB 1N5JA 4Q7MB 3NBXX 1KO4A 1COWA 1XPRA 2D2FA 4RD6A 1VMAA 1JR3E 2YNMA 4JL6A 2W2VA 5J4YA 1Q20A 3GEIA 1JR3A 2QTFA 2UZ3A 4CIDA 1VPLA 4Q7JB 3ZVNA 2IYRA 3NTUA 1GDDA 4XVUA 1X8LA 4IVPA 3W9YA 3K53A 2ERXA 3BC1A 1E9AA 5BN4A 3A1TA 4MYHA 4A0FA 4XWAA 1AQYA 4HDCA 3HYTA 2PLFA 3B9QA 3OEED 1OB5A 1X8KA 1ZNWA 2ZAMA 4DSUA 3IDQA 1RPZA 1WBDA 3B82A 5HCIA 2EYQA 4DDUA 2WWHA 1M2OB 4WXPA 3ZQJA 4JS0A 3NIBA 3A6PC 3GLGE 2Q9AA 4KBGA 3TR0A 3E70C 3PUZA 2WWWA 1UKVY 1DBSA 4KFUA 3W8RA 4RFSB 2VO1A 3AP2A 3SOPA 1XD8A 1FNMA 3P20A 3QKSA 4D25A 3U3KA 2W6ID 1OE0A 2QEQA 1KJZA 1Y3AA 5EP2A 1ELOA 4HAZA 1UBEA 1NVXQ 1UBCA 2JJ2A 2JLRA 2V8OA 1AGPA 4RD4A 5JRZA 1RIFA 3RHFA 3RSLA 4B3XA 4ZI3A 5JJKA 2FFBA 3QNUA 5KOYA 3BK7A 2F1HA 4PZZA 4QBGB 1CKEA 2YC4C 2R6DA 1ZU5A 3K0EA 5SZJA 1CU1A 3CF6R 4HDQB 1GKIA 4C0AC 3DM9B 1FPMA 4QHYA 4YC7A 1SKQA 3WYFA 3KQLA 3KUCA 1M6NA 2F7SA 3ZYCA 3NDBB 2RHDA 4B73A 1PV4A 3QKUA 4DSTA 4O25A 3NH6A 1MO6A 3WMGA 3OIUA 1DS6A 1B23P 3GMTA 3EX7C 2XXAA 1TEVA 3SQXA 3CH4B 4YLGA 4HYYA 3TBKA 4HZIA 4IOKA 3BXZA 2ODEA 4KSBA 2O8FB 1E1QA 2ZRBA 3QI2A 1VKJA 3QG1A 4O3MA 4JIMA 2H18A 1FMJA 3BD9A 4TYQA 2Z6VA 5KNDA 1MKYA 1C4OA 1FX0A 1N6OA 1XEWY 4ZDJA 1DEKA 4B74A 4LHXA 3C14C 4HLQB 4TT3D 1Y63A 4EQ6A 3L2OB 4L9WA 2ZSBA 4GDFA 1NKTA 1DAGA 3UIEA 4LJ4A 2REBA 2QM8A 4DCUA 5CITA 3K0SA 1OH7A 1KDRA 4JVMA 3RRZA 5CLLA 2BMJA 3QXHA 1XJCA 2WJJA 4D0NA 1YRBA 1E69A 1OH8A 2A9KA 3KQHA 4FN5A 3CUEF 4HLUA 1Q1QA 5UKDA 1MH1A 2OSBA 4R9UC 1TF7A 3Q7PA 3T35A 4IXMA 2RGAA 1LV7A 4PAQA 3FPAA 1LFDB 3JVUA 3N2IA 4TTPA 5LBIA 3B1YA 4DLTA 5J47A 3RNLA 4HUQB 2C98A 3RWMB 3K09C 4M2LA 5JHHB 1O87A 3CNNA 4QG7A 2AKYA 2FPMA 1JXOA 1JQJC 3S1AA 1UAAA 4G5QA 1E9CA 2BIFA 5FL7A 3BIFA 1GL9B 4Q7KA 1R10A 1E9DA 4QKQA 2YV5A 1BOFA 3RVBA 4GL2A 2RGXA 2L0XA 1Q1ZA 2OBLA 3LV8A 2GAOA 4OL0A 2Q3FA 1VG1A 1W4RA 4OQFA 1CLUA 4LBZA 4ASUD 2NO0A 4D81A 4KODA 3FMOB 3O8BA 2ZQ5A 3AKEA 1UEIA 1XEXA 3Q9LA 3QPUA 2JJ2D 2G6BA 2GDJA 4II7A 4R98A 3EZ2A 4B3FX 2CMKA 2ZRIA 2ZRCA 2PMDA 3O8CA 4ZKDA 2CNWD 4CEJB 1YR8A 2ZRKA 3GJXC 1Z6YA 2YJTD 2FFHA 4M9ZA 1WB9A 1P2VA 1IXSB 1CBUA 1SVKA 4FIDA 2IYLD 1NI3A 3BJIC 3MJHA 4TWZA 1LS1A 2H8KA 4ILEA 4NL4H 1RVDA 2QSZA 1BIFA 1OB2A 2ZJAA 4MRVA 4HUQA 1JJVA 2VQSA 4JLKA 3U6KA 3CRW1 1AS0A 3L82B 3EW9A 2EFDB 4AC9A 4G0NA 4JKIA 3EA5A 1GNPA 4PC6A 4E09A 4W9MC 4NCKA 1VDZA 2F1IA 2SHKA 4DZZA 4TL8A 2C9OA 2CK3A 3PFIA 4DWJA 4KXFB 3TMKA 3AVWA 5JI2E 1A1VA 1E9RA 2XITA 3B85A 2YYZA 5FI0B 2CLDX 2ZRJA 4F4JA 2WZQA 3AB3A 5KNBA 3K0FB 4A1FA 4UNNA 1W0JA 4V0MA 3VNVA 4DCVA 4ERNA 5AUOB 5G53C 3DOFA 1XDBA 1E98A 1SVOA 1WBBA 2OE2A 3X1WA 5KSOA 4LK2A 3TK1A 5EZ6B 5EJEA 2IWRA 1VG0B 1ZUHA 1XD2A 2E9SA 3GD7A 4ZCIA 1D5CA 1IJEA 1ZMXA 5TDHA 1XTRA 4BLTA 4Q66C 1US8A 1GRRA 4Q9HA 2AR7A 4URZR 2ZJ5A 4NCNA 3CRVA 1F2UB 1Z5ZA 4LV8B 1J8MF 3RS5A 4ARZB 5GJBA 2GWHA 2VHTA 2DWQA 2W6IA 2DB3A 2GTPA 1E2JA 1U8ZA 3QBVA 1P60A 2E1RA 2GXQA 2WSSD 4MUAA 3C15C 1R5OA 1Z0IA 3LA6A 4DEXA 3GJ4A 1TADA 3GJ6A 5BQ5A 4M1TA 5GVRA 3H0KA 3BH6A 3LRPA 4QFMA 2QT0A 3SBEA 4HLCA 2J0SA 1EGAA 1GNQA 2RGNC 5C2JB 4RKFA 2IYXA 5JJIA 5DH9A 2FPKA 2RGNA 2CCJA 1EXMA 3X1DA 2J87A 1E2QA 2JJ8A 1E2EA 1UEJA 2CCKA 2DFNA 4PQRA 3WMFA 4B6EA 2VYFA 2GK7A 3QKRA 2RGCA 1R5NA 2AFIE 4UNPA 2P2LA 3J81k 2GILA 2HYIC 3VX4A 4BQSA 5DI3A 4Q9KA 5KPDA 1CR0A 4Y0AA 4OQXA 4DC9A 1VG8A 3F5FA 1KMHA 2Q3MA 2ZU6A 5J40A 1ZM7A 2NQ2C 2QG6A 3EPJA 4IDHA 2GEUA 4IVQA 2FPLA 1EX6A 3K0FA 4A6PA 3T61A 2D3WA 1JAIA 1IHUA 5D3MA 2WMNB 1YQTA 3MWKA 2F3RA 4AYXA 1RJ9A 4HB0A 2V1UA 2JCSA 1AM4D 1ZBDA 2O0JA 2YWFA 1MRNA 1QBKC 2V6JA 2WV9A 4QNMA 4EAQA 3PIRA 5EZ5A 2AXPA 4B35A 4BASA 1U81A 4PO1A 4UXHA 4ESVA 1WE2A 1HE8B 4WZ6A 1Q57A 3S1AB 2V7QA 4A2WA 3THYB 4JZKA 4UXJA 1QZXA 4PAMA 3VAAA 3RC8A 3ZZ0A 3QF4B 5FH9A 4QNRA 4C3ZA 4MGIR 2BOVA 1OF1A 2EFHB 3SJBA 3DEFA 3CKLA 2G83A 1E0JA 2JGNA 3REFA 1LVGA 1VIAA 2ASEA 1Q3HA 4GMXA 1N2CE 1ZU4A 1J99A 5EE5B 5C18A 621PA 1OFUX 2YVUA 4CEHB 1H8EA 3SN6A 4GZMA 2JJ1A 1TEXA 1L4UA 1C1YA 2C99A 2DHRA 1KO5A 2F43A 2IHYA 4PSVA 4QC2A 3WBJA 2AK2A 1KY3A 1RRGA 1CULC 2EU8A 5E95A 1RKBA 1SVSA 4C0HA 4QBFA 2UKDA 2AFHE 2CL6X 4PANA 2J0QA 2GVZC 2OM2A 3CWQA 2A78A 3DM5A 2WJYA 2ZJOA 3LO5A 1WCV1 4CDGA 1QF9A 2EFEB 3I5YA 4C0JA 2O8EA 2WWFA 3I1FA 5TY0A 1NKSA 1KHTA 1DO0A 2GJSA 4M1KA 4EKDA 4DDVA 4S35A 4LI0A 2HYDA 2HJGA 1A2KC 1RYFA 2XNSA 2BV3A 4F7WA 3CX8A 2JDIA 2JIZA 3DMDA 3H2YA 1ZD9A 2FG5A 2QY9A 4TSFA 5FUXA 1N6NA 5J4HA 1XTJA 4XTCS 1L4YA 4MKHA 4U00A 3I62A 2KWIA 4GFDA 3EPLA 3GJ3A 4JLBA 2R2AA 2BMFA 3I3SR 4GBMA 2GVDC 3ASYA 4GNKA 2NPIA 2G1JA 2ZJZA 3KJEA 4F93B 4DSOA 2PZEA 3QY0A 1H8HA 4A2PA 4UKDA 1SGWA 1TQ2A 3LBNA 4TLBA 1M7BA 1VYTA 5P21A 1N3BA 2GXSA 1KI3A 1G9XA 3TAHA 1CJVC 5DIFA 2G0TA 4JT4A 2O8EB 4HLUC 3B60A 1R2QA 1XNJA 4FXPA 1T5IA 4Z51A 4I1UA 1SXJC 3C41J 3N2EA 3TIFA 3NH9A 1Z06A 3GLGA 3KB1A 3A4LA 4PPNA 1IAQA 2HCBA 4D0GA 2GETA 1W5SA 3SJAA 4ZDKA 3K70D 2QBYA 3LD9A 2Z0MA 3U4QB 1NVWQ 1T5LA 2WIBA 5EE9A 3I32A 3WNCA 1P2SA 3H84A 3OEHA 3U3OA 3PITA 3R7WA 4JMPA 5LB2A 1WDTA 2OCBA 1OSNA 3C8UA 3W3AA 3U2QA 2HEIA 4EPXA 1LF5A 3VQTA 1XFAA 4F38A 5L3VA 1N6PA 1ZVQA 2C95A 3AKDA 3U3RA 2CL0X 5J4LA 1G6OA 1XRJA 4A2QA 4DXAA 2VP0A 2ZE5A 3BFXA 1R0WA 2XGJA 4BZPA 3TGPA 1E2IA 5TV2A 2VRWA 3C16C 4EUNA 3X1YA 1Z8FA 3OE7A 4HI0E 1BO6A 4KFRA 4O2RA 2WWIA 1OKKA 2PMKA 4M9QA 1ZYUA 4X8LA 3SE0A 3P1JA 3U3JA 2I1QA 4UJ5A 2DFLA 2ODNA 4C2TA 1YZKA 4A8JB 5C4GB 4KU4A 2FGJA 5D3MB 5AWFC 1E0KA 3TNFA 3NC0C 3KKQA 3AUYA 2AD5A 4PX9A 3SJZA 3W34A 2IF0A 4V0OA 1YR9A 3GFOA 4PC2A 1P6XA 2ZSAA 2IXGA 5SZIA 1YJ5A 1EG7A 3LVQE 4P31A 3GCGA 4N0EA 4AKEA 1KGDA 4PPQA 2ZVQX 4Q19A 4B3CA 4PR0A 3RABA 2P65A 3K0CC 4C0KA 3GLFE 4IXNA 1P73A 4OKSA 1KK1A 2Z43A 3BFKA 3TQFA 1NY6A 4BFVA 5HR5A 2GBLA 3GFTA 3NBFA 1YKSA 4US0R 1YZQA 5IRCD 5HZHA 1XTKA 2Q6TA 1TQDA 1X8JA 5EP1A 5F9FA 5L3SA 4GOJA 3T1OA 1HT2E 3THWA 5FUVA 2QAJA 3NDPA 3TSZA 4O0MA 1DO2A 3TJZA 2G1KA 4HSEA 3SR0A 5CM9C 4L8GA 2ZETA 4DLXA 1UFQA 5A4JA 3I72A 2DY1A 3W5JA 3L0OA 2ZUCA 1NMYA 3HR7A 3KZ1E 5B57C 4RZXA 3KUDA 2ONJA 3KKNA 1GRNA 3AGQA 4FD2A 3KQKA 3VU9A 2DFTA 4TTQA 1DG3A 4JBYA 2VHUA 3REGA 5JCPA 4B2IA 4D82A 1W49A 2IS2A 3FE2A 1QG4A 2FMXA 1Z0KA 2EFCB 2J46A 1D2MA 1DAHA 2ZYVX 3ZLJA 4EFNA 1CP2A 1KMQA 1YE8A 3KJIA 3SYNA 4UNSA 3MGCA 2GXAA 3LBHA 4M22A 1YU9A 5G3YA 4QBHA 1EFCA 1RRFA 3KFVA 1S8FA 3B1WA 3AP3A 3K70B 2WJVA 4XTRA 3T15A 1ZRHA 4OHYA 1PLKA 3WP1B 4KVGA 4Q02A 1S96A 3IO5A 5FPHA 2ONKA 3P4XA 2JLZA 1U8AA 1TUIA 2EYUA 4K81B 5DNYB 1KI8A 3U5ZB 2A7QA 3CNOA 3UMFA 3NEJA 2ZI5A 5E4FA 1X1SA 3T06B 2RAPA 2IYQA 1F48A 5JEEA 3ICEA 2VTKA 4Q03A 3PVSA 1XP8A 4S2EA 4TZ0A 3K09A 5FPTA 1Z22A 1I4TD 1Z07A 4B71A 3R9WA 4BFSA 4CEIB 4CF7A 2ZRDA 4LHZA 4WIAA 2Q21A 3EZ9A 1JB1A 3D6TB 4DLRA 1HYQA 2XB2A 2CDNA 1SULA 4JYCA 2XX3A 1XZPA 4BZQA 4LJ8A 3L0SA 4MDFA 4P33A 2WJGA 5TVKA 1VCNA 2KE5A 2TMKA 1JR3D 2ZRPA 5EQTA 3P26A 4LBWA 3OAAA 4LJAA 1G8YA 3THXB 4DEYA 1U90A 3LNCA 3ZQ6A 4TYYA 1S2MA 3CRRA 1X1RA 4XOIA 5JRJA 1BKDR 4ACAA 1EK0A 5JBQA 2WAYA 1ZNZA 3LY5A 1IN5A 3QKSB 4MKFA 1NN1A 4TMXA 1GSIA 2C03A 4TMZA 1N6RA 4Q47A 1CIPA 1LS6A 3QQ5A 4LRWA 4G3XA 4NH0A 2PH1A 4LYJA 4LC1A 4I99A 1MRSA 1LY1A 1N5LA 2HT6A 1X86B 3HU3A 2P3SA 4E03A 4DB2A 3VR3A 1XXHE 3CR8A 2XEXA 3LW7A 3K0AA 1K5DA 5H68A 1SXJB 3WHLA 2AD1A 3KTAA 4AYWA 1QHGA 1XXHB 2WPDA 3P32A 3BORA 1KI2A 5IT5A 4PQFA 1F3OA 2Y8EA 4HZUA 4A8JA 4CEHA 3GJ0A 4A36A 2XAUA 3DL0A 2OXCA 1W1WA 3I8SA 3MMPA 4DLVA 4IJMA 4EFMA 3D3QA 4F91B 5H8WA 2RCNA 2OV2A 1KI7A 4Q1CA 2AX4A 3Q5DA 3W6PA 3Q8XB 4ZKEA 1CRQA 3SFZA 1E1RD 3MD0A 1NBMA 2NZ8A 2ANBA 3AKCA 5KDOA 3U7GA 1KI4A 3GLHE 3TLXA 3SFVA 3GJ5A 1IOZA 5JWHA 5CJ2A 3FMPB 1T0HB 3K70C 5DI9A 1P7CA 2GK6A 2B8TA 4A0HA 1GILA 2IA5A 3IEUA 2IK8A 5FPYA 1T3LA 4JLAA 4V0ME 3DMNA 1SQ5A 2OFXA 4DLWA 3FHCB 2ZJYA 4RY2A 1F2TA 3T1QA 4RVCA 3CF0A 2GF9A 2FA9A 2R6FA 4Q4AA 4TLCA 1TL7C 1HEIA 5BXQC 1CS4C 2PCJA 4IDQA 3BB4A 3VFDA 1OH6A 4TQUS 5LPNA 1G3MA 3MLEA 3X1XA 1W46A 5SZKB 1AN0A 2ZANA 3QG5A 2Z83A 4DT1A 4LZZA 1IBRA 4PHGA 4C7OB 3OEEA 5KDLA 5KU1A 1KI6A 4EPTA 1G4AE 4KYUA 3RLFA 1JEDA 2W58A 2QTVB 2ORIA 5CLQA 2B92A 4MA4A 2W00A 3UMSA 1UBGA 1AS3A 1G5TA 3BGWA 3TUJC 2QQEA 3H1TA 1SVMA 1ODFA 4V02A 1XEWX 1S9HA 4DLZA 2UZIR 4LSGA 4DHEA 4OI4A 1UKZA 2YOGA 4M9SA 3MCAA 4OK5A 4QGAA 1FW6A 1R8QA 4WOPA 2REOA 3ADKA 4DB4A 2PLRA 2VP4A 1P72A 1BMFA 1NJFA 1KDPA 1OHHD 2WPDD 4TL9A 1D2EA 3WRYC 2QI9C 3TVTA 2ZXUA 4G01B 4Q1FA 2I1VB 4HB4A 2H57A 5FTKA 1E2GA 1JECA 1ZM9A 1AK2A 2A2ZA 4D0LB 5FOWA 3EPKA 5B2ZA 3MFYA 2WKQA 3NXSA 1NF3A 3SHFA 1OH5A 4BLSA 2ZE7A 4RD0A 4DIDA 1GOTA 1E9EA 5FOXA 4JT2A 1Q22A 2FOLA 5KSZA 2PEYA 3QVUA 4NPHA 1A4RA 2ZJ8A 4H1UA 4IEEA 2NO1A 3KX2A 4YQFA 3QE0A 1JPJA 2PEZA 4URWR 3LH5A 4UNQA 1PLJA 3DOEA 1XB2A 4LDJA 5E7JA 1I4DD 4FW9A 3ZVLA 3QXCA 3THYA 2WSSA 1XCMA 2IYVA 3GPLA 1GM5A 4F92B 4TLAA 1ONBA 1TQ4A 3UANA 4ZV4A 3IIMA 5FI1B 5FBLB 3ZZTA 4BRUA 3N70A 3V9PA 3QF7A 1Z6GA 4IOMA 3QF4A 4EJSC 1KJYA 3PUVA 2EWVA 2BHRA 1WA5A 3DVLA 3L43A 2IF2A 4M1WA 4AWXA 1FP6A 2RGDA 1WP9A 1GWNA 3O47A 4ZCMA 2ZVPX 1GL6A 3X2SA 2VHJA 4AI6A 1G20E 2IXFA 3AVPA 2IS1A 2XJ9A 2IHBA 1J2JA 5HTKA 1CJTC 3AF1A 5FOTA 3IBYA 5A0FA 2AK3A 4KBFA 2ZR0A 1G7RA 4KLZA 3A1WA 3CRQA 2HF9A 1Q1BA 1VIYA 2ZYWX 4RCZA 3SU8A 3IGFA 5DHFA 3GEHA 5G40A 5L3QB 1AA9A 4BE7B 5FL3A 5DN6A 4L15A 1G8PA 1LNZA 1CR4A 5LD2C 1XTIA 5EE3A 2FDCA 1T6NA 5IDVA 1MT0A 1IXZA 4NCIA 2O52A 3HU1A 4R71A 2HXYA 2REXB 3A1SA 3FMFA 4WXRA 1HA3A 4LPSA 3VU9B 5CK4A 4YDHB 2NO6A 4LJ9A 2V54A 4GPTA 1MO3A 2GA8A 5AJZA 4HAXA 4NP6A 4B3DA 2GJKA 1ZW6A 3E2IA 1HQCA 4JVLA 5IK2A 3CX6A 3GJ7A 1NNEA 2QROA 1R8SA 1Z28A 3HWSA 2VPPA 1UKEA 2YWGA 2X2EA 5EXPA 4KHZA 2FSFA 4UQOA 3K0CA 4FINA 4ZDWA 1G291 2ZROA 3B8HA 4JJKA 1H65A 1E99A 4DVGA 3DO6A 3W6NA 1QHXA 1VCMA 1Z2AA 1X3SA 1IY0A 4JLNA 1BH2A 1J7KA 2OFWA 4UXIA 4JVSB 3PUYA 3FDIA 2IXEA 4QXAA 3W3ZB 1I4LD 1W0JD 1FZQA 2KB0A 1L7VC 3TSOA 4B3BA 3VTKA 1XCGB 2VF8A 2XJ4A 1XX6A 1YRAA 3QXJA 4RFSA 2ODWA 1RZ3A 2RKOA 2ZS9A 2CBZA 3V00A 5K8IA 1JJ7A 2QENA 4HLDA 2HJVA 4JLDA 1IY2A 1NVVR 2IYZA 2DCUA 3CONA 2VSOA 5EXXA 1XTSA 2ZI4A 3M1IA 5FTLA 4DIEA 3CZPA 1E94E 5KO2A 2WM9B 2FZLA 3SEAA 3UK6A 4DLYA 5HKKA 5GJCA 5AUNB 1F60A 4LBVA 1IN7A 1R0YA 1KK2A 1VHLA 2MSDB 2BBSA 4M1OA 3TH5A 4C30A 1P61B 3SHWA 2HLDA 2CNWA 3LLUA 4Q18A 2QRNA 3EIEA 1CF4A 4DDTA 4D26A 4PXAA 3A36A 3PUWA 3QIAA 4GI7A 1WMSA 2XZOA 3DZ8A 2PJRA 5FBWB 4JSYA 3FFAA 1W36C 2ZI3A 1G3IA 1QHIA 4AKHA 3QXXA 4LC0A 4NYMQ 5KPJA 2VHCA 3QEOA 1II8A 2DPXA 3AKYA 4MYCA 4RJLA 1YZGA 3PENA 1SXJA 4NCJA 3RDPA 1Z08A 2X19A 3ND9A 4P4SA 4Y0VA 4A6XA 3E5HA 1IY1A 1FX0B 3BH7A 5DYIA 2C78A 4E07A 2GZHA 1LF0A 2J0UB 1LB1B 5EP4A 2IYUA 5CB8A 1UPTA 2QL6A 5FL7D 4XIGS 4A0GA 4Q4HA 1TU4A 4IW3B 4YMWA 2FJUA 3VR5A 4AK9A 2UVQA 3U6BA 3H86A 2E87A 3K9HA 4TQAA 2IYYA 4W5HA 3TKLA 1J8YF 4IDNA 4RZ2A 1DG1G 1FQJA 1W2HA 1Z6XA 1E9SA 2ZRGA 3JVVA 4LHWA 5JFGA 2G9NA 2WWYA 2ZI7A 4IVRA 3QKRB 2I3BA 5FUYA 2A5YB 1FMLA 1N0UA 1OT3A 3PEVA 4M4SA 1KK3A 3C5CA 2C77A 2J1LA 1N6LA 3L0IB 1OXSC 4R2HA 4BFWA 1TTTA 2LWIA 1FP7A 3CNLA 2V9PA 4RZ3A 1RFLA 4IFEA 4M0LA 4D80A 4HAWA 4I1SA 3A4MA 2YOHA 1UDWA 2D74A 1HUQA 4K8OA 2ZRNA 3BFVA 1FOEB 2C9YA 1NY5A 3ZS9A 4MITA 1Z6AA 3FTQA 4X8MA 4QHTA 1W4CA 3VKGA 4WW0A 3W8NA 3VHLB 3FFBA 1SVLA 4KVAA 4NU0A 4XD7A 4CT4B 4QJ3A 2QORA 2FV8A 2KSQA 3BRWD 1OHHA 1XBTA 1KNQA 5CJPA 1KI6B 2XNDD 4TL7A 1P9NA 3AVOA 3T1TA 4YMTA 1G3UA 5L8VA 5KSYA 3GLIB 1EFHA 1P2TA 2B21A 4NDZA 4WBSA 4DT1B 1QHSA 5DISB 5IF9A 2FZ4A 2FFAA 2XTZA 1KIMA 3X1ZA 5EP3A 1OPXA 2O8BB 1UM8A 2J7PD 3O8RA 2R62A 1F2TB 5AK0A 5LB4A 2GNOA 1GKUB 1Q0UA 3O8DA 2OHFA 4Q9LA 3UG7A 3IPXA 3AEZA 3QENA 2XOKA 5JS8A 1ANKA 2H17A 2JJ1D 3LX5A 1OIWA 2WBLC 3R8FA 2JLWA 3IIJA 3M6AA 2VLIA 2AL7A 4RZUA 3AVTA 3DDCA 5DN6D 3IIKA 1YZUA 3OFNA 4B43A 5DHAA 4Z8XA 2ZPTX 1OXVA 5HE8A 2F43B 4MGYR 2J7KA 1AZSC 2A30A 2WJIA 2H5EA 3VKWA 3WRXC 1QDEA 4ZDIA 4TYNA 3SS8A 5E7IA 2BMEA 2G0NA 2ORVA 4LX0A 4Z1MA 1JALA 3ZIAA 5LDDC 1NN5A 1R6BX 2CHQA 1FQKA 3B2EA 3NBYC 4KSCA 4JSTA 2Z5FA 3NBZC 5CDFA 4A0RA 1XWIA 2QPOA 3FOZA 3UXMA 2BEKA 1OFTA 3THWB 4QGGA 1XTQA 2ANCA 1E32A 4IRUB 4Q1BA 3ADDA 2VH5R 1CXZA 2X2FA 1RYHA 1K8RA 1NJGA 5LD2B 1ZIPA 4QGHA 2ZAOA 1Z2CA 3AF4A 4IEIA 1OYWA 1EX7A 1DAEA 2LKCA 3A1VA 1OFHA 2DYKA 2W6JD 2EVWX 3MWYW 1ZCAA 2IUSA 5AJYA 3OAAD 2HF8A 1G17A 4XWOA 2FH5B 1YR6A 3L8ZA 5IHPA 4O2LA 2R6AA 3RAPR 2FN4A 5ELXA 4RD3A 3ZDQA 1P2UA 3NVAA 5FUWA 5DYGA 5TXGA 3F3YA 2O5VA 2FGKA 1G21E 1XU4A 2F9MA 3WNBA 4MYUA 3ZH9B 1Q44A 3HJNA 4NYJR 5FTNA 2CVFA 1DOAA 1MO5A 1N25A 2GAAA 2KI5A 2B6HA 3A4NA 4KLNA 4FMBB 4NZYA 5JSZB 3EASA 2ZSDA 4F4CA 4N3NA 1QVRA 4A4DA 5KNCA 2ECKA 2NO9A 4HDOB 1KDOA 1SXJD 4PO9A 3FB4A 4GRAA 2XTMA 3KKMA 3B9PA 2QQ0A 1ZINA 3HR8A 5H1YA 4ABYA 2HDNB 1R0XA 5SZHB 1ZD1A 1W4BA 2BDTA 2Q9CA 5J4VA 3F8TA 1A2BA 4BUJA 1D8TA 2ZE8A 2ZS8A 1MOZA 4U02A 1G64A 1G7CA 4BLOA 2QBYB 1WF3A 1CJKC 1NLFA 5TMPA 3U44A 1FUKA 3K9NA 3GEEA 3TR5A 1OFIA 2GESA 1U8YA 2IS4A 4PSAA 2B7BA 3CRMA 2RMKA 3BH0A 4BPBA 4CEIA 1G3QA 3CBQA 4YMSA 1XCPA 2BJVA 2KBFA 2O0HA 3KKPA 1E96A 5JLJA 2O8FA 2IS6A 5CYOA 3BS4A 4LHYA 3T1VA 4WZAE 4P0TA 4B48A 3IUYA 2QGNA 3EWAA 1S3GA 3SNHA 4C4PA 5BYKA 3CW2A 2AKAB 3BE4A 2XTNA 4JLJA
chains in the Genus database with same CATH superfamily
4YFVA 4ZVMA 1P81A 1R00A 1ZKMA 2KBEA 1V1MA 3N5CA 1A5ZA 5DK4A 3J81A 2AW5A 4C29A 5DN9A 2X3UA 4HPJB 3AZOA 1BQEA 1W35A 4MVCA 5F5LA 4Z1MD 3ESYA 5TGTA 1U5AA 1LPPA 2HJ9A 6LDHA 2XXJA 4OJNA 1FK8A 2AQIA 3CZQA 1GFWA 2HSDA 3F9IA 1II0A 4N0DA 1H0HA 1LBIA 4HB3A 1F4LA 2A0KA 4RDCA 4BX8A 1RC8A 5FAKA 5FLEX 2OQ2A 3CLRD 1HKHA 1PZHA 1P3JA 2PXAA 2IHUA 3D6NB 2PR7A 1P1RA 2O20A 3CRZA 1GA6A 4HWTA 3OZIA 4P93A 3B7PA 4XFDA 2NX2A 3VDQA 2IL1A 3QWAA 4XCQA 4B87A 5I8PA 1ZJ6A 2BFOA 4Z3OA 1E1MA 1RI4A 3DV0A 4BFUA 4KO3S 1OWPA 4Q4LA 3H18A 4OI0A 1NW7A 3P9YA 3B6JA 1H0KA 2RBEA 5BOVA 2B9EA 1IONA 1CUZA 4MCJA 5K3SA 4D6PA 5AVVA 1V5FA 3GFPA 2X0JA 4L3VA 5DCYA 3V1UA 4LE0A 4EHNA 3S68A 1I6WA 3VU0A 4JASB 1U8FO 1NN0A 2JATA 3AIOA 3KE9A 4EUEA 5HK8A 2JLQA 4B32A 1G20B 3ME5A 5JPDA 4P6VF 2WMOB 2WNHA 5F73A 3TQCA 1AV7A 1VKOA 5SYAA 1S4MA 3TSYA 3B1ZA 2EZ9A 4JL5A 2G76A 2WHRA 3HFSA 5LA6A 1RXUA 4LJLA 3SQMA 4HWKA 2CDBA 1T5OA 5AI8A 2C2HA 3R6DA 4KK3A 2NW6A 2VDPB 5D3QA 4HNAB 4BO2A 1XGKA 2YZ2A 4DIOA 3P7MA 3F96A 1O94D 2FR8C 5EZSA 4ESOA 3JZMA 2G5PA 4QJ4A 2VCHA 2Q8NA 1TQHA 3KV3O 1H9BA 3IP3A 4LCEA 2M1ZA 4P36A 4P7JA 4K46A 1TECE 2X77A 2J4CA 1K7XB 2C5BA 3IKTA 2AWNA 1YIAA 2GK4A 3AVQA 4MS1A 3TI9A 2EQ5A 1Z63A 2FX3A 1TMOA 1XTTA 3O90A 5A1JA 4BUCA 4EG3A 1R4AA 2XBUA 4DFDA 4UDYX 5AQEA 5C34B 1J39A 3PB3A 4EM6A 1MOSA 2VHWA 3EEYA 2Q45A 2Z6UA 4D2IA 3W1WA 5TB5A 1AKRA 2HHLA 2GFHA 2W11A 4QT0A 3LY8A 5LCXA 1E2HA 1USGA 3MFQA 4RKRA 3R4CA 1I2AA 1R6DA 1OTYA 2ZUBA 3UICA 1UJ4A 3V4VB 2DWOA 1XELA 2IEZA 2D2XA 2G63A 4XPIB 4EHBA 5JS7A 3EWSA 1V9SA 3T3HA 1OXUA 3LDAA 3ZCVA 3QLTA 3WYAA 5BSGA 2SKEA 3FOCA 1W0KA 3U7EB 3VTZA 2P5UA 1AKEA 3I23A 3MT8A 4N41A 4ND8B 5NULA 1KAGA 5BR8B 1Y98A 1ESNA 1T26A 1KTVA 2PTGA 3GLFB 4ALKA 2FMIA 1C9KA 1REQB 4CYMA 1J49A 3CIOA 2DY0A 2PT6A 4AY2A 3WIUA 1SCDA 2X6TA 3G0GA 3K72B 1BS1A 3NTQA 3WV5A 2CFTA 3MJCA 1J23A 1UBLS 4I6JA 3UAGA 2NTVA 3C6YA 2HIAA 1SH7A 3DYBA 4MVJG 2JIZD 3G82C 4DY6A 3FZNA 2VP6A 4INAA 2X9QA 5ENDA 3TGLA 1GSHA 3BA1A 3ND6A 2VA8A 4LDNA 3TEMA 4FMCB 2QUZA 1P6QA 3M6MD 1SHKA 2XOEA 2FOIA 1Z6TA 3RRYA 3FKSA 3TIIA 3BM5A 5A0TA 4BB0A 1L4MA 4RF5A 4L08A 5DGCA 5DHQA 3EIOA 5ALXA 1ZR2A 2PD4A 1G5HA 4UVGA 2Q8QA 1HNZB 3WFIA 1HRDA 1U4NA 3DQZA 3B89A 5AVSA 1ADYA 1TC2A 2FZ5A 1KI9A 2IODA 1BW9A 1N3LA 2QLTA 3PVZA 4XJXA 3G17A 3UUFA 4REQA 1ZMOA 5B64A 5LC1A 3WDMA 6Q21A 1WXQA 2CHFA 2QAIA 5JQGB 2QTNA 2FW7A 3IRUA 2E82A 2X0NA 4GPZA 2X0EA 2JLUA 1K75A 3ABSB 3QU9A 3OMXA 5JHGB 5ULLA 4EH1A 1G6HA 2OZVA 4A8HA 3BWMA 4AIIA 5CDGA 2OHHA 4IIXA 3D8SA 1X7ZB 4LNUB 1E4YA 3MLBA 4A92A 4RSGA 1IQUA 2LXNA 4MV3A 5CDFE 1UMBA 3SI7A 3VR1A 1QSGA 4MUNA 4N1AA 4IEFB 2R0QC 4WESB 2ZTLA 2VHEA 4JWKA 4BN0A 4EZBA 2DR3A 2ZI9A 1KZYC 3BTOA 1GFIA 3KPVA 4V0QA 1ULBA 1GTL1 4XDZA 3WJ1A 5AK3A 4FGLA 2BFFB 4H6PA 3SC4A 3FLAA 2ASVA 2TS1A 1MVNA 4Z99A 4KZKA 3DVAA 2AN9A 4JI1B 4BO5A 4Y9TA 1RMYA 4S0ZA 4GXQA 1D3AA 4JUIA 5T4FA 3ADPA 3SBOA 3VYSB 3W2TA 3IHLA 3C0KA 5EKTA 5IKMA 1NVBA 1GGJA 2CN1A 4QXPA 2LCIA 3DCIA 4N5NA 3R3UA 4FU0A 4MUJA 3EWNA 5L40A 3B7GA 3KYDA 1QXSA 1LX7A 3QBTA 4NEGA 4URFA 3ZBUA 4K9NA 2I65A 2WU1A 4YMVA 2YBDA 2DGDA 2QRQA 3P0HA 5HGXA 3OQVA 4TV9F 1JGTA 3URMA 2A6PA 2OHGA 3BCSA 2CNLA 5JVDF 1NC3A 3HXPA 1SBCA 2C4TA 1Y48E 1J70A 3P9KA 5AVYA 4U7DA 1G5RA 1O4WA 2GOYA 3OCWA 2XMBA 3LKDA 3DH0A 1ODCA 2Q1UA 3NTLA 3EGOA 1EWRA 4QREA 3ZDBA 2I4OA 2J3EA 3W2HA 4AJNA 5HFJA 1W47A 4URUR 5EXSA 3I6QA 4KR2A 3W7BA 2X3YA 4ND2A 1CEEA 1M34E 2WFZA 4Y30A 2NVOA 3WL3A 2HBRA 3VPBA 1KAHA 5BYJA 5FFMA 2B6NA 2XADA 4E46A 4RJTA 1VB5A 1MZVA 4RYLA 4YJFB 4JUAA 4I81A 2Z2IA 3IAHA 4U8HA 4D4MA 5BSKA 4QL3A 3J7AC 1UBMS 1ADJA 1H6DA 3CZ9A 4YGXB 1JDPA 2FFQA 2TSYB 2R6GA 1IUOA 1DT3A 2NU7B 4MVJH 4HS4A 1Y6ZA 2HGZA 2HC9A 2XA9A 3L4SO 3PHIA 3H16A 4ZN6A 4B46A 2QGZA 4COKA 1J21A 1F3LA 2HIGA 3FHTA 3QUTA 2A88A 2H4ZA 1DLIA 3EZFA 1R18A 2XUKA 5K3FB 3ZWBA 4D92A 3NWJA 1K98A 3HN7A 1H0SA 4KO2S 1D4ZA 3KS9A 2Q6IA 4A91A 4H0NA 4D98A 3GAMA 1NG1A 3I9JA 2VKQA 3O95A 3L04A 3P0EA 5BXYA 1C4KA 4DQXA 5LJIA 3ZVKA 3D8UA 2ZIEA 1YL6A 4ZVUA 4NOLA 3TBFA 1Y8RB 4RNDB 2N47A 1X9HA 5ED4A 1ZICA 2WC1A 1Q3TA 2E49A 4GAEA 5H5JA 1FDSA 1TMGE 5DTQA 1AXEA 1NXSA 1VP9A 4P3PA 1KAQA 3VM6A 1T0BA 4YMLA 3T4EA 3RAJA 3RS0A 4YRBA 5AICA 1IDOA 1YJXA 4KNYA 5FNZA 3HV2A 2NUPB 4YAKA 3FWYA 3Q1LA 1DXYA 5HDQA 3L1KA 1CUAA 3DKPA 4B33A 4F45A 4MRSA 2CXUA 4WASA 1ATZA 3P2OA 1BVRA 1HE1C 1NJ5A 3G1TA 3SDBA 2QN9A 4YRPA 4CE6A 3OZGA 3TINA 5A4MS 1TAQA 3PXCX 4FI3F 4PYQA 5L6LB 4M49A 1FE8A 3ROKA 2RI1A 5JY1A 1WY5A 3HJGA 3U0BA 5KVAA 4KFTA 4F9GA 1TEZA 3GN2A 3QVTA 2J5XA 5EUQB 4ARZA 3KJNA 3UXHA 1JB9A 2HA0A 4P58A 3VI4B 4D6YA 2NP6A 5E0KB 3FKQA 5JWOA 1BA3A 1G7SA 3CUTA 1V1MB 4HK4A 4DDWA 4BNDA 2VHYA 3BF8A 5EXDA 5K8TA 1MX9A 4YMIA 2QPAA 1ZGGA 4WOJA 4BMPB 1IL0A 1JT2A 2J45A 5A9TA 3R9IA 3WLOA 2R97A 3E84A 3RUCA 3L8MA 2YFHA 5F5XA 1QZTA 4X7BA 2RD2A 1X2BA 1KFCB 3I05A 4MPTA 2DERA 1R6XA 1IZ7A 1Z3IX 2HV8A 1O96B 2Q28A 4GSKA 3B3FA 3M4JA 2H2DA 3DVSX 1M2NA 4JDPA 3K5PA 2HU8A 4LUCA 3DTNA 3EF0A 4AO7A 4XWKA 3QJYA 1OREA 2CDCA 2MIIA 2QTRA 2Z2YA 4R3WA 4AECA 2ZM5A 2Q4EA 4EA6A 2YWRA 4UTXA 3QIVA 3QVGB 2WNIA 2GX6A 1DAOA 3ABZA 1BGXT 4MPDA 3PFBA 4IQ8A 4TTVA 5KJ1A 1A9OA 2IDZA 3R5JA 4BAZA 5KTYA 2D2EA 3WQRA 2IVZA 3PQ5A 1JYFA 4GQIA 3L7LA 2A1TS 3FVTA 1YS6A 1L2TA 4AAYA 3MS7A 3MELA 3REOA 1UK8A 2QMZA 3ETHA 3GQBA 3KLMX 4H9GA 2Z5LA 4MGZR 2P7IA 4O02B 1Q1AA 3HPQA 2PFSA 5F1KA 5JZVA 2NYAA 1NVUQ 5FR1A 3OJCA 1XOIA 3S40A 1ECGA 1NYRA 1NMEA 1I7PA 3QJ5A 4QXOA 5EE1A 2A3NA 1ENOA 2AFIA 5E2BA 5F1PA 3DXFA 3RH0A 3BAFA 3RRMA 2J0UA 1ZPDA 3SC2B 2NUTA 3F1LA 4V1CA 3MOIA 3PE6A 4CODB 4Z8YA 4BO8A 2CFCA 4Y1RA 4DZRA 2UU9B 1COWD 4XJSA 2Z30A 5JSKA 2ZT8A 1Z6ZA 4OK3A 4XH9B 5FTJA 5ARCA 4G97A 3RRFA 4ZIRB 3UG6A 3U3MA 3FI9A 2ZAGA 1T4DA 3LBFA 2NAPA 4MW4A 1ISPA 3LDGA 3EULA 3LBAA 3OTQA 2CVZA 3RM3A 2FK8A 2WF6A 4LJ6A 4BJHB 5K2OA 4UJ3A 4KYVA 1K6MA 2I4MA 2QP4A 3ONVA 3ZHUA 4L6CA 4CI9A 4U5XA 4TKUA 2Y2UA 1QVVA 5EN4A 4RM2A 3HYRA 3LUDA 2W93A 1TC1A 2P30A 1Z2DA 3GJZA 5EWJA 4GZ5A 2OWEA 4EF6A 1V1JA 4XGRA 4FHFA 3PEYA 4R9SA 4ZI7B 2O8CB 4ZXPA 2P5SA 4KO1S 4LZJA 4BVAA 1U94A 1XZQA 2V55B 3FTNA 5BVHA 1TD1A 1JAHA 2ODAA 2P6UA 2X1MA 2WVGA 3B13B 2C3YA 2PZBA 4WNAB 5AM0A 5HCNA 3HPRA 4NJMA 1GCGA 3SICE 3L1JA 2O2JA 4HTFA 5JAPA 2PUGA 1C3EA 2AMLA 5DLQC 2W22A 2WAXA 5A7HA 4LOAA 4R8VA 4B2IA 1I2DA 3PPXA 2F3SA 4U9UA 1QG2A 1H05A 4IXWA 4JBWA 3UATA 4CPDA 1U9IA 4FVTA 4N65A 4ZIRA 1HNWB 2CHVA 5DEIA 1F6WA 4RF2A 4W7SA 3G5TA 2XQJA 1S1MA 3EIQA 4KX5A 5F4BA 4FMPA 2GEBA 1N7IA 3DFMA 3DFIA 3DWIA 2C4HA 2YZGA 5HOQA 2WSYB 1CZHA 2O0KA 2NQTA 3OG9A 1U0LA 2V5VA 4QAQA 3WWZA 5HRCA 1YU6A 1DEHA 2PQ6A 2YIJA 4X1KB 5E1BA 2ZUEA 4TZ6A 2YXPX 2R47A 3QPVA 1EIWA 2WIAA 2XMQA 2PT9A 5EGNA 4ZVNA 4G9BA 4RFVA 3CH6A 3CNQS 4DZTA 1KA9H 1IEVA 4HNVA 5L7TA 1OXXK 3G8YA 6ADHA 4GOMD 4BLPA 2AXEA 3E58A 3ORYA 5D87A 3PDUA 1LA2A 3Q7TA 3HBFA 1U2ZA 2QK4A 1U9JA 3F7TA 3UN1A 2J41A 2OEPA 2R79A 2XSZD 3T5CA 1V3QE 3PV0A 3I37X 1XAGA 2C9ZA 4B2LA 1KS9A 1J6UA 4EUHA 1RXVA 4Y2SA 2J6HA 2C7RA 3D2BA 1JI0A 2G88A 4JJZA 1PL6A 5HPYB 1QP7A 2DP4E 1CUUA 3IP8A 4OXQA 4K8RB 2ISQA 4U6NA 1FNNA 2GN6A 4IH4A 5DOZA 2W37A 3PQ2A 2C00A 2CJWA 4G1CA 4G5RA 1CUSA 3DEJA 4EJSA 3U60B 4FKBA 5A3SA 2BKUA 1X13A 2VTVA 2X7HA 2PH7A 3M49A 2E4VA 2ZJBA 5AFSA 1KGSA 1V3VA 3DPIA 5TVGA 4FK8A 4BU0A 1O9BA 4M7RA 3WLMA 3IJ5A 4AG5A 5CFZA 5HKKD 1Y1RA 1OW3B 4OK6A 1OZHA 3D8RA 2W9XA 2BJWA 3CS3A 3KQSA 1V5WA 1HH4A 4NULA 3OIFA 4BKOA 4REMA 3DHYA 4OL9A 1G63A 4NDAA 3D5QA 5FUBA 1GUAA 2HY7A 1T9AA 4JKYA 1NWCA 1ZGCA 4HWSA 3REQB 3HWRA 1N6HA 4TVOA 1FDRA 1XRLA 1OWMA 5JMTA 1KR5A 1HLFA 4A2CA 5AM2A 3WHKA 2LCFA 1QYIA 3HN2A 4V0KA 3KEFA 3ONDA 5GP1A 4LXTA 1PVOA 1U0NA 3IOBA 5DYTA 3S8YA 3IEKA 4AMYA 5AIBA 1HDZA 3JZAA 3FUTA 1AH2A 4JT8A 3SQNA 1TFRA 3O93A 2G4LA 2WYOA 1J5PA 2A4KA 4KI0A 4RLFA 3EPRA 2D0OB 2D4HA 5DWVA 2ZJ6A 2F59A 3C5HA 1NRJB 2EL7A 3M6UA 4EDHA 3VR3D 4ZCLA 3T0GA 4AUEA 3ZDXB 4Q9AA 2XMZA 1TIBA 2VYQA 1EWYA 1M73E 2IUEA 2PYZA 5AW2A 5DM0A 1VJTA 4BV3A 3IE1A 1ZDMA 2CMFA 2JGFA 2NM0A 3MJ4A 4G5OA 4PFQA 4DWWA 4A27A 1J90A 4HQOA 4HEJA 1UZMA 5AVZA 1SXQA 3DYVA 3PFCA 1G4UR 3PX3A 3TB6A 1X9GA 1G2QA 1RLJA 2P77A 4G1VA 2Q27A 4G4SO 1KH3A 5L4LA 1RJFA 3IP1A 3B3GA 4QPPA 4JYBA 3G0DA 1F0KA 1EEHA 4JBLA 4Q4DA 4NTZA 2WKWA 1DZIA 1FXSA 1QRAA 2AOTA 1BKYA 3AF0A 1GPBA 3T94A 3TRIA 5HJ7A 4JVOA 1A9RA 5F9HA 1GPYA 3GNQA 5JD6A 1PWEA 1Z5VA 4V2UA 1JU3A 2ZITA 4TT8A 4TXNA 4E5KA 3DLHA 2QM7A 2BTQB 1ORIA 3ZS8A 1SXIA 3DZBA 2BBOA 4MWGA 4FYWA 3JWHA 1QIGA 3DWFA 2HLDD 3L01A 5KTMA 4ND3A 2D1SA 2H1LA 2RK4A 5LQRA 1AZWA 3CPHA 4Y6RA 5BT8A 3GLGB 4OHMA 4EHJA 1RRCA 1KZ1A 4FSDA 3TUIC 3HXOA 2VR1A 4N40A 2HPZA 5E6SB 1UPUA 2BM0A 2MJLA 3AUJB 3C7CB 1QFSA 3HB5X 4JBGA 2XIJA 3H4MA 4RVSA 3D4PA 5A5FA 5JAMA 3OPNA 3U1BA 3B70A 2FWMX 2X7XA 4P5DA 3PYLA 3ZWVA 2M6KA 4OQQA 3IQEA 1P33A 1WABA 5L9AA 1QJ4A 3OF5A 3P0FA 5CVJA 1XVUA 4Q6BA 1ZC4A 2HXSA 3LTNC 4IZIA 1GZSA 3OSUA 1Q0PA 2H4WA 3D1LA 2O59A 3EC2A 1E6UA 1ONNA 1ZA2A 3SQDA 4DR7B 4G1MB 1RHUA 3CNHA 4RH1A 4EHDA 3HDTA 2HWKA 3A4TA 4CI0B 1L7BA 4PF1A 4MROA 1RM4A 1AZTA 3RYCB 3UFXB 1AXRA 3MTQA 4M98A 1WZIA 1SD2A 2ZTMA 3PUKA 4WKOA 5E9JA 3VC1A 1H1LB 3SHTA 3BMCA 3LT2A 4LCJA 1W4AA 2OPHA 3FI0A 1AGYA 3FGOA 4FCCA 7REQA 1N2EA 3DZIA 4KNVA 1N8NA 1U7PA 5FBKA 521PA 3ND8A 4AMVA 1K5GA 1KJ9A 2JZOA 5DM2A 1FYEA 3SYMA 2BYTA 4F56A 1LI7A 1NP7A 1U3TA 2MMGA 1S0UA 3H99A 3LWBA 2A5FA 1DKPA 2O1WA 4G26A 1KAEA 2PUDA 1RLMA 4EF5A 1L4FA 1DI0A 3PUXA 1ZVKA 3CGWA 2UUOA 4HX5A 1UK9A 4KN9S 3GWZA 3FTFA 2V97A 1CQIB 2BHLA 1P3DA 3JWEA 4OMUA 1ESCA 4A3SA 2PQMA 1CF9A 4JJGA 2QIPA 5ALRA 4KP7A 5EIBD 1R7RA 4UTNA 4UCWA 4WTOA 4WESA 2OB1A 1GO2A 3GEBA 3GELA 3H9JA 2DHQA 2GM4A 4PX2A 8ADHA 4LI3X 4WFIA 2NADA 4XWGA 2Z8YM 2IKSA 3E61A 3H0CA 1VI2A 2Q46A 1NQTA 1H6AA 2H0RA 4DRXA 2OFFA 1H4TA 1U63A 2BEJA 1A7JA 1S3IA 5JW6A 5JS6A 4X1IA 1NJ1A 1F7VA 2IHTA 3QX3A 1UKCA 2PJUA 3NIFB 3BFJA 1FFHA 4LE2A 5AK6A 5HRUA 1DAMA 1VXRA 3UWSA 4D41A 1EBFA 3A6LA 4CM8A 1FP2A 1WUJS 1KY2A 4X3CA 4YAEA 1G2PA 1KYIA 5JSFA 3UB3A 2C04A 1NPDA 2IZ7A 3DZKA 4D8VA 1JHUA 3M6IA 4V0LA 3JARB 5A02A 1DUSA 1B14A 4LJ7A 1IOLA 3FUCA 2QVYX 1GUYA 2ERYA 1T6YA 1E0DA 2J9FA 2QT1A 3KQTA 4F2WA 4GKAA 3PGKA 5EQJB 1TOAA 3HA5A 4K88A 3KP1A 3GU3A 4M8IA 4OQNA 4R8RA 3HK2A 1V5EA 5J2UA 2QN8A 4TTAA 4QQ8A 3G8CA 4YJ2F 5CLGA 3NVDA 3L0BA 121PA 2R60A 3KZKA 2PJZA 1EXNA 3A6KA 4NABA 4O8CA 4PLGA 3EW7A 1ZN7A 3LQQA 1MC5A 4J4TA 5K0NA 2Q5FA 3C5WP 5G3ZA 1SKYE 1L5OA 3PXAA 3UUWA 5KKCA 4DBLC 4EP1A 2W6ZA 1H23A 3LPCA 1F17A 1XYGA 4P54A 2D62A 4BV8A 5CFQA 1UP7A 2NXNA 2ORED 4G2NA 2ETVA 3TOXA 1NN3A 2OOSA 3O2QB 3I8OA 1S4QA 5CCDA 1YQ9A 2Q6VA 5KYNA 1ZIOA 4ZPJA 1MG5A 4CRWB 1CC1S 1YMVA 4WOCA 1JQLB 4YCCA 4WD3A 1P1BA 2ZI6A 3H2SA 1WUIS 1U3CA 3R0VA 2QLBA 4C7XA 2Q1TA 3BMOA 1OZGA 1U3VA 2I7DA 3AR5A 3MA0A 4PQYA 3F49S 2DLDA 2ATXA 3AETB 1WXIA 3M89A 5FNVA 2FP4A 3ZX5A 5KINB 2Q0HA 3CG4A 4WVFA 1P4SA 1L3IA 1E3JA 2CSXA 1N2HA 1N92A 2IYSA 4OQPA 1N2JA 2SBTA 3V97A 1ZNXA 2FQWA 3BRWA 3IPYA 3O21A 1GLVA 2QUKA 4TL6A 3VOAA 3R0IA 3HFJA 4RE6A 3KUUA 3WKEA 2YINC 4J9UE 3OQNA 4JXJA 4MDHA 3IR7A 1PZNA 3DHNA 4G24A 1QO9A 4CM9A 1QHHB 5B36A 1XDGA 1VTKA 1N7JA 4M1YA 4NH4A 4D1YA 1KWGA 2DF8A 1OV4A 3D6AA 5G1PA 4CM8B 3ZJTA 2C5LA 1QYXA 3E1GA 4MUHA 3W90A 2BI7A 5EL0A 3G8BA 5T5QA 4BFYA 3IV9A 1YRLA 4DN6A 1YVRA 2BTEA 4EIWA 3E3NA 4RVGA 4U2CA 1N0VC 1W9MA 5B3JC 3UJNA 4C0QC 4Y2JA 2H07A 1X70A 1P31A 1WMBA 3OJ0A 1MHTA 4GSYA 1TPZA 2B1RA 4LTNA 2J08A 4MLPA 3EFBA 5I7FA 4KPYA 3TTVA 2RHWA 4DKXA 1A82A 3CZ5A 2OHXA 4CT5A 3R0XA 2B4TO 3DVAB 1MQ8B 1Y4AE 1Y3CE 1WL8A 4BTLA 4TT3A 2VNAA 1P29A 2O1EA 4QBIA 2WUGA 1ZC3A 3NC1C 1X38A 4MUGA 4H1WA 4ENUA 1OZ0A 3T7TA 2GHRA 1V95A 3EVDA 3ZE9A 3CLSD 3ZJYA 2VP5A 2TMGA 3BWEA 5TPWA 4XD2A 3HRIA 4Q00A 4OIMA 1UWVA 3EG5A 5E9WA 4WFJA 4RD2A 4F72A 2D0IA 1TZ2A 4FR0A 3BMCB 2QJTA 1BDMA 3DBRA 2XLCA 4QATA 1VA4A 2FZKA 4YB8A 3VX3A 4BLWA 1G16A 3HDJA 3O83A 4KQ1A 4QWMA 1X7HA 1VLMA 1U1EA 1KYWA 5HM6A 4CQNA 1OX4B 2FSIA 1ORDA 3N2NA 2XTJA 2Y0BA 3AU8A 3V8EA 1IQPA 3WBKA 5SICE 4YJ3B 5C4IA 1YAHA 5LXTB 4N76A 4CQLA 1PIWA 1VHDA 4LNHA 3SJCA 3H97A 2WTEA 3SBDA 1NUSA 4YRGA 1JQ5A 1UOEA 5F7ZA 1X6VA 2FZCA 2BKVA 1JHYA 1EU1A 1TJ5A 3IIEA 2EW1A 3O26A 2QYHA 5IVKA 3KT6A 3NQ41 4MWSA 1TKAA 4JLPA 4RX1A 3ASZA 1UKYA 2UAGA 1IJFA 2A4MA 4M1SA 4UCXA 4EGFA 5HQ3B 2G06A 3K6KA 4C0LA 5TS3A 1W59A 1Z2PX 3I04M 5ALDA 1G19A 1PK9A 4YIKA 1ND6A 2AF4C 3LE8A 4R7TA 1U2GA 1VP3A 2PVSA 1UQRA 2H1SA 2OC9A 3H2BA 1O97D 2JZNA 3N76A 5B58T 1EVEA 3ZTWA 4PGGA 4AZ3B 2RGEA 4X90A 2XA2A 1HURA 2F3UA 2M32A 3I39X 3M34A 2NZYA 3VMFA 1YZLA 3BSFA 4WNCA 2RGWA 3K8YA 4JENA 1D4OA 3U49A 1IM2A 1BFUA 2OUKA 1BC5A 2ZDGA 1YHNA 5K0JA 1SCUB 1XN1A 1EFPB 1JA1A 2VDNB 3HCNA 3PDHA 3H9UA 4W9NC 4KMSA 5AOBA 3WZMA 3UJAA 2XUFA 5F12A 2YWEA 1U0EA 5H59A 3W4JA 4ZRDA 1G60A 2YMPA 1E2LA 4D4IA 4YV7A 2MYTA 2ODQA 1NSTA 3SX2A 1YGYA 1A9SA 1EK2A 2FWBA 1T3HA 1YR7A 2H54A 2J5RA 3DCNA 4ARVA 5IHXA 3DJFA 2VIIA 4DEVA 2ZRMA 1O3YA 2O1XA 3ECCA 3AJAA 1QV7A 2PHZA 2R1TB 3CUUA 1YS1X 4Q7MB 4HNSA 1TVEA 4ZO6A 5IDYA 4YNBA 2DJ5A 5L3ZA 1NQVA 4KE9A 3NDRA 1Y1KE 4FFRA 1R66A 4FFWA 4JL6A 2YNMA 2EBFX 2W2VA 3NNDA 4ZQBA 3UWMA 4CIDA 1XWFA 3KKKA 2FPRA 3OWHA 4HKTA 3GPBA 3PYXA 5A9SA 4MS1B 4TRJA 4XVUA 1V35A 3QE3A 2C5HA 1RSZA 4XWAA 3A9RA 4HDCA 3TQRA 3HA2A 4CCYA 1LC3A 1E3WB 3OEED 1X8KA 3NASA 1D2GA 3OZBA 1ZNWA 3Q5GA 4NX2A 5KYUA 3IDQA 2PD3A 3BCUA 1WB9A 1WBDA 3BMNA 1PQYA 4OMDA 2A58A 2GK3A 2TRSB 5HCIA 3WL6A 4DDUA 2ISSD 2RHLA 1TA0A 2AS0A 1U0FA 3PHBE 3TLGA 2YASA 1WDKA 4I1YA 3P9ZA 4DMUB 4GEGA 2ON6A 4BMVA 4EJ2A 4RW0A 3C7TA 1UODA 1UT5A 2J85A 4RFSB 2XYGA 3W8RA 2VO1A 4DHWA 2FZGA 3STHA 2C0PA 1ICIA 1ZZGA 4G63A 1I5RA 2ZSKA 3ENKA 2VLBA 5KNDD 2ZVJA 3BCRA 1OE0A 1P8JA 1ZGBA 1E18A 5EP2A 1FY2A 1AA6A 4UE3S 4U7JA 2PRYA 3WISA 4RD4A 4TXMA 3N8GA 1X19A 3A10A 1TDJA 4HEA6 4ZI3A 5KJCA 3RVLA 4TWIA 3AZPA 3L4BC 2AN5A 3HXMA 4EABA 1A95A 1OBFO 3BK7A 3S1LA 2QLLA 4YO8A 4F4UA 5SZJA 3QX9A 4YAWA 4ZD6A 4QOGA 3DM9B 1TZCA 3OA2A 3NIDB 3KOUA 2QL5A 3K4HA 4NWIA 3RUIA 2VNSA 4NCXA 1ODKA 3RFXA 1JP7A 1UZLA 1N5RA 5TF4A 3G2HA 3QX8A 2GHQA 3Q2KA 1SWWA 1MAWA 3DMTA 4N18A 3DA8A 3NLLA 5IAAA 4JYAB 1MO6A 1PGNA 3WMGA 2RDMA 1DS6A 2EEZA 2EGHA 1E63A 2W98A 3GMTA 1XE3A 3JD2A 4HWGA 4U4AA 1YFJA 2BGWA 5EHZA 3EX7C 1TEVA 3SQXA 4QELA 3CH4B 1QQTA 1VL6A 2Z3ZA 3QBJA 1DEOA 4HZIA 3DAYA 3DV2A 3K31A 2ZRBA 2HPVA 3QVSA 5C5IA 3QG1A 3RKUA 2B83A 1Y6RA 4JQCA 2EZ8A 4JIMA 4MAMA 4LOKA 1FMJA 3E18A 4ZFNA 3EG9A 2Z6VA 1FIUA 2WYIA 1P44A 4TTTS 5CHEA 3A3PA 2A1UB 1FX0A 4EHHA 4ZDJA 3LMKA 2P1DA 3VV3A 1DEKA 3EXEB 5DW0A 4LHXA 1RLIA 4MW5A 5FWYA 4QA9A 1RRKA 2ZWVA 2KS6A 4TT3D 4L9WA 2ZSBA 1XNGA 3UMMA 4GDFA 2E0IA 4LJ4A 2J31A 5CITA 1OH7A 2VNHA 4F3KA 2BMJA 3PFKA 4AKTA 1E69A 1KARA 3TXAA 3VPAA 4MB2A 3GGDA 4D9CA 4ZQIA 4IS3A 3U7QB 1ESZA 1Q1QA 5CB0A 2OD2A 3D54D 4M1EA 2XGGA 3ETEA 4R9UC 1TF7A 3BK2A 3WZLA 3KUKA 2JIBA 2HK9A 4LGVA 4E4YA 2Q7DA 4C88A 5LBIA 3B1YA 3AY3A 4R1TA 3SF8B 1PX2A 3I42A 4DLTA 1K7SN 3RNLA 1P0IA 1XZEA 1QOQB 3D4IA 4J0DA 3GLIA 3K09C 4M2LA 4YJDA 3RYIB 2P9BA 5JHHB 2XQIA 4RJIA 3EZXA 2FPMA 1ZJJA 1U0BB 1T8PA 2BMAA 1GL9B 2AE1A 2XVXA 3IPRA 2FSVC 2PQ2A 3OQHA 5B3KA 5ALUA 1BE0A 4ZU3A 5I7AA 3Q9NA 3AG5A 2AC2A 2RGXA 2L0XA 2OMEA 4LC9A 4ALLA 2GAOA 2Q3FA 1W4RA 3ODPA 4D9FA 1KZ6A 1EG2A 2PNJA 4Z7NB 5CB4F 3GNTA 4BXOA 3T5TA 3FOFC 4K6GA 2V0GA 1G6KA 1UEIA 4G23A 4R05A 1QRRA 3MTJA 5LNK1 1RCFA 1KS2A 4ZOLA 1AV6A 1QCDA 1XKLA 1ZXBA 4R98A 2DFPA 5JYBA 1W4ZA 3Q10A 5DLEA 4K9MA 4B3FX 2FWNA 4IQGA 3U56A 1X2EA 1DBVO 2ZKIA 1D4AA 4MQEB 5AK5A 1Z7GA 2YVQA 2Z3VA 2ZRKA 4CEJB 3A4YA 2FFHA 1HETA 2QS9A 1IXSB 1ZSNA 3C48A 2BUCA 4B8WA 4ZMSA 2B8JA 3FHJA 3KTFA 4L8LA 4CMEA 4UM5A 1RM5A 2H8KA 3JZDA 4LNAA 4ILEA 3ZZNA 4DNXA 1RVDA 1MW8X 1QE0A 4GRDA 5CDUA 2EIXA 1MA3A 1LJ8A 2L42A 3K9QO 4JCOA 3D0QA 4XM0A 3LCCA 3PXBA 1Q84A 4AC9A 3EW9A 1PEDA 2EFDB 3ASVA 2XZTA 4KXYA 3EA5A 3WGGA 1JIQA 1GNPA 3ZN2A 3AWDA 1FYDA 1Z2NX 2C2BA 5H82A 4E09A 5KQPA 1XCLA 1TYZA 4X92A 5D5PA 1STOA 2NU9A 5I7OA 1VPEA 2PO7A 5K8VA 4KW7A 3TMKA 4FSXA 4AUMA 1IY9A 4KSYA 3PJEA 5JI2E 1XMQB 2I6XA 5TEVA 1E9RA 1O77A 2OK7A 1LPBB 1FDOA 2IPAB 5FI0B 1I3MA 2P8JA 4J7AA 4TMFA 2ZRJA 3S0JA 3NFRA 3OU7A 3W2GA 4DAEA 3BREA 4Q3BA 4JKOA 3VJKA 3KWLA 4YQZA 3BD6A 3JX9A 3ECAA 3O73A 4GZ3A 4NLLA 3DOFA 4HNGA 1XDBA 1SVOA 4KPUB 4B7ZA 4F3RA 1WBBA 4KH0A 1WO8A 4LK2A 1JLKA 2R11A 1IM5A 3TK1A 4AJ4A 3QLJA 1PI3A 4W1RA 3UW3A 1VKRA 3U4DA 2HGSA 4MP3A 2BONA 2XKJE 3LHDA 4MULA 1D5CA 5SY4A 3W4KA 2W42A 1R0LA 1XT6A 3GDHA 1MBZA 4TV8A 5HOEA 2XKKA 1R9NA 1ORWA 3H9BA 1GRRA 1SQFA 1Z4MA 2Z9DA 1MRZA 1TO2E 2AR7A 3PRJA 3ZQ4A 2ZJ5A 5KI6A 3VNBA 5LU9A 1YCHA 3TI7A 1F2UB 3PKIA 5EXEA 4ID9A 1IWPB 3D1VA 5FD8A 3WLLA 5ADWA 4FFBA 4JEMA 3RS5A 4XM2A 5EMLA 1GKKA 2DB3A 1SAYA 2DWQA 1JV2B 3DSRA 4WLEA 4BMZA 1E2JA 4TM8A 1ZD5A 1U8ZA 2HK6A 3Q7EA 3CVUA 4OX9B 4RPJA 2Q62A 4EB0A 2G9RA 4RPCA 3FDXA 4MUAA 1YQQA 1LWNA 1Z35A 4UQPA 3QE9Y 3AUFA 3MM4A 1L8XA 4QOIA 1Z0IA 2WQ6A 3HLYA 3LA6A 4PYJA 4EATA 3QVLA 3UJHA 2ZSHA 2OP1A 3UV3A 4I3GA 4BP1A 1HNXB 3SBEA 3LRPA 4Q3EA 4RTNA 2LTAA 1V26A 1DBRA 1SUPA 3DHVA 1K2VN 3D7NA 3L6OO 4HQNA 4TKLA 5BRNA 2RCYA 4QTYA 5KBYA 1GJRA 2KQUA 3N2GB 3FSGD 5M2QA 2CCJA 2H5IA 4R4JA 4HV4A 5DNCA 5KWIA 1E2QA 2HJSA 1E2EA 2Y68A 4AY3A 2BGLA 2Q6OA 5B1DA 5LQMA 2OQIA 4B6EA 4EO4A 4DOMA 3TD6A 1E77A 4YEDA 2GMWA 3P9IA 1UFVA 4UNPA 2WD7A 3I9MA 2P2LA 3T4UA 4RTJA 3HRKA 3VX4A 1WOMA 2HTFA 2B3TA 4BQSA 3AEQB 4KN8A 4M3NA 4BVJA 4DL9A 3DZJA 1OLUA 3QVJA 4O4LB 1UBHS 3IV7A 1KMHA 3DXYA 3KFLA 5BSHA 3V5NA 3AB7A 5J40A 3RODA 3U40A 4DPKA 1DJMA 4D8XA 4PCAA 4D3XA 2XVYA 2R1ZA 1ISGA 1CF2O 1YMQA 2D8AA 1LXCA 2AR0A 2BFMA 2X8BA 3RQSA 3UMGA 5ICMA 1N9GA 5F9MA 1L7NA 1GL3A 1R1DA 2TYSB 4PU0A 2V9ZA 2WMNB 3GFVA 4BTEA 5U9CA 2NXEA 1I9GA 5HW0A 4AUNA 2JCSA 4HDNB 1OGIA 1F6DA 4Q0MA 2EATA 5JDCA 3GVIA 4DV4B 3WRXA 3DNMA 4OXXA 3M4ZA 3BEDA 4B3SB 4L0MA 4AXXA 4BASA 1K5PA 3K15A 5AIAA 2Z9CA 1AQIA 4J3NA 1ODSA 3GJQA 5LM3A 3JR3A 4MCAA 5C51B 2ECQA 1WE2A 1Y5IA 2DMRA 4O59O 1GTSA 3E27A 2EBWA 4MLDA 3N2KB 2BR5A 4CTKA 1NR5A 3DEAA 2A59A 3DAGA 4UFNA 3LX6A 2CV0A 3T4PA 4XOUA 2V4UA 1IB6A 3O31A 4QNRA 4XZ3A