1K5NA

Hla-b*2709 bound to nona-peptide m9
Total Genus 79
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
79
sequence length
276
structure length
276
Chain Sequence
GSHSMRYFHTSVSRPGRGEPRFITVGYVDDTLFVRFDSDAASPREEPRAPWIEQEGPEYWDRETQICKAKAQTDREDLRTLLRYYNQSEAGSHTLQNMYGCDVGPDGRLLRGYHQHAYDGKDYIALNEDLSSWTAADTAAQITQRKWEAARVAEQLRAYLEGECVEWLRRYLENGKETLQRADPPKTHVTHHPISDHEATLRCWALGFYPAEITLTWQRDGEDQTQDTELVETRPAGDRTFQKWAAVVVPSGEEQRYTCHVQHEGLPKPLTLRWEP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords major histocompatibility complex molecule HLA-B*2709
publication title HLA-B27 Subtypes Differentially Associated with Disease Exhibit Subtle Structural Alterations
pubmed doi rcsb
source organism Homo sapiens
total genus 79
structure length 276
sequence length 276
ec nomenclature
pdb deposition date 2001-10-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00129 MHC_I Class I Histocompatibility antigen, domains alpha 1 and 2
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1k5nA02
3.30.500.10 Alpha Beta 2-Layer Sandwich Murine Class I Major Histocompatibility Complex, H2-DB; Chain A, domain 1 MHC class I-like antigen recognition-like 1k5nA01
1BM3L 1QEWA 4ODXB 4WCYL 2J8UE 5ISZD 1FZOA 1YYML 3ZKMC 5SWQA 3HMWL 4WY7L 1WBYB 3VXRD 3W5NA 5HPMB 4PRNA 1ZAGA 4OZGB 3G08B 3BKML 3M8OL 2BHYA 5F9WC 5DVKA 5D1XB 5F21B 1Q9LA 4YBLB 4UAOB 1GZPA 3DUSA 3SGDI 5CBEB 4X99B 1VGEH 1WWWX 3L3DA 4DW2L 1JZ3A 3O3BB 5LBSL 4D9LL 1U8PB 3H3BC 3DBXA 4OZHF 3QZWG 3ESVF 2DQJH 3P77A 1Z3GH 5FYJH 3KYKL 4ZUTA 1YPZA 2Y36L 5GRJH 4NWTH 4D94A 2I07A 3E6FA 4K2UL 1T1YB 5BV7L 3P0VH 4KY1L 5F6HJ 3KPRA 1NLDL 4H5SB 2VSDA 3VFMA 4NRXB 3WLWC 3L6FA 4G80A 2X4PA 4LLYB 3T3PE 2BRRL 3WLBB 4PJHE 4XNQB 2P5WE 1VADA 4X6EA 3TFKA 3TT3L 3RGVA 1QFHA 4WW1B 4X5XB 2DM3A 3WNKA 3PGFL 4IMKA 2FGWL 4JCMA 4ZS7H 4KUCD 3MUZ1 4TVPE 4DK6A 3UJTH 3EDDA 5LXGL 1KN2L 2GSGB 2IGFH 3U7YL 4Z0BL 3V0WL 1MI5E 4ZOAA 5FGBC 1ONQB 1XF4B 1NGWA 4FMKA 4Y19E 4PJXF 1SBBA 4G8FB 1IBGL 5JHLH 2BNRD 3BPLB 5E1AA 4TQEH 2HT2D 4QNPF 3P73A 4PJGA 1YYLL 3RTQA 2R4SH 4KQ4L 3RA7L 4PRDB 5DURD 3EYUH 1I3VA 1GGUA 4X4ZA 43CAA 5E6ZA 3UBXG 4MD0A 1DBBL 3AY4A 4ODBD 1JPGB 3T2PA 2QSVA 5DQDH 1T5XB 3CFBA 4S11A 2YD5A 3NFNA 2J6EH 2VQ1B 4C56D 5J0BA 5CJQL 2O5YH 4OZIF 4GRMB 4P48A 5JLZB 4DGYL 2VISA 1C7SA 3AU1B 4JFQB 1ZLSL 4UTAL 4JQXC 3S37X 1DUZA 4QTHB 2VXVH 3H6JA 3CZFA 2QKIA 3MV9A 4LLVB 3RDTC 1KLUA 3QAZB 1CDBA 4NZRL 1T22A 5E9DE 2J6EA 2H32B 3QCUL 4ZPVB 3T2OA 5ADPL 3R1GH 4PJAE 3BH8A 1NEZG 4WWKB 5GHWH 5IMLA 5DHVB 1J1OH 4NQCD 4HFWB 2X70B 2XWJA 1IQDA 3RZWA 3OGOE 3QBTB 3VW3L 3MSPA 5AYUH 2HJLB 5ISZB 1DQTA 3OJDA 3IGAA 4LPCA 2MQ0A 5LGKA 4Y4FA 1X5XA 3VXRB 3DRQB 4PP1C 2ESVD 1NCCL 1S9VA 4XP1H 3ZZ1A 4XNXH 2K7PA 3QQ4B 5CEYB 4YK4B 1X5ZA 1M05B 3T3ME 1PFCA 2FIKA 3T77B 2VL5B 1YEDB 1G7LB 2Y5EA 1JE6A 3VH8A 3DSNA 5JQ6H 5IQ7L 3UTTA 3LS4L 4WU5B 1DQQB 5HHMA 3EDKA 2IG2H 2M26A 3IXAB 3MRMB 4NJAL 3PL6A 5DWUH 3QFDB 1F4XH 4K71C 1NC4D 4XCFL 1U3ZA 4UB0H 3U0TB 4GKSA 3JUZA 3T2NL 1PBYA 1JPFB 3RKDC 2FJHB 4NYLB 2JK5A 1F8TL 1GSMA 2G2RB 1IM3A 2VNCA 1QSFE 5JW4Q 1INDL 5F88A 1D5XB 1MCCA 4MNHA 4X6DF 1F6FB 4IS6B 1ACZA 3DX9B 2R4RL 1JPSH 4NT6A 1C1EL 5HY9A 2FEEL 4FFEX 2D31B 3U0WH 4J2XA 3GGWB 5AEAA 1T89A 1HHHB 4Y2DC 3QXAA 4YDIL 3EFFB 3L3KB 5DEFB 4L3CB 3T1FB 4K7PX 2OXGA 4NN7C 3FO9B 1E4KA 2DKSA 4MDJB 2H2SC 4NFDA 3P9LB 4ODXA 4XVUD 5TE4L 5M94B 2WSKA 3SE8H 4J6RH 2FIRT 3LEYH 1WBYA 5HPMA 4OZGA 2NZ9C 3G08A 4TTGA 3S3JA 5I1HH 2GJZB 4JFXB 5D1XA 4X99A 4KK5C 2AK1L 5HDBE 5A3ID 2LTQC 3B2VL 3O3BA 4KGLA 3RWGB 1EHLL 2VJXA 4UIKL 2BNRB 3RNKB 1YZZA 4AH2B 4JFDE 1A14H 1HKFA 3MYZA 2GY5A 1J10A 5JDSB 3IETB 2DIAA 5EA0L 2X5PA 2HFFA 1RUKL 3VA2C 1INEL 1A7PH 2Y1VA 4U6XB 1QR1B 4GXUN 4CN1A 1FG2B 2H45A 3WFEH 1WFNA 1ZLWK 2FHCA 1SEQL 1OCWL 2QSCL 4MNGE 4P99A 1T1YA 4CNIA 4LAJH 4UV7L 4OAWB 4C56B 1CK0H 3LH2H 5C7XH 4NRXA 3LD8C 2FLRT 4NJ9H 1MRCH 4LLYA 3WLBA 1MCWM 3ZTJH 4MGXA 5I1GL 2ZUTA 1B3JA 2XN9D 3FFCE 5D2NB 4W68A 1WTLA 1QKZL 5D72H 5D7LA 2FH6A 4ERSL 3RIAF 2N7BA 3EGSB 4IRSD 4M9PA 2Z31C 4WW1A 4X5XA 3V8CA 3D39A 5EO0B 3WJLC 2VDML 3GIZH 3M1BA 3L3OB 3OKEB 1Y6KR 1HZHL 4NQCB 3HTLX 1UADC 3GHBL 1CGYA 4XMLL 1IMHC 3OKLA 2GSGA 4KQ3L 5KN5B 2UZYB 1WV7T 2E6QA 4U1NA 1F4WL 2JJWA 1ONQA 1XF4A 3BRDA 2ESVB 2CUHA 4J3OC 4ODUB 1VERA 4PP2B 2E5EA 2FATH 4JFYB 5GGRB 3SY0A 4S2SB 2E7BA 4E41E 5FKAB 1N0XL 5DD5H 4PRDA 3VDBA 2JKXA 4HXAH 1OW0C 5FM5O 3EKCA 3HN3A 2IADB 4FS0A 3TH2T 1JPGA 4TULL 5AZ2H 2EC9U 5C0AE 1NC4B 5IHUH 1T5XA 3W0WA 5I18L 4FFVD 3U82B 2H32H 5KVGH 5HVGB 4TSBH 3WMSA 5D1ZC 5LCVL 2PN5A 4GRMA 4PRPE 5JLZA 1KCUL 3VWJB 5I0DA 5DHVH 2NR6C 4HK0B 2UYLB 1B2WL 3AU1A 4JFQA 5B38G 1IEHA 4R3SB 1L6ZA 1G6RB 3VG9C 4YPGB 3MLTB 4QHLB 1K6QH 4LLVA 5HHXH 3C6SB 2OX5A 5DLMH 1DTUA 4YIQB 3EOBA 3VG0L 2H32A 4ZPVA 1T6WA 2DQJL 1QZ1A 4WWKA 1F02I 2EDWA 4PRBB 5DHVA 4OT1H 3SKJL 1N7ML 2X70A 1LDPH 5GRXG 4OF6A 3ALWA 5DGRA 1LEIB 4KK8D 4G42B 2VDLL 1J5OH 1BBJA 1RUMH 2HJLA 5ISZA 5C09D 3V52H 1D6VL 3VXRA 5JMRA 4FZEH 4XPHH 2D2OA 5FYJU 4ESKA 4JVUA 4LVEA 2QTEA 4NZTH 4XC1H 3WFCL 3BEVB 3K4ZA 4YWGL 1NANH 3HR5B 4S0UC 3QQ4A 4NP4L 3C60D 1M05A 1URLA 1J8KA 4IDJL 1GJIA 2P44B 2VZUA 3UO1H 3T77A 2VL5A 1YEDA 1G7LA 3K8LA 5AD0B 4FFYL 4UQ3B 2XYCA 1PVHA 4ZAKC 1KCVH 2IMNA 3RVTD 3SGKA 4P9HC 4YZFE 4WU5A 4Y4HA 1DQQA 2X4QB 3IXAA 1TJGH 1U3HD 3QFDA 4Q97A 5AZEH 2UWEE 1P4BL 3B43A 3CMOL 3U0TA 4OUOA 2W0LA 1G7MB 5GS1B 1JPFA 2PW2B 3MOBL 2FJHA 4NYLA 1QHPA 1YEGL 2G2RA 4JZJC 4OZFH 5SWSE 1D5XA 1WITA 3FFDA 1ZGLM 2Z8SA 1U95B 3DX9A 4Y5VC 1KJVB 4ONGH 5DD0H 1RUAH 2X40A 4JRXD 5JPNB 2XN9B 1YY9D 2D31A 1R3IH 1DN0A 4FQCL 1HHHA 3WFBH 1OAUH 3EFFA 3L3KA 4OZFA 3V0VB 5DEFA 4L3CA 3T1FA 3RWJA 4IRSB 3FO9A 4MDJA 2HJFB 3P9LA 4LSSH 4H0GA 3QJFB 3VWKD 4XGZB 1GL4B 2JB5H 4X4XB 4KTEL 5DQDL 4Z78B 4JPVL 4LQFH 5C0JB 3H0TA 5D2LE 3VXUD 4XAWH 3HCVB 2GJZA 4JFXA 4OCYH 1V5JA 2QADD 4ZSOA 2K9UA 1JBJA 4PJ5D 1FYTE 4FTVD 4PJBE 2DICA 3GBNL 3RWGA 4ONHA 3GO1L 1EEYB 4DGIL 1NC2B 3BKYL 4XAKE 3RNKA 4AH2A 2OP4H 1EV2E 4KGJA 4PRID 5IIEA 5I1JH 1B9ZA 5JDSA 1J0ZA 3IETA 3QIBC 5E4EC 3LEVH 5FYLE 2NNAB 2XTJC 4H26B 5GHWL 3STBA 4LRIA 1QR1A 4NN5C 1FG2A 2PO6C 4JKPH 1ODAA 3CFIC 3PDGA 2XTLA 1EBPA 4FQJL 3GK8H 5CD3A 1U2CA 1MCQA 4WO4D 3MLUH 4OAWA 3PDDA 4LLAA 4OLYH 4C56A 3MRQB 3BOVA 3CZJA 1CGSL 1S9WB 1X4ZA 4DEPC 2AXGB 5D2NA 1HIMH 4NUJB 1S7UA 3RQ3A 5DD1H 3NOIA 2AABH 4FOMA 4CJ0A 4K8RD 4ODVL 5I8KH 4JGJA 4JREB 1R3JA 5EO0A 2FZ3A 4M93C 4L9LC 3L3OA 3OKEA 2IMMA 4NQCA 2EIEA 4WVRA 3ROOA 4BK5A 1GOGA 2FX9L 3FTGB 3BJLA 3D3VA 5IMKB 2Q8AL 3KS0H 5C09B 4G8IB 2Q6WB 3NZHH 5KN5A 5KS9F 3WUZA 4X7TA 3BP5B 2YPVH 2CR3A 1B6UA 2ESVA 5C9JB 2HWZH 2VITB 4JN1H 2EZ0C 4OF3A 4KJQC 3TJHC 4J12A 3RL2B 2Q1EA 4M5ZH 1JNHB 5FM4A 4PP2A 4ACPA 3C60B 4UILH 2Z93A 5C0CB 5C1MB 4KJYB 4JFYA 4XNMB 1CDCA 4S2SA 2IEPA 4PTUB 4HUXB 1QO3B 1A6UH 5H35B 4ONFL 2Y07L 1N64H 4LGRB 1XIWD 3MV01 2B5IB 1G6RH 1NANI 1UA6L 3P4NB 1U3HB 3RVUC 1CQKA 3LKNB 4TRPH 1KPRB 4O9HL 4I3SH 4YFLI 4ZUSB 3VGGA 2L7UA 2VLJD 1P4LB 4PLKC 5I1HL 1UYWH 3QXDB 3V7AE 1W0WB 4HZAA 4LLDA 4L8BB 4HK0A 4K7PL 2UYLA 5ID0B 4NBYB 4R3SA 1G6RA 3QHFH 1KCSH 4YPGA 4XNZC 3MLTA 4QHLA 3C6SA 4RFOH 1J05B 3KYOB 2PNDA 5FB8B 4YIQA 4JRXB 3HI6H 5C2UB 2D03L 1YDPB 5FAAA 2QHLA 2BSTB 5L8LB 1P84J 2A6KA 4PRBA 3QUMB 2B8OT 1NCWH 2DBLH 4YGAB 1LEIA 4WFFD 4G42A 5DR5L 3GEWB 1DBKL 3I6LD 6FABH 4OCRL 4DVBB 4U1JB 4FP8H 3VWKB 4DQOL 3ME0A 3V6OC 3I3BA 5DZNA 2FD6H 1U8QB 4HD9A 2QV2A 3VXUB 1FNLA 2X44D 4K3DH 3BEVA 2QADB 1U3JA 4U7SA 2CDGB 3HR5A 2V7HB 3HRZB 2B39A 4PJ5B 4HGWA 1I85C 3HZMA 4FTVB 4L8DB 2Q7YB 4E42B 5CZKA 4O58L 2A6IB 5C3TA 4ISVA 4R4NC 4PRIB 4UQ3A 4UNUA 1UACL 4Q2ZB 5FA4B 4MCZB 4AEIL 3GIZL 2X4QA 1GC1H 1IAKB 1OPGL 3BQUD 4P23C 2YPLE 1KB9J 1MREH 3MBXH 3RAJH 3ARQA 5GS1A 5EBWB 1ACYH 5CCKL 5EU6D 2PW2A 2WZPD 4BH7B 4XC3H 4NPYA 1HSAA 3EJYD 2EDHA 4WO4B 5F97E 5FCUL 4Z7UB 1T1ZB 1DJSA 3TCLB 2C1PB 1MFAH 1R3KB 1U95A 5EZIL 1HINL 3OPZL 5JXEC 3HC3L 5JW5B 4L4VD 2XN9A 4MJ4A 4U7KA 1GGTA 4PJIF 4BSJA 4HXAL 2DRUA 5IBTH 5JHDD 1HHIB 4IRSA 2HJFA 4I0PA 2DOCA 4HBCL 4JKMA 4HUNB 3Q5OA 3TIEB 3FONB 1FV1B 1KEML 5DQ9B 3NIGF 4MQXD 2VDRL 5A40E 2ICES 1BVLB 2XNAB 25C8H 3HCVA 1V3MA 4KKCD 5CEZL 1SHMA 4RFNB 1D7FA 1EFXA 3FN3A 4R2GC 5F9OL 1DDHB 5D7JD 2MQCA 4ZO8A 2JELL 1T66D 3KPOB 3BP4A 3HLAA 4LDLB 4KK6D 1P1ZB 1S8DB 2C3WA 3TO2B 4CRPA 4EIGB 2XWBA 2NNAA 3QQ9D 4HUUB 4E5XB 2IAMC 3JWDH 1KCKA 4OT1L 3ZE0F 2V2XA 3MODH 4XI5D 2DI8A 2FYYB 3MCKB 4A6YB 1XIWB 1T21B 3QIWD 4IIQB 4KI5E 1K8DB 2R9HD 5D8JH 1NCTA 4JDTH 1OLZA 3MRQA 3VFRB 4NZTL 3D25B 3FB8A 1S9WA 4FQ2L 4ODHH 5IB5B 3WE6B 3REWB 2IBBA 2AXGA 5FO8A 3QR2A 3UO1L 1P9MA 4CMMB 4NUJA 1BEYL 3A67L 4L8SC 3JVGC 4LHUG 1ZEAL 4R7NB 1NMBL 2Z8WC 4HH9B 4O2FB 4NSKB 5HJ3B 3V0AC 4Q0XH 4KDWA 4KC3B 1EGJH 2CLZA 4X7DC 2BVPA 5DJDB 4E9LA 4X6CE 4OCXH 1DANU 1S78D 1JZ4A 5C09A 1CF8L 1JGUH 3KNBB 5DMKB 3BP5A 5DJCB 2J12B 3EJJX 5C9JA 2VXSH 5ADOH 1HEZB 4MAUH 2VITA 2IQ9H 1F58H 3QZWB 1EGJA 4YGVB 5DD0L 3RL2A 1JNHA 5GZOD 2IH1B 5BS0A 2P47B 4KJYA 3Q5TA 4XNMA 1ORSB 4G6AC 1R3IL 4PTUA 4WFEE 1JN6B 5BVPH 1OAUL 1FZJB 4HUXA 4PJ9C 3E1F1 4HKZA 3WDIA 1U58A 3NABH 3GSNB 2NX5D 3BIKB 4LSSL 5H35A 3OSKA 3T2QA 4Z7QE 4UOW0 2EXYC 1RZKL 2QEJA 1A6TA 3BQUB 4YHNA 3P4NA 3LKNA 3MLXH 2JB5L 5F7KC 1KPRA 1S5HB 3ARRA 3V4VH 4ZUSA 5I15L 1QVOB 4XAWL 1P4LA 1UWEH 1MRFL 1FFOA 5EU6B 2EC8A 3QXDA 1G7QB 3UEZA 1W0WA 3BHBB 4DVRL 5EU3A 4L8BA 1QPPA 4JDVB 3QG6B 3L5HA 5A2FA 5ID0A 1LO0L 3LEXB 5C71A 3G5YB 4GMTH 3G9VA 3HNVH 3MUHL 3Q1SH 1J05A 1G7HB 3MXVH 3KYOA 4L4VB 1TETH 1F11B 5FB8A 4JRXA 3BT2H 5FYKD 3T4YA 4HAFA 1N5YH 3SDYL 1YDPA 4UT9H 5HDQL 2DLHA 2BSTA 1C5CL 2HTLD 4GKOA 2CLVB 4QOKE 2W60B 1K3IA 5JHDB 5CSGA 4IRZH 2A83B 3MCLL 4N9OB 4DVBA 2J88H 4U1JA 3BEWB 4GRWE 1FNEB 2R69L 2EDJA 1YPZF 5JA8B 1WF5A 2DQIL 3QNZB 2W9LA 5EBLB 3MLUL 1U8QA 1MVFA 3VXUA 1AC0A 3LIZH 4F7TA 5FV1L 4HJ0D 4ZTPL 1MJ7H 3GBML 2HTKC 3D0LA 3N1GC 4NKQB 2V7HA 3HRZA 5EBMB 4PJ5A 4FTVA 4L8DA 1HIML 5D7JB 2VDKH 2XQBL 1IC4L 2A6IA 5DD1L 1KXTB 3QNXB 4V2BA 3DUHA 1OTSC 1S9YA 3UBXB 3WBDA 2BVYA 4PRIA 4M7JH 3I6GB 5GS2D 4Q2ZA 2A0LD 1YNLL 2A38A 2DYPD 3DROB 4MCZA 4QRQB 3JWOH 1IAKA 5ERWB 3WKMH 1KNOA 1I1RA 4LKCB 5HVHB 3ILPB 5EBWA 5F3BB 3MUY1 4MD4B 3QIWB 4BH7A 3WJJA 4JO4L 2NW2B 5MERB 4K8RH 4Z7UA 1T1ZA 2B4CH 4R97B 1UVQB 1KYOK 2EIZB 3TCLA 1AR1D 1A7QH 3PQYE 3RGHA 2XG5A 2IQAA 5CZXD 4FQ1H 1CD8A 2AEPH 5C3LD 1WISA 5C07E 3ULSA 2BMKB 3CSYB 1RIHL 4F15B 1YEFH 2GUOA 4TYUA 3MGTA 2DQHH 4POZC 1S3KH 2VDOL 4MJ6A 1HHIA 4CADB 4J7RA 1UXWB 4QRPD 1Z0NA 2WBJC 3E8UH 3TIEA 3FONA 3O8XD 5ITBH 5DQ9A 4TRPL 4P9HL 4M6MH 2JTDA 4OQTH 2D3VA 3MLVH 1OAQH 5E8OB 4KKAD 2XNAA 3O41A 4PJEE 3HUJB 1JTPA 1UYWL 2M2DA 5ACLA 3G6JF 5KTEH 3PWJB 1CU4H 2NTFB 1DDHA 2VH5H 2VIRB 3BPCA 1G9EA 3KPOA 4A6YH 4PUBL 1WT5C 4OQTA 4OFDA 2GY7B 1P1ZA 1S8DA 2IBZY 3CK0H 1SYVB 3TO2A 1UCBL 2HN7B 4HUUA 2D0GA 4E5XA 5D5MB 3CU7A 1JYVA 1OHQA 4XBEL 3RWJB 3C6LD 3IJHA 1HI6B 3D87B 1F3RB 1PKQE 2J2ZA 2NX5B 3WV0A 5K59E 2BY3A 2AJXH 1S9KC 4HKBB 4A6YA 1RIUH 1XIWA 4DUXA 4UINL 1MCRA 1T21A 1V3LA 4OCLC 3UX9B 4EI5D 5MEQB 5D6DA 1K8DA 2X1XR 3O9WD 2XKUA 2HLAA 3GMNB 2VLJA 4OJFH 3HC4H 5JIHA 3VFRA 5C0BE 1NFDB 1RV6X 3D25A 3BH9B 5L2JB 3BYYA 3H2WA 3WE6A 5IB5A 3REWA 5BRZD 4QYOA 4OF8A 1EEZA 1IKNA 4Z5RB 5ELIA 4HQQH 2VSCA 3QP3A 3S8WA 4HH9A 4O2FA 4NSKA 4XCEB 3R06B 2FGZA 4WENB 5HJ3A 2KDGA 2VKWA 1DQLH 5F72S 5HD8D 4Z7VE 1R0AH 1YECL 1KN4L 4PJCB 4XT1C 1MJUL 2G75B 3CFJB 3UYOD 4XH2A 2WANA 1MREL 3MBXL 5JW3H 1SBSL 5DJDA 4YHYC 2HH0L 4XNYL 5BJTB 1J1XH 3KNBA 5D7IE 2A77L 3K7UA 4JN2B 2GW5A 4O5LH 3WIHL 5FOJA 3IFOB 2W1NA 2VLME 1RHHA 2HAZA 1H5BC 3GSNH 2NYYC 3QH3A 5JIIA 1T7VA 4HIXH 1B0WA 4GBXD 4BH8A 3QUXC 1RSFA 2E9IA 5HHVH 2Q86B 2IH1A 3UTSE 1ORSA 2H2PD 1JN6A 5I9QC 1RVFH 3P4LA 1FZJA 3UTZB 5EOQL 3DUUB 2Y5TB 1JZ7A 2DYPB 3GSNA 5CS7A 3BIKA 3MFFB 4LCWD 1MCSA 2IPUK 2R1WB 4LMQI 1A6ZB 5HBBA 3MLWH 4MJ2A 1CZ8H 2ZUUA 1S5HA 1IGMH 4ETYA 1QVOA 3THMH 5EU6A 4G6JL 2GK0A 1G7QA 1GIGL 3BJ91 4P2QD 3TVMC 3BHBA 3LQAH 2EDRA 4H1LG 2N7AA 4OZGF 3FHQA 3QG6A 4JDVA 3D18A 1EZVY 3LEXA 3G5YA 4N5ED 1LWRA 1L9MA 1VFAB 4GKNB 4YXHL 4J3VA 1G7HA 2VDPL 3C2SA 1T2QH 2FECL 4L4VA 4O51B 1F11A 1QSVA 2AK4E 7FABL 1W0VB 4HG4K 1A7OH 4S0SD 4U6VL 4L1DA 3SQOL 1A7RL 2CLVA 3MODL 1HKLH 1U6AH 2VC2L 3WFDH 1JGDB 1RJYB 2W60A 5JHDA 1C5BH 2A83A 3GZKA 5DC0A 1FO0B 2J4WH 5J11C 4QRPB 3BEWA 4ZOBA 5I1DB 3LS5L 1EDQA 3O8XB 3EYVA 4Y7MA 4UAOC 5D8JL 2V2TB 5EBLA 4ZUWB 1NBQA 3ZDYE 4P2YA 3UJIH 3RBSA 1S7VB 3T8XA 3LMJL 4EUPG 3CH1B 1MLCB 3DVNB 4IM8A 4LPUA 1UH3A 5EBMA 5B8CC 4MA7H 3K8KA 4KJPC 3CLEH 4PJ7F 2VXTH 3AM8C 4HF5H 5E00B 4CVXA 3I6GA 5CWSB 4MZ3A 5F89B 3DROA 1OF2A 1KTDA 4QRQA 4D9QE 4R4BA 4U6HB 2E9WA 3UC0H 3SDXB 5ESAB 4K9EC 3C6LB 3CVHB 4N8PA 4FQPA 5ERWA 2D9QB 4LKCA 5JW4M 4FNLH 4I3RL 3ARVA 5F3BA 4MD4A 3ARYA 3QIWA 4EI5B 5B38B 2NW2A 1MWAB 1Q0YL 3O9WB 4U1HB 5MERA 2OR8A 4NBZB 1A6WL 4YHMH 5ADOL 1UVQA 4MAUL 4PGDB 4G59A 1PZ5B 3VJ6A 5E5UB 4RIRB 1QLFB 1X5GA 3VGFA 4KROC 1DN2A 3SKUD 2BMKA 5IBUB 3QCVL 3X3GH 3CSYA 4PB9L 3CVIH 3PV6B 3DVIA 4P3CL 4NN6B 3RWDB 1CGWA 4TNWF 1YN6B 3O3AB 4WI8A 2EH7L 3D9AH 4LL9A 4CADA 3DI3B 3UJJL 5L6YL 2G9HB 1RZGB 1UXWA 1CLYH 3O2WL 1FORL 4DUWA 4JPWL 4V3DB 3BUTA 3QG7H 4KHXL 1FN4B 3DLQR 1UM6L 4M61B 5J13B 3EYQC 1RY7B 5E8EB 5E8OA 5HI3C 1WGOA 3HUJA 4JZOB 4F58L 2DD8L 1QHOA 2N4IA 3E2HB 5GISL 1I9JH 1MFNA 1MHEB 2NTFA 2P5WD 4KV5F 3CCHB 3FT4B 4GMTL 5IVOA 1DQDL 1GHFH 3IFPA 1YEEH 1QTYT 3TA3D 2OTWB 3Q1SL 4QXUL 2W0PA 4GBXB 2EEDA 2CUMA 1CL7L 3B8YA 3HMXL 3IDIA 3MXVL 4FG6C 4LAQL 3UYPA 1SYVA 4OGYH 2M8XA 2HN7A 3BE1H 4QRUB 4HJGB 4I77H 4WEBH 2NXZD 1FIGH 1X6LA 4TVPD 4IRZL 1HI6A 3KHQA 1SYSB 5KZCD 4HKBA 4HIIB 4N90E 4LCWB 4NO0B 5C0GB 3AB0B 3P11H 5BMFH 4MS8C 5MEQA 1MI5D 4RMVA 4U0RB 3UXFA 3MLPA 4Y19D 4TTDC 1P7HL 5FYKH 1QFPA 5F9DC 1XR8B 3UYRL 5EUOE 1NFDA 5KG9A 3BH9A 4P2QB 3QAZC 3V4PH 2PYFB 1GGIL 4PB0L 5A1AA 5EPMB 1PYWB 5F7MC 4Z5RA 3RPIB 2AW2A 4I48B 1CLOH 5B3JF 2CXGA 2UZIH 4U1SA 1GPOL 3R06A 1JHLH 3JWOL 4PJCA 2G75A 3MLSL 3CFJA 2ZNXA 2Q20A 3T0XA 1UEMA 5BJTA 3SE4C 4WEUD 1B6DA 1I7RB 4JN2A 1QP1A 1YEKH 4YFLF 3SEPA 4YK4C 2YK1L 3IFOA 4L29A 4BQ6A 5GS2H 4YDKL 4WW2B 1A7QL 4R26H 1NLBH 3JZ7A 3QRGL 4HWEH 2Q86A 5E9DD 5FECB 1MIEH 5EWIL 1YEFL 4ZNEA 1U91B 2H26B 3UBXI 3UTZA 3HZKA 3SKMA 4OTXL 2VYRE 3SGJC 2DJUA 2DYPA 2J8UB 5CGYC 1MHHB 3MFFA 4PJ8D 4YHOH 4D3CL 1D9KD 3E8UL 4TVSa 5T33H 2R1WA 3BVNA 1A6ZA 3UDWC 4M6ML 2IPTL 3IDGB 3G5ZB 3MLVL 3L5IA 2C9AA 1T80A 3ILQC 4KUCF 2R1YB 2K1MA 5KTEL 2F74B 4P59H 4LHQB 5JO5B 3KWWA 3QCTL 4EQ3A 2PYEE 1IL1B 4XBPA 1FO0H 1VFAA 4GKNA 1QNZH 5DK3A 4O51A 1BVZA 2KL6A 3FB5A 4ORGB 4PY7B 1LO3L 4PBXA 1NMCB 1XAUA 2IF7A 5DK0A 3FAWA 2HMIC 1DFBH 2O5ZH 5GPRA 5KVMC 4IDLA 1JGDA 3W5MA 1RJYA 4P46D 1FLRH 2ZP0T 2AJXL 1FO0A 1LD9B 3EDEA 4QRPA 5I1DA 1XF5B 1U8NB 3NFSL 4PREB 1Q72L 3QJHB 1QSFD 3K74B 1G84A 1MIML 2FX8H 4ZUWA 4OJFL 2RBLA 2YA1A 3HC4L 1TNMA 4CMHB 3OZ9H 4ZXBD 1S7VA 4KKLC 3J8F7 3CH1A 1FBIH 4NNYB 4PJHB 4LCIH 1NBZA 35C8H 3BWUC 2P5WB 1EIBA 4YC2B 4YXKH 3CVHH 4RQQB 4OZHE 3TA3B 1JHKL 4M1DH 1G0YR 3MACL 1CT8B 2VR4A 5E00A 3LB6D 2OI9B 3UROR 1MWAH 5F89A 3VXME 5CILL 4U6HA 2NXZB 1R0AL 5D1QD 3SDXA 1MAKA 1HE7A 1R5IB 3BUYB 3C6LA 3CVHA 4ODSL 2OLDA 2BRQA 2HVJB 1FVDB 4LSRL 3RY6C 2EDLA 5EZJA 3NACH 4JCLA 3VXPB 4C4KT 4EI5A 1MI5B 1FSKB 3CSBA 4GQ9L 2O61A 1MWAA 3O9WA 4Y19B 3VXOB 5HHOA 4PGDA 3W9EB 1PZ5A 5T5NF 4NGHL 4Q9QH 5GRUH 4HIXL 4U1KB 4JFDD 4R8WH 4RIRA 1QLFA 2HKFL 4FQXD 4KVCL 3QXUA 5BRZA 4JGMA 2DL9A 4W4OA 5I1LA 4QWWC 3RWDA 1RVFL 3OKKB 4ZOCA 4I18B 5KJRL 4XPAL 4HLJA 3MJGX 2G9HA 4R4FH 4RCAA 2DL2A 1RZGA 4M6NL 3STLB 2MCPH 3QA3B 1IGFH 4LSUL 1FN4A 1YNTB 1ORQB 4M61A 5E8EA 1A5FL 1N3NB 2DQEH 3NFPB 5D7LE 1IC7H 2FHFA 4JZOA 4CVZB 4NNXA 4PJXE 5LQBH 4W6XB 5FUCE 1XZ0B 2HFGH 5DJYB 3E2HA 3D39E 5H2BB 4NHCH 3WXVH 1DLHA 3CCHA 3FT4A 3FFCD 5C0EB 1HNGA 3VXNB 3O2DH 3WCYA 4GBXA 1F4AA 5EFIB 2A9NL 1BF8A 5E9DB 4NBXB 4J4PD 4PJAB 4WFGE 5ILTH 2XZQH 1ZTXL 2MHAB 4HJGA 4LCUA 5IB3B 2GKIA 4QXWA 2CGRL 3VDCA 4Y5YA 2VERN 2HJKA 1MCPL 4DKAA 1SYSA 4PJ8B 3O2DA 4LCWA 1D9KB 3C08L 5C0GA 1TQBC 3DGGB 1F90H 3VWJC 5CAYB 4HW6A 4OZIE 5FUZH 1N4XL 3K1DA 2LABA 4Y5XA 4DFHA 2D4FA 1CE1L 3NA9H 1PZUB 4P2QA 3FN9A 2ZCHH 5DRZB 4MA7L 1AXSB 5IKCB 2PYFA 4N5EA 5IF0B 2DIJA 4E41D 4AK1A 1I8MB 1IGYA 1AXTL 1PYWA 1CFSB 4UTBH 3RPIA 4I48A 2ZPKL 3B2UC 2ZZUT 2OK0H 4OIAA 1X4XA 3ARBD 2QLVB 4LASH 4P49A 3HB3C 1BQLL 4NDMB 1UB6B 3UPAA 5C0AD 4P46B 5J8OA 4OB5L 1NQBA 4NCC1 1Z2KA 2D7TH 4GS7B 4FNLL 1E4WL 2IWGA 3JTSA 5FO9B 2IH3B 3C2AH 4Y16A 4PRPD 1QSFB 4OSUL 5CEZE 2BVQB 4L8CA 3AGVA 4NQTA 1NL0H 4ZXBB 3GMLB 3SBWA 1UKSA 5M7QA 3VGHA 1CXIA 4MB3A 2Q3ZA 1BBDH 1U91A 2H26A 3PHQB 4LPXA 3WSQL 1AD9B 4UZGA 3F7PC 4NC0B 4ZDHB 2J8UA 1MHHA 3PHOB 1NEUA 2R56L 1S7SB 2P4AB 5D1QB 1TTGA 1DQMH 1YMME 5DVLA 3CFEB 5EC2B 1PJ9A 3IDGA 3G5ZA 2UUDH 1XGTB 3B5TA 2J1KA 2XA8H 3RU8L 3U30B 2R1YA 4X6DE 2F74A 3LN4B 5JO5A 1G7IB 2J3SA 3P0YL 4R96B 2B2XL 4LHUB 1IL1A 1MHPH 3PGCB 4PYHA 3BIBX 1IZKA 3VGAC 5HHQB 4RGMC 4JFDB 4UNTA 1J7VR 4IRSC 1BVKB 4ORGA 4PY7A 5SV4A 1P5VA 2FX7L 1IILE 1H15B 5JR1H 1FL3A 1FIGL 3OHXA 1FZKA 2YXMA 3O3EB 3ZSTA 2NXYC 1LD9A 1JPTL 4FN0A 2NY0D 2R2BB 1XF5A 2IC2A 2YD9A 3KPNB 1U8NA 4MNGB 4PREA 3QJHA 3ZDZF 1T83C 5SWSD 2ED9A 2DQCL 1IE5A 3WUWG 3TEUA 3MYJB 3QPQC 2YUWA 1IEAB 5KW9H 4LARH 2GTZB 4PJHA 3UZEA 2P5WA 2ZKHL 1CLCA 3R8BB 3FFCB 4TVPH 4RQQA 4Y2OA 3TA3A 2VOTA 3CXHJ 1XGRA 3VMOA 4CVUA 1A3RL 3B3IB 3QUZB 1ZOXA 4Z76B 3N1QC 2OI9A 5FYKU 1G7PB 5LWYL 3MNZB 4ZFGL 4XMPL 1SMOA 1FRGL 2C26A 4BZ1L 3ARGD 1ZHBB 1E27B 4LBEB 4X4ME 3T65B 3MLZL 3HS0B 3JWDC 1FVDA 3BO8B 1A02N 3VXPA 4APQD 1MI5A 2N1KA 1F3DH 2QQKL 3RPKA 4EDXB 1EA9C 1YEKL 1P4IH 4LDEB 1FYTD 3VXOA 4HS3B 1OAZH 3QRFM 3MRRA 2X89D 3W9EA 2ICWJ 2YMXL 4U1KA 4XAKD 3WEXB 2YRPA 4HWEL 3DIFB 2BERA 2D7PA 4Y8DC 1WICA 5E2UH 1UM5H 4L5FH 5DQJB 5EZOH 5FYLD 5HI5C 2KBGA 4ZUVB 3L3IB 5TF1H 4HIHB 2E8YA 3DHJA 3GMPB 2DQTH 3UZQA 2LAGB 2NLJA 4X7CC 3ARBB 3P4OA 3QDHA 5BVJA 2FBJL 5T33L 4GAJH 3QA3A 5C0AB 1UJ3A 1YNTA 1NGPH 5J4MA 1G9MC 3SO3B 1N3NA 3NFPA 1S7WA 4K9EL 4PRPB 2A1WL 3TBYA 3EZJB 5DJYA 3C60C 4OLXL 3ULUF 5H2BA 1LEKB 3VE0B 5C0EA 3VXNA 4G9FB 4JO1H 3UAJD 4CU8A 4F7EB 5EFIA 4K3EH 5E9DA 1KXVC 3BMWA 5T3XL 3D3VE 3FN0H 4GJTB 5D70L 4PJAA 2EDXA 1H8NA 2MHAA 2B5IC 4NNPH 3TBTB 1CDGA 5IB3A 1U3HC 2V17H 4JJHA 3TC9A 3V4UH 3ULUC 4AENB 4G8GE 1M71B 4PGZA 4MNQA 1D9KA 3C09B 2XICA 3MJ6A 4ONOA 3DGGA 3WN5B 1TENA 4XP6H 1JV5A 2YD1A 5CBAA 1YEJH 1LE9B 5TQ2H 4LNRB 5IVZB 5I8CB 3N1FC 3U0PA 4P4KD 4NKMB 3WS6C 4JM2D 5DRZA 1AXSA 3C5JA 5IKCA 2R0KH 3DTXB 2BCKB 3BPOB 5E6IA 3KR3L 1I8MA 5BW7C 2ZG1A 2AGJL 5DJ0B 4AMKH 5FOBB 3H9ZA 3MRPB 3MRJB 3V6ZA 3OG6B 3VWKC 1HSBB 2V9TA 2WQ8A 4MVBD 2I9TB 3QQNA 4NDMA 1UB6A 4KH2A 4QRTA 4P46A 1QYGH 4NQEB 4XWGH 1CTNA 1MFEH 1NGZB 1XR9B 2IH3A 3T4AB 1QSFA 1UGNA 2DI7A 4B7IA 2BVQA 5SWSB 5EU5B 4OD3H 2C7UB 1WWAX 1BFVL 4DWHA 3DYPA 5HI4C 4ZXBA 4FRWA 3GMLA 3SPVB 1KIQB 3RNQB 4X9FA 2CKBL 5AUMA 4WV1C 1MCBA 5KSBE 3EIFA 1BECA 2NPLX 3EYOB 4PIRF 4JM4H 1CVRA 1CFBA 3HG1E 4ZDHA 5J6HB 1NGXB 4ZFZB 3PHOA 4NKIL 3ARGB 1SJHB 1S7SA 2ICCA 5D1QA 3IU3B 1SY6H 5E5RB 4WO4C 5L2KE 3CFEA 5EC2A 4DKEL 5D2LB 5IJVB 3TJEH 4UQ2B 2XRAH 5HGDB 3DYOA 4APQB 1HHKB 2WWMC 1VEOA 3LN4A 1G7IA 1C8PA 1J9CT 3ROLB 1FYTB 4M5YH 4DTGH 1WZ1L 5HHQA 3O2DL 1SY6A 4WRLA 3TN0D 5J06A 2HLFD 1O5DT 1VHPA 4JFHE 5EO1B 4OLWL 4FQXA 4OKDA 3KLSA 3HI5H 5B4MC 1I8LA 3LHPL 1H15A 2YPLD 2X4UA 4EDWL 3O3EA 1QPXA 4OCWH 1N2RB 2XTJE 2R2BA 3KPNA 4RFNC 4MNGA 4MXWH 4NQSA 5FUZL 1FP5A 3JBG7 5HVWA 4WHDA 1ZT4B 3B5HA 1AHWB 4N0CD 3GJFB 3S9DB 1D5BB 4MYWB 4X9HA 2DI9A 3BDBA 1IEAA 3E3QC 3QFJE 4AM0B 1BX2B 2GTZA 3VH8G 1UQSB 3FFCA 4NHUA 5INCB 4YQXH 1I9RL 1T7YA 3RHWK 1SQ2N 4Z76A 1G7PA 3GBLA 4J4PA 1XIWC 3MNZA 3TCXA 1L7TL 4IIQC 5I1KH 3P30H 1ZHBA 1E27A 2YUXA 3OGCB 5DFVC 1IM9D 2J7LA 4LBEA 2JJTC 3T65A 1ZANL 1EHAA 3HS0A 1HQRB 1MCOL 4S1RH 2OL3B 5FGCE 5HGGS 2H1PH 3BZEB 2FDBP 3OR7B 4JG1L 4FQIL 4PGEB 2P45B 5GGSB 4EDXA 1LO2H 3I2CH 4EZMA 4XPFH 3HZVB 1AFVL 3MO1B 1WCBB 3WEXA 2V5RA 1BAFH 4XNUL 4P4KB 2XZAL 1GXEA 2VMFA 5FDYA 5DQJA 4BSWB 1LK3L 4E41A 1KC5L 5F7HA 1BBDL 2XG4A 3L3IA 4P2OD 1R5VB 4HIHA 2DMBA 2DAVA 3RL1A 3GMPA 2VUOA 3DMMD 1Y0LB 5H8DA 3ARBA 3DSFH 2Q87A 1T3FB 4TN9A 4KI5D 4OLZH 5D7KE 5C0AA 4M7LT 2ITCB 3SJVE 4XVSH 2OMBA 3X3FL 3TYGL 3GUTB 1MCHA 5TE7H 1AXIB 3AVEA 4HK3N 4JO3L 2Q3AA 4OFVA 3MOAL 5KSVA 2JLLA 4PRPA 1XGYH 5E8PB 4OI9A 1F6LL 4RGNC 1HXYA 5D4QA 4N0RA 5TE6H 1LEKA 5KSAC 4WUKH 2GJ6E 3PIQB 4LOUC 2HT3D 3WD5H 3DNKA 2MJWA 3S34H 4KJWC 3PWUB 2JJUA 4LCYB 2FO4B 4F7EA 3V95A 3VDAA 4CKVX 2AJ3B 1I3RB 2AQ3A 3EJZD 3WKNA 4WTXA 5KSUB 4WGWB 4J8RB 2H9GB 2M1KA 4GO6B 2OR9L 4UDTA 3BQUC 1QRNE 3HAEB 1W72B 5JR1L 1PG7X 4PY8I 2ZG2A 1BGXH 1LO4H 2DWDB 3I84A 2W91A 4OCMC 1Z6JT 1IQWH 1M71A 3STZB 4KK9C 3WN5A 1U8JB 4XXCC 1FPTL 5BS0E 5A43C 2JB6A 4FQQA 3U9PL 4ZNCD 3G6DL 4M6OH 1NBVH 2VWEC 3BXNB 4H88H 4BJLA 1LE9A 4LNRA 4LARL 3V6OE 2WLYA 5JPMB 5I8CA 1MH5B 4PJDF 4NKMA 5DJ8A 3NIDE 2P46B 3DTXA 2BCKA 4P0DA 3NH7L 4WFED 4QKXB 1K5NB 3LQAC 3TN0B 1OGTB 3ZTJG 1JP5A 5FOBA 3ZT7A 1FJ1B 3MRJA 4FQLL 1HSBA 2Z8VC 2I9TA 2YPLB 5GJSL 4MZ2A 2UWEA 2W9DL 2EYTB 3DJ9A 3L3JB 3VFGH 4LRNH 4UT6L 2FL5B 2WIIB 4LEXL 4LKXB 2RCSL 4TSAH 1XR9A 3T4AA 5ETUB 1U8MB 5SWSA 4M1CC 2C7UA 5D7JC 1T66C 3D2UD 2NY3D 4G5ZH 2I60L 2OJEB 1QA9B 3MREA 3SPVA 1OTUC 1KLGB 4NWUH 4KK6C 1KIQA 3VRLF 5JW4R 3RNQA 3MRBB 3ZKSD 4UU9B 1UM5L 2Y4SA 3ABZA 4RMQA 3BAEH 1X3DA 3HE6B 3EYOA 4XI5C 1B4JH 4QOKD 2F5BH 5HYSA 5HVHC 3P0GB 1NGXA 4ZFZA 4PGJA 3ARGA 1SJHA 2ZJSH 3LQZB 4LPVA 1IM9B 4PDCE 4JHAH 4M48H 4JHBA 2IPUG 3O6KH 4OUUB 1OARL 5D2LA 5DHYB 2EEBA 4R97C 3NCJH 4EIZC 5IJVA 4UQ2A 5IGXH 5FYLH 2X4OB 5HGDA 4APQA 1HHKA 4XRCB 1NKOA 3NPSB 4N1HB 1J86A 4L3AA 1FYTA 1ZHNB 4PJBA 4YE4H 3HUJF 2OZ4H 2X89A 4F15C 1YNKH 5L9DL 5I17A 2H8PB 1OAXL 3ZDXE 4RAVB 1I7UB 4KVNH 5EO1A 1RMFL 5KBNC 5MHSE 3SE3C 1P7QD 3U46B 3ARED 3GJFH 2KKQA 2V17L 5H37H 2OZ4A 3NIGE 5D5MF 1J11A 4DN4L 1S78C 2X6MA 5GGSY 3RP1A 1RK0B 1AHWA 3GJFA 1D5BA 1T0MB 3PQYD 3S7GA 2JJVA 4AM0A 1BX2A 5GS0C 4ELKB 1LO5A 3C8DA 5C07D 1UQSA 5GRZA 3PDOB 4XMKL 1NFDF 3QO1B 4QY8B 1XGQB 4DGVH 5F7UA 1RPQA 1OM3H 4XX1G 4G7VH 1Q9KB 5INCA 2OL3H 3ZE0E 1P7KA 5I1EH 4ORZC 2DDQH 2UY7A 2NY4C 3OGCA 3B9KD 4JY4B 1AJ7H 3DO3A 3KAAA 1CR9L 2C3VA 4X6CB 1HQRA 3CDGB 2OL3A 1M1SA 5DMIL 4LSTH 4BFEA 1CDUA 3HE7D 5HHNA 3OR7A 4QHNB 5GGSA 4LLUB 3SGEH 1D5MB 4PGEA 2ARJB 2EDBA 4Q9CA 5INDB 3HZVA 3U1SH 1BD2E 2F53E 1RURL 3AAZB 1JF5A 1WCBA 12E8L 1XF2A 4OZFG 4EN3D 4OIIH 4P4KA 4JM2A 1I1YB 4GQPH 2HTLC 3TZVC 1N6QH 1R5VA 1DBJL 1Y0LA 1HILB 2NY5H 4MVBA 1T3FA 2C4FU 1B0RB 2MFNA 5GJTH 3WIFB 1SY6L 3RZCD 2D4DA 2ITCA 4ZQKA 4KDTC 1UM4H 4OKVB 3GUTA 5BV7B 3OXSB 5EDXA 5C0BD 4RGOH 2W0FB 3X14A 5E08H 3I85A 4Q74A 5E8PA 3HAEH 4R0LB 2QR0B 4Y0GA 1W72H 1NSNL 1A3LH 3RY5A 1T7XA 2PF6A 3RUGF 1LHZA 3D2UB 4QRRE 4KRPC 2NY3B 4QXGH 2X41A 2XQYK 4WI5A 1DE4A 3PWUA 4K23L 4LCYA 2FO4A 1CD9B 5I1AB 3MRKA 1I3RA 5C6TL 2ED7A 4J8RA 2H9GA 5F6IC 5I0ZA 1MQKH 3D69B 1E4XI 4F7MB 3HPLB 1IAIM 4AG4L 3O2VH 3L1OL 3NAAH 1W72A 3EAKA 4QCIB 4QOKB 4GG6B 1JGVL 4HK3J 2DQDH 2DWDA 4LP4A 4Q7DA 4GRWB 3LSOB 3NZ8B 4NKOB 1YJDH 1AQDB 1U8JA 4K3GA 3ULVF 4Z7WE 3RI5F 2VLMD 1X5HA 1AR1C 3O45B 4U05A 3BXNA 5ABDE 3BP6A 1L7IH 5DMYA 5JPMA 5CZXC 1MH5A 1G9ML 4N8CL 4GMSH 1WWCA 5J57B 3UTSD 4N8VB 5DGQA 4AT6B 1M7DB 2AJZB 4LVOB 1RUQH 1K5NA 4F7PA 1TMCA 3TN0A 1OGTA 3SE9L 2MKLC 4V1DE 1IFHH 1RUPH 2LAAA 3ULVC 2HVKA 1K9TA 3EO9H 1P7QB 4XVJH 2ZCLL 3AREB 3WO4C 3O8XC 2YPLA 3FAXA 3PABB 4JKKA 2OTUB 3VRJB 4IRJD 3H9YA 1N59B 2WIIA 5DMGC 5KVDL 4LKXA 4P5TD 1KCRL 3K81A 2H1PL 1INQB 5ETUA 1H3GA 3ULUL 1YY8B 3I2CL 1MCEA 4N0CA 3TV3L 4HIEB 3PQYB 2OJEA 1QA9A 5F7EH 1KLGA 1BAFL 1BWWA 2LU3A 4XBGB 4OV5B 3MRBA 2DKMA 4UU9A 2AK4D 2CH8A 2VLLB 3QDMB 2IANE 5CIPA 1FVCA 1AE6L 5C0RH 3NTCH 3CD4A 1S7RB 2O5XL 2C5DC 4YLQT 1ZA3B 3H9SE 1JGLH 3B9KB 1IM9A 1Q9WB 4G7YL 4F37F 2PTTB 3MZTA 4OUUA 2APWA 4MDIA 5DHYA 3S96B 5IBLC 4NO2A 4XB8A 4PJEB 2UUDK 2B7DT 4FXGB 4XRCA 4HAGA 3HE7B 1RIVL 2QHRL 3MJ9H 1MPAH 3X11A 3WIIH 3AXLB 4N0YL 3RIFK 3S36X 1ZHNA 3S34L 4NN6C 5K9JL 2JJSA 4EN3B 4RAVA 1I7UA 5HGHB 1ZKAA 5JUEL 1OAKL 3HNSH 1LVEA 5TDOA 4D9QD 3U46A 3SGEI 5BXFA 3MJ9A 4P2OA 2PR4H 4KZEL 2AI0L 3DMMA 4RISH 1PKQB 3MBEC 4GRLD 5J13C 5TGBB 5DJXA 1N5AB 2I26N 2XKNB 1ITBB 1H3XA 2YHGA 5L88H 4NCC2 4HUMB 3RZCB 4M1GH 5IMMB 3G6JE 4HWBL 1M7IB 5C0BB 1FAKT 1T0MA 4GBXC 2V9RA 3LZFL 3OR6B 4NQDE 2P8MB 4XWOC 3GM0A 4S10A 4WCYH 3GMOB 3PDOA 5F1NB 2H41A 4QY8A 2H2PC 1XGQA 4HZLA 5F7NC 4JAMB 2DQGL 3HMWH 4WY7H 4X7SH 4G6ML 3VD3A 4UBDD 3NBNA 4GKZB 1W0YT 4P2CG 3AB0C 4Z7VB 4KKNA 2WIMA 1CLZH 1UWGH 4DW2H 4JY4A 4HFUH 1CYGA 4MA1B 4D9LH 4X6CA 4ZO9A 3RX8A 1S5IL 3F58H 1L0QA 5DJAB 3JV0A 5D7IB 3QULB 4ZTOL 4LLUA 4OV6F 1D5MA 2DMKA 5DEGB 2ARJA 1GOFA 1OP3H 3P2TA 5INDA 1ZT7A 3KYKH 3AAZA 4F9LC 3BN3B 1PY4A 1ZXQA 3UTSB 2GFBB 5CSBA 1I1YA 4WW2F 3BAEL 5HPOA 2DF3A 4K2UH 4XHQA 5BV7H 4MLSA 4KY1H 1HNFA 2R8SH 1VENA 1NLDH 3U4BL 2OTPA 4W4NA 1R3HB 3OMZA 1VACB 4JZNB 4JFPB 4N90D 4L1HA 2BRRH 3JTTB 1RZIB 4RZCB 1Q0XL 3IDXL 1X6NA 5C0IB 3WIFA 3WUWB 4JHAL 2DWEB 5J12B 3O6KL 5TQ0L 3TPKA 2VR5A 1G9NC 3TT3H 4OKVA 4MMXC 4WW2C 3IS0X 3OXSA 4P5TB 1MFBL 4OLEA 4NRZB 3W2DL 4OF7A 4R0LA 5GZNC 3PGFH 3PNWB 4IOFC 4P3WA 3ZYIA 2IFFH 3EOTH 1MJ8L 2AJUL 1X4YA 3D2UA 4BUGA 1ZVYA 4GRWH 5HHPB 4BQ9A 4KVNL 1KN2H 2AK4B 5EIQA 4N0FB 1JL8A 4Z0BH 3U7YH 1HWGB 3D69A 4F7MA 4RDQG 3MTRA 1GYAA 4QCIA 4P5KB 4QOKA 3FZUD 2HKHL 1D6EA 3OKMB 1IBGH 3TPUE 4HIJB 4NKOA 3LSOA 3NZ8A 1EBAA 1AQDA 3V2AR 3T0EA 1G6VK 4A2LA 3BDXA 2HFTA 3GMMB 1YYLH 1CXFA 4KQ4H 3RA7H 2E7LC 4PYGA 3O45A 4R90L 1WBXB 2FEDC 2RIKA 4POYA 4X0KB 1DBBH 3SCMD 4N8VA 1NMCC 5SWQB 3ARDD 4JQVC 3K3QA 4AT6A 4ZFOA 2AJZA 1KOAA 3T3PF 4HG4J 4PRNB 5CJQH 1Q9LB 1P7QA 3AREA 4DGYH 1FCGA 1UFUA 1ZVSA 1ZLSH 1OLLA 3PABA 1WFTA 3MR9B 5TJWK 4UTAH 5C0FB 2OTUA 3VRJA 2VKXA 4GRLB 1AJ7L 3NCFB 1N59A 4NO5B 1YC8A 4NZRH 1FDLL 3QCUH 1INQA 3F6IA 3FOLA 3P77B 1YY8A 2PYED 4NM8L 4HIEA 2BOBB 3PQYA 5I75C 2XZCL 1AC6A 4KMTH 4PJ7E 3VW3H 4XBGA 2YEZB 4OV5A 1I9EA 4PLJC 5C07A 1DR9A 2QQQA 1ZHKB 5E8DL 2VLLA 3JV6A 2LQRA 4NQUA 4WHCA 5T3XE 4I5BB 4CUCA 3WNMA 1UCTA 3IDYC 5DS8A 1S7RA 2NY5L 2EO9A 2AS5M 1H9VA 5IEHA 1SEBB 1R24B 3B9KA 1Q9WA 4X6EB 1DL7H 3BN9C 5CJOL 3S96A 3K2UL 5JIKA 5C0NC 4F33B 4PJEA 4RGOL 4FXGA 3HE7A 3QHZL 3LS4H 4JQIL 4C4KO 3GI9L 1Z9LA 3AXLA 4WHTB 1REIA 4BZ2L 4NJAH 2CIKB 5FCSH 3B4NA 4XCFH 4I18C 4EN3A 3Q3GB 5HGHA 4BK4A 5I74C 1WIUA 2GHWB 3VXMD 1F8TH 1NBYB 1A4JB 3BGFB 1INDH 1NGWB 5HHOE 1PKQA 3VFPA 3WNPA 2DQDL 3OKDB 4I2XE 4YO0B 5SX5H 4R7DA 5TGBA 1C1EH 1KTRL 1N5AA 2VB5A 2XKNA 3FQXB 5GRVL 2EE9A 4AYFA 3RZCA 3KJ4B 4BSVB 5LKNA 1JWMB 4YEEA 1RFDL 2E7CA 1M7IA 4YDIH 4K07A 5C0BA 4KV5E 2AV1B 4X5LA 3PGDB 3OR6A 2P8MA 1DEEB 5TE4H 3GMOA 1QBML 4PS4L 2MTPA 5F1NA 5IK3B 3IRZA 1RUQL 2P49B 4JAMA 1EO7A 1J0HA 3HFML 2YSSB 1IFHL 1Z5LB 4CL7A 1TVHB 1Q9OA 4XP9L 3G9AB 4GKZA 4PJ8C 1PG7W 1XFPA 4Z7VA 4M8QB 3W81A 3CDFA 2AK1H 4HEME 3QEUB 3CZFB 3B2VH 1EHLH 4H20H 1LILA 1KLUB 1WJ3A 5D7LD 1T22B 1II4E 5GGQL 2YA2A 5D7IA 3QULA 5EA0H 3BH8B 3D39D 5DEGA 4UT7L 5IMLB 5DVNA 1RUKH 5F8RC 4NQVB 1INEH 1A1OB 2BY1A 5F7EL 3G5VB 1V3KA 3PXHA 2GFBA 3ARDB 3PF2A 4WFGD 1MAMH 4B53A 2QSCH 3IGAB 1SEQH 1OCWH 2BSSB 4S1DC 1DBMH 1BQSA 2EDTA 5GS0L 4UV7H 4XZUB 3RDTD 3NTCL 4DFIA 1R3HA 1VACA 3JTTA 2GT9A 5I1GH 4W70A 4HSQA 5HDLA 5C0IA 2DWEA 2FIKB 4IRJA 4IHOB 4RRPA 1QKZH 3VH8B 3QEGL 4P5TA 2EE6A 4ERSH 1MAJA 1DLFL 4NRZA 2VZTA 2VDMH 3PL6B 2ZUSA 1XF1A 1HZHH 2HA1A 4PP1D 2ORBL 4PTTA 1TDQA 4GKSB 4XMLH 2NW3B 4PG2A 2AK4A 1VB9A 4KQ3H 5LJYH 4N0FA 1L4IA 3CX2A 1F4WH 4JFEE 5IROA 5D1QC 1J12A 4P5KA 1M4KA 1QFWM 1HOCB 4HDIB 3S36L 4HIJA 3GSWB 3U30C 5EU7C 1RZFH 4WJ5A 2K3TA 1EEQA 1ETZB 5CEZD 3GMMA 2VRAA 3PJSB 1N0XH 4P5MB 2DJ4A 5SWZE 3RKDD 1WBXA 2NY6C 4X0KA 5I6XB 3GNML 4TULH 2VN4A 4X7SL 5I18H 4CW1A 3F7VA 2XY1A 5F7FA 2E27H 4O02H 3VXMB 5LCVH 1KCUH 1EX0A 1H8SA 5F1SA 4BYHA 1B2WH 1CLZL 5HYQB 4Y2DD 3MR9A 1UWGL 1YMMD 2J5LC 5C0FA 4HPOL 4HFUL 3CGTA 4GRLA 1RJLB 4GG8A 4NO5A 2H2SD 5DVMA 1Q8MA 3F58L 4JE4B 1MNUH 4QT5B 3X13B 3VG0H 4NZDA 2HFFB 3D1MC 2G5BA 4Y4HD 5MEOA 5I19H 4FZ8L 2F54E 3SKJH 1N7MH 2BOBA 2YD6A 1G0XA 4RMTA 3QUZC 5DRXB 2VDLH 2YEZA 3VFTA 3MZGB 2MNUA 1ZHKA 2BVTA 3KYMA 4CNIB 5CHNB 2FEEI 1D6VH 2YOCA 3O81A 5DUML 4I5BA 2R8SL 5DF0A 3L7EB 4RAHA 4UIMB 3WFCH 4X6BA 3ZKQD 1KIPB 4YHKL 4YWGH 3GHEL 4XVTL 3HA0A 3BD4A 4NP4H 5C70A 1SEBA 1UB5B 1R24A 3AS3A 1EVUA 4IDJH 3B9AA 4HMCA 3OX8B 1CE6B 5KAQF 4FFYH 3VCLA 4F33A 5D7LB 3I9GL 4PJXB 3D39B 3M1BB 2IFFL 4WHTA 3V5DB 3WHE0 5JORB 3EOTL 2FB4L 4GAFB 2CIKA 4DAGL 1BZQK 4H0IA 3O0RL 1P4BH 2J8HA 3CMOH 3Q3GA 3OKLB 3E6HB 1IAIH 2QJDA 5EBGA 5I2IB 3MOBH 4ZMAT 4U1NB 4XPBL 1YEGH 1NBYA 1A4JA 3JV5A 3N06B 3CLFH 1U0QA 1AI1L 4EOWL 3GJFK 4OCSL 5MENE 3T1WA 4RNRB 3OKDA 4YO0A 3SO3C 2Z31D 3FQXA 1KGCE 4ZFOL 3GMRA 3SY0B 4BSVA 4RMRA 1F4HA 2NY7L 4IOIB 1FE8L 1JWMA 1OT2A 4FQCH 3M07A 2Z92A 5EUOA 2DLGA 2AV1A 1AGDB 3QXTA 5GIRB 3PGDA 1DEEA 5F7WC 3DVGB 1ED3B 2LVCA 1OSZB 5IK3A 1KJMB 4KTEH 3W0WB 2EYRB 4JPVH 4OLVL 4IJ3C 2YSSA 1Z5LA 1UZ6F 1TVHA 4HWNA 3GSRB 1MFDL 1VSCA 2R39A 4M8QA 3WN5C 5EU4A 3QEUA 1MHCB 2WWKT 4YZFF 2VDNL 3GBNH 1EJOL 4LIQL 3GO1H 4KXZH 4XCNA 4DGIH 3BKYH 1BP3B 3EOBB 1AKJD 4B41A 3EO1B 1ZSDB 1TTUA 1T7WA 4NM4L 2BFVL 3TBVB 4K71B 1CBVL 4MAYD 3BPOC 4NQVA 5ID1A 3EFDH 1A1OA 2Y6SC 4M4PA 1DVFC 5D1ZD 4KMTL 1T20B 5D7SL 3G5VA 3S37H 1WEJL 1BBJB 2WM0A 4MNQE 1QBLL 2NR6D 3D3VD 3SCMA 3ARDA 4FQJH 5BZWA 2BSSA 3C5SB 3LRGA 5C2BH 4XZUA 1QD0A 2I9LB 5BOPA 1CGSH 4G8GD 3L95B 7CGTA 3IU4L 5T3ZL 4Y2DB 1YMMB 4PRHE 4M3KB 1DL7L 2B1AH 4U6TA 1HK6A 1UXSA 4IHOA 4NN7B 2D9CA 1CG9A 4ODVH 4X6DB 2R0ZL 4XXDB 4HMEA 4N0UE 4Z18A 4Y4HB 2PYEA 3VMPA 4YFDB 4DK3A 1GGBL 3MRHA 1IRAY 2BVUA 2FX9H 3NIFF 2NW3A 1KT2A 2Q8AH 5F7YC 3FFDB 3C87A 4O2EB 4HDIA 1HOCA 1SMAA 3AS2A 4ZAKD 2HFEB 3GSWA 4APQC 1PSKL 4WI4A 4FABL 1ETZA 2Z8RA 4JHWL 5GRVK 1DN0B 2JCCE 2YD8A 2QQLL 3L3HB 3PJSA 4K7PY 2X4NB 3BP7B 2UY6A 4P5MA 5LGHL 1A3QA 1JZ6A 4HS8L 4OZFB 4YXLL 1FAIL 4PLOB 4ONFH 2Y07H 1G9NL 2YXFA 1UA6H 1IKFL 4OZHA 1MQ8A 4QHUA 1IC1A 1NUNB 4O9HH 3H0TB 3ARPA 3ZSSA 3HG1D 3KGRA 4TOYL 1XT5A 4XHJC 3KJ6L 3VXMA 2W9EL 4ZSOB 4XPTL 4K7PH 1EVTC 3ARXA 5HYQA 4M43L 5L2KD 4ONHB 5TFSL 4H20L 1RJLA 3BDYL 2Z31B 5IIEB 5M95B 1JRHH 4QT5A 3X13A 3H42L 2D03H 2ERJB 2ZSWB 5DURB 2SEBA 4NRYB 1BZ9B 5E94B 1U93B 3UAJC 5DR5H 5DRXA 1DBKH 4JFHD 3MRFB 4OCRH 2VTFA 5FGBA 4DQOH 5TF0A 1MAML 3T0WA 4WI9A 5CHNA 5CD3B 1DBML 4YDLC 4H8WC 3GKZA 1EERB 2WUCL 5I1CL 3L7EA 4UIMA 1I1FB 1KIPA 3QIBD 4XP4L 2D7NA 1ZS8B 2XTJD 5A2KH 2DLEA 1LK2B 1UB5A 5FDWB 1S9XB 3S5LB 1N26A 3OX8A 1S7UB 1CE6A 4O58H 1QSEE 4NHUE 2PTVA 4KPHL 2F58L 4PJXA 1UACH 3QFJD 4AQ1B 1R3JB 4I0PD 2YRLA 2FZ3B 4AEIH 4MXQD 3V5DA 5D71L 5JORA 3NGBC 4MAYB 1OPGH 1AQKL 3QIUC 4FQHB 5D1ZB 3ROOB 4KXZI 3E6HA 2MPAL 1CXLA 3D3VB 1EJ6A 5CCKH 5I2IA 4Q9RL 5C0CE 4JQXA 1UKQA 3TO4C 1NKRA 1OL0A 3ECBB 1EFXD 1KG0B 3C8HA 4X7TB 4Z95H 4HUWB 5IM7B 4OI8A 5FCUH 3RDTA 1JHTB 3QUKB 4RNRA 3TP4A 3BKCL 5EZIH 4MD5B 1HINH 3OPZH 4G8GB 3FKUS 1FYHB 1CDIA 3HC3H 4AL8L 1RZFL 1B4RA 2Y06H 1PEWA 2Z93B 4OZIA 4IOIA 2DLIA 4IEFB 2Y72A 2UV3A 3ULUE 4GH7B 2L4OA 2OCFD 1AGDA 5GIRA 2NY2D 4HBCH 4HWZB 3UTPE 3DVGA 1ED3A 1NAKL 5F96L 1OSZA 1JUFB 1KEMH 1KJMA 1JF1B 2EYRA 2EZ0D 4FFZL 2VDRH 4KJQD 1IGIL 2E27L 4O02L 5CEZH 3DRTB 3GSRA 2X7LB 4LLDB 2VDQL 2V5MA 5F70A 5F9OH 5D7KD 1VGKB 1TQCB 1MHCA 3SJVD 2JELH 5FXCH 4ZAKB 3ORJA 3LV3A 1PEZA 1MNUL 1RHFA 1EMTH 3O3UN 5CJXC 1ZSDA 3EO1A 3TBVA 1RZJC 4KUZL 5I19L 2GJ6D 2A6KB 1A2YB 5IBUG 5IR1B 4PLKD 4Q6IC 1OP3K 3DPBA 1T20A 4ZYKB 1C16B 4ZUUB 4JZJB 5ENWA 5KSBB 1I8IB 3C5SA 1XGPA 1U9KA 1QRND 3K2MC 9CGTA 1OY3B 1EO8H 2I9LA 4Y1AE 2XY2A 3CU1A 4WHYH 3L95A 3DV6B 3Q6GH 4FQ2H 4HGWB 5BS0D 4Y2DA 1YMMA 3HZMB 5L2KB 3CC5B 4LMQE 4AEHL 4V3EB 1MF2L 4ISVB 3QUYC 1BEYH 3A67H 1F00I 4P57B 4JRWA 1RU9H 1ZEAH 1NMBH 1V05A 3P40A 2X09A 4X6DA 4AZ8A 4XXDA 3ZE2E 3LKPA 2RGSA 3QO0B 4UMGA 1OQXA 1WCQA 3HE6C 4JJ5B 2B0SL 4M7ZC 5D93C 5IB1A 3OJ2C 1YQVL 1IAIL 1MEXL 2XQYG 3VFSB 4K94C 3CX5K 4NPYB 5I76B 1CF8H 1HSAB 1P5UA 3CLFL 1FGNH 1H3PH 2OBGA 1HCFX 2YD2A 4R4ND 4O2EA 2EH8L 4JO2L 3MJ8A 3LPGA 4ELME 2HFEA 2V9QA 2D0HA 2XTJB 3KHOA 2EIBA 3NPSC 3LN5A 4P23D 2PKDA 3L3HA 2X4NA 3BP7A 3B83A 4NN5B 4KI5F 1ROWA 3QFJB 4KRNA 4I0PB 1CTOA 1RZKH 4OLUL 2XI9A 1M6OB 4I3GA 1U8LB 5TDNB 3CJJA 4KTDL 4LSPL 3IAPA 3LKSA 3CAFA 5JXED 3E3QE 1A8JH 5I15H 3C5ZC 1MRFH 3VI4E 4MQSB 3MLYL 1C12B 4DEPB 2CD0A 1EFXB 4HPYL 1L0XA 4DVRH 2MKWA 4KI5C 2BSED 1LO0H 2F5AL 4MQTB 3ALPA 4JLRB 4X4MA 3AS0A 4HBQA 5E2VL 5IMOB 3BP4B 2Z31A 1XH3A 3HLAB 3KXFE 5FGCB 3WJLA 5E24E 1MVUB 4LU5L 5DO2C 4Z7NE 3SDYH 5HDQH 2XWBB 3OB0H 1C5CH 2ZSWA 4KZDL 4C59B 4JPKL 2V2XB 4NRYA 1BZ9A 3EFDL 5E94A 1U93A 1GAFL 3IS1X 1BF2A 5HVFB 3MCLH 1FL5B 2NY2B 3S37L 5IWLC 4HUVB 1OSPL 3MRFA 4BFIA 4TUKH 2R69H 3MXWH 5MHSD 3O6LH 1MELA 3F6LA 5DI8B 5FO7A 2DQIH 3HPJB 5C2BL 4XCCL 5ICXB 5L7XH 4JFFE 2WINA 1RULL 4ZTPH 1I1FA 2ATPA 3FB8B 2AEWA 3GBMH 4EBQL 4D0DB 1ZS8A 3MRDB 4ZOEA 1LK2A 5T5FL 15C8L 2IAMD 1S9XA 5FDWA 5TH2B 5FO8B 1CFVL 3S5LA 3SJVB 2B1AL 2XQBH 1IC4H 2MSPA 4Z7QF 1OW0A 3IFLL 5IFAL 3D0VB 4N68A 1AKJA 4YX2L 4XP5L 1YNLH 3D6GA 1X5AA 2GJ6B 3GSUB 4MAYA 3UPCA 1FVEB 3QI9C 1BQHB 4FQHA 5D1ZA 2CLZB 3SDDC 2BVPB 5CZVL 4HEPG 4RGNE 1PDKA 4F8QA 4I0KA 3ECBA 4JO4H 4LGSB 1KG0A 5IM7A 4HUWA 4XNZB 1FH5L 1JHTA 3QUKA 1S7XA 5KANI 4MD5A 4G8GA 1UC6A 4JANB 5SX5K 5BS0B 4WI7A 4GG6F 5B21A 5LG1A 1RIHH 2DM2A 4GRWF 1UG9A 4DN3L 1NGQL 1BD2D 2EC9T 1EHNA 2F53D 2R2CA 2ZUYA 4HKZB 1U58B 2VDOH 3TBSB 1IAMA 4HWZA 2HRPL 5CJ5A 3HHRB 5ICZB 1A6TB 1I1AC 4YHNB 4UOJA 1JUFA 4PP8C 2X9WA 1A21A 3QYCA 1JF1A 1NCDL 4P9HH 2R15A 4YHZL 2BZDA 3VFNB 1BJMA 1OOAA 5K33A 1FFOB 2P1YA 3DRTA 4AJ0A 2X7LA 2OSLB 5EU3B 4G6AD 2OJZL 3DX7A 1KF9B 2HT4D 4YPJA 1VGKA 2ZOKB 3KYAA 1GGCL 4ZAKA 4PUBH 5IB4B 3QWQB 1JRHL 3T4YB 3LOWA 1FGVL 4P23B 1I8KA 1UCBH 1TITA 5JXAL 1FQ9C 1CXKA 2EKJA 3FMGL 1U8HB 3B8SA 3BPNC 4PJDE 4QRRD 4XBEH 1A2YA 2RFXA 3MROA 5IR1A 1K2DA 2KPNA 1MCKA 2F8XC 2PXYC 4ZYKA 1C16A 4ZUUA 4JZJA 3MRNA 4UINH 1IEBB 5KSBA 1I8IA 1E6OL 5ICYB 1A6VH 3NCEB 3QPXL 4NCDA 4Y5VA 5I8OL 4F7TB 3HG1A 4DZ8B 5EN2A 5B39B 4K7FB 3D0LB 3DV6A 5J7CC 2BJML 4Z9KB 3ARTA 1F13A 4NQXB 4RA0C 3GFUA 2AV7B 5L2KA 3CC5A 3V5KA 2Q8BH 2FNBA 5TPWL 4P57A 3A6BL 4ALAL 2P7TB 1S9YB 2EKSB 1TVBB 4YDVB 3QO0A 4TUOB 4GAGL 5EOCJ 3VRLE 1YECH 4ZD3L 1KN4H 1WAAE 2COQA 4S1SH 3OAYH 1E28A 1MJUH 4JJ5A 3K1KC 1KNOB 4V1DD 2VAAB 1SBSH 4F9PA 2HH0H 1HDMB 3VFSA 4XNYH 3TLRA 5I76A 2A77H 2RQ8A 5D9SB 4Z95L 3S4SB 3WIHH 4XCYA 4IMLB 1OTSD 3RWIA 1J1PL 3QIBA 2AJVL 4PJFE 2IQAB 2Y06L 4WTZA 2IAMB 5E7BA 3V6BR 1ULVA 3ULSB 2NY1C 1NFKA 1U8OB 3S35X 5JQHC 1IVLA 3REVB 2GUOB 3MGTB 4YDJA 1YEHL 4O00A 3WIHA 5DJ6B 4MXVF 5EOQH 5IP4A 1NGYB 4MJ6B 3TESA 3WXWH 2ZNWA 3QFJA 4HJJL 5A2JH 1FNFA 3PG2A 2KH2B 4PV9B 4MXQA 1RZ8B 1M6OA 1U8LA 5TDNA 3DXAE 2IAND 3EYSL 3LKOB 1P6FA 3FOMA 5IVXE 3MLRL 1ZLVH 3O41B 4YBQC 3F62A 4G6JH 3SOBL 4AY0A 1RI8A 1C12A 1GIGH 1BFOB 5CP7A 2P43B 4N9GB 5D5ME 3H9SD 1LQSR 3BPCB 4L8SB 3VA6A 2RHEA 4JLRA 5FUOL 1YA5A 4I13B 4POZD 3L5JA 2G60L 5IMOA 4Z7VF 4JG0H 4YXHH 4WI3A 3H9HB 3LRSB 4X80L 5T1DH 2VDPH 1BWMA 1LP9E 1MVUA 1EMTL 7FABH 4S1QL 2WBJD 3KLDA 2ICEB 4U6VH 3SQOH 1UWXH 1A7RH 1BD2B 1CCZA 2F53B 2VC2H 5D7IF 3U83A 3IJHB 4F3FB 2YUVA 4JVWA 4PR5B 1FL5A 4KWUA 3SQBA 4HUVA 3WNLA 2L0DA 4MQ7B 3BZFB 3DETC 3LS5H 4U1MA 5DI8A 3HPJA 1IC5L 2HLAB 3CDCA 4BQ8A 2VLJB 5EO9B 5ICXA 3WL9B 1EO8L 4NZJA 5DUBB 3LMJH 1BHGA 3MCG1 2VQTA 3NA4A 4D0DA 3MRDA 3Q6GL 4B5EA 5F7LB 5TH2A 3BWAA 4QYOB 2BHUA 3SJVA 1EEZB 5I30L 1RU9L 3D0VA 1NUDA 3P9WB 2GITA 4NQDD 5IOPB 1A7BA 1KCGC 3T04D 2GJ6A 3GSUA 2ED8A 4QRRB 3S6CA 1FVEA 1BQHA 3FQRB 1MFCL 4XH2B 1J0KA 1MCNA 3KVQA 5ANME 4I3RH 4R9HA 4OM1L 4JFZL 3A6CL 5IT2H 3FB6A 1Q0YH 1QRNA 1FGNL 2VXQL 1H3PL 1U3YA 1A6WH 2EDQA 1RHHB 3QH3B 4MMZC 5DT1L 1H0DA 3OBAA 4BH8B 1TZIB 3HZYB 4H0HB 4H8WL 4JANA 3AS1A 1JNLL 5IJKC 1VFOA 3QCVH 4PB9H 4Z7WB 1JPST 4P3CH 1ZGLB 1DEDA 3TBSA 2XOTA 3RUGE 1HYSD 2EH7H 5DA4A 3V6OA 4LGPB 3UJJH 5L6YH 4GSDL 4DUVA 4J3UA 3FHAA 3TYFB 4CVWA 5ICZA 1PLGL 3O2WH 1FORH 5GS3A 3ZDYF 4JPWH 5IROC 4KHXH 1JF6A 2O26U 4X83A 1UM6H 4V1DB 3VFNA 2ENSA 4TNVK 3QUXD 3OXRB 2GK0B 5JOEA 1I85A 4F58H 2ZUXA 2DD8H 5BO1L 2OSLA 3CXDL 5GISH 5LVEA 3D18B 4FHBD 1DQDH 2ZOKA 2RB8A 4QXUH 5DD3H 5L8JB 5IB4A 1ZA6B 3ULVE 1CL7H 3HMXH 4LAQH 3R8QA 3N9GL 1QLEL 4P23A 1MCLA 3RWFA 4G3YL 1V7ML 1U8HA 3PUCA 3G6AB 1TPXB 4KI1A 4N5UA 4X98B 4TUKL 1KJ2L 1IEBA 3HMXA 3MXWL 3EYVB 3O6LL 3QDJE 4PD4K 3T0EE 5ICYA 5KAQG 2GI7A 2IANB 2DQFB 1FNSH 4QLRA 5FFLA 5JXEA 5L7XL 2XACC 3UYRH 3IJSB 4DZ8A 3T8XB 5B39A 3V79C 3RVXC 4JGUA 3ZL4H 4K7FA 1FLTX 3H9SB 1J8HE 3SDAD 4NQXA 5EZLB 1GGIH 4PB0H 2AV7A 3PP4L 1O0VA 3PWVB 2P7TA 4CVXB 2AJYL 2EKSA 1TVBA 2WBJB 1GPOH 4YDVA 1OF2B 1KTDB 4NFCA 4TUOA 4R4BB 2ADGB 1F97A 2X4TA 1OT1A 3KPSE 4E0RA 3MLSH 2DN7A 4UBDC 1RZJL 2VAAA 1HDMA 2CO7B 2EXWC 2FECI 1QFWL 4KJPD 5D9SA 3S4SA 2YK1H 4IMLA 4YDKH 3TFKC 2YN3A 5CFHA 3VJ6B 2YD3A 3QRGH 3U4EB 4LIQE 3RGVC 2VE6B 2IAMA 2ZUQB 4WU7B 3C9NA 1U36A 1U8OA 4IMKC 5CUSH 5EWIH 3REVA 5FF6B 2F9BT 4JDZB 3PV7A 5DJ6A 4D0BA 1NGYA 4OTXH 5J6GB 3H7BA 4NQDB 5HGBB 3FQUA 4PJGF 4PV9A 1OGAE 1NUFA 4D3CH 2X1OA 5DA0B 1RZ8A 1WFOA 1V8HA 5T3XD 4N1EA 2IPTH 3IFNH 3LKOA 5DSCB 3MOQA 4KROD 2E9BA 1BFOA 2CXKA 4N9GA 3QCTH 1C08B 1HCVA 1A7NL 3IB4A 3KJ4C 4L8SA 3JVGA 4MSWB 3IFPB 2V5YA 1KLFA 3RTQC 5T3ZE 3IDIB 1X5LA 3H9HA 3LRSA 5DUPL 2ZUVA 1FC2D 1DSFL 1LO3H 3ZKNC 2GAZA 3AY4C 5AWNL 4ZODA 1YEIH 2ICEA 1YC7A 1BD2A 3OJVC 2F53A 2WUBL 3EYQD 4YHYB 5HI3D 4F3FA 1BJ1H 1MSPA 2KZ1B 4PR5A 2VLKE 4MQ7A 3BZFA 1A6VL 3NFSH 3M17B 1Q72H 5J3HC 1H5BB 1MIMH 3IDNB 5EO9A 3QUXB 3WL9A 4M62L 5HHOD 4FG6D 5KG9B 5DUBA 2A73B 5GRYA 2H3NB 3U7WL 5I9QB 2A9ML 2Q8BL 1JHKH 3B5GA 3D85D 3MACH 1QLRB 1RD6A 1J18A 1F3DJ 4U1SB 3VFWB 5CKAA 5IOPA 4D9RE 4MS8D 1ERNA 1NAML 1DANT 5CILH 1ZT1A 4QRRA 2AP2A 4K55A 4TTDD 5BZDA 4RMWA 4S1SL 4Y4FC 4ODSH 3FQRA 1A1NB 1O7VA 4HC1L 2PW1B 1A47A 4O4YL 4LSRH 1CL7I 1EAPA 4U3XA 3LDBC 5IW1B 3W11C 1ZGLP 4GQ9H 1UZ8B 1RJZA 4L29B 5FKPB 5KVFH 3TPUB 4NGHH 2EDFA 5IQ9B 1TZIA 3HZYA 1V7NL 3MC0A 3SDAB 1VEPA 5CD5C 2BY2A 1E4JA 1KBGL 1TZGL 2D0FA 2HKFH 4KVCH 5H37G 2Z9TA 3L3GB 1SM3L 4UDUB 4X8XA 4Z7WA 1ZGLA 3PL6C 5J11B 3HZKB 3SKMB 2YN5A 5KJRH 2B1HH 3WXWL 4XPAH 4B50A 2ZSVB 1RZ7L 3UPRB 1A9BA 3TYFA 4M6NH 2Q7NA 3BVNB 1JVKA 3INUL 2C1OB 4LSUH 4HKXB 4LSVH 2E7LE 4LFHD 1G1CA 1KENL 4V1DA 2BXYA 1A5FH 3P9MB 3S35L 1OP9A 3OXRA 1Q38A 5B8CB 1EXUA 1SJVA 1W8NA 2AEQH 1ADQH 3KWWB 3FT3B 3BW9A 3PWPE 4XBPB 2PCPB 3KYNB 1QFOA 1T89C 3RVVC 4JG0L 1ZA6A 5C86A 4OD1L 1JYWA 5T1DL 2A9NH 5CGYD 1KFAL 1E4KC 3FB5B 1KELH 5DK0B 4ODTH 1ZTXH 5I6XC 4LSQL 1KV3A 2IFGA 2F8OA 2CGRH 4YHIA 3RVWC 5C92A 2D7MA 1ADQA 2ZCKH 3G6AA 1MCPH 3ILQD 4PJ7B 3R0MA 3MA9L 2FR4B 2KQMA 4X98A 3C08H 4NFBA 2ADJA 5D1XC 4Y16D 1G7JB 4YBLC 4AIOA 1IT9L 2IANA 2DQFA 1QG3A 4JFED 1N4XH 1XF3B 3FQWB 1JJUA 4FFWC 4HCRL 3RWEB 3IJSA 4KROB 1CE1H 1H8OA 1QACA 4NZUL 1NBZB 3B9EA 3H9SA 3V7AG 2HMID 4L3EE 3GKWH 5EZLA 4BUHA 4F57L 1TIUA 1AXTH 5JZ7D 2GTWB 3PWVA 1K8IB 2ZPKH 5SWZD 2DLFL 3L5XL 2WBJA 3I75B 4PY8J 1B0GB 2ADGA 3U4AA 1BQLH 2WQRA 3HAEG 1KTKE 3DARA 4OB5H 4KKLD 3ELAT 1E4WH 5EZJB 2F15A 1J0YA 2DBJA 3DI2B 3WHE1 3BKJL 3QDGE 3ERYA 5IT2L 4OSUH 2O61B 3EUUA 4M7KL 1WT5A 5HHOB 2J8OA 4OFPA 1FIEA 2B20A 2DS4A 4I2XB 3NCMA 5DRNB 3TNNB 4LQ1A 3U4EA 2BX5A 5FUCC 2VE6A 4WU7A 5BRZB 1BIIA 1AGFB 3G6JA 5I1LB 4TPRL 3D85B 2F54D 2R23B 5FF6A 3TGXA 4JDZA 3LKQA 3EOAA 3WSQH 1MUJB 5J6GA 1NUGA 4NQDA 5HGBA 3O11A 1CFNA 4YFEA 3TF7A 2R56H 2R29L 2CKBB 3FO1B 3WFHA 1JCKA 4WFHE 5DSCA 1BLNB 5EH1A 4JB9L 5J1AB 3GSOB 5GGVY 3RU8H 3BPLC 1I7ZB 3P4MA 4NNXB 4PGBB 4DKFL 1DQJA 1C08A 3S88L 4OBRA 1F45A 1DLHB 4QWWD 2EIDA 3P0YH 5C6PB 2B2XH 4MSWA 1CXEA 4OZ4A 3EHBD 4F2MB 3MPCA 3EW3B 5E0QA 3MUJA 5DD3L 4OM0L 5IFHL 1WSST 5IHBA 3RIAK 1NMAL 4TSCH 4LCUB 2GCYB 2FX7H 2YKLL 4Y5YB 5A2LH 3OB0K 4OGAD 2HJKB 5GGVH 3GRWL 4OGXL 4ETQA 5C08E 1JPTH 3TT1L 4M8VA 4GFTB 3M17A 3PP3H 3L7FB 1H5BA 3IDNA 1FNSL 1XMWA 3U7AA 4BA8A 4Y5XB 2DQCH 5MEND 3QUXA 3ZL4L 2A73A 2H3NA 1KGCD 4ODWB 1TCRB 1S7QA 2ZKHH 1AGBB 3O6ML 2XT1B 3JV4B 2XWTB 4WWKC 1IGYB 2X4SB 2WWKO 1QLRA 1A3RH 4Z7OE 3VFWA 5LWYH 3VWJD 1A22B 4FA8A 4ZFGH 4XMPH 1FRGH 4BZ1H 3ZHLA 1GVIA 4MA8L 5E8NB 1HWHB 2A6JB 3MLZH 2AERT 2EDEA 1A1NA 3TVMA 2PW1A 3JTSB 4QXTB 4Y16B 5IW1A 2QQKH 4JFEB 3FJTA 4L8CB 1UZ8A 2WV3A 5FKPA 2W0KA 3K4AA 3B2UD 3TPUA 2YMXH 5IQ9A 1U41A 1A6PA 2F19L 2AAVA 3HC0B 3DX8B 3SDAA 3N85L 2VXUL 3SGKC 3HB3D 4UDUA 3L3GA 4Y4HC 5CUSL 2WY3A 4MJIE 4H25B 5SWZB 5DD6B 5EU7E 4U31A 2ZSVA 1Q1JH 2HYMA 2YBRB 4NO3B 5CBEA 3UPRA 4MNQD 2FBJH 4I9WE 3U9UB 2C1OA 3CNKA 4HKXA 3IFNL 1T04B 1U8PA 4PBWD 3P9MA 3CXHK 5B8CA 4K9EH 1IGTB 1MRDH 2YRZA 2A1WH 3LCYA 3FT3A 4OLXH 4PRHD 1JFMA 3AM8A 2BVEA 2PCPA 4R6UA 3KYNA 5E6ID 2V6HA 4GAYB 3PWNB 3FO0L 4QHKI 5T3XH 5D70H 4Q6YA 2C3XA 1YEIL 2F54B 1FL3B 1ND0B 1CI5A 1BOYA 4H5SA 3OHXB 1FZKB 4L4TE 1WC7B 4PJ7A 2FR4A 4D2NA 4XNQA 2WBWB 1G7JA 2X10A 1XF3A 2AXHA 1RZKC 3FQWA 3RWEA 1KB5L 3SO5A 1EH9A 2RAMA 2HT2C 5E1HB 1JGEB 2ERJC 2EE2A 3KLAB 3KR3H 1XGRB 1L8JA 2CK0L 2AGJH 2GTWA 2R0WL 5MP6H 1K8IA 4LRIC 1KJ3H 3SKOB 2NXYD 3I75A 3CFKB 5C8JB 3IJYB 1O7SA 1K85A 1B0GA 2I5YL 4LNVA 4RMUA 5ESVB 2VR9A 5J9PB 4G8FA 3KLHD 3QPQD 5K9QI 1NC2D 4GUPB 1JNNL 5KZCB 2CQVA 3OAYK 1T0PB 5F71A 4KAQL 4S0TD 1NCBL 2YA0A 3ZT6A 4X9IA 5F1IB 5D2NC 4X7EC 5MENB 1BFVH 5KVFL 3MRRB 4I2XA 1OAYL 1A1MB 1FL6B 5DRNA 3TNNA 3QSKB 1JTTA 4QGTA 1SJEB 2CKBH 3ZLQC 1JK8B 5ESQB 1AGFA 1OB1B 4MAYC 3D85A 2MQ3A 2R23A 4N8VG 2VQ1A 3QEHB 2B1HL 1MUJA 1TQBB 2NLJB 1WIOA 4MS8A 3EDJA 2CRMA 4O2CB 3P4OB 5BVJB 3H3PH 1VGEL 4NKIH 1IGJB 1UJ3B 2CKBA 3F65A 4QTHA 3FO1A 4LSVL 3ETBF 4DKEH 4G9FE 1BLNA 1CICD 5J1AA 3GSOA 1S7WB 1PY9A 1I7ZA 4PGBA 4JKWA 1ZLVK 2AEQL 5HI5D 1ADQL 1Z3GL 3TBYB 5FYJL 3LKRB 4HFWA 1LMKA 3RY4A 4CDGC 1WZ1H 4F2MA 4QNPE 1QSED 4GXVH 5GRJL 4NWTL 3DOSA 4OLWH 3OTTA 1KELL <