1K5NA

Hla-b*2709 bound to nona-peptide m9
Total Genus 79
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
79
sequence length
276
structure length
276
Chain Sequence
GSHSMRYFHTSVSRPGRGEPRFITVGYVDDTLFVRFDSDAASPREEPRAPWIEQEGPEYWDRETQICKAKAQTDREDLRTLLRYYNQSEAGSHTLQNMYGCDVGPDGRLLRGYHQHAYDGKDYIALNEDLSSWTAADTAAQITQRKWEAARVAEQLRAYLEGECVEWLRRYLENGKETLQRADPPKTHVTHHPISDHEATLRCWALGFYPAEITLTWQRDGEDQTQDTELVETRPAGDRTFQKWAAVVVPSGEEQRYTCHVQHEGLPKPLTLRWEP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords major histocompatibility complex molecule HLA-B*2709
publication title HLA-B27 Subtypes Differentially Associated with Disease Exhibit Subtle Structural Alterations
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 79
structure length 276
sequence length 276
ec nomenclature
pdb deposition date 2001-10-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00129 MHC_I Class I Histocompatibility antigen, domains alpha 1 and 2
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1k5nA02
3.30.500.10 Alpha Beta 2-Layer Sandwich Murine Class I Major Histocompatibility Complex, H2-DB; Chain A, domain 1 MHC class I-like antigen recognition-like 1k5nA01
3LKQA 3BP4A 1B6UA 3FQRA 1Q38A 3QDAA 4BUHA 3BYTA 5L88L 4ACPA 2R2EA 1IKFL 3U48A 3OAZH 4Y5XB 2GKIA 1RUAH 3EHBD 1Y6KR 3SY0A 2QQKL 4Z7QF 2OJEA 3IS0X 4MD5B 4U33A 4JQVA 3O3EA 4J3VA 4GG8A 3DVFA 4B5EA 1I1RA 2IAMA 4HLJA 2ZKHL 3KHOA 3H7BA 1CN4A 5T33L 4KJQC 4S1DC 1TCMA 2IANB 4UOW0 1IQDB 5CP7B 3DECA 3ARGC 5DMIL 5I6XB 3KG5A 2BSTB 1V05A 4GBXD 1F3JB 4MXWL 3RZCD 3PIQB 5F3HA 3HE6A 3LKOB 5A2IH 3OR7A 3W9DB 1BEYL 4ZAKA 2YWZA 4GRWH 3WEXB 5EU3A 3AAZB 1KJ2A 3VXNB 4MWFA 1YEHH 5DJ2B 1EERB 1NAMB 3E6HA 4YUEH 1KNOB 1Q9KB 4FXGA 2J88H 5SWQB 3IDXH 5T3ZD 1DZBA 5FYKD 5A2JH 3R8QA 1YNTA 4PRBB 4PGDB 2LU4A 5D7LD 2VL5B 4I3SL 1IAOB 3PGFH 4FG6C 5J3HC 1H5BB 5IKCB 4BZ1H 1KPUA 4Z7VE 5CUSH 2AK4D 5I15L 1HYRC 2DI9A 1BFVH 3MJ8A 5I66B 3B9KA 1Z0NA 4CMHC 4JN1H 3AS3A 3AU1A 1PEZA 3GMMB 3OJVC 3QG7L 4IBLT 3QI9A 1D5ZA 4JQXC 2XTJD 5FF6B 5DJZA 5TFSH 2VXSH 5DEFA 5HI3D 2B4CL 3D85A 3W0WA 3WFCH 1JPGB 2DQFA 4LPCA 3RHWF 2DKSA 3HZMA 4UAOC 4DUWA 2XA8L 4I18C 4K2UL 1U41A 1AGEA 1MCBA 2Y7QA 2ZUXA 3FO2B 3LQAH 1RJZB 4QHNB 1J9CT 1RZFL 2GTWA 4WI2A 3VFSA 2R9HD 3KYOB 4WI8A 1T03H 4UI2A 5TH2B 3O3BB 5GGVL 3QNXA 4KC3B 4X99A 5C71A 4LASL 2VLRB 5LGJA 3WL9B 5SWSD 4GUPB 1AXTL 5E8EB 2XZZA 3NCYS 3JTCA 3CX5K 4OZGE 4GJTB 3CXDH 5E2TL 5IMLB 2O61A 5IFAL 3BP7B 1S8DB 3VXMA 1L7IL 3PABA 1QRNB 2HAZA 1GZPA 2E7LC 2E8ZA 2B0SH 2I9LB 4NO5B 4JM4L 4L8CB 3L5WA 3PWLA 5EOCL 4K3EL 3ULUH 4JB9H 1YN6A 5HD8C 4OQTL 1FL5B 4NQXA 4R90H 4DFIA 1N4XH 3QDJB 3MLZH 3VFUA 3ZTNL 5C0BA 1HHKA 3WO3B 3CLFL 4EQ3A 1UACH 4GRWE 3MJ7B 1KIQA 2A0LC 4P46C 4KJQD 3EDDA 4S1DD 1EA9C 4LAQH 5CZVL 5HJ3B 3MGOB 3ARGD 4JR9H 4NNYA 1Z9OA 4R6UA 1CFSA 3BVNA 3SOBH 1YDPA 5C0RH 4J1UB 5D7SL 1XZ0A 2QL1A 3QULB 5EU6D 1NBZA 1KCGC 1ZHNA 1XGRB 4UT7L 1II4E 3IRPX 3GJFA 3A67L 4ZUTB 3LSOA 2ICEB 4U6TA 3MV7A 3NZ8A 2J8OA 1MCQA 1EX0A 4OZIF 5D8JL 2ESVE 1P7KA 3P73A 3IFLL 1YMHB 2Q3ZA 1ZV5A 4QRSA 3VXSB 2P7TB 1S7VB 2R4SL 4FG6D 3QBTB 3BWAB 5J3HD 1LO4L 5KANI 4X6DF 4JQIH 4L9LC 5IROA 1MREH 4PRPA 2A77H 4HUXA 4R7DB 2AS5M 4JRXE 2WM0A 5FKAA 3SGDI 1RIVH 1TIUA 1DQDH 1SJXA 4LKXA 4UT9L 1UM5H 4HV8A 5I1GH 5B3NA 3GMPA 3FONB 2FJFA 3HR6A 4KZDH 4Y89A 4ETQA 2JELH 1C12A 4UUJA 3DRTA 2VWEE 4V1DE 2GYSA 4FQ1L 2JJWA 3Q1SL 5IMMB 1D5BA 4UV7H 1W72L 4OCWH 2GITA 5IT2H 1G7QA 2Y36H 2DWDA 4I4WB 4XC3H 2CKBB 2GSIA 5TE6L 1MRCL 1OGAB 3NPSC 3C9NA 4XGZB 2X05A 1U93B 3C2AH 2FX7L 1T7XA 4PRIA 5LG1A 5DO2C 3OKDA 4MCYA 4H25B 4UILL 3MRPA 3QUXC 3MRFB 2D7PA 1B2WH 1ZLSL 3ULUE 1YMMD 4AJ0A 2P8PA 5L2KE 3U4EB 2MKLC 4HBCL 3VI3F 2NX5B 2LE9A 3H9SD 1P7QB 5C8JA 4HIHB 5HYJA 4MQSB 1G9NC 2X9WA 3HNVH 4OCMC 5HD8D 1D5IH 3PL6A 4JG1L 5EO0B 4HSQA 1W0YT 2IWGA 5CBAA 1UVQB 3TNNB 2A0LD 4P46D 4YHMH 1MCJA 1XGYH 3GBNL 1MFAH 3E2HC 5DMGC 4O2EB 1AD0B 1U3HA 1U91A 1RZ8A 3VRJB 3D0LB 4OLVH 2ZOKB 4WI6A 3REVA 1B6DA 4MXQA 4WU7B 1LK3H 4HFUH 5F1OB 3P9MB 1ZS8B 2B1HH 4MD0A 3TBWA 4QRPB 4JRYA 1X44A 4KK6C 1HHJB 2IPTL 4GRMA 3QZWG 1QSZA 4G8EA 4OCXL 1T89A 2VH5H 4JG0L 2GSGA 4HZLB 2E7BA 3KPRB 2X4OA 3F6IA 3W9EA 5DEGB 4W6XB 5KTEH 3ECBA 4HDIA 4HFWB 2HG5A 3MOAL 3O3AB 3DBXA 3SGJA 3O3UN 3UTZB 5KAQF 3HZKA 2W38A 2ICCA 5FV2A 4KKBC 5DUBA 1YEGH 2CDFA 2Q8BH 4O2CB 5DD1H 1W0WA 5C1MB 2XI9A 2X4QB 1OSPL 4PJGB 4LQ1A 5D1ZC 4QF1A 3T4AA 1K5NB 3QI9C 5K59F 3FB8B 5JOEA 1MF2L 5IWLC 4CN4A 3OB8A 4XNZB 1G84A 2Q7YB 1MLCA 1YEDB 4XVTH 2AQ3A 1GIGL 1ZGLA 1KBGH 1FC2D 4L3EE 4X7DC 1RK1B 2CO7B 1AQKH 4FQIL 4RWYL 1UB6A 1X5AA 2P8LB 4XPTL 1A8JH 4WJ5B 1C5DA 4HS8H 1F4HA 3RIAF 2GJ6D 1YN7B 2OL3H 1X5JA 3QA3A 2AABL 5BV7C 3QIUD 1HOCB 3RGVC 3EYSL 3L9RB 5DRZA 4P2QA 3UBXA 3HAEA 1TJHH 1M71B 4XMLL 5E2WL 3N06B 2DQGL 5DO2D 4G7YL 2NQCA 3UCRA 3NCYP 3QUXD 2R8SL 1R3KB 4KI5E 4GBXB 1R24A 4OLXH 1NCCL 2A73B 3ALXA 3LS4H 1RJYB 5DS8A 3BQUB 2FX8L 1SYVA 5DLMH 5FUCE 1LMKA 1IC4H 1WICA 4NQDD 4A6YL 2EE9A 5CEZL 4ELKA 4WUUE 2A74B 5H35B 1F6AB 3IVKA 4MB4A 4XPGL 1BJ1J 2AJVL 1OQXA 2WUBL 1J0IA 2JK5A 4HG4K 5E9DE 2MCPL 1QEWA 3B6SA 4L4VD 5DMGD 3TF7A 2NTFB 1MFCL 3U7WL 4OQ1A 2QSTA 5TDPB 3Q6GH 3BPCA 2AK4B 2P47B 3U7YH 1M05A 3B5TA 4G3YL 4M4PA 3AS0A 4ALAL 3VH8B 3MUJA 4R3SB 3SE9L 1MCEA 2ENYA 5HYEA 5HDBF 3EFFB 5HYFA 2AV1A 3C09B 4KK6D 5FDYA 3WIHA 1OAQL 4IEFB 1MFBL 2BMKB 2UY6A 1BFOB 2HFGH 1FIEA 1ZHLB 1Q1JH 2J6EA 1F11A 5KW9H 1NCTA 3BGFC 4GKZB 4NKOB 4HPYL 3TBYA 4KKBD 5T1DH 1T20B 1A3LH 3KYKL 2JLLA 3FB5B 4LSTH 2DL2A 1ZT1A 2JIXA 1G6RH 3BW9A 5GSRA 2I07A 2Y4SA 5D1ZD 1FZMA 4QYOA 3HMXL 4NSKA 4WNQA 3B5HA 1AY1H 2Z9TA 4ZOAA 2G75B 2VXTL 4LCWB 3QEQA 5L9DH 1R3HB 1X5IA 5DZNA 3U2SB 1J0KA 5JUEH 3MZTA 1CE6B 4QRTA 4LQFH 4LHUA 4E0RA 3QCUL 1VEPA 4J3SA 1CLOH 3EYOA 1AGCA 3GZKA 4Z95L 5KSVA 5CINL 1PQZB 5BMFL 5EBMB 3SE8L 1XGUB 2N4IA 1A7QH 1ZVSB 2VXQH 4BSVB 3GIZL 1ZT4B 2HTKC 3RGVD 2EO1A 1P69B 5T1LA 1KB9J 4NQCD 4AY0A 3LQZA 3MV8B 4LPUA 3V6FB 4FTVB 5LWYL 5D5ME 4NQEA 4JFDE 4P9HH 3GIVB 3ILPA 4P5MB 3RWIB 3BKYH 4HD9A 3KPSA 2ZUSA 4U0QB 4RFEB 4IDJL 4KK9C 5EU6B 5D1QC 1MVUB 5ETUA 1P4BH 3NA9L 4CVXA 5GHWH 5TPWL 4ONFH 3WUWB 5HVHC 4DUVA 3V6ZB 1S5HB 1CDUA 5E99L 5M95B 4HK3J 1EZVY 4P5TA 4YHYC 4I3GA 1A1NA 2H32B 2ERJC 2BRRH 2ZSVA 1WITA 1MEXL 3HE7A 3RHWK 3LDBB 1LP9F 1MJ7L 3EDFA 1I1YB 3V6OC 4OFVA 2C7UB 4Q6IA 4G9FD 1U3HC 1GVIA 2OBGA 3GHBL 4K8RH 1W8OA 5F70A 1ITCA 4ODWA 1RZIB 4NKMA 5CIPB 1TQBB 1QVOB 5DQJA 5IB4A 5IGXL 4CMHB 3VE0A 5ANME 4LNRB 3SJVE 5JIIA 3ES6B 4UINH 4M93C 4NWTL 5EZJA 1LK2A 1YY8B 1KB5H 5SWZB 1HIML 4PJXE 1Q94A 5HYQB 1SVCP 1GGBL 1U2HA 4LCCC 4QNPE 3WDIA 2APXA 3GSNA 1C1EH 3BJ91 5IB2A 1NL0L 1EGJL 2VXVL 1UG9A 1T21B 1WUNT 3B9DA 1CZ8L 5ITBH 1RUKL 1WBYA 1WZ1L 3IFNL 5JOPD 2I24N 3PDOA 5JMRA 4ZFGL 4PDCE 5FOBB 2B7DT 1OAYL 1CDGA 5I2IB 2W9LA 1Q9WA 2PF6A 5KSBA 1MHHA 2LVEA 4NQUA 5FV1L 3VGDA 4QTIH 3W81A 4XCYA 2NY5L 2YPLA 5I76A 1DQQB 1WFTA 1KIRB 3HUJE 3AXLB 1TQCC 4KTEL 1SVZA 3LN4A 4OAWB 4NFDA 3LKPB 5DURB 1YECH 4DAGH 2XXMB 5F7WC 4ZUUB 3ZYZA 5LAXA 2HTKD 4D0BB 3L3DB 1BWWA 1DDHB 5DTFB 3RY4A 4G8FB 2ZSWB 4R4BA 1QLFA 2AJSH 3GM0A 5KSBF 1I3GH 4QXTA 2APVA 2NY3B 2OYPA 4X4XA 2RIKA 3HG1E 3IU3B 1FFPA 3RDTA 4KK9D 5D1QD 3QUML 5CWSB 4JO1H 2XQYK 3IFOA 1JNHB 1NAKL 5EUOA 4JHWL 3BZFA 4KK5D 4NZTH 2P43B 1U8IB 5ESAB 2WAHA 3L7FA 5C0CE 1HEZB 4Q6YA 2DQTL 2BNQA 4XP9H 3QFJA 4Y0GA 5BZDA 1BD2B 1I3VA 2EE3A 1NGQH 3I3DA 1KLUA 5BCAA 4IDLA 4XAKE 4M1DH 4NO2A 2LABA 3RFZC 4ODTH 4JFEB 5C0AE 4XAWL 2I9TA 1ED3A 4WVRA 1IGIH 1K4DB 5D72H 4KZEH 2YA1A 3G08B 2NXYB 2EDEA 3ALPA 4XC1L 2F54E 3RUGE 5F96H 3BP6B 3VXRD 3ARED 4NT6B 4CNIB 3GSXA 2YC1A 4GW4B 1ORSB 1MI5D 1CXFA 1RVFL 2H9GB 3U30C 4FABL 1IBGH 2GT9A 3MRRA 3ZSTA 2MJWA 4XNXL 4AL8H 4NNXB 2D7TH 4MA3B 3EAKA 3MGTA 4YQXL 4X80H 1DTUA 3VWKB 2VN7A 3CPLA 1BP3B 3QIUB 1YPZE 1MPAH 4PTUB 7FABH 4XPAL 1ACYH 4PJIF 4DQOL 2EDYA 4ETYA 4YO0B 3TWCL 3GI8H 4D9RD 1YC7A 4YXHH 1A9EB 5J1AB 3WIFB 4P57A 32C2A 3QUXB 4QTHB 3KYMB 5A3IC 5KVFL 2O5YH 1U8OB 4DVRH 5I18H 3L7EA 4E9LA 1ORQA 4MNGB 5FO9A 3OB0H 1GC1L 1X6LA 3QEUB 5MI0C 1AH1A 1T2QL 1ZLVK 4NCDA 1DUZA 3MOBH 5IHUH 3K2UH 3N50A 4MQTB 3QISA 2A9NL 1G7LB 3SBWC 3D69A 4K3DL 3ZE0E 3P77B 5C3LD 2F19L 5D6CB 1FRGH 1OAUL 3DVNB 4L4VB 4J2XA 4J6RH 1LDSA 1U8PA 5EC2A 4NQSA 2V5YA 5FYJH 5D7IB 2W0FA 4OF8A 3RAJH 4N0YH 1J88A 1FNEB 4BSWA 3F6LA 4L1HA 4LIQL 4F2MB 2XN9D 2CLVB 3V9FA 3O4LE 3FMGL 2F15A 4YZFE 2WBJB 5DMKA 2CDGB 4OF7A 5CJQH 4Z7VA 1INDL 5EG6C 1RZGB 4XBPA 2Z93B 3CVIH 4JFPA 3TA3C 4HULB 1MIMH 4KJYA 3VFMB 4NQTA 3SKJH 2YXMA 1SM3H 3G04B 3RU8L 4H26B 1XGTB 2IH1A 1KLGB 5BS0E 1DSFL 1A6UL 4GAGH 3H6JA 3LV3A 2WV3A 1T83C 2NLJB 4PYHA 4PP2A 2YRZA 3SE4A 3A6CL 2WMPA 3T2QA 3GSRB 4MDIA 1JHLH 4D0DB 4ISVA 4LRIC 1TMCB 1SY6A 5F6IB 3OHXA 3SKNA 3UYRH 5E00A 5F9JA 3QXAB 2DYPA 2EDHA 3GO1L 3O3DA 1NFKA 4PR5A 5D2LE 4F7PA 3VXUD 4O02L 2AEIT 2XXCB 1NJ9A 3ELAT 3FQXB 4JANA 1A0QH 1WFUA 5FYLL 4FA8A 3RPKA 1IAKA 4QHKI 4X6CB 4Z7VF 3NFNA 4JY6A 1G0XA 4ODVL 4B53A 3C5JB 3MRMA 4YAQA 1TCRA 5C07A 4NP4H 3TV3H 4N0RA 1KXTB 1WC7A 4W68A 1URLA 4U1NB 1KF9B 1MWAH 4TSCH 5GGSY 4TVPD 1OB1B 4PPTA 3UO1H 3P40A 1EEZB 5TE7H 1FE8L 3MFFA 4O9HL 4M7LL 1RZJC 4S1QH 4MA1C 3RGVB 1F42A 4QY8B 3C8DA 4X7TA 2DN7A 5T33H 4NQCB 4UU9B 3OV6A 4JFXA 1CFVH 1C5CH 1WWWX 4XXCC 1MFEL 5GZNC 4JPIB 5E8PB 4X7EC 3S88L 4MXWH 2CLRA 3DHMA 1ZWIA 4EDXB 1J7VR 1LEIA 2DQJL 1SEBA 1XCQA 4UBDC 1MHCB 5IV2A 4RISH 4LSUH 5DD6B 1EAPA 1VKXA 1UH4A 1B4JH 5ECJE 3KS0J 4RQQA 3X11B 4BUGA 4LPTA 4JGMA 4UNVA 5ILTL 3T2PA 3T1FB 2FEEL 3FB6B 5FYKL 5JW4M 2CKNA 5IMKA 4OZGF 1WCBB 4M3JA 2O26U 4WV1C 3D3VD 5FYJE 3G6JA 2VSDA 1J05A 1OW0C 1S9VB 5MERB 3UTSA 4X83A 1KG0A 3SO3B 5I15H 3J7HA 3BIKB 2ESVA 4G9FB 1G7IB 4ZSOB 4Q9RL 5SV3A 2J3SA 4JFOB 3FOLA 4JPVL 4QXUH 3L95A 1FNFA 1IEAA 5DK0B 1YNKL 5L7XH 4GRWF 3ARTA 4Y4HB 3BH8B 3MLUL 3TA3D 3IU4H 1QFWH 3CSYB 1N2RA 5F7FA 3ARFB 3IGAA 2VERN 1B0WA 3REWB 5FYJU 3SDCC 3TIEA 3F58L 2XWTB 3PQYD 2XA8H 5H2BB 3DGGB 3O6KL 3BGFB 5DJCB 4PJ7E 4D9QD 3C8HA 4FFEX 4MS8C 4JO2H 5HGHA 2MPAL 3OKLB 1QFPA 3EDJA 4V1DA 1A6ZA 4GH7B 5IEHA 4U1JA 1XT5A 1FZJB 4OJFL 1AXTH 4PJDE 4Q2ZA 3MROB 4FQ2H 4P23A 4HUKB 4QOKD 2D03H 2HFTA 2QHLA 1WVZA 1AO7E 5INCB 3ROLB 3ARZA 5ID1A 4CGTA 5HPMA 1BECA 3KPQA 4KRMB 4NO3A 3V2AR 3D5OF 4FFVC 4W6YB 3SPVA 1RAMA 1ZT7A 1P7HL 4F15C 3BI9X 4PRHE 4OQTH 1IC1A 3JWDC 4RBPH 5FUZH 2WBKA 4DW2H 2PTTB 2WNGA 3QCVL 1TNMA 4WO4C 1VFUA 1D9KC 5GZND 1G7PB 4N1HB 5DJ6B 1NCDL 1A7RL 4UBDD 1N59A 3UZVB 1DBKH 1U8MB 1KIPB 1WBXA 3MRIB 5ENWB 3A67H 3MO1B 15C8L 3DPBA 1T5WA 5E7BA 1OAZL 3LS5L 5IOPB 3DMMC 2V7NB 1OTUC 2EO9A 4S1RL 2AXJA 5GJTH 3ROOB 2B5IC 3NCJH 4ZYKB 1EVTC 2XQBL 2VLJE 1W0VB 3LKRB 3VXOA 2IMMA 3ULUF 4BK4A 2A9MH 4L9DA 4X6BA 4BZYA 2F53A 3UTPD 4OLZL 3R1GH 5FO7A 2APTA 4HMCA 3TO2B 1JPST 1UFUA 4Y4KA 3MLRH 3MV01 2K7PA 3FB7B 2CMRL 1TXKA 5DC0A 1SQ2N 1P4LA 4QT5A 4HJ0C 4KUCF 5AWNL 5C0FB 3I02A 4O58L 2EIBA 1IJ9A 3T8XA 3IJSA 4LCCB 5C3TA 4ZPVB 4Q0XL 5GGRA 5IF0B 4A6YB 3SDCD 4OBSA 4DKDC 4LSSH 4C56A 4C59B 4TQEH 1KCRH 1QPPA 3VXRB 3ZT6A 3AREB 3MMEA 3SE4C 4MJ6A 5CHNA 5KOMC 4PRAB 1XCTB 2LAGB 4QO1A 1MI5B 1ONQA 5J6GB 5IVXB 1TPXB 1AHWC 4EDWH 1LDPH 3FQWA 4XMPL 4MS8D 3ARVA 4R2GB 2R1YB 3V6BR 1UJ3C 2VLKB 5F89A 2EIEA 3ME0A 4YX2L 4CU6A 3QXDA 1BQLL 1S78C 4I8DA 5IHZA 1PD6A 1JHTA 1PLGL 1FAIL 1SHMA 1A7NH 4OZHE 1J8HE 5LXGL 4UILH 1JRHL 1K6QL 3CFKA 4P4RA 1NMBL 2D9QB 4OUUA 2ORBH 2WWKO 1FL6A 4PIRF 4NN6C 2PXYC 3DTXB 2Q86A 4Y1AE 3FHQA 4LSRH 3JBG7 4FFVD 1MVFA 5F9OH 2R0KH 3TVMC 4JFZH 3S34L 1GGUA 4HT1L 1TZIB 4BH8A 5HHMD 3BRFA 4N0UE 4WO4D 1UKTA 3CK0L 4S11A 1HINH 4KPHH 3GBNH 1FFRA 5HGBB 3U0TB 3N85L 1D9KD 5EUKA 3IKCB 5HY9A 5IESL 2VN4A 1NC4D 4U1MA 3ZO0A 1DP0A 1S7SB 3C5ZB 3EGSB 2PTVA 5KS9B 1IGTA 3DVGB 12E8H 3M07A 1MLBA 1IC5H 1GCFA 1RZKH 5BVJB 5GS0H 5E9DA 2E7MA 4KMTL 3TZVC 3UPRB 5LQBL 1BVKB 3DMMD 1K2DB 1OTUD 5F3BA 4IMLA 2ITDA 3F7VA 4X4YB 2OJZH 2WZPD 4MNQA 4RA0C 4WHTA 2EC8A 4XNYL 3RVWC 4F7EB 3I85A 5FGCB 4KI5F 5FA4A 1G7HB 4E41E 3BD4A 4J3TA 2EH8H 3V52H 1P9MA 4D8PB 1NGPH 3BZ4B 3LPFA 1OP9A 1LD9A 3S37L 2EIZB 1LE5B 4NPYA 3EOTL 4JY4B 1CD9B 3QO0A 5DJXB 3QUKB 5CGYC 2W0KA 2Q8AH 3MLSL 3KNBB 3MBEA 3ZKXB 1FG2B 2B8OT 3DV6B 4XBGA 1A6TB 1UEYA 2OSLA 2NMSA 4HMDA 1X3DA 3VXUB 4J4PA 3HLAA 5IIEB 1JE6A 4ZOBA 1CVRA 3IJYA 4PV9A 3FQUA 3CJJA 4PJ8B 4K9EH 3F7QA 4G7VL 1DANU 4BELD 3LIZH 4DTGL 4JEGB 2ADGB 4R26L 5IQ7H 4HCRA 3LQAC 1OF2A 5JPMB 2XY2A 4U1SB 4LLQA 1FCCA 2IFFL 3S96B 2BDNL 3CVHB 3L5HA 5F7LB 5B4MC 1J0ZA 4QRRA 5KG9A 2VWEC 2VZ3A 4MSWA 4DVBA 2OL3A 5B39B 2BSSB 1S78D 5DMJB 5EU5A 3MFGB 5CJXC 5MEND 2JB5H 1SMAA 4P4KB 2IBZY 3CSBA 4LFHD 5C08E 2DTML 1BBDL 5KSAB 2BSRA 3FFCD 4KJPC 4G7YH 4JHAL 2P4AB 4HPOL 2MHAA 2R8SH 4Z78A 5DWUH 2AJYL 3VCLA 3GSUB 2EICA 3MJ9A 1GAFH 1G9NL 2PXYD 1S5IH 3K8KA 1YC8A 5D5MA 3WXVH 5BRZE 4HS3A 5JIKA 5DXWA 3TVMD 3I3BA 4MAYC 3DXAB 3MPCA 2BFVL 1MSPA 2ZPKH 4PJAE 1NFIB 4CJ0A 3HC3H 4RAUA 2C3XA 4PYGA 2AJVH 4PRDB 2WUBH 1I7ZB 5HDQH 2ADIA 4Z5RB 4XVUD 4WTWA 3BP5B 2CIKA 3P2TA 3W39B 1MFCH 1CFTB 4OGXH 1IM3A 5E94A 3M45A 4XH2B 5MEOA 1KJ2L 2VLME 3VGHA 1IKNC 4Z7WA 4MDJB 5IMOA 1HILA 2EEDA 1KN2H 3TZVD 3MQIA 5D5MF 5GRVK 2DBLH 5LCVH 5EZOH 2BVQB 2C4FT 4YIQA 1V3JA 4HH9A 4DKFL 3TA3B 4IS6A 2ATPA 4JE4B 3RVWD 1RZ7H 3ALWA 2R69L 1MCRA 5FO8B 1IFHH 3PP3K 4DN4L 5KJRL 4ZFOA 3VJ6A 1CTNA 1E6JH 3BGAA 1DJSA 5I73C 3QXWA 1T4KB 4F58L 4IIQC 2RB8A 2VZUA 3KYKH 4PJXA 1K8IA 1I8LC 5E2UL 5FGBA 1BM3H 4HKBA 3MRNB 4G6KL 2VAAB 2D31B 5CGYD 3G5ZB 4LRNH 1UKSA 4M7KL 3H9HA 1G6RA 4M03A 4PJCB 3OF6A 1WF5A 4ZFZB 3FOMA 2VXTH 4Y19D 4ZO9A 4JRXD 4F8QA 3GK8H 1G6VK 2QADC 4WU5B 1OCWL 4K71C 4NJAL 2OR8A 3WLWC 1YYMH 1EO8H 4O00A 4XWGL 2FATH 5ISZA 3M1BB 1A7PH 4M5YL 2DLEA 3MRLA 1KN4H 2CUIA 4FZ8L 4P2OB 1JNLL 4ODSH 3WFHB 2BOBB 3SE8H 4N5EA 2ADJA 2EDLA 5BV7L 5B4MD 1QNZH 4PJXF 3OAZK 1MQKL 3T3PF 3U9PL 3HUJA 4QNPF 1CICB 4AYFA 4ZOEA 4CVZA 1OARL 3D1MC 5CKGA 3MV9B 5C6PB 5LWYH 3B9AA 1WBZA 1T1YB 5EO9A 5B38B 3NABL 4KJPD 3C6LA 3KPOA 4NC0B 1A4KB 3BJLA 3STLA 4RGMB 4NRXB 4IDJH 1NAMH 4YHKH 3GMNB 3SGEH 5J56B 3S37X 2AXFB 4DZBA 3V7AG 1DQML 1MFDL 3HC0B 3PE9A 4E42A 3K74B 1GOGA 4MAYD 4KI5C 3S4SB 1ZAGA 4WY7L 5L2KD 5JLZA 4PJEB 1CLZH 5FUCC 3HUJF 4DKEH 4JAMB 2DM7A 4H1LG 4K3JH 3JV6B 1IGFH 3WXWL 3NAAL 1I3UA 1IGMH 3L1OH 1WWAX 3TBSB 5E2VL 1JUFB 2RCSL 1BF8A 1CD1B 3VH8G 5IVOA 1KENL 2ZCHL 1QBLL 5C0CA 3DO3A 3WUZA 1NBQA 2PKDA 3PV6A 4CW1A 5IGXH 4KUCD 3IXAB 2AGJL 3P30H 2KZWA 2OXHA 5I1LB 3MREA 4JFFB 3V5DB 1KB5A 3BPLC 5F1NB 3DARA 3LRSA 5J11C 3DJ9A 3PWJB 5DRXA 1QFWI 2F8VA 1TZHB 1FYTE 3VFOA 3THML 1D6VH 1J5OL 1WIPA 2XFXB 3PGDA 1FGVL 1JNNH 2YEZA 3IFNH 1TTUA 3X3GH 2Z31C 3TPUA 2NNAB 1XMWA 2HJFA 1JHKL 1L9MA 2F54A 4DJMA 1QR4A 5ICZB 2Y25A 3QAZB 4ZPTB 4NUGL 1N3NB 4OT1L 3VGFA 5E5MB 4J4PC 5F6HI 4S0UC 1ZHKB 1JF1B 5D9SA 3L5XL 4FQXB 2QADD 3ZT5A 1HYSC 3WLWD 1EHLH 3QUZA 1G7JB 3VXTB 3WS3B 3QDGB 1YPZA 4YDLB 3X14B 4X8XA 2IANE 3OXSA 4PFEA 4LP5A 3STBA 2EIDA 2HWZL 5GGUB 3CFDB 1JGUH 5DUMH 2VE6B 2YWYA 5CSZB 5DVNA 1JIBA 4N1CA 3EFDH 4L3ED 3RUGF 2BC4A 3IETB 2YSSB 5HHMB 4HKJA 5INDA 4TNWK 1YEIH 3O11B 4NZDA 4H20H 4WO4B 3ZSSA 1YUHA 2J8UB 2FD6H 4HUUB 1MCPL 3U4AA 4UTAH 5EIIB 2G5BB 2ZJSH 5A16B 4HX1A 5ITFB 3ARDC 2WK2A 1OAKL 4UZGA 3QUMH 4H0IA 5D2NC 2X4RA 5E8NA 3O45B 1LWRA 4BZ2L 1YPZF 2V7HA 5KVEH 3E1F1 5I1JL 1HDMA 4JHWH 2HN7A 1VA9A 1KTLA 1VENA 4KI5D 3SDDA 1HHGA 1QFOA 3VD7A 2EEAA 3SGKA 3TIDB 1GGCH 1NGXB 2B5IB 2FH8A 3CFEB 3QZWA 4I13B 5CGTA 4LP4A 2NW3A 2DL9A 4NKQB 3V0VA 5IFHL 2OI9A 3O4LA 2KH2B 3A6BL 1EFXD 2HKFH 4WUUD 4YBQC 4NDMA 4H88H 1S9XA 4WIQA 1T2XA 1KCVL 3HR5B 4F8TA 1I9IH 4RFOH 4XAWH 1DBBL 2CRZA 3NZHH 4PJHA 4TUOA 4HGMA 5T1KD 1JFQL 2Z92B 5E70A 3ZE0F 1SBSL 3U9UA 1WGOA 2B1AL 4LCIH 4Z77A 2AEQL 3FTGA 1J1OL 3NFPA 1U3JA 4F7TB 4KHXL 2ZCLL 3CZJA 3VFTA 4K07A 4R4NC 1OWRM 1G0YR 2VLRE 5D2LA 3RX5A 1VGKA 1UWGL 3E3QE 4G8IA 3RWHA 3HA0A 4YZFF 2E9WA 5EPMA 3CSGA 4XNXH 3AC0A 2Z31D 4PS4H 5AEAA 2C3VA 4YDIL 5F8RC 1KFAH 1QRNE 5DR5L 5TDOA 4AEIL 1R5VA 2SEBA 5C0EB 4LSVH 5KZCD 4PLJC 1QA9B 2JCCA 3OKEB 1CK0H 1INQA 4ODHH 5FB8A 5MENB 3H3KA 4UQ3A 5I16A 1TVBB 4PJFA 1Z6JT 4U0RC 5D96C 3FFCB 4XVSH 1HYSD 1CVSC 4XBEL 4F7CB 3P4OA 2IGFH 3QDJE 4LLDA 4ZUWB 2J5LC 4NHUA 3JTTA 1I1AC 1N5YH 1UQSB 4ZQKA 2IEPA 5D2LF 5IB5A 3N1PC 3OKNA 1RIUL 5EA0L 3HRZB 3TVMB 4V3EB 3BSZL 3WBDA 2HFEB 5HHOD 4OD1L 2GAZB 4D3CH 4ODUB 5JHLH 1DR9A 2Z91B 4AM0A 4YC2C 1OLZA 2R4RH 1AFVL 2F74A 2EDXA 1JV5B 3QFDB 2PR4H 1KYOJ 2XZCH 4UIMB 4W81A 3ARDD 5IP4A 3O8XA 3P11L 3VFRA 1M7IA 1MCOH 5F7HA 4JFDD 3BO8B 1EFQA 43CAA 5FM5M 1QZ1A 1T1WB 1VACA 5DI8B 4HXBL 1BJ8A 2P24B 5CEYB 4KHTL 2X40A 1N6VA 3OQ3B 3DYMA 2R56L 1T1XA 4Z7OE 3M17A 5JOFA 1OQOA 4LLWA 1F90L 4YBQD 1CG9B 4M1GH 5DFWH 4K8RC 4C58B 2EE6A 4RDQG 5TQ0L 2W1NA 1F5WA 1WFOA 2GJZB 4GW1A 4GXUN 4M5ZL 3NGBB 1RHHB 2EYSB 1CGYA 1B3JA 4LBEA 5ID0B 5FYLH 3R8BB 5GGTH 4Y4FC 3EW3B 4YXKL 3SDXA 4HH8A 3RWEA 1OGAE 2H8PA 3LD8C 4RFNC 3PJSA 3SJVD 4K7PH 4R4ND 3QDMA 1CE1L 4TVPL 4F3FA 5D71H 5BJTB 1F4YL 4R7NB 5EFIB 1CDCA 4KROB 3RX8A 1MWAA 5IHBA 4PGBB 3UTTD 4OB5L 3O6FA 4O5LH 4F33A 3FO9A 3C2SA 1XGQA 3LMJH 2C1OA 5C9JA 3VFWB 3UJTH 3C08H 2V2TB 2NX5E 2EXWD 4PLJD 1CXHA 1NC2D 4PRNB 1ZVHA 4P2RB 2V2XA 1A21A 5D7JC 1AGBB 1NCBH 3U83A 4OIIH 2X4UB 5D70L 1U8KA 2GFBA 3PNWA 4PJ7F 3PG2A 4NNPL 1RK0B 2AEPH 1CGVA 3TYFA 1I1FA 1D5MA 4P3CL 1MQ8A 3N0PB 1I1AD 4GAYA 1QR1A 1Y6MR 4YDVA 1ZA6B 5T3ZH 1NFDB 1HQRA 3WMSA 3U36B 4NRYA 3IRZA 4PJDF 2FR4A 4XP5H 3OKOB 3O9WA 3F62A 3QWRD 2LTQB 3DX8A 3NFSL 3CDYA 4QRPE 3RTQA 1OPGH 5EZIL 5IJVB 2DM2A 3IDIB 5L8JB 1LO0H 4OFYA 4KDVA 3BHBB 3KPRE 4UB0L 4UQ2B 2VLJA 4MJ5B 5H94A 1BQSA 4X5XA 1KULA 1T7ZA 1T22B 3MUGA 1ZSDB 2ATKB 1TTFA 4Q97A 3HG1D 2MQ3A 3ARWA 3VWJC 4PJGE 2IJ0C 2NW2A 3EOBA 5FECB 1JWMA 1LO2H 4BQBA 5CCKL 3F58H 2E27L 5DJ8A 2XRAH 3RJQB 4MJID 1H9VA 2ZUQC 5B8CC 5HI4C 2Z8VC 5I73B 1RULL 2ZG1A 4O51A 4AG4H 4K8RD 3FT4A 2Z35A 4ZUVB 5JXAH 1VGEL 5LBSL 1BLNB 4ZNEA 3WFEH 3O2WH 3TN0B 3INUL 1JPTL 3FO0L 2VDOL 3MRHB 3RL2A 3QWQB 4EUPA 3GSNL 1HXYB 1M7DB 2H1PH 3SCMC 4Y4FD 2FWOB 3MXVL 1A1MB 3WKML 5C0AD 4BKLB 1PDKA 4JPWH 5ALBH 1GOFA 4APQA 1FZKB 4OI7A 4MQXC 2AXHA 4QGYA 5IEKA 4Y2DB 3GB7A 1VESA 1RZJL 1V7NH 1J8HA 5LGHL 2XZAH 3L3GA 3FN0H 3SQBA 1FVCA 4PY7B 2CGRH 4YNYB 1BWMA 1BZ7A 5MEPA 4OQTA 4XMKL 3VFNB 3HTLX 3QCTH 5D1XC 3RIFF 1XR9A 4B0MM 4TVSa 5I17B 3UDWA 4XCEB 4BH7A 4HWZA 4ZS7H 1SJHB 5D7JD 1IGJB 1P4IL 1YQVH 3V7AE 1NUNB 1Q9LB 3HI6L 5T3ZE 4JREC 3GMRA 4WEUD 3EO0A 4DWHA 1D5XA 2Z8WC 3TCLB 3BN9C 7CGTA 4S0SD 3EO9H 1WT5C 4XXDA 4JO4L 1PX3A 1KCLA 4N0UA 3MJ6A 1JGLL 9CGTA 3F12B 3SGEI 2P42B 2AK4E 2WLYA 4OZHF 2FDBP 3T2OA 4KVNH 3QDHA 5EWIH 5CLTA 4TRPH 2QQLL 5EBGA 1N5AB 1RPQA 1S9WB 4HS6B 4OCYH 2I60L 4PREB 5E8OB 1FH5H 5CIPH 3K3QA 3KXFB 1IGCH 35C8L 5CP3H 3BD3A 2XQYG 5GISL 1U95A 2CJUL 3QEGH 1HCFX 2B2XH 4HK0A 3HS0A 5FK9A 3HCVA 3LKQB 5EU7E 3FQRB 2D0HA 4K7PY 5J1TC 1EBPA 4PLKC 4IHOA 2R2EB 3VWJD 1MAML 4EI5A 4G6JH 1AGDA 1F45A 1N0LA 3SY0B 2OJEB 1ND0A 3TYGL 1UENA 3TP4A 1TJIL 1DBAL 3O3EB 4GG8B 4LCWE 1Q0YH 2IAMB 4B7LA 1WWCA 1IGYB 3BAEH 5FHAL 3QHFL 4HGWA 5HI4D 1BIIA 3H7BB 2AXGA 5IG7A 4EIZC 4XMPH 2FBJH 3NN8B 3MRKB 5BS0D 3VDAA 2B20A 3FO1A 5F3HB 3HE6B 3O81A 1BBJA 3OR7B 1HQ4B 3MYZA 4AEHH 1KJ2B 4MWFB 5AG9A 1A6PA 3E6HB 1JRHH 3O6LL 5EORH 3F7PC 4WW2F 3SCMD 2O5ZL 1Y0LA 4ELMA 1TVHA 4PLNC 4YK4C 4EOWH 5EBLB 1MRFH 4Z0XA 2PNDA 1RQ5A 4R0LC 2R1XA 4FTVE 5BOPA 1YNTB 5AAWA 4MQXD 3RWCB 4FZEH 1DFBH 4IRSC 3JWDL 4N1EA 5EU6E 1KPUB 2L7UA 5EOCJ 5HHOB 2EDNA 5D1XD 4N0CC 5JW4R 4KQ4H 1UCBH 2VDPL 3B9KB 3AU1B 2FJHA 4U1HA 4WTZG 2XWJA 4PJAA 2P49B 2DIBA 4RRPG 1ZTXL 2X7LA 3TEUA 3MLXL 1NPUA 2PETA 2JF1A 1NDMB 1CXKA 4ELMF 2R1WA 4PY8I 1NUGA 3D85B 5D2NB 1C16A 3W0WB 4KMTH 5F9AC 4GQPH 4FQLH 5JW5A 3U0PA 3ULVC 3HZMB 4XPBL 2Y7QB 1EJOL 2WWMC 3X3FH 5I1HL 3VFSB 4EKXA 4OTXL 2OTUA 2F5BL 3P9WB 4PBVC 2QR0A 4DKAA 4MX7B 3QNXB 5SWZE 3MRDA 4CDGC 2OMBA 5HSFA 4X99B 1WWBX 2BVOA 5LGJB 4G8GA 2HA1A 1SJEA 1N0XH 4PJAF 4QRQA 3S36H 3GNMH 4FP8H 3BH9A 2XICA 4KAQH 1N26A 4LLVA 4Z7NE 2YD9A 4PB9L 2O61B 3VRIB 3VXMB 2FNBA 1UC6A 3PABB 3CAFA 1C7TA 3G6AA 1QFWM 3AY4C 4GQ9L 4PLKD 4Q9QH 4LDOB 1DEDA 3F65A 1I9JL 3IAPA 3GM8A 3L5WB 3PWLB 3VXQA 4RNRA 2W0PA 3KR3L 4YHZL 2JJSA 2Q20A 4U1IA 5HYSB 2BVYA 3DSFH 4DTGH 3QIBA 2HMIC 5C0BB 1HHKB 1SY6L 5J9PA 4PUBL 1DQLL 1KIQB 2N1KA 4YBLC 2EH7H 3BUYA 3CFJA 3MTRA 1F4XH 3L6FB 1MIEH 1KV3A 1CFSB 5TE4L 1YDPB 3X13A 1XZ0B 1NBZB 3W2DH 1ZHNB 2ZCKH 3JVGC 1DLFL 1BBDH 4QXGL 4ONHA 3GJFB 5IW3A 3QRGL 4NN7C 1U8JA 3MV7B 5CEXA 2HLAA 1OP3K 4EVNA 4XNMB 5DRNA 1P7KB 5E4EC 4Y5YA 3AB0C 2P5WD 4NKIH 1QKZH 4QRSB 1RUAL 4JZJC 4IRJC 5EOTB 4LHQB 2H3NB 3VFPA 4IRSD 4M6MH 3HMWH 1AO7D 3OJMB 3AFLA 4UNUA 3TBTA 3QRFM 4X9BA 3RVTD 4LGRB 1TNNA 4PRPB 2VZ1A 4HUXB 3SDAC 2VNCA 4MZ2A 1KPRA 4N0CD 3WJLC 2X9XA 2WLZA 4IOSD 4PRHD 2XWBA 4HV8B 4DGIH 3GDBA 2X1OA 3B4NA 5J12B 3GMPB 2ARJQ 2FJFB 1YEHL 3IYLW 1BD2E 4NZUH 4YUEL 3T0WA 1FO0B 1SJVA 1DVFA 4ETQB 1C12B 4UUJB 3H42H 4JZOA 2J88L 3IDXL 3T2NH 3ULVD 4ZODA 5FDWA 3CC5A 1D5BB 4L3CA 4OFIA 1YEKL 4XZUA 3VGAB 4JFEE 5E08H 2WWMD 2GITB 2GEEA 1G7QB 3PGFL 2C3WA 3X17A 3T77A 2GSIB 2X1QA 4PG2C 4BZ1L 1CCZA 5CUSL 3C9NB 3SEPA 4MJIB 1BFVL 1DQJB 1QD0A 1E4WH 1MJUH 4DGVH 3FRUA 4PRIB 3OKDB 4JN1L 4MCYB 1GL4B 4ESKA 3MRPB 2X70B 5I8KH 4ZTPH 2P8PB 3VD4A 4WW2C 3HMXA 2IH3A 1MFNA 1MUJB 5TFSL 2VXSL 1Q9OB 4JFQB 5E0QA 4LGSB 5I75C 3FRPA 3WFCL 4GG6A 1QFHA 2BVEA 3C8KA 2DQUH 3PL6B 1FGNL 2HMID 5CBAB 4EN3C 3D39A 3LQAL 3HNSL 5B39G 1T03L 3RVXC 1G0DA 4ENEC 5JHDD 4HUVA 5DQDH 2LQRA 1U91B 5JXEC 1CFBA 1NBYA 1NMAH 1RZ8B 2HJKA 4MNGE 5DSCA 5I30H 4NQDE 3REVB 4NJ9H 3DURA 2BSTA 5F7EL 5AZEH 1F3JA 3OL2A 3CXDL 3FCTA 3LKOA 2W59A 4BA8A 4P2CG 4MD0B 3W9DA 1R6VA 3WEXA 5K9OA 4GRMB 4GRLA 5DJ2A 2B0SL 2NY4C 2GSGB 5FAAA 3ZT7A 1K85A 2X4OB 3P0VH 3W9EB 1KIUA 4KTYA 4IRJD 3GFUA 4HDIB 4L4VE 4X4ZA 3ULUL 4JB9L 3V7MA 1H3PH 3DBXB 3GHEH 2I26N 5D7IE 1HZHH 1N4XL 3HZKB 3MLZL 3OJDB 4I0PC 5BXFB 5DUBB 4PRBA 3O2DH 2CDFB 1UACL 4RMRA 5A2KH 3LEYH 5GS1B 3SDAD 4Y1AD 2FO4A 3ZDZE 1H5BA 1NLBH 2Z0BA 4LAQL 5IKCA 3LZFH 2WBWB 4JR9L 4HKZA 2GY7B 3K4DA 4KQ3H 3SOBL 5C0RL 5GJSH 3T4AB 3ARBA 2VISA 1CDBA 5I66A 1VADB 3C60A 1QOKA 2WP3T 5JA8B 4OLYH 2YXFA 3GMMA 5SV4A 1MLCB 3JSSA 4WWKC 4XNQA 1JTTA 3KGRA 5GS0C 2DAVA 1WIOA 1CXEA 2FGWL 2ICWA 3EYQC 2D4FA 4KKCC 5GRZA 3WSQL 5J6HA 5I9QC 5FOJA 2DLFH 3RJDA 2A6IA 2QLVB 4Y5VC 1C8PA 1CR9H 1CXIA 4JQIL 2YD6A 4P2QB 3UBXB 1MREL 4QHNA 2A77L 2ZUQB 3CGTA 4D2NA 4LAJH 3TPKA 2NY2C 4ODBD 1RIVL 4XNUH 1DQDL 2VDMH 2ARJA 4E41D 4I9WE 1FIGH 1IZJA 5I1GL 1UM5L 3RIFK 3OPZH 1FSKB 4GUPA 3HI1A 4KZDL 1OWWA 2CDEA 3LKSA 2JELL 2QHRH 1S8DA 1WLHA 5IJKC 2R0LH 4ELKB 1N64H 3R0MA 3D2UD 3EZ8A 4K9EC 4N9GB 4NQCE 3IVKB 4HF5L 4JDVB 4UV7L 4EN3D 2PO6D 4OCWL 5IT2L 2Y36L 2JK5B 1FL5A 4QCIA 4XC3L 3RVXD 4ENED 3B6SB 3QDJA 4F9LC 1CBVH 3BPCB 3EZJB 1HH9A 5JXED 1M05B 3C2AL 4RBPK 2AEWA 3QQ3A 4S2SA 4XI5C 4LK4A 2R15A 1IAMA 2E5EA 1B2WL 1MCPH 1R3JA 3WNPA 4M8QB 3OR6A 2FIKA 4JREB 4TPRL 5CSGA 3DX7A 2NY4D 5C08D 2D3VA 2X10A 3QUMA 5DGRA 2W65A 5FCUH 1XF4B 1YEJH 5L6YH 4HK3N 3HFMH 1F11B 3HNVL 4G9FE 4ZSOE 1D5IL 3U0WH 4I0PD 3TBYB 1JP5A 2P7TA 1ZT1B 4PJ9C 1S7WA 1IRAY 1BZQK 2JIXB 3BW9B 4YHML 1XGYL 1MFAL 3ARPA 5BRZD 2I07B 1FZMB 3Q5YA 4QYOB 1FFOB 4R7DA 4YDKH 3ZKMC 2BVUA 4OLVL 1NGWB 1RFDH 3QEQB 1LK3L 1F02I 1BOYA 4PJ5A 4HFUL 2HJLA 3IJHB 4QRTB 1DBBH 1DBJL 1KJMA 4WWKD 4E0RB 3BRGC 4PJBA 3EYOB 1AGCB 4KDTA 5JOPE 2VLMD 2VH5L 4GAJH 3W82A 3LQMA 3WDHA 1OD7A 3EYQD 4I3RH 4KKCD 5KTEL 2ICWJ 2H6PA 3MRQA 1DL7L 2AJXH 3CMOH 5T1LB 1YEGL 1N7MH 2Q8BL 2IMNA 4N8CH 2YPKB 3LQZB 4I4WA 5I74C 2A1WH 4NQEB 2NY2D 1ETZA 2CIIB 4HJGA 2BNUA 3GRWH 5SX5H 3KPSB 3WO4B 3NBNA 4CKVX 5E6IA 3R4DA 5FCSH 4FFWC 1P2CA 3QIWC 4CVXB 2VO5A 1L6XA 3MRFA 4Z7OF 4XVTL 4ZFFA 3I6GA 1KBGL 5D93B 1AQKL 2M2DA 1P7QA 4IJ3C 3PGCA 4Y5XC 2ZSVB 3EYVA 5C2BH 2D4DA 2K3TA 2P5WB 4HS8L 4TYUA 4NRZA 3MRBA 2DM3A 2V17H 1T7WA 5EO0A 2P45B 4Q6IB 1PEWA 4OD1H 1OL0A 2EDRA 3TNNA 2YD2A 3DROA 4PGZA 5I6XC 1TJHL 4NKMB 4H5SB 5E6YA 2Q76A 1NGZA 4LVEA 3BIAX 2BCKB 5ADOH 3VMPA 4OLXL 3D0LA 5EZJB 1LK2B 3LS4L 5JMOC 1Q94B 4WU7A 5DLML 4WI7A 3KJ6H 4OCRH 1IC4L 2HRPH 2W9DH 1ZS8A 4U6HA 3WS6C 3GSNB 1X5YA 1HHJA 1M4KA 2EDDA 4QHUA 4X9FA 3IDMB 2ICES 2NY6B 3WIIH 3PDOB 4L8BA 4HFWA 4PJ9D 4CMMA 4HEME 4C54A 2DOCA 2GY5A 1JZ4A 1NSNH 3UTZA 3Q3GA 1YA5A 3TJHC 4O2CA 3Q6GL 2X4QA 3LH2H 4OZFB 3ZKMD 3U7YL 5KSBB 1MHHB 4PJGA 4BYHA 3O2VH 3QXTA 4XCYB 3QUYC 1K5NA 2YPLB 5I76B 1PG7W 3VXRE 5KVMC 4AK1A 3UYOD 1MI5E 5K33A 5IVXE 3EDKA 3LN4B 4UV4H 1XIWA 1Y18B 2HFGL 1U3ZA 5CD5C 1YEDA 1A22B 1P6AB 2VLKE 4OF5A 1Q1JL 3QHZH 3VGGA 5I8OH 3KPNA 5KW9L 5LVEA 5E6ZA 2NTSP 5LAXB 3D0VB 4JO3L 1PY9A 2P8LA 1JZ3A 5T1DL 4C55A 3CVHH 1A3LL 1RIHH 3MA7B 4LSTL 4D9RE 1G6RL 3WHXB 2QSVA 2VOTA 4R4BB 1HOCA 5B3JF 1QLFB 3LKNA 4PJGF 1FYTD 5JHDB 4LPWA 4LFHG 1FFPB 1J1PL 1AY1L 2D7MA 3RDTB 1JF6A 3E3QC 4FFWD 2XG4A 3QIWD 5JUEL 4NCC2 1EXUA 4GBXA 1BQHB 3IFOB 4V2CB 3VMOA 3RZCA 5EUOB 4LQFL 3BZFB 1CLOL 2R23A 3NIGE 4J3XA 1QUNA 3L7FB 5DC4B 3AB0B 4YDJA 4U2YA 1A7QL 2BNQB 3KYNA 1FJ1A 2UVEA 2VXQL 5H35A 4UT6H 5BZDB 4MB5A 4OUOA 5KS9E 2IAND 4LLAA 4Q58C 4RGOH 3RPIA 4NO2B 2E7CA 5D7LA 3BEVA 2VITA 3RL1A 4DEPB 2NTFA 4H1LA 3BKYL 4U3CA 4Z76A 1HSAA 2AK4A 1ED3B 3UTQA 4N9OB 2CRMA 1C08B 5FGCE 2RAMA 1EZVX 4BFIB 1P4BL 2DMBA 5GHWL 4ONFL 4L4JA 5TF1H 3MR9A 1JI1A 1YEEH 2GIYA 2BMKA 2LU7A 2AP2A 3GSXB 2YC1B 4L8SA 1IE5A 2BRRL 4GXVH 1J1XH 3VRLE 2Y06H 3MRRB 4BJLA 3MXWH 1ZHLA 5KOVC 5C0IB 3MGTB 4R4FH 1HSBA 4GKZA 3VXUE 5I1IH 4NKOA 2H26B 4I48A 2XZQH 3FB5A 3TJHD 4K8RL 5KN5B 1RULH 4G43B 4BQ6A 3QUYD 4JCLA 2XY1A 4HWBH 1JGEB 4UINL 1I8KA 5SWSA 3GI9H 4DCQA 4DFHA 3U2SA 3RWJA 1FBIL 5CD5D 1ORQB 1IVLA 5FO9B 4N8VG 1C1EL 1VB9A 3WKMH 2IALA 2N56A 5ITBL 1M6OA 5HHPB 4GSDH 4TOYL 4EXKA 3B2UC 3EJZC 2PO6B 3D69B 3S9DB 4LLYA 3UPAA 4RMTA 1T0NA 4JM2C 1S7UA 4BQ8A 4BQCA 2UZXB 2VLRD 4XMKH 5I1CH 1U8PB 1CL7H 1CGXA 1I3RA 4NQSB 2W0FB 4C83B 1KACB 4QTIL 1QBMH 3DXAE 3ARGA 1RD6A 2YPVH 5DMKB 4ZDHA 1QRND 3DHJA 5CJOH 4G9DB 5EU6A 2VDQL 1MVUA 4NN5B 4XBPB 5JO5A 4JFPB 3DRQA 1JGLH 5CD3A 1ODAA 1YECL 3U79A 4DAGL 3VU2A 2IH1B 4HZAA 4TNVF 1Z0MA 1QQDA 3LV3B 3O0RL 3OKMA 5IBLC 2GTZA 4P5KB 2QQLH 3D18A 2X41A 3ZDYE 4WI4A 5GS2H 43C9A 1CLCA 5E4IA 2PYFA 4U6YA 3OHXB 3SKNB 2AJSL 3OX8B 2E8YA 5GRWA 3TH2T 1I3GL 1MCNA 3O3DB 4PR5B 3O41A 4F7PB 3K2MC 2GHWB 5IUSA 5CIPA 1QVOA 5CP3A 4XPHH 1IAKB 4QHMB 3NFNB 4JY6B 4JO1L 5JTWA 1YY8A 3MRMB 4YAQB 5E95B 5C07B 1WC7B 4JQXA 5D7KE 4NZTL 4HQQH 1REIA 4HIIB 3VXSD 4M8VA 3GSVA 3DV4A 3MFFB 3NVQA 2GUOA 4XP9L 1LEKA 4PJCE 3FT3A 5I9QB 1PKQB 1NGQL 4I18A 3W5MA 1HCVA 4X7TB 4M1DL 1WAAA 4JFXB 4OM1H 3DI3B 4ODTL 5I2IA 2NY2B 3LRGA 1ZWIB 1LEIB 1IGIL 1QLRA 1SEBB 1J11A 1XCQB 1UADC 5D72L 5IV2B 4XNZC 1T04A 4U1GC 1CLYH 2YMXH 3VI4E 4GRWB 1EAPB 1VKXB 2P1YA 3O6LH 4RQQB 5F96L 1WEJH 1YMMA 3MV9E 1XFPA 5IMKB 1MAKA 1I4FA 2E7LA 3H9SA 1IBGL 4Z7NF 3B3IA 3G6JB 3V0WL 4AL8L 3B2UD 3EJZD 4ZUUA 1ES0A 2D7TL 1OGAD 1YY9C 2YD8A 1NDGA 4JM2D 4NYLA 4X80L 5DTFA 4CAGA 5BO1H 3UTSB 1MPAL 1KG0B 4G8FA 7FABL 1ACYL 4PTTB 1Z9LA 5T5NG 1EMTL 3FOLB 4MLIA 4P46A 3FFDA 3GI8L 4YXHL 3QXVA 4M6AA 3L3HA 1OOAA 1XH3B 3BQUC 4HMEA 2QBWA 25C8H 4PJEE 2NX5D 1VCAA 1SBBA 1JL8A 2O5YL 4DVRL 5I18L 1N2RB 3D25A 3IGAB 1JNHA 5GGQH 3TIEB 5DD3H 3MOBL 2Y9RT 5IHUL 3K2UL 2OK0H 1MCKA 3KPTA 3CDCA 5IBLD 1HEZA 3I9GH 3LPWA 2FRGP 1FRGL 5HGHB 4JFFE 2EYTA 3T0EC 1A6ZB 1OD9A 4J6RL 5JQ6H 1S7RB 3OMZA 4L9LA 3TNMA 2UY7A 4U1JB 5FYJL 5ALCH 4KMQA 3RAJL 3MOQA 4N0YL 4G6MH 1G9MC 4WWID 4QRPD 2EDWA 1NUFA 3C09C 3RY6C 1K4DA 3ORJA 4X0KA 5CJQL 1K4CA 4PB0H 3HRPA 5HPMB 3CVIL 3KPRD 1MIML 4LU5H 4NO3B 4R96A 1INEH 3SKJL 4AIOA 1JGDA 1SM3L 4AZ8A 3IDUA 3SPVB 1SMOA 1ZT7B 4GAGL 2DBJA 4XCNA 5EU7C 4LVOB 1ADQH 2C3GA 3CIQA 1ZEAH 4XPFH 4YR6A 3P9LA 1AI1H 2GJ6A 3UYRL 2Q6WA 3BDXA 3QDGE 3QIUA 5AYUH 3ZE1E 1NBVH 1CT8A 1UZ6E 3MNVA 1N59B 4RDQF 4YO0A 4B7IA 4OCSH 1A0QL 2EKSB 1WBXB 4AMKH 1A9EA 3WIFA 2I27N 1NUDA 1AKJD 3QRGH 3QUXA 4NP4L 3TV3L 5HHME 1PSKH 4ZS6C 1MWAL 2XACC 4TSCL 2FO1A 1SEQH 2CK2A 4NQDA 3UO1L 4IJ3B 2J8UE 5TE7L 3QEUA 4X6BB 2EC9T 4S1QL 4HWUA 2F53B 2YZ8A 1YY9D 1VPOH 4S1SH 2JJUA 5FO7B 5C2UB 1NGYB 1WQVT 4D94A 1F3DH 1GGIH 4Y4KB 1CFVL 1C5CL 5FXCH 4WFFE 2G2RB 5E1AA 3DVNA 4L4VA 3E2HA 3BQUD 1P4LB 1NLDH 4QT5B 4YWGH 2CRYA 2BY3A 1FNEA 2LAAA 4ORZC 4RISL 4LSUL 2XKSA 1B4JL 3ESVF 5DD0H 3IJSB 4WHYG 2CDGA 1BMGA 5GGRB 4C56B 4JHZA 1T6WA 4MJ6B 5CHNB 2ZNWA 4PV8A 2MMXA 3G04A 1YEKH 4POZC 3LDBC 2VZVA 1ONQB 3FQWB 1BAFH 1OTTC 4YLQT 5ELIA 2BERA 5F89B 1OGTA 3T0ED 4OKVB 3QXDB 5IHZB 3RVUC 4UTBL 1JHTB 1TQBC 4XHQA 2OS7A 4XP6H 1BIHA 4QXUL 5C6WH 5D7IF 3IDJB 4MYWB 3CFKB 3MBXH 5D1ZA 3QUYB 5L7XL 4OUUB 2CSPA 3ZDZF 1FL6B 4NCC1 5IWLA 2AKRA 3IU4L 1QFWL 4TUKH 4RGNB 2D7OA 2Q86B 5HYSG 3C5JA 4KDWA 4QGTA 1BZ9B 1A5FH 2HFFA 2FLBT 3RNQB 1JWUB 3NACH 1FGNH 5MENE 4BQ9A 2MKWA 3RKPA 1RUQH 4BH8B 3HNSH 1EEZA 2VQUA 3FFCE 3S5LG 4M4RA 4JO2L 5EUKB 5HY9B 3RGVA 4ONGL 4NQCA 4LCWD 4HC1H 2DQHH 3B2VH 1YJDH 5I19L 3KLDA 3GSOA 1MJJA 4JPIA 4FQ2L 1MLBB 2WIIA 5F7EH 4EDXA 2D03L 1AC6A 3SQOH 1MHCA 2ZUTA 4IMLB 3F7VB 5DD6A 4ZS6D 4MNQB 4WHTB 2FJGA 4IRZH 4JFHD 5FA4B 4OZIA 3T1FA 2RQ8A 2R29H 4NC1E 3X12B 1WCBA 5FUZL 4DW2L 1LD9B 3MV8D 4OIBA 4GS7C 4NPYB 5DVKA 4FTVD 2X4NA 3O2DA 3QO0B 4X6DA 4Z9KB 2NY3C 3MBEB 3CFCH 3P4MA 3T0AA 5MERA 1LGVA 2RJMA 4G9FA 2VXUH 3KDMA 1OLLA 1FLRH 4XBGB 5IK3A 2OSLB 2NY1B 1DBKL 1S7TA 2EZ0C 1FFQA 2XA3A 3ZHLA 5FGRA 1B4RA 2X1PA 1L0XA 3IJYB 4L29A 3VG9C 3FQUB 3RA7H 1JGVH 3IS1X 4PD4K 5GJTL 3PWUA 3NCJL 2FGWH 2L0DA 4POZD 2A9ML 2XWTA 1TJGL 4LLQB 3WSQH 4BSJA 2HH0L 2J2ZA 4QRRB 5KG9B 1OTTD 3DGGA 3R1GL 4MSWB 1KEMH 2OL3B 4HJJH 4ZO8A 5EU5B 4M48H 1IARB 4Y19E 3RVUD 4TSAH 3MLRL 1QLEH 2BSRB 4FXLA 2G5RA 3OKLA 1RUMH 3QYCA 1CDHA 4WEMB 4Z78B 5SWZD 3BPNB 1OT2A 2E7HA 3VCLB 4X5WA 2YD3A 2NXYC 2UWEE 2VQ1A 1CFNB 5CMAA 3GKWL 1HH6A 2VR4A 5INCA 2WINB 4LSSL 1TTGA 4TQEL 1KCRL 4P2RE 4HF5H 4P59H 1DUYA 2YZ1A 3PXJA 1H15A 3HNTH 4EDWL 1LDPL 4TNVK 3VWKC 1KEGH 2CIKB 3QIUC 1L0QA 1FL3A 1IILE 3QQ4B 2KBGA 1ZOXA 5FHBL 2GK0B 1IM3B 4JM2B 5MEOB 4P3DB 2QV2A 2BY2A 1A7NL 1CL7I 1NFDE 4Z7WB 2GI7A 1HILB 2DMKA 5KBNC 4G80B 4AENA 4U05A 2ORBL 3DOSA 1U8MA 4TPRH 5DVMA 4EZMA 1PX4A 1PFCA 4YIQB 5D1QA 5ENWA 3GEWB 4HH9B 4IS6B 5DURD 2B4CC 2ATPB 4LSRL 2YHGA 5CLWA 5IOPA 1HNFA 5F9OL 2R0KL 4JFZL 4ZFOB 2J7LA 3BRDA 2P5ED 3H3PH 1W0VA 3V4VH 3U6RA 2M26A 3LKRA 4Q9CA 1H3VA 4PGCA 1K8IB 2J12B 1AE6H 1A1OB 1HINL 4KPHL 3TFKC 2YS4A 2NY3D 2XV6B 1TDQA 3V6OA 3BZEB 3FOMB 4P9MH 1BVZA 2EZ0D 3FQTA 12E8L 1I75A 1IC5L 2WBJC 1U42A 1RZKL 5GS0L 1DBJH 5GZOD 1LILA 1S3KH 3VD5A 5C0FA 5ISZB 1EO5A 2X4TB 2OJZL 3MRLB 4U31A 4LCCA 5FKPB 4WI9A 2I5YH 1TETH 5F88A 3SN6N 2W9EH 2ADJB 3H9ZA 5IF0A 1BD2D 2EH8L 3V52L 1ZK9A 2WW8A 4IOIB 1DL7H 1DEEA 1NGPL 3VXRA 3AREA 1K8DB 3WJJC 4NFCA 3SKOA 1MI5A 5J6GA 3KPLA 5IVXA 1I7TB 5F6IC 5IQ9A 3QHTC 4YPGA 3HZYB 4JFED 1WBZB 5EO9B 2Q8AL 3TH4T 4AH2A 4UMGA 3C6LB 3KPOB 2BJMH 3UJIH 1PZ5B 2DQIH 4OF3A 5ACLA 2NXYD 3ZHKA 3EUUA 3QEHB 5I0ZA 4DZBB 1DE4B 4U1GB 4CUCA 3PP4H 4FQQA 2VB5A 4K9EL 2DDQH 4YEFA 3DIFB 1AKJB 3LIZL 3ILQC 3L5JA 3ISWA 1JZ2A 4X4MA 3NA4A 5KSUB 5JLZB 5IQ7L 2DD8H 2JTDA 2IBZX 3VWKD 5IVXF 2RHEA 4CBPA 1QSED 1KSRA 3K80A 4GKOA 2JB5L 3BEWA 3CH8A 3IKCA 4GMTH 1FORL 3UP1A 4D0CB 3PV6B 4CW1B 1LO3H 1XF3A 5DWUL 3DX9A 5KS9A 3B43A 3MREB 5DYOA 3NCFB 5IVZB 1GAFL 2X89D 1KB5B 1VSCA 3DYOA 2D0GA 1S5IL 3LRSB 2XN9A 3H8NA 5DRXB 4WHYH 3WXVL 4OFPA 3KXFE 2Q3AA 3VFOB 4XCCH 3ZE2E 1VFBA 2ZPKL 4X4YA 3PGDB 2Q1EA 2BSED 3HC3L 4F7EA 3CLEH 2YEZB 1FNGA 4FQHB 5HDQL 5ERWA 3TPUB 3NIGF 4WI3A 2HJFB 2XOTA 3TFKD 2F54B 5JNYA 3SO3C 1K9TA 2EIZA 3NTCH 4OGXL 3IDGA 3I75A 1O0VA 5F7MC 2QSCH 3T0EB 4JY4A 3BXNA 3KNBA 3S7GA 5D9SB 5KS9F 2WBJD 5HHVH 3MNWB 1FG2A 4Y4HC 3DV6A 1KN2L 3QUZB 3I3EA 3VXUA 1UZ8A 2DIJA 5LCVL 2DBLL 5EZOL 5I1DA 1M7XA 5IIEA 4E5XA 3ARFC 3OXSB 1A47A 4NFBA 2HT3C 5EULV 2DIAA 1RZ7L 5LJYH 2W91A 3CXHK 1IFHL 5DD5H 1E28A 5IW6B 1E6JL 3MCLH 1W8NA 4JO3H 5GSVB 4Y88A 3O4OB 3MLWH 4X6FA 5JR1H 2X4PA 2F8XC 1J8KA 4N68A 3NIFF 4U1SA 4HKJB 3S96A 1EV2E 1BM3L 1EAJA 2X2YA 4LRNL 1JPSH 1Y6NR 1YUHB 3CH1B 4UDUA 5EIVA 3VRLF 5DF0A 1BREA 1I7UA 3IDYC 1J1PH 3GJFH 4HX1B 4MD4B 4M61B 5KVGH 4AQOA 1G7MB 3GK8L 4YHPA 3H7LA 5E8NB 2H41A 2HP4A 1HDMB 2KKQA 1YYML 2HN7B 1EO8L 2CXKA 4I9WD 1KTLB 5HHOE 2OQJB 2JB6A 3S3PA 2FATL 2X4SB 3ILQD 3SDDB 1A7PL 5CGMA 1VFMA 1KN4L 2DI8A 4KGLA 4KY1H 3C5SB 3QZWB 4ODSL 3BDBA 1UXWA 2NW3B 1CD0A 4JN2A 1QNZL 3V0VB 1MRDH 8FABA 3RKDC 3D6GA 1KLFA 4EJ1C 1LP9A 1I7ZA 1S9XB 3E8UH 4Z5RA 3D3VA 4X9GA 5D2NE 3BP5A 3SBWA 3I50H 3W39A 4JLRA 2ZOLB 4X7SH 4XH2A 4PJHB 4R97B 4Z7UB 4F57H 5JZ7D 1GJIA 1NAML 3U9UB 4YHKL 1FO0H 1BHGA 1QSFD 1YNLH 4I0KA 4Z77B 3FTGB 3NFPB 5HGGS 2DQDH 3IXTA 3VFTB 4KK5C 3TA3A 4G8IB 4LARH 3RWHB 1CLZL 4JKKA 4OV5B 5EPMB 5FO8A 3BT2H 4L8DA 4Y8DC 4DKEL 5C09D 2PCPA 2CK0H 4K3JL 3VXME 4J23A 1IGFL 4OZFG 1IGML 3L1OL 5DEZA 3OGCB 3PQYA 2DM4A 5TDOB 3ZTJG 2SEBB 1T83A 2JCCB 1T0MB 1QP1A 5FB8B 1INQB 3MRNA 2VR5A 4LRIA 4UQ3B 5I16B 4PJFB 3WNLA 5F9WB 5DDHA 4TUJA 4BFGA 3P30L 3P4OB 4NHCL 4PJCA 4Y4HD 5C0BE 3ZDYF 4LLDB 1U6AH 3BIBX 3QG6B 4NHUB 3ARFD 3JTTB 3UTTE 1KJ3H 5M94B 2HT3D 4ZQKB 4QOKA 1FBIH 3HZVA 1BJ1H 5DJYB 2PW2A 4KVCH 3OKNB 1D6VL 3AREC 4O4YH 1JNNL 5F21B 3X3GL 1TPXC 1S7XB 4TOYH 5J13B 5DJDB 4AM0B 4R2GC 2VAJA 1KCKA 5BW7C 1E6OH 3MV7E 3EOAB 3WDJA 4LLMA 2DMCA 3QH3A 2RGSA 3KJ4C 4PJCF 1BQHG 1VHPA 1UB5A 4I5BA 4XXCA 1M7IB 2BOCB 1T2JA 1IM9D 43CAB 1EHLL 4PRPE 2VDQH 3GMNA 5D4QA 3DLQR 3DUSB 1L7TH 2AXFA 1X4XA 5I8EA 1JGUL 5JORA 5DUML 4NM8H 2K9UA 5KVDL 3O0RH 3RKDD 4PJEA 2P5EB 3EFDL 3M17B 5JOFB 4LLWB 4WFHE 1J87A 4WV1A 4G42B 5CILH 1P84J 4GS7B 1YEIL 3VI3E 3G9AB 4H20L 2FD6L 1OW0A 3C5ZC 4UTAL 4GW1B 2ZJSL 5BVPH 3BPOB 3F5WA 1WTLA 5KVEL 3SDXB 3RWEB 2H8PB 1A4JA 4MJIE 3VG9B 4OSUH 4LL9A 3BKMH 3PJSB 2YA0A 3QDMB 4F3FB 4PRIE 1GGCL 5T5FH 1MWAB 3FQNA 1MCLA 4PJEF 1O5DT 1QHPA 3O6FB 1X5KA 3SDCA 1A7OH 2XFXA 1XGQB 4UDTB 1KCSH 2HKFL 3KPPA 4FNLH 3S3SA 4H88L 1E4XH 3QWOA 2W07A 2IADA 3ZKXC 4ZXBC 2IPUG 2V2XB 4OLUH 1I9IL 4MS8A 4RFOL 4PJIA 1MCIA 3PNWB 3NZHL 5C0JA 3Q5OA 3VGEA 2HT4C 4ZD3H 3TYFB 1I1FB 2WIMA 1D5MB 4LCIL 5JPNA 4GAYB 4PJ8C 4YDVB 2UVFA 3VXTA 5CEZD 1HQRB 3RX7A 4NKDA 4U49A 3WS3A 1BJMA 4NRYB 4Z0BH 5GGUA 5K59E 2CKBL 3O9WB 3V0WH 2VE6A 4R2GD 4PS4L 5CSZA 2J1KA 2VLKD 3RTQB 1KFAL 4LSVL 4P4KC 5KSAC 4QLRA 4WW1A 5HHMA 1QSEB 5DHXB 3O11A 1CK0L 4ODHL 4OCNC 4WO4A 2VLJB 1EMTH 5H94B 4KKNA 3WN5B 4DOHB 4X5XB 5EU4A 1OP3H 4XVSL 3WIHH 1D9KA 2IGFL 3U46A 1NC4A 5A16A 3MUGB 2R2HA 2Z4QA 3ZYIA 5EO1A 3IDNB 1X4ZA 1YEFH 4B50A 4V2BA 1JZ7A 5A40E 1N5YL 2J6EH 2NW2B 3ZE1F 1HKLH 1PY4A 3IF1A 3EOBB 1UZ6F 1JWMB 1R0AH 3TJEH 1RURH 3DMMA 3F7YA 4L4TD 2DICA 4M7JH 1NGXA 2ADFH 4D3CL 5JHLL 3T0BA 1V7MH 1UEMA 4F7MA 2Z35B 5I1KH 2R4RL 4LEOA 3WNKA 2PR4L 2XZCL 1DLHA 5SX4H 3C5ZD 4JKPH 2FL5A 2VC2H 2OXGA 4P3WA 4EUPB 5FM5O 1MCOL 4G5ZL 4MQ7A 2DRUA 5HYIA 3G9VA 1Q72H 4APQB 1A3QA 4F7TA 5IEKB 3TH3T 3GB7B 1DCLA 1CGWA 3N1QC 3L3GB 4JY5H 1P5UA 1FVCB 3MLTA 5IFJA 4CL7A 1BZ7B 1LNUA 5MEPB 1JN6A 4M1GL 3QB7C 1ADQA 1XR9B 1UGNA 4ZXBD 4BH7B 4HWZB 1AHWA 1CF8L 5C0EA 1UJ3A 5EN2B 4KKLC 5F1IA 2OZ4H 3GMRB 3OKEA 3EO0B 1D5XB 4XP1H 2HT4D 5MENA 5EC1A 4OBRA 5SX5K 2FYYA 5F7KC 5C86A 5GGTL 4XXDB 5GIRA 3FFCA 4F7CA 4PJ8D 5AG8A 5IBUB 2VKXA 2D2OA 3VFVA 4K7PL 4P2OC 5D71L 1UQSA 2P8MA 2PXYA 5J1SC 2N7AA 4O5LL 2R0WH 4OZGA 1BQUA 3IAQA 3TVMA 1CICC 3GJEA 3LMJL 2HFEA 2VDRH 4XP4H 3UJTL 3C08L 5C0DA 2C4FU 3NCBB 2Z91A 4P4KD 4IMKC 5KSAD 2Y07H 1U95B 4WDIA 1JI2A 1NCBL 4OIIL 2UZIL 2VLLA 3QFDA 4RGMC 1HHIB 3ZKSD 2MSPA 3HS0B 2JJTC 4HK0B 4UIMA 5FK9B 3HCVB 2AEPL 5DUPH 2F58H 4IHOB 4LVNB 5L2JB 3L3JA 4OI8A 1QSFB 4PG9A 5DZLA 1AGDB 1HI6B 4LF3A 3DXAD 1T1WA 5T3ZL 3ULVH 3TZVA 3T3ME 2DJ4A 1G1CA 3V8OA 3QEQE 3UAJC 2BNRB 4XP5L 4HGWB 1BIIB 3ULSA 5HI5C 3K46A 2AXGB 4XRCB 4ZMAT 2C26A 1MHEA 1W72B 1CS6A 1OPGL 5C09B 4OZFH 2C4XA 5E8DH 3ZTJH 1LO0L 1CG9A 3FO1B 1ROWA 4UTBH 1JF5A 1RJLA 2BXZA 1B90A 2VQTA 1R3IH 3QNZA 3C6SB 2AJZB 2UZYB 4DGYH 1PG7L 4JPKH 2GJZA 2DI7A 5DJ0A 2Y72A 1UCTA 3C87A 2E9JA 4ELMB 1TVHB 3ZYOA 1ZA3B 4FN0A 1IC7H 4Z0XB 2R1XB 4Y19A 1FPTH 3EJJX 4NQEE 4JRXA 1LO2L 3KPSE 3GSWA 5DA4A 1WK0A 1GGYA 2V2WA 4YPJA 2XRAL 4N8VA 5BJTA 4TTGA 1HHHA 4CDHA 5D7KD 4WUKH 2PW1A 2UWEA 4AG4L 3LEXA 3EYUH 5JXAL 1ZMYA 3QAZC 1CIUA 3WFEL 3O2WL 3VFWA 1I85C 3RRQA 2V2TA 3P4LA 4OD2B 2FJHB 4KKLD 2XWJB 2EYRA 4YGAB 3S6CA 4ONGH 2AERT 2O5XH 5CJXA 2J4WH 2P5WE 2X7LB 4FQXC 3IDYB 1VFAA 5I19H 4P48A 3TO4C 2X4UA 4P49A 2H45A 4FQCH 2H1PL 2R1WB 4X98A 5DK2B 4KH2A 3K8LA 1RK0A 4YDLC 1FQ9C 4MNHA 4JPWL 5ALBL 3U0PB 1IM9B 5JW3H 5JW5B 4P2OD 5EIQA 2R0ZH 3UJJL 2DQEH 4M9PA 1LE9A 2FX9H 4M6OH 4ODXA 1ZA6A 1V7NL 2XZAL 5A2FA 3FN0L 3U36A 2OTUB 1NANI 5TF0A 4MVBC 2UWEF 1CICD 2QR0B 4W4NA 4MAYA 3OTTA 3MRDB 4X6EA 2CGRL 5L2KA 3MYJA 3QCTL 3MV9D 2BVOB 4CADB 4G8GB 1AXIB 5MEQA 1SJEB 4ZS7L 4QRQB 3KYAA 1N6UA 3BH9B 1KPVA 1YQVL 1QYGH 4LLVB 3HC4H 3ULVE 4DN3L 3G6AB 3TT3H 3EO9L 5IM7A 3FHAA 1IKNA 1T22A 3WE6A 3QJFA 2X42A 4FMKA 4YEEA 3VXQB 4RNRB 3LRHA 1GHFL 4U1IB 1NFDF 5KSBE 3MRJA 4KVNL 1FDLH 5EWIL 4TRPL 3UAJD 2QEJA 4PBWD 5J9PB 1FNAA 2EDTA 2YPLE 2HKHH 5HI5D 1TJGH 4NM4H 2H2SC 3CFJB 3BUYB 3Q2CA 2HH0H 4TNWF 5DHYA 5GS2D 1JYVA 4OCYL 2EDBA 3J8F7 5C6TH 1HE7A 4LCUA 3WFBH 3X13B 4F9PC 1FH5L 2CXGA 1IGCL 5HHXH 4IIQA 1CGSH 4K7PX 1A2YB 1I8LA 1F58H 3RNKA 4ONHB 3QEGL 1S9YB 2B2XL 5F93C 2EDKA 1YQ2A 3KS0H 4J8RA 1BX2B 3JUYA 1QBAA 5CEXB 2HLAB 4JFFD 3MRHA 5DRNB 5TQ2L 4Y5YB 1KC5H 1HXYA 1E4KC 5BOZG 3BE1H 2FWOA 4G6JL 3GKWH 1A1MA 2CR6A 5JHDE 1JCKA 4RX4D 3VFPB 4YHLH 3T0DA 2O93L 1RUPH 1Q0YL 5FUOH 5T3XH 3TBTB 1UYWH 3BAEL 5D6DC 2FZ3A 2MFNA 1KT2B 5EUOE 4O2FA 3MRGA 2FBJL 4HHAA 1F4WH 1DN0B 4GMSH 5FHBH 3VFNA 5JDSB 2XWBB 2V9TA 4L3EA 4YGVA 4AEHL 1QO3A 4OGAC 2BNQE 1IGJA 4FQXD 3KJ4B 3TO4D 5EORL 4G6FB 2VDLH 3QO1A 1DVFB 4JZOB 4K94H 3VFGH 3QDGD 3DI2B 4EOWL 1MRFL 5FDWB 1JK8B 3CC5B 1FNSH 1KJVA 4L3CB 3F12A 3GMLB 3WV0A 1KTKE 4FZEL 3OSKA 4YHNA 4LPVA 3ZHDA 1DFBL 3V95A 4MVBD 1N8ZA 1AR1D 4L4TB 3AM8C 1A6WH 2FHBA 4GXUM 5L0QB 4FQPA 1CQKA 1AR2A 4KQ4L 1UCBL 3FRUB 4XVUC 4HW6A 4QEGA 1AXSA 1T5XB 4WCYH 4NC1C 1EFXA 1FZOA 3GMOB 4Q9BA 4WUUA 1U58B 5T5NF 4JDTH 1IT9L 4M43H 3QJHB 5TDNB 3T65B 4MA7H 4WFFD 4FQLL 5T1KA 2OR9H 1FFNA 4GG6B 3PDGA 3C8KB 2YK1H 1O7VA 1ZKAA 3D39B 1AIFA 3KLAA 3X3FL 4ZOCA 4YFDB 2H2SD 2MTPA 4HUVB 3UBXI 1IGYA 1UXSB 2PYED 1NBYB 1MJ8H 3WLBA 1T1ZB 2HJKB 5DSCB 3L3OB 3ZE2F 1E4XI 1N0XL 2Z31A 3D9AH 3S36L 3GNML 3MRKA 3DURB 3NN8A 4FP8L 1CFQA 4ZXBB 1OM3H 4LDEB 2ZUVA 3FCTB 1U8HB 4KAQL 3NGBC 1F00I 1HQ4A 5K9OB 4Q9QL 1KCUH 2XYCA 4GRLB 4Y16C 3BDYH 5T3XE 1DBMH 3Q6FA 3VXPB 2YRPA 4KRPD 4MA8H 3QQNA 5CSBA 3PWPD 1NMCB 5EBLA 3DSFL 3OG6B 1OSZB 3P3YA 2BY1A 4KROC 3RWCA 3ZL4H 5HGDA 2QKIA 2AQ1A 2FO4B 2EH7L 1A14H 1F4XL 2UV3A 1MIEL 4YHOH 4HKZB 3VG0H 3ARBB 2VISB 5HHOA 4GO6B 4HKXB 1I9RH 3W2DL 3C60B 2ZCKL 4OGAD 8CGTA 1UA6H 1YJDC 3PHOB 1BFSA 1FORH 4I2XE 1LHZA 1CU4H 4XNQB 1EPFA 1YZZA 1KUMA 2YKLL 5DJAA 5E1HB 2KQMA 3ARDA 1NDMA 3LPGA 1NCAH 4NKIL 3RWDA 2ICWB 5D2NA 1QKZL 2FBOJ 4JFDA 5J6HB 4M6ML 3HMWL 2A6IB 5E2JA 3ET9F 2CLZA 2C5DC 3Q0HA 2LTQC 5DMYA 1EHNA 1H3WM 4MX7A 5C07E 2ARJB 3L3KA 4DGIL 3L5IA 4U1LB 5SX4I 3HI1B 2HVJB 2A83B 5DT1H 1MH5B 2VDNH 2CDEB 3WCYA 1IL1B 1U36A 5T1MA 3LKSB 4HGKC 4N0FA 4NZUL 3UC0H 3EIFA 3VRIA 1PKQE 3H42L 3LOWA 4BFEA 3T0VA 3T2NL 4ZO7A 3MRCB 4U7SA 3VW3H 2A6KB 5AUMA 5E08L 2WUCH 1JPFA 1NQBA 3H0TA 3SKUD 5HYSA 1CXLA 4QCIB 1Q8MA 3HPJB 3G6DH 5ANMA 3JV0A 4JDZA 4Q74A 1ZLUH 3SJVA 3OBAA 3MZGB 1U8NA 4G59A 1FNHA 5HHNA 1HH9B 3MNZB 1E4WL 1MJUL 4DGVL 3UTTA 3TN0C 2P44B 3L6FA 3QQ3B 4NO0D 4S2SB 5FA3A 1VEOA 3GSQB 3S5LA 5I8KL 2ITCB 1NCWH 5LKNA 1R3JB 4ZTPL 1CGTA 3MLYH 3OR6B 1NC2A 2FIKB 2NXZB 3G6JE 3DX7B 3MA9H 4ORGA 4Y16D 3NH7H 4GKSA 4G6AC 5J89A 3QUMB 2EDOA 1XR8A 5F7UA 4QHKJ 2W65B 3MX0A 3UTSE 4W6WB 3V4UH 4ZUSA 1IEBA 2FHCA 4XNMA 5FEBA 2DQUL 4YXLH 1U8QA 4RWHA 4Y2DC 4KROD 1I1AA 4KV5E 3OAUH 2BXYA 5EOTA 4MJ4A 1S7WB 2H3NA 3SE3C 4FRWA 5JIPA 4POYA 1AJ7H 5DQDL 3WNOA 4LKCA 4P2RD 1NMAL 5E03A 3QWRA 5I30L 4NJ9L 1GZQA 4PJ5B 5AZEL 1ZHBA 2HJLB 3Q5TA 1UM4H 3G5XA 1KJMB 2AK1H 4PJBB 5I71B 3G5YB 1MY7A 2VMFA 5IVNA 1FO0A 3P0VL 4TSBH 5DVOA 2VDKH 2H6PB 2NY7H 3MRQB 3ARXA 2XKNA 1H3PL 1EHXA 3S36X 3GHEL 4KMLB 1HZHL 1XGPB 3HG1A 1P6FA 3O2DL 1I8MB 3LEYL 1NLBL 5K9QI 3U4BH 2KDGA 3LZFL 1ETZB 1A3RH 4HJGB 4KQ3L 2BNUB 2Y5TB 5GJSL 4MJIA 4AIZA 1VERA 1EBAA 1Q0XH 1DQJA 5E6IB 1JMXA 2ED8A 1P2CB 4OLYL 1FNLA 3OXRA 2X70A 1AD9A 2XPGB 2CO6B 4NHCH 4C4KT 1U92A 3I6GB 4ZFFB 4DUXA 3CZFA 1IQWH 5GRJH 5AD0A 1MUJA 5HDOA 1Q9OA 4JFQA 3PGCB 4IM8A 4ERSH 3EYVB 1EO7A 3GKZA 4HEPG 4Y4FA 2ID5A 5HVGB 3V5KB 4JQVC 1K3ZA 4NRZB 5C0AA 3MRBB 4RCAA 5IW1B 2DLFL 2IAMC 1RU9H 1CR9L 4CVWA 4FXKB 1EEQA 5F1SA 4MAUH 1EVUA 1AP2B 4TULH 4WTXA 3DROB 5CKAA 4XNUL 3TN0D 2VDML 3RUGA 3HE6C 4K23H 1RY7B 2Q76B 4PLOB 1NGZB 1FIGL 3HPLA 4ZAKC 5ICXA 3OPZL 3P0YH 2EDFA 5I8CA 4KU1A 3WKNA 3LHPH 5BZWB 5D7JA 4G6AD 2F53E 4U6HB 2QHRL 3TO4B 4M3KB 2R0LL 1N64L 1F6FB 1XF2A 5DGQA 4QHUB 1QACA 2VL4A 5ADPH 1A9BB 3MLVH 4Y2DD 1WFNA 4V3DB 4L8BB 4CMMB 4FS0A 3MUY1 4BM7A 1LEGB 5BXFA 3OJDA 2YR3A 4ZTOH 5KVDH 3Q3GB 1ZLWK 3V79C 1CBVL 5AAMA 3BKJH 3S97C 3MCKA 3B9KC 5GS1A 6FABH 5GGSA 1X7QA 3P4NB 4FQJH 1N6QH 4I77H 4C56E 1D6EA 2F5AH 3GMQB 5DZOA 3UZQA 3AVEA 4XCFH 5BQ7A 4LCYA 1VADA 3WUWG 1HN1A 1XIWB 4EI6A 4TN9A 4OGZA 2EEBA 3FZUC 1WZKA 5FCUL 1YEJL 1PVHA 5L6YL 3HFML 1C5BL 3KPNB 4N5UA 3U0WL 4X5LA 4HCRH 3M8OH 5E56A 1PYWA 3VWJA 3BKCH 5C9KA 5E5UB 3QPXH 5L8KB 3EO1B 4X7FC 3LKNB 1MNUH 3KXFD 4QKXB 1ZANH 5B8CA 4YDKL 4RGNE 4J3OC 1JTOA 3D87B 3GUTB 1SYSA 1RFDL 2PYEB 1GXEA 2JE8A 4MCZB 2C1PB 3T4YA 5BS0A 1EXUB 4NOFA 3MJ9H 3RZCB 5IB1B 5C7XH 2R23B 1JYXA 3PWVA 4OLWH 4GAJL 5JQHC 2A2QT 4I3RL 4YDJB 3KYNB 1FJ1B 3SCMA 4KRPB 4N9GA 3PWPB 2AJXL 2IAMD 3R06A 4JDVA 1KOAA 3CMOL 1N7ML 1H0DA 2CKBH 2FLRT 4N8CL 2VR9A 3RPIB 5JIHA 3K7UA 5D7LB 3BEVB 2A1WL 2VITB 3RL1B 4LPXA 4GFTB 4H1LB 3HE6D 3GRWL 4Z76B 1HSAB 4ZAKD 2EXWC 3UTQB 1LO5A 5DVLA