1K5NA

Hla-b*2709 bound to nona-peptide m9
Total Genus 79
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
79
sequence length
276
structure length
276
Chain Sequence
b'GSHSMRYFHTSVSRPGRGEPRFITVGYVDDTLFVRFDSDAASPREEPRAPWIEQEGPEYWDRETQICKAKAQTDREDLRTLLRYYNQSEAGSHTLQNMYGCDVGPDGRLLRGYHQHAYDGKDYIALNEDLSSWTAADTAAQITQRKWEAARVAEQLRAYLEGECVEWLRRYLENGKETLQRADPPKTHVTHHPISDHEATLRCWALGFYPAEITLTWQRDGEDQTQDTELVETRPAGDRTFQKWAAVVVPSGEEQRYTCHVQHEGLPKPLTLRWEP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords major histocompatibility complex molecule HLA-B*2709
publication title HLA-B27 Subtypes Differentially Associated with Disease Exhibit Subtle Structural Alterations
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 79
structure length 276
sequence length 276
ec nomenclature
pdb deposition date 2001-10-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00129 MHC_I Class I Histocompatibility antigen, domains alpha 1 and 2
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1k5nA02
3.30.500.10 Alpha Beta 2-Layer Sandwich Murine Class I Major Histocompatibility Complex, H2-DB; Chain A, domain 1 MHC class I-like antigen recognition-like 1k5nA01
2W60B 3GGWB 4QXUH 1FFOA 3RVVC 4G7YH 5GS0D 1S7SA 4BH7B 3GMPA 2E27L 3NCFB 2WINA 4N1EA 5D72H 2MJWA 1WGOA 3GDBA 3SE9H 4LVEA 2AJUL 2MWCA 3KPNA 1FZJB 4NIKB 3DUUB 1RZKL 1N6QL 4GW5A 3OX8B 4JM2C 4S2SB 4ODVH 4ZUTB 4ZUWA 2NY6C 3PV7A 2AJXL 5GRVK 2GK0A 1S9XA 4PG2C 2FBJH 4GS7B 3OJMB 3L5JA 1U8LB 1U8OA 5FGBA 3O0RH 4KHXL 3MLXL 5BZWA 4QCIB 3CFEA 2IH1A 4NZTH 5J7CC 1SY6L 1HHGB 1OAYL 3NGBB 5EWIL 1VSCA 2V2WB 4FFWC 4QKXB 4GH7B 5GRUH 4DN3H 2EDJA 2W0FB 2ICEB 5I1EL 1FL5B 3GBNL 3CMGA 1SMOA 5FO7B 1BLNB 4OIIL 1Q9LA 4MLIA 4KK9C 5KANG 4AM0B 1FO0B 2CGRL 4MXWL 4YHMH 1CWVA 4P2YA 4PR5B 4I4WA 1DBKL 4IRJB 3UTTA 4HK3N 4S1RH 1A5FH 2YRPA 1QO3A 5F70A 4LCYA 1IC7L 2F5BL 5TFSH 3LEXB 5E94B 1XAUA 2PCPB 5I16A 3Q2CA 2Z4QB 4MSWB 3RP1A 4PB9H 1IARB 3LZFL 2ILLA 5GSRA 1LP9F 4YDVB 2EDDA 1CQKA 4W4OA 5CIPB 4IIQC 1CXEA 3WO3B 4M6AA 4DN4L 1T1ZA 3TJEH 1MFDH 3H7BB 5BXFA 1P4IL 1YN7A 4HJ0C 5LXGH 3VFGL 4Z7WF 4YHOH 3SDDA 5DA4A 4PLJD 3WLBA 5J6GB 3BDXA 1JPSH 4L4VD 1QSED 4N1CA 4WUKL 2YBRB 4MD4A 5FUCE 3PL6B 1CR9L 4HC1L 3D1MC 5DMIL 5CKAA 2PW1B 5EC2B 2RB8A 2H26A 2AGJH 5F6HI 5GS2D 2JF1A 1UENA 5B38B 1BM3L 4B0MM 2GYSA 3VXSD 1SJXA 4HAFA 5I8EB 3U9PL 4YJZL 5JXED 3CAFA 3P77B 2MFNA 3QNZA 5IROA 2WIIA 4XVSH 5D1ZA 4K9EC 4M7LL 1LE5A 5EZJB 4LOUC 1KBGH 3VXMB 4GAJL 2X89A 2I9TA 1WZMA 1CICA 4HT1H 1RIUL 4PY7A 3FQRA 4XZUB 5L2JA 4UIMB 5ICXA 5F9OL 1XR9B 2R8SH 2IADB 3MXWL 4Y4FD 2AQ2A 5LJYH 2AK4D 4HXBH 1J1PL 3RWCB 2V7NB 2EEAA 3B9AA 3MV9B 4Z7VE 4D3CL 3TBYA 3FAXA 4NC0B 5EZLB 3VRIB 3W5MA 4OLVH 1IFHL 4P2QE 1M7IA 3TO2B 1AGCA 1NCBH 1TTUA 3TC9A 4TULL 4NRYA 2XXMB 4MNQD 4BQ9A 1RZ7L 4YNYA 3VFSA 1EA9C 4LRNL 5EZIL 2YPKA 2AV1B 4WV1C 4PJXB 3V0AC 1IEAA 4X7DC 4EUPH 3RU8L 2R0WL 5JQ6H 4HWBH 1AGEA 3SDXE 1FCCA 3BP6B 3UP1A 3TPKA 4IMKA 1U3ZA 4FQCH 1LO3H 4W68A 1HH9B 4N90E 2VQUA 3FB5A 3QEGH 4PJBB 2OX5A 3VFVA 2PYEE 2J4WL 4KKLD 5CILH 5BQ7A 2FEDC 1YEDB 1QFUH 3ALPA 4FN0A 3ZL4L 3H42H 3EYVA 4I18B 3X13B 3WFCL 4F7CA 3FQUA 1OB1A 3X3GL 2P8MA 5C3TA 3BESR 3GSQA 2J5LB 3C5ZD 3OJDB 4HX1B 4U1IB 3CDFA 3IU4H 3TFKA 5C08B 3UZEA 3IT8D 3QJFB 3QQ4A 4RQQB 4ONHA 5I19H 1FORL 4LLQA 5C92A 4KAQH 4B41A 5T3XD 1U6AL 5I1JH 4PJIE 3MJ7A 3QDJE 4JQIL 1FH5H 1NSNH 2M1KA 5FHAH 3MCLL 2QHRL 2R2HA 1PZUB 1HCVA 1NMBL 4U2YA 3BN3B 1JGDA 4HDIA 2IAMD 3VWJA 2Y5TA 1KCUL 4TUJA 3BFOA 3QO1A 4XVUC 5KVGH 4N8VG 4H8WH 3SO5A 3PP3H 1S3KH 2ZUWA 4FQIL 4CJ1A 1QNZH 5C0CB 1YJDH 3O2WL 1V7ML 2NR6C 4JQXC 1MQKL 3U0PB 5JZ7D 4KK8C 4RFOH 2VXTH 3HE6A 3VFOA 1J1OH 1ZTXH 2MCG1 4CAGA 1OTTD 2BXYA 3STZA 2O61A 1N3NB 2R9HC 3S96B 4PJAA 5B8CA 1DQQA 3DBXA 3L95A 4LPUA 1C5DA 4X4XA 3RWJB 1BIIA 1KN2H 4UQ3A 1P4LB 3VH8A 3MV8E 1A6UH 2J3SA 4I1NB 1S5HB 1MRDH 2VUOA 5FKAB 4Y4HB 3WNKA 1P7KA 3VRJB 1A7QL 3IJSA 4AEHL 1YZZA 1KCRH 4L9LC 1K5NA 5GZNC 1KJ3L 1PBYA 1B0WA 5D2LE 1Q9KB 4EI5D 4TSCL 1Y18A 5IBUG 2XZAH 3EO1A 3QIUC 4F33A 4LCCC 4PJCF 2EXYD 1F11A 3SDYH 2X2YA 3TEUA 3T1FA 1B0GA 1BJ1J 1I9JH 3V7AE 4D94A 1JWSA 4OKDA 3KPSD 3IFNH 1FFOB 4OB5H 1A1OA 1S7SB 4EUPG 3GMPB 3L1OL 2COQA 2WINB 1QEWA 3ZSSA 1HK6A 1NAMH 3W2DL 4BJLA 1GOHA 1WZ1H 3KPNB 3TIEA 1Q1JL 2HJLA 4PJEA 1LO4L 4PGCA 2NZ9C 4WFFD 5TDNA 4GW5B 1PQZA 4ZUWB 4ZO9A 2GK0B 3X12A 1S9XB 2EDKA 3ULVD 3M17A 4KDVA 2Z92A 4MZ2A 5MHSD 2DQEL 1U8OB 3B9KA 4ZS7H 5BZWB 3BH9A 3CFEB 2IH1B 2KL6A 4Q6IC 1XF1A 4MA1C 4GBXC 1KB9K 2BERA 4LIQE 4JDTL 2ZUQC 4YGAB 5ICZA 3LS5H 4OFKA 4J3SA 1IBGH 1F13A 1LQSR 3I3DA 4ZAKA 1DTUA 1NCCH 2B0SL 1Q9LB 5C07E 3MZGB 3P9WB 3WFDH 2XZCL 4DK3A 3QZWA 2YUZA 1IGML 5I6XC 3QUMA 4GKZA 5E03A 5EBMA 1LE9A 4I4WB 4KDWA 3MLPA 2YD8A 3UTTB 1BREA 4IJ3C 1QO3B 4LCYB 1HYSD 2QL1A 4U4BA 2D9CA 1N5YH 3EHBC 5CJXA 2FSEA 5I16B 1CXIA 4J7RA 3TO4C 3K81A 2XTJC 1X5FA 1TJIL 5HI5D 1AQKH 1E4XL 5GSRB 3MO1A 1Q9WA 3H9YA 5T3ZH 2DJ4A 5DXWA 4FNLH 2DRUA 1E4KC 1MHCA 1T1ZB 3D9AL 1ZEAH 3TCXA 1T20A 5BXFB 3KG5A 1YN7B 1ACYL 1FP5A 3SDDB 2W0KA 4M61A 4J3VA 4PRNA 4RFNC 1Z9OA 3DPBA 3WLBB 3TP4A 3FN3A 4LF3A 3BQUC 3SKOA 4XWOC 3Q5YA 2VLRA 3GJEA 4MD4B 5KOMC 2OZ4L 1TQCB 1LDPH 3RY5A 1F90L 5C9JA 2H26B 1EEUA 5SWSD 2ARJA 1ZA3A 2F19H 3ZE2F 4JRYD 4LVOB 3EOBA 5LWYL 4JFEE 3NZHL 3VI4F 1YQVH 2AQ1A 3O6LH 1S9VA 2QR0B 4J12A 4JZOA 3NA4A 3QNZB 2WIIB 3HFML 4R97C 3IFPA 5D1ZB 4BUGA 3MRBA 4EOWL 1LE5B 4X7CC 4LBEA 1VESA 3H3PH 4HKZA 4QRPD 2I9TB 4FQ1L 1CICB 3FB7A 3HHRB 3BPLB 4PY7B 1BJ8A 2NTSP 3FQRB 3WNOA 3OL2A 5L2JB 3WHXA 2UZYB 3ALWA 3C60A 5ICXB 3ZKMC 1CDGA 1I1CA 1M7XA 4LHJB 5JIKA 4NQDD 1RMFL 4N9GA 3MRDA 4M7ZC 3NIFE 1BP3B 2FHFA 4NBZB 3FMGH 5I75B 4M43H 4L4VA 1QSEA 3TBYB 2GTWA 1F4XH 3B5HA 1JPGA 1U8JA 4X6CF 3AC0A 3FO0H 1M7IB 4MB5A 1AGCB 4FQXD 2JJWA 4YDIH 3SKJL 4GMSL 4GQ9H 4NRYB 5I9QC 1K3ZA 2F74A 1YMHA 4ORZC 3VDCA 3VXSA 2CK2A 2NX5D 4YNYB 4XPTL 3VFSB 1YEIL 2DQHH 3LDBB 3O6ML 3ZT5A 2YPKB 3QIBC 3E8UH 1IEAB 2X1XR 1FBIL 1E6OL 1GVIA 3RUGE 1AGEB 2AEPL 5DJZA 5CGYD 4XMLL 5L88H 5KSUA 1D5IH 4YLQT 3FB5B 1H3TA 4GW4A 3VFVB 3AAZA 5DYOB 3U79A 3PG2A 1W0VA 1HHKA 1RZJL 4XNXH 5IOPA 5BQ7B 1KIPA 4Y4FA 5IBLD 2AK4A 4UV4H 3EYVB 2O5ZH 4LIQL 1O7SA 4F7CB 4KV5F 3FQUB 3NGBC 1OT2A 1YC8A 3I6KA 4XXCA 1OB1B 4MB4A 4M6MH 2P8MB 2FLBT 8FABA 2HT4D 3GSQB 3EYUH 4KKAD 2W65A 2X4RA 2ICWA 3QQ4B 4ONHB 3MRPA 3IAGC 1JZ2A 4LLQB 2HWZH 3QRGL 3LRHA 4HPOH 4JFHE 1AXIB 3MJ7B 2PR4H 5BV7L 4MNQA 5KVDH 5J3HD 4RGOL 4H8WC 2DTML 2R2HB 1YJDC 3IS1X 3CX2A 2IMNA 4JFYA 4KROC 1G6VK 4L5FH 5KW9L 1JGDB 1JHTA 4HDIB 1XR8A 4N0CC 4EDWL 4ZS6D 3VWJB 2JCCE 2Y5TB 4TUJB 5E99L 4OZIA 5FB8A 2PYFA 3EFDH 3LPGA 5F88A 5C6TL 3QO1B 4WI7A 2NY1B 1SMAA 1IZJA 2Y23A 3D3VD 4OQ1A 3ZYZA 3SDCD 5J9PA 4R0LC 1VFUA 4OGXH 2D0HA 1FGNL 1A7NL 1NPUA 1C1EH 3HE6B 3VFOB 3G6AA 5EIVA 4XWGL 5AYQA 3UO1H 4GRWB 3STZB 2O61B 1W8NA 4FFYL 4OT1H 4PJAB 3WLWC 3P9LA 2EE9A 3C5ZA 4BK4A 5B8CB 1DQQB 1F6FB 3V4VH 3DBXB 4M7JH 3L95B 1OAUL 3LKOA 2X44D 4MMXC 1C5DB 3PL6C 4JHWH 4X4XB 1BIIB 2VN7A 5EUOA 1NUGA 4UQ3B 3VH8B 5MEQA 3PE9A 1T83C 4D0CB 3M8OH 3WXWH 1WZLA 4X6DA 2EDTA 1Z3GL 2WM0A 4OCRH 3TVMD 5KTEH 1P7KB 1GIGL 4MNGE 3IJSB 4I5BA 4FP8H 1AJ7L 2P5WA 1K5NB 2IAMA 3ARWA 4FTVD 1A4KA 2P4AB 5EOCL 1Y18B 3DUSB 2QADB 3EO1B 4F33B 1F11B 2AK1H 2Z35A 1BQLL 3T1FB 1BX2A 1B0GB 5FA3A 4MHHI 4XP9L 3JWDH 1JWSB 4LU5H 1A1OB 1MAMH 1LP9E 1FZKA 3EJZC 1SYVA 3TF7C 1QEWB 1G7QA 2R2BA 1BVZA 4X5XB 3GHBH 5GGUA 1X3DA 3CGTA 4G6JH 1KEGL 2XY2A 5MP6H 3TIEB 4L3AA 2HJLB 1R5IA 4PJEB 4PGCB 4HUXA 5TDNB 3ULUD 4PREA 1LO2L 1PQZB 3QNXA 5SWZD 4A6YH 2AABH 4EXKA 4K71C 3LEVL 3X12B 1NDGA 1N5AA 5H8DA 3CLEH 4YGVA 3M17B 2Z92B 3S36H 5FK9A 4E41D 3B9KB 1IMHC 3KYOA 3BH9B 4E42A 3O3EA 5IR1A 1MCDA 2D31A 2DLIA 4TTGA 4RA3A 3BW9A 3VJ6A 1I85C 4XC3L 2X70A 4N8VA 4XVJL 2OXHA 5ICZB 4LARH 5C0FA 2F54A 1K85A 3STLA 4EI5A 4XCCH 1X6NA 1AI1L 4J3TA 4U2ZA 4ZAKB 4OCLC 4J4PC 3QZWB 3SKNB 3QUKA 3U36A 2OR9H 3QUMB 4GKZB 3D39D 1XGYH 5GGQL 2UWEA 5EBMB 1LE9B 3D87B 4GKSB 2QQQA 5KS9A 4HWEL 3EJJX 1IJ9A 1R5VA 2HT3C 3ZTJG 5A3IC 1KENH 3MRMA 2FSEB 1MNUL 1WJ3A 3VXOA 2VZTA 1HXYA 3VGDA 1V7NH 2JB6A 3KGRA 5IJKC 1PKQE 3MO1B 2W0LA 1Q9WB 3P9MB 4JFOA 3SBWC 5JW5B 3N1MC 3WD5H 1KYOK 4W6XB 4JM2F 1MHCB 1OAQH 1Y6NR 4R2GC 1T20B 1JTOA 2VDOL 3KS0J 4CW1A 1CE1L 4M61B 2KPNA 4PRNB 5M95B 4XPHH 2VC2H 2XICA 3V4UH 4LF3B 3SKOB 2VLRB 3AROA 3GJEB 1KCSH 4HCRL 2RFXA 5C9JB 1DLFH 2ARJB 2LVEA 4RAHA 2J8UF 4GAGH 3RKDD 1ZA3B 2R0KH 1FFQA 1TZIA 3EOBB 5L7XH 1MCNA 4PRPE 4F8QA 1S9VB 4JR9H 4JZOB 4UILH 3IFPB 4YBHA 3GSNH 2F5AL 4W70A 3F58H 3MRBB 3VFRA 4LBEB 4GO6B 2D7OA 4HKZB 1UCBH 2UVEA 5HGBA 5HDQL 3FB7B 4JPVH 4L8SC 3WHXB 2C7UA 3C60B 3O41A 3HR6A 5JIPA 2HFGL 1N0XL 4L3CA 1UKSA 5KSBA 5TF1H 5FO8A 3CVHL 4N9GB 3MRDB 1GYAA 5INDA 4FA8A 4K8RL 3RIFK 4L4VB 1QSEB 1CLZL 3CH8A 2GTWB 1JPGB 1EBAA 1NMCB 1U8JB 3SEPA 1DL7L 2XA3A 1C16A 2NY5H 5SWSA 1C7TA 3BWUC 5EU6E 3MYJB 2FB4H 4JRYA 5HTSA 2F74B 4QXTA 1B4RA 4PJDE 3VXSB 4D9LL 5EOTA 4KY1H 1OCWL 4MAUH 5CAYB 1MCCA 3C09C 1K2DA 4PDCE 15C8H 1WUNT 4PLOB 2BY3A 5DJZB 1T7YA 5E8EA 1T80A 5KSUB 5I76A 5BOZG 4QRPA 4BYHA 4LLUA 1G6RH 1B9ZA 3RVXC 1DUYA 4D9QD 3O45B 3NOIA 4GW4B 3AAZB 4YHNA 5F6HJ 1W0VB 1HHKB 3REWA 5IOPB 3GRWL 1KIPB 4Y4FB 2AK4B 3ZKSD 2X1OA 1D6VH 2FRGP 4NQVA 5DC4B 1G1CA 1A7PL 4GXVH 2VDKL 3I6KB 3ZDXF 3OXSA 5CMAA 8FABB 3LV3A 4UT6H 5CS7A 1N7ML 3GSWA 3VW3H 4UNUA 1KTLA 3EOTL 1KB5L 2X4RB 4E5XA 2ICWB 1UYWL 4KZEL 1KIQA 3MRPB 5EOQH 1H3UA 5E4EB 4RIRA 5FM5O 3UEZA 4DVRH 1FQ9C 5AD0A 4PJCE 4MNQB 2F8OA 2B39A 2NX5A 3UAJD 4NCC1 2VLME 2OQJA 4Q9RL 4JFYB 2V2XA 1NFIA 1J86A 1JHTB 1Q72L 1XR8B 4Y2DD 2WV3A 4OAWA 3LEYL 1NAMA 1EJOL 4F57L 4OZIB 5FB8B 2PYFB 1V05A 5EOCJ 5F88B 1FL3A 1BQUA 4XNZB 3ZZ1A 1TDQA 5J9PB 1TVBA 4CDHA 1NBVH 1ZKAA 1DBAL 1W0WA 3PWJA 3MRIA 4DKFH 4FFZH 5D8JH 1GXEA 3G6AB 2JJTA 5DC0A 4LLYA 5DFTA 4WO4D 3P9LB 3C5ZB 1BFSA 4JPKH 1K4CA 4NQTA 3TT3H 3LKOB 4N0RA 1TCRA 2KDGA 2D7NA 1TQCC 5EUOB 4X8JA 3UTSD 5E9DD 5A2LH 4TOYL 5MEQB 3F8UB 1P5UA 4X6DB 4NHCH 5GJTL 1N6UA 4OLWL 4ZPTA 4I5BB 5CD3A 4G43A 2P5WB 3SHSA 5F8RC 4NN5B 2IAMB 5D7LD 4ZODA 5IGXH 4APQD 1BBJA 1NFDA 4I9WE 4LK4A 1A4KB 1KACB 3EYOA 3U82B 1EEYA 3D3VA 3PABA 2QQLL 2Z35B 4HV8A 3SDCA 5FA3B 2ICES 5D1QD 3BPCA 2H2SD 4KUCF 4MDIA 1HIML 3RPKA 1FYHB 1TVHA 1BD2E 1FZKB 3UJTL 1SYVB 1G7QB 2R2BB 4HPYH 5GGUB 1MRFH 4Q9BA 3VDBA 4JN2A 4P2OA 1R5IB 2P48B 4DUWA 4HUXB 5H94A 4HFUL 4R26H 3G6JF 3QNXB 5I75C 2FX7H 1JGUL 3QDME 2N1KA 2VDLL 5FFLA 4KC3B 1NDGB 1N5AB 4NZUL 4YGVB 5HDBF 2DLFH 5FK9B 4ODTL 3P0VH 1DQTA 5F72S 3S4SG 3S36X 1JHLH 1OT1A 3QPQD 5GS3A 3VA6A 1G9ML 4E42B 5D96B 3GBML 3O3EB 4G6KL 2VMFA 2PXYC 3GMMA 1J0ZA 2NW3A 3TVMA 3ZE2E 2BNQE 5IR1B 2D31B 2OM5A 4M48H 3SOBH 1JNJA 3LDBC 3BW9B 3KNBA 3VJ6B 5FM5M 3VI4E 1P84J 2B1AH 4G8EA 4RISL 2X70B 4N8VB 5ID1A 1A7BA 2ADGA 5C0FB 2F54B 5BVPH 2P8LA 3STLB 4EI5B 4QTHA 1QRNE 1I1FA 2C1PA 4KTEL 4LLVA 4OM1L 3ZDYF 1K3IA 2ZSVA 1HQ4A 4OCNC 4WW2C 3HKFA 2VDRH 3QUKB 3TPUA 3U36B 5C0ND 1Z6JT 4QO1A 5FUOL 1QPXA 3BKCL 1A6VH 1CVRA 2UWEB 1Z0NA 1BVLA 5KS9B 4NDMA 5LG1A 1R5VB 5DK3A 1FNAA 5HI4D 2AJXH 2C3GA 3CSYA 3MRMB 5C6PB 3WIIH 1QOKA 1AY1L 1IGFH 4FABL 1HXYB 4Z0XA 4KHXH 2BNUA 3MNVA 3KPRE 2JB6B 4FFVC 4CMHC 3FT3A 4P23D 5EWIH 1OAYH 4JFOB 4NZDA 2KZ1B 4Y16C 4RMWA 4LHUD 2YWYA 1IRAY 1F4YH 4DAGH 1JF5A 4WCYL 4WU5A 4CW1B 4R8WL 1MJ7H 3GI8H 5IBUB 2IEPA 3KLHD 1CXHA 3GBNH 1F58L 2AJSH 2IQ9L 4KJWD 3VG0H 3VWJC 5DLMH 2RFXB 3OB0K 1E0OB 4CL7A 1DCLA 4EUPB 4M93B 1REIA 2H1PL 1DBKH 2X1QA 4UT9L 4NO0D 1TZIB 5TE4L 2R0ZL 4C83A 3D0VA 1IC7H 3D39A 1X5JA 4OM0L 5DZNA 4AEIH 3D85A 5F7MC 3H2WA 4S1QH 1FAKT 3V0WL 1OGTA 4KV5E 5E2TL 4QT5A 5LGKA 3MCG1 2UY6A 3VFRB 4NQEE 2YMXL 5HGBB 1ITBB 3QI9D 2D0GA 2C7UB 3O41B 4CMMA 5E8OA 5GZOC 4L3CB 5KSBB 4OFYD 2F53E 3DJ9A 4JN1L 5FO8B 3B8SA 3EJYD 1FPTL 1KN4L 4HC1H 3N85H 5INDB 3OHXA 1EMTL 3GNMH 4OF7A 3U1SH 3KPLA 4JFDA 4TVPE 2Q6WA 3N0PB 1DR9A 2E9WA 2KZWA 2XN9E 4J3UA 1YN6A 3MLZL 1C16B 5SWSB 2EH7L 2ZKHL 4O2FA 5E2UL 5SV3A 3O2DH 4KI5D 4JRYB 4MS8D 2ENSA 4H0GA 4K7FA 4OLUH 4QXTB 4S1SL 3JTTA 4NBXB 2EYTA 3FN9A 5EOTB 5C0AA 4D0BA 2DMBA 2WZPD 2XPGA 2H41A 1K2DB 3NABL 1AE6L 1VHPA 1MCFA 1NFKA 2A0LC 5E8EB 3RNQA 1H0DA 5I76B 1NCDL 5E5MA 4QRPB 5I74B 2AXFA 4LLUB 4YXLL 2R1XA 1DUYB 2E7LC 4RGNC 4O5LH 1J1PH 3SCMD 4YHNB 3HB3C 1DQDL 1JI2A 1UJ3C 1VFAA 5JMRA 3REWB 4TVSa 5HHOE 2IGFL 1PAMA 1AHWA 1J9CT 1OQOA 1MPAH 4V3DB 4NQVB 2OI9A 2OTUA 4WNQA 3OXSB 2Q7NA 5CMAB 5A16A 2IMMA 3IGAA 3LV3B 4KKCD 1NGQH 2AJ3A 2APTA 4TULH 3O4LE 4H88H 4WDIA 3GSWB 3TYGL 3QCTH 1KTLB 4E5XB 4JG1H 3SQOH 1RZ7H 1KIQB 3V0VA 4RIRB 4ZAKC 4I0PD 1MFCL 4OF6A 3BDBA 5AD0B 1NMAL 1P1ZA 4IMLA 3BXNA 4XHJD 3FFCD 4V3EB 1CD1B 2AJYH 2NX5B 1U8QA 4MCZA 1NANH 3RU8H 2OQJB 4PP8C 3MPCA 2V2XB 3CDGA 1NFIB 3A67L 5LQBH 3MQIA 2X4PA 3VMPA 1MCLA 4FQQA 1M1SA 4UT7L 4LMQI 1F2QA 2VLJD 4OAWB 3GSVA 1NAMB 2J4WH 3DHMA 5CJXC 1FL3B 4JO3L 4WFED 3NN8A 3VGAB 1WBXA 3ZL4H 3H9SD 4OCWL 1TVBB 4QNPE 1HYRC 1G7LA 1QA9A 3QXDA 1W0WB 3PWJB 3MRIB 1FC2D 3F5WA 3X3GH 1FIGL 2XNAA 4LSRL 1L9NA 1ZA6A 3CXHK 5TJWK 2DWEA 2PTUA 4LLYB 4Y19E 1WITA 2DI8A 4DZBA 1U6AH 1PY4A 1T0MA 4R7DA 3QEQE 5IT2L 1TCRB 1AO7D 4UAOC 4X8JB 3WSQL 4GRLD 2VZUA 3MA7B 2JJVA 5DHVA 3B2UC 2XG5A 2GSGA 3HI5L 2X10A 4JKKA 2XIDA 4XRCA 3WS3A 5ICYA 4C56E 2G5RA 3RX7A 4P46D 4ZPTB 1T2JA 1KCUH 2OL3A 4I48A 4G43B 4KVCL 2XFXA 5DQDL 3VI3F 4BH8A 5CD3B 5L9DH 2ZCLH 5BS0D 4Y2DA 5E2VL 5D7JD 2R39A 4ORGA 1BBJB 1NFDB 4XVTH 1T21A 3OSKA 5ALBL 3EYOB 1EEYB 3LH2L 3CX5J 3D3VB 3PABB 3R1GL 4HV8B 3SDCB 3A6CH 3KYAA 3SE4C 3X11B 4ESKA 1RZFL 3BPCB 4YFDB 4MDIB 1TVHB 5F1IA 5F9WC 2YPLE 5I1KH 1C5CH 4AL8L 1EIBA 1LO0H 5D70L 2YSSA 4JN2B 2O5YH 4P2OB 4PLJC 4DGIL 1WVZA 4H0IA 4WO4A 5H94B 3QXVA 1NCUA 4RBPH 4TVPL 3MACL 3HRZA 1UWGL 3WNPA 3UTSA 2BDNL 4UIKH 1W72L 1BQHG 3B3IA 1R3IH 2HKHL 2NW3B 3EDDA 1YEEH 3GMMB 3TVMB 2J6EA 3ILQC 3QG7H 4PBXA 3KNBB 2EDOA 4XPGL 4G8EB 4NQCE 5C0GA 5JXEC 2F58L 1EHLH 1CBVL 5ID1B 2ADGB 4F9LA 4APQA 2P8LB 4LQ1A 2MQ0A 4PV8A 1AD0A 4JAMA 3GSUA 5L0QB 4QTHB 1I1FB 2C1PB 4LLVB 4NKDA 5EIIA 3BD3A 4K3HA 3IDYB 2FECL 2ZSVB 1HQ4B 3WFHA 3BI9X 3TPUB 3S5LG 3RY6A 4J3WA 4WI6A 4YBQD 2BRRL 1V8HA 5GGSA 1BVLB 3MRKA 1XCQA 2M8XA 4NDMB 1KG0A 3HAEH 3MXVL 2P46B 2YPVL 4O51A 3CSYB 4KJQD 1GC1C 4JPWL 5GHWH 2P47B 3UPAA 1C7SA 4OZGE 5GGVL 4FZ8L 4Z0XB 3PXJA 2BNUB 2D2OA 3MNVB 1OWWA 4IOIA 3AS0A 3UTPD 3FT3B 1MOEA 4KDTA 4JDTH 1WF5A 3L5WA 5CD5C 1WBZA 1X5KA 4DTGH 4P59L 4WU5B 4M7LT 4NNPL 3RPIA 1PSKH 2AJVL 1J1XH 2R56H 3GKWH 4YFLF 2F8VA 1T7XA 7CGTA 5DEFA 5K9OA 1UXWA 4V1DA 1UH4A 3DI2B 3HLAA 4RZCA 3ZE1E 3GSRA 2RR3A 1FNHA 4OLXL 2E9IA 4C83B 3D0VB 4KKLC 3D39B 3MLWL 3S7GA 3D85B 3QFDA 1X4XA 4PJBF 4PGDA 1ZLVK 3OKOA 1OGTB 3CLFL 3MMEA 4ZD3L 4QT5B 4WI2A 3S4SA 4OGAD 4Z8FL 4MXQC 4YC2C 1JVKA 1II4E 4FOMA 5DMGD 4Z0BL 1GJIA 3U4BH 1K8DB 3UYRL 5F1NA 4P23A 2BOBA 1FNSL 4CMMB 1OVZA 2A6KA 5E8OB 3OKNA 1YEFH 2V17H 3IFLL 3CH1A 2X4UA 1AXTH 4OD1H 4WFGE 1INDL 3OHXB 1KTDA 4PGEA 3FO9B 3QIWD 4G7VL 3KPLB 1A0QL 2VIRA 4JFDB 2Q6WB 4DVBA 1ZOXA 3MJ9H 1CZ8L 1YN6B 3OQ3B 4DGVL 3KPQA 3TH4T 2C4XA 4MQTB 3ZDZF 4O2FB 1AD9A 1PX4A 2YKLH 3CSBA 2EO9A 2JELL 4K7FB 4F80A 1RIHH 4G80A 4NM8H 4OSUH 2EYTB 1L8JA 1K6QL 5BRZD 5C0AB 4D0BB 3QUXD 3WNLA 2XPGB 2FBOJ 1J18A 4O4YH 2XG4A 5JZ7C 3MOBL 3ZKNC 2KKQA 3RVWD 3H8NA 1OTTC 1NBYA 3RNQB 1H0DB 1SQ2N 2X40A 3KJ6H 5E5MB 1CIDA 2XZQH 2AXFB 3BMWA 2R1XB 4CN1A 3QI9A 1BIHA 1EFQA 4M9OA 5E5RB 1VFAB 5FIEA 4BUHA 3TT1L 1FFNA 1AHWB 2OI9B 2OTUB 3ZHDA 2VWEC 4HMCA 4WNQB 4JFPA 3O9WC 1RJZA 1MHPH 5A16B 4P2CG 3AU1A 3IGAB 4ZG1A 2AJ3B 2MKWA 2NYYC 2VXSH 4ZOCA 4LMQE 4WDIB 3OG6B 4NPYA 5E2JA 4MGXA 5I1IL 3V0VB 1HINL 2EXYC 3D25A 1NLBL 1KXQE 4PS4H 1P1ZB 4IMLB 1TJGL 5HHVH 3BXNB 1RULL 1U8QB 4MCZB 5JUEL 4ZFFA 2Y25A 3WNNA 5KVMC 2CLZA 3CDGB 4LGSB 2Z31D 2X4PB 4FQQB 3BT2H 1VEMA 2DQTL 2APVA 3QQ9C 5L6YL 1LO5A 3ILPA 4HWNA 1OAZH 3GSVB 1P5VA 3PWPE 5SX4I 1V3JA 3NH7L 1A64A 1RJYA 3NN8B 1WBXB 3Q6FA 5MEPB 4ZO7A 4P2QD 5AYUL 3SCMA 3QHZL 1CT8A 3TA3D 4G8FA 3WIHL 1G7LB 1QA9B 4KMTH 4UINL 4PJ5E 5A43C 5HDBE 3QXDB 5E8DL 4AMKH 1SM3H 3F5WB 4HS3A 2VZSA 2NNAA 3QWQB 2W59A 4K7PL 1VENA 2XNAB 5F96L 1ZA6B 1YNLH 2DWEB 1EUUA 4DZBB 1CGWA 5DUML 1AR1D 1T0MB 3VXRE 4R7DB 5DUPL 4GSDH 5F89A 3K2UH 4RGOH 2A74A 1TMCB 5I1GL 1R3HA 4I0PA 4N90D 2Y36L 5DHVB 3FFCA 3ZDYE 2GSGB 2E6PA 3QBTB 4XRCB 3SJVE 5FYLE 3WS3B 3WS6A 5ICYB 2YD9A 5HD8C 4XNUH 4LASL 1E27A 3P4LA 3ET9F 2OL3B 4I48B 2XFXB 4BH8B 1RUMH 3IXTA 4XGZA 3VMNA 4Y2DB 3IB4A 2VLJA 1GGIL 1I3GH 4LLAA 5F6IB 1T21B 2IQAA 2VOTA 2HFTA 4PY8I 5FYJL 3GSOA 2BMKA 3H9SA 3BH8A 4WW1A 5HI5C 2RHEA 3BD5A 3CFIC 4XWGH 2ED7A 3QDJD 5F1IB 1EGJL 5TQ2L 1JZ3A 1SY6A 5HI3D 4X7FC 3N1GC 2XKSA 5DRNA 2YSSB 4X0KA 4MQ7A 3OKDA 4WO4B 2EC8A 3HRZB 1LGVA 5ITBL 3SGJC 1XF5A 1B4JH 1AO7A 3UTSB 4FS0A 5EZOL 1T89A 4GRLA 5T1KD 1LDSA 3ARDD 4YQXH 5KOVC 3MODL 1X5LA 1GAFH 2DQGH 3B3IB 1WSST 4JO1L 4L3EE 1CU4L 1RUKH 2EIEA 2P1YA 2Q3ZA 4P46A 5DO2C 5E8NA 3AREB 3V7AG 1T22A 5C0GB 1UM6H 2BFVL 4ZDHA 4DFHA 2V5RA 4QHMA 5D7JA 4APQB 4WWKD 4PV8B 1AD0B 2J8HA 4JAMB 2BX5A 4XP9H 3GSUB 2I07A 1T0PB 4BZ2L 3GMRA 1T6WA 4NKDB 5EIIB 3E6FA 4ETQA 3MV7E 3L3IA 5I74C 3WFHB 3VXTA 2X9XA 3U6RA 2EKJA 3EDEA 4HLJA 3MV8D 5GGSB 3MRKB 4TUKL 3WUZA 1G9NH 1XCQB 4F7EA 4LPYA 1KG0B 5DD0H 3BZEA 3THML 1MRCH 2Q86A 2XTJE 4O51B 4OGYL 5JA8B 1UWEL 3VGEA 4LSQL 4L1HA 2YUVA 3BZ4A 2CRZA 2BVPA 4ELMA 4N0FA 1JGLH 4IOIB 4HC1A 5EH1A 3E3QA 3O6FD 4UQ2A 1KELL 1DQLH 3GJFK 3P11H 4FQXC 3MRHA 5IK3A 3L5WB 1FVDA 6FABL 1WBZB 1NGYA 1IAIM 3S34L 3DVNA 3D48R 5M94B 1PLGL 4MJIE 3RPIB 2E7HA 4TNVK 2KQMA 4XTRD 1UZ8A 5DEFB 2H8PA 4PPTA 5K9OB 1UXWB 3OXRA 4V1DB 2CMRL 5C0JA 4FZEL 4XP5H 3HLAB 4RZCB 5FGRA 1JHKH 3KJ4C 4LAQL 4XNYL 2ZCKL 4X7SH 5IB1A 1P7HL 1W0YT 4HIXH 3VG9B 1MNUH 3QFDB 4W6YB 2HMIC 5KAQG 1JMXA 3MLSH 4PGDB 1BFVH 2R2CA 3BYTA 1KLGA 3OKOB 3MMEB 2AAVA 5FGCE 5HVHB 3S4SB 4M62H 3OKKA 1MREL 2LABA 1BQHA 5ETUA 1VB9A 4NJ9H 1T4KA 3SE8H 4OLZH 5F1NB 4EXPX 2BOBB 3BN9C 1IAOA 4QXUL 3UBXG 1UEYA 5C07D 4G7YL 2A6KB 1JWMA 1PW3A 3OKNB 4MDJA 5DI8A 5D72L 4XXDA 3CH1B 2X4UB 1OQXA 3DVGA 3PHOA 3WDIA 4FMKA 5ITFA 1KTDB 4PGEB 3TNMA 5HXMA 2VIRB 4ZTOH 4ODVL 4DVBB 2PTTA 3S5LA 5IW6A 2FBJL 1A1NA 4OLEA 1AD9B 4L4TE 3AFLA 4LRIA 3O0RL 1NCWH 5CSGA 1P4BH 4G80B 3SDCC 4NZTL 4G3YH 3VXUE 2F5AH 3MTRA 4RA0C 4PJ8D 4XX1E 5GRUL 4X7EC 4PYHA 4AIOA 4DN3L 2HT2D 4UDUA 4PJHF 1NBYB 2VTFA 2BRQA 1XFPA 3BISA 3RA7H 1TTFA 1RFDH 5I1DA 4KVNL 1QFOA 2FD6H 4R7NA 3R8BB 1C12A 2NXYD 3QI9B 5I0ZA 4OUOA 4HH9A 1FFNB 3LMJL 4YHZL 1S78D 4GRMA 1T7VA 4PJAF 4K8RH 3C9NA 4JFED 4S1RL 1A5FL 4FQJH 5TFSL 4JFPB 4KKBC 3QIWA 4JVUA 3AU1B 1TCMA 2Z0BA 2VDNH 5GGTH 3VI3E 3TBTA 3DROA 4PB9L 4F37K 1J0HA 4NPYB 4D9LH 5CKGA 3QULA 3MYZA 4ZFGH 3D25B 3S9DB 2GJZA 3VGFA 3IF1A 1I8MA 4MJ5A 3TJEL 5JOFA 1YNTA 4ZFFB 1MFDL 5LXGL 2CLZB 4YHOL 3BSZH 1BAFH 3DRTA 1JPSL 3B9EA 4QRRD 2GY7B 1LO5B 32C2A 3BPNC 3ILPB 4LLWA 1I3RA 3ULUC 1JTTA 1RJYB 4JKMA 3Q6FB 3SCMB 8CGTA 2W9EH 1CT8B 4G8FB 1RJLA 3PDDA 4PJEF 3CFDA 3RGVD 4HS3B 1KV3A 3CFBA 2NNAB 1CD8A 1S7UA 4KJPD 4XVSL 1UYWH 3MRJA 4Y4KD 1KBGL 4Z76A 4IS6A 2VNCA 5F89B 4HGWA 4HT1L 1ZHBA 5J0BA 5DEZA 2A74B 1R0AH 1R3HB 3BGFC 5EULV 1T3FA 4I0PB 4S0TD 2YS4A 5FOBA 4WIQA 4AG4H 2VKXA 2R8SL 3RZCD 3S3PA 3FFCB 1U91A 2O26U 4HXBL 4KPHH 5EO0A 2IG2L 5K9KA 1H3PH 3ARTA 1E27B 2A9MH 3IXTB 4XGZB 2Z31A 2AXHA 2V5SA 2VLJB 4Z7VA 4OLVL 1WTLA 2IQAB 4JZJC 4YIQA 4WVRA 3KXFE 2VO5A 3GSOB 5DR5H 3RAJL 3BPOB 4P2QA 3H9SB 5EUKA 3BH8B 4WW1B 3TA3A 1HKLH 2WWMD 3AM8C 4RGMB 3VFPA 2J7LA 1J12A 3UYOD 4PLKC 3TV3H 5CGTA 1WFUA 2A9NH 3ESVF 1TZHA 2V9QA 5JQ6L 5DRNB 4HWBL 5SX5K 4X0KB 4MQ7B 1EPFA 4LL9A 3OKDB 4NM4H 4PRBA 5CJQH 4FQCL 1LO3L 3C8KA 3QEGL 1XF5B 5I71C 1AO7B 2WUBH 3LIZL 4GRLB 5CP7A 2BJMH 3QWOA 2DM4A 3RKDC 2OJZH 1I8KA 1QFUL 4QRUA 4P46B 5E8NB 1IM9D 4YO0A 5T1DH 1UADC 4EN3C 1T22B 4ZDHB 1YYMH 5IG7A 3IKCA 4QHMB 5D7JB 3OKMA 4YXHL 2QQLH 3ARSA 4PJBE 3T3MF 4HJJL 2I07B 3GMRB 3E6FB 5I19L 2BSTA 5AG8A 4KAQL 3GJFH 1K4DA 4ETQB 4OJFL 3UJTH 1NQBA 3L3IB 3VXTB 3U6RB 1NSNL 2H6PA 5FHAL 4PJIA 3QDJA 1PYWA 1DANT 3BP7A 3JWOC 3QJHB 2ICWJ 4F7EB 3BZEB 5IB4A 1JGUH 1X5XA 2Q86B 4LPWA 1MWAH 4OFVA 3V6FA 5BMFH 1ZLWH 4JVPA 4K3EL 4K8RD 4TRPL 5CBEA 4ODTH 5C0RH 3BZ4B 5KVGL 1DBMH 2BVPB 4ELMB 4N0FB 2OZ4A 1G9MH 4H8WL 1S3KL 1UWXK 5GISH 4UQ2B 1QNZL 1YJDL 5T1KA 1A6WH 3I75A 3ARDA 4PRDA 5I8CA 3MRHB 5IK3B 1FVDB 3MJ9A 3ZDZE 2VKWA 1NGYB 4RFOL 2VXTL 2BNRE 3DVNB 1YMME 3WEXA 1Q8MA 2HFFA 4EVNA 1J1OL 1RUPL 2XRAH 3DX8A 1HHHA 2OCFD 3ZTNL 3OKLA 1ULVA 1UZ8B 5EU3A 1QVOA 4OM1H 1X5IA 4WWKA 2H8PB 2NZIA 3MRFA 3OXRB 4LQFH 5C0JB 1HSAA 3TWCH 1DSFH 5EU4A 2FHCA 2KUTA 1KCLA 1A6UL 4PP2A 3FQXA 1MRDL 3K80A 3FTGA 3MV8A 5IB1B 5E00A 3HR5A 2JIXD 4WENB 5FUZH 3C6LD 4UDTA 1AY1H 1KCRL 4WY7H 2G75A 4C58B 2VRAA 1KLGB 2JTDA 5GRVL 1FIEA 5D93B 2XZAL 5D2LA 3OKKB 1BQHB 5ETUB 1T4KB 3SDYL 1ED3A 3O6FA 1I9JL 4GLRH 3AMLA 3FN0L 1OSPH 1IAOB 4WCYH 3IFNL 3OKEA 5IQ9A 4OB5L 3U7YH 1JWMB 5EU5A 1LWRA 3V9FA 4MDJB 5DI8B 1NLDH 3UAJC 3MBXH 4XXDB 3E6HA 3DVGB 1FLTX 3BRFA 3PHOB 5ITFB 3VFMA 5MEOA 1FV1A 3TNMB 1I3UA 4MZ3A 4Y2DC 1BWWA 2PTTB 3S5LB 4DKEH 3HG1E 5IW6B 1A1NB 4JREC 5C2BH 2OBGA 1A9BA 1Y6KR 2WLYA 2BHYA 4EJ1C 4U3XA 4OZIF 2O5XH 3NACL 5I8OH 4UDUB 3LS5L 1IQWH 4RWYH 3FCTA 1QBLH 1IBGL 5HSFA 2AI0L 5HDOA 5I1DB 1NCCL 3I9GH 3QUYD 4R7NB 2YUWA 3S97C 2X9WA 3WFDL 1MJUH 4IRJD 1C12B 5FECA 1QKZH 3QA3A 3OPZH 5C07A 1SVZA 4HH9B 2JB5H 5DVKA 4GRMB 3H0TA 4H20H 4WRLA 3C87A 4PRPD 4Y0GA 3E2HC 2DM7A 5AAWA 5J56B 1YEHH 3ZMRA 1N5YL 3FZUD 3QIWB 2MQCA 4JJ5A 2ZKHH 5K93A 2EYSA 3TBTB 3DROB 2FEEI 4MXVE 4X6DF 5ANME 3UTOA 2FR4A 1AQKL 3LN4A 3O6KH 4JCMA 1OTUD 1F42A 3QULB 4FNLL 5F1OB 1YNKH 2DMCA 2GJZB 3IF1B 4Z7NF 1I8MB 5D1QC 4MJ5B 5F7KC 2H2SC 1YNTB 1ZEAL 5JOFB 4JO4L 4XBEH 4GXUM 3MBEC 4HIIA 4PJ8A 2ZUUA 1MFEH 2A6DA 2RIKA 3DRTB 4XNMB 3V8OA 1DJSA 1ORQA 5JORA 4LLWB 32C2B 4ZOEA 4ZUUA 2ZG2A 1I3RB 3UBXA 3KYKL 1LDPL 3JZ7A 4CDGC 5LCVH 3QB7C 4M5ZH 3UPRA 4YE4L 3ZHLA 3F62A 3BDYL 2WAHA 1TFHA 4JJHA 3JTSA 1RJLB 4QGTA 4LEXL 2IPUG 5EU6D 4LCWE 1I9EA 3CFDB 3DIFA 3UC0H 4JFEA 3O6LL 3CFBB 2IJ0C 3GIZH 1S7UB 3WNMA 2PETA 3VD4A 1OP5K 3MRJB 3X17A 4WTZG 4Z76B 3H3PL 4IS6B 1A6ZA 3VXPA 2PO6D 4PUBH 4HGWB 1ZHBB 4XB7A 1T3FB 5IBTL 4R4NC 5FOBB 2OMNA 2Y72A 3A67H 1U91B 2NY0D 1NUDA 2CO6B 4UT7H 5FV1L 5EO0B 4LPTA 4JFZH 4PJ7E 3V5DA 5K9KB 3B43A 4WEUD 4R3SA 1P2CA 3HMXH 5SX5H 2Z31B 3FMGL 4M43L 1NJ9A 2CLRA 5IUSA 4Z7VB 3HMWH 3Q1SL 4HK3J 3NFSH 3FO0L 4YIQB 4KRMB 2UWEF 5HVHC 2YD3A 3WFBL 4YDIL 5KS9F 3AB0B 5JIHA 5J13B 5IW3A 4P2QB 4GQ9L 5EUKB 3VXQA 3SO3B 3TA3B 3VFPB 3H3BC 5IB3A 4P23C 1J11A 3NPSB 2DQHL 3B9DA 3RGVA 4M3JA 5GPRA 1BPVA 4MA8H 3E8UL 1VPOL 2BZDA 2B7DT 2RBLA 1TZHB 3AGVA 1EAPA 4XMPH 5CZVH 3ULVF 3MV01 4MHHG 2EDYA 3KLHC 5TH2B 3RUGA 3T65A 3WSQH 4PRBB 1D5IL 1R3JA 4HUMB 2AQ3A 1D9KA 3C8KB 3JV5A 2EDBA 3B6SA 5CP7B 4CADA 3RZCA 2KH2B 1YPZE 3QWOB 4HS8H 1I8KB 2VDQH 1FNLA 4QRUB 4NC1C 1WLHA 4YO0B 5E8PA 4D0DA 4GW1A 4O2CA 4M6ML 5IG7B 3IKCB 4OCXH 3OKMB 3EYUL 1CIUA 2I26N 2BSTB 2HWZL 1K4DB 4HPOL 3FT4A 2PR4L 5HPOA 5JNYA 2H6PB 5FEBA 4PJIB 3QDJB 1PYWB 3OMZA 3BP7B 3U7AA 4DKDC 5C7XH 3C6SA 4TVPH 4YHPA 5IB4B 1JNLH 3OZ9H 3NIGF 3TN0C 3GHEH 5LGHH 5TDOA 3V6FB 1SHMA 3VGBA 2MKLC 5CBEB 3EFDL 2JCCA 3ZYIA 2RJMA 2L7JA 4K23H 5JO5A 5KSBF 4HCRA 4I9WD 4NYLA 1CXLA 5T1KB 3I75B 4OGXL 3ARDB 4PRDB 3V6OC 1IL1A 1A3RH 3KYNA 3T4YA 2HFEA 4MS8C 5CJ8A 5D7IE 5F8QC 4MCYB 1C1EL 2B20A 3WEXB 2HFFB 4ETYA 4EVNB 1IM9A 3DX8B 4OTXH 4WHYH 1HHHB 3UO1L 4ZSOE 3HZVA 3OKLB 5EU3B 1QVOB 5EN2A 4K94H 4WWKB 2OP4H 3MRFB 4HQQH 3V4VL 4M7JL 4ALAH 1HSAB 4PJHE 3LKRA 4JHWL 5EU4B 2P45B 2C4FU 3M8OL 1RIVL 1JL8A 3FQXB 3FTGB 3OG4B 1IQDA 3MV8B 4OCRL 2WLZA 5E00B 5KTEL 3HR5B 2ZWLT 3ZSTA 2NY7H 4UDTB 1H3VA 5GGVH 4YEFA 4PJAE 2BNQD 4M1GH 3CVHA 4PJFE 2NY4C 1T03H 4MNGA 2G75B 4EQ2A 4HG4J 2YK1H 2VXVL 1XF3A 5D2LB 2EXWC 2AK1L 3VWKC 2XACC 1ED3B 1YEJH 1QRND 3O6FB 3MRRA 1J0KA 3JWDL 4YDLC 3OKEB 5IQ9B 1D5MA 1MAML 4U1KA 3Q5OA 5EU5B 1UACH 3T4AA 1DEEA 3B8YA 1SJVA 1LP9A 3GHBL 3K0WA 3MA9H 4RDQG 3WS6C 3E6HB 3GO1H 4G6JL 4PTTA 4A2MA 5MP6L 3VFMB 5KSAD 5MEOB 3ARFD 1FV1B 1GGUA 5FOJA 1J10A 3CIQA 4A6YL 4OUUA 1ZGLA 2AABL 2CRIA 2VITA 4OLXH 3MGOA 3ARGC 3CLEL 3TNNA 1VA9A 5C0DA 2MTPA 3DXAE 5E1AA 3JTCA 1A9BB 5I30H 2IANE 3GRWA 1ZVHA 2VR4A 4YX2H 5DC9B 3CLFH 4ZD3H 3C6LA 4MAYC 4PJEE 2ZG1A 4LVNB 5F7UA 4H5SA 4LARL 2E7LE 4RGNE 4CN6A 3FCTB 4IDLA 2V9RA 4BZYA 1KB5A 5FECB 4H1LG 5E70A 3RQ3A 3TCLA 1T2QL 4HJGA 3QA3B 1AC0A 5C07B 3V4PH 2OR9L 5BV7B 1XGYL 4UB0L 3WN5A 3S35H 4HK0A 2EC9U 3H0TB 1DBBH 1T7WA 4DGYH 3PDGA 4N5ED 2NY3C 4U6YA 3U7WH 1P9MA 3V5HA 1G84A 4JJ5B 1EFXD 1AP2A 4DGVH 2EYSB 4Z7UF 5D7JC 5DHXB 1T5XA 1V7NL 2C3WA 2FR4B 1FL6A 1ZHNA 3LN4B 2YR3A 4NQED 3U30C 5CJ5A 3WD5L 5L8LB 4PLNC 1OAQL 2ERJB 1FSKB 3MOBH 3MUY1 3CSPA 1J8HE 1NFDF 1WWBX 1EO5A 4HIIB 4PJ8B 2A6DB 4S10A 1A4JA 4XPHL 2VC2L 1ORQB 3MNZA 5JORB 4ZUUB 5E7FA 5D2NC 2VSDA 1KCSL 3PGFL 3HC0A 2EO1A 1IGCH 3QUYA 3UPRB 3BUTA 5EA0H 3Q3GA 5CP3A 2NXYB 4GAGL 4W4NA 1LD9A 2A77H 1CCZA 1VFMA 3JTSB 3K46A 5ALCH 1MJJB 4BKLA 1XGQA 5L7XL 3DIFB 2PCPA 4JFEB 5JXAH 1RUAH 4ZXBC 4LSSH 4PRPA 4PGZA 1A9EA 4UILL 1JP5A 1U2CA 3GSNL 1CICD 3F58L 4OCSL 4NSKA 5TF0A 3ROLA 1XF2A 5CIPA 1A6ZB 1NLBH 3VXPB 1UCBL 1T2XA 3G5XA 4JPVL 2VUYA 4FMFA 2AERT 5FV2A 4TSBH 1Y0LA 3QHTC 3HS0A 4L29A 5TF1L 1CGTA 5HHOD 2DQTH 3V5DB 4R3SB 1P2CB 1LHZA 4Y5XC 4TN9A 5DURD 1DVFD 1JZ4A 1NJ9B 2CLRB 3ZKQD 2AEWA 1DBJL 5JW4Q 4I0CC 3T2QA 2P7TA 2NY5L 3HNSH 5FCUH 1ZGLM 1QPPA 3H7LA 5FYKH 1MUJB 3HC4H 2FB4L 2EE3A 3VXQB 3WHE1 3WMSA 4CRPA 1F5WA 5IB3B 4K7PH 5EU6A 2GY5A 4KY1L 2HTLD 1MIEH 2Q76A 3HN3A 4O9HL 3RGVB 3ULUF 5IM7A 1TPXB 2I25N 4PJDA 3PDOA 3KS0H 1QSEE 3BP5A 15C8L 1EAPB 4R4BA 2X4TA 3U0TA 1OP9A 1IGJA 1HWHB 2E9BA 4Z7QE 3RUGB 4X9FA 4KHTH 2PO6A 1R3JB 1XR9A 1D9KB 1G6RL 5ENWA 3DURA 1BVKA 3MCKA 1L7TH 4K9EH 1CGVA 5TDPA 3B6SB 5H35A 4CADB 3RZCB 1F97A 1D6VL 2XOTA 4J3XA 2XQYG 2HVKA 5J12C 1EAJA 5E8PB 2FHBA 2W07A 4D0DB 4GW1B 4O2CB 3TO2A 2B5IC 4LCUA 4UT6L 3DECA 1N4XH 1GPOH 2MHAA 3H6JA 2HRPL 3VW3L 2JE8A 4Y19D 5IVXE 3T0AA 1ODAA 3DO7A 1CGSH 3EYQD 2FEEL 2Z8SA 5EOQL 5EO9A 4OGAC 5DMGC 4DUVA 4DVRL 3QEQD 5L8JB 3FRPG 2AK4E 2VAAA 3FT4B 4X9BA 1OTSC 3NAAH 3Q5TA 2VLLA 5JNYB 5DJYA 4YHIA 3MRLA 3QUZC 5HJ3A 4WTZA 3BO8A 5T5NG 3C6SB 4YHPB 3CFCL 2NY1D 5J06A 2VDMH 5TDOB 1SBSH 4OFPA 4KTDH 4MWFA 1UH2A 2ZUVA 2JCCB 3LY6A 3E0GA 5JO5B 3B9VA 4NYLB 1NBVL 1IL1B 3KYNB 3T4YB 4DKFL 2HFEB 4FFZL 3U0WL 3MR9A 5EU7C 5D8JL 3T3PF 1IM9B 3QUXC 2YPLD 3CVIH 3HZVB 1BECA 5EN2B 3SGEH 2WWKO 4NJAH 4JPKL 4TQEH 1NC2A 3TT3L 1XT5A 3LKRB 2FGWH 4YUEH 1TIUA 1WFOA 3MLTA 3O4OB 5J11C 5DWUH 4TUKH 3WDHA 3UZQA 3ABZA 4NHCL 1IQDB 5JA9A 2W92A 4FFWD 4OGYH 2NTFA 3PUCA 3RI5F 2OJEB 4YZFF 1GOGA 5JR1L 1X6LA 3CVHB 2QADD 5BW7C 4MNGB 5IGXL 3RDTC 4NQCD 3CJJA 1UB5A 1KELH 1ETZA 1XF3B 5BZDA 5T3XE 4KK9D 3DETD 5KZCD 3MRRB 5IESH 4X6DE 1QZ1A 4PB0H 1D5MB 5GS1B 4U1KB 4P2RE 4NN6B 3T4AB 1F3DH 3FOMA 1DEEB 1NAKH 1QP1A 4JFFE 1LP9B 4HPYL 2PTVA 3N1QC 1MY7A 4PTTB 2I9LA 5C71A 2GJ6E 3T2PA 5C2UB 7FABL 4R26L 2IBZX 4P3CL 1PJ9A 2FX7L 4OUUB 1ZGLB 2VITB 3DYPA 4XNYH 1F2XK 3MGOB 5LAXA 3TNNB 1H8NA 5C0DB 5E1AB 2DLFL 2O93L 3P0VL 2YD2A 2YD4A 5J13C 4HJ0D 2ESVE 4Z77A 4NUGH 4M48L 2YOCA 3SOBL 3C8DA 3QXUA 3C6LB 2BNQA 5DA0B 2B1AL 1IC1A 1JV5A 4H5SB 5BVPL 4Q9CA 2CO7B 3QXWA 4JM4H 3HI6H 3J7HA 4C59B 3ETBF 1AR1C 1KB5B 1QRNA 3BEWA 5ID0A 3TCLB 4XB8A 4HJGB 5FYLH 2VDRL 2VWEE 4RNRA 1A6VL 3WN5B 1ZE3C 4HK0B 1JK8A 5HYSG 12E8H 2Y06L 4OBRA 2WY3A 1JFQH 4LOUD 1CGYA 4U6YB 5KSAA 1NCAH 3ARFA 1P53A 3V5HB 3HE7A 1AP2B 2VQTA 3GMLA 3WIIL 3D2UD 1IGFL 4IOFC 1JWUA 2BVQA 3V5KA 1T5XB 3LD8B 2APBA 1FL6B 3KPSE 1PZ5A 1ZHNB 2EDEA 3KPRA 5FYJD 3BRGC 1KTKE 2UWEE 1PX3A 1FDLL 4FXKA 4DAGL 1F4YL 2D7TH 2N4IA 1GC1L 3WXVH 4URTB 5I8KL 2UVFA 2VLRD 1MJ7L 3GI8L 4NRZA 2QBWA 4WFFE 1A4JB 3WFEH 5HI3C 4KVNH 5F7WC 1P69B 1IEHA 3MNZB 2AJSL 4HWUA 1FNEA 3VG0L 5DLML 2DTSA 3HC0B 1X4YA 3LMJH 2Y4SA 4YHZH 4MVBA 3QUYB 3UTQA 5GGSY 3Q3GB 3TIDA 3CX5K 1LD9B 5MENE 1L9MA 1UM5L 3IAPA 3CZFA 5GRXG 4JEGB 3VGGA 4F15B 2FX9H 2P5EE 4BKLB 1XGQB 1S7VA 4AEIL 5I2IA 4TSAH 2ZUTA 5D4QA 1KEMH 3BWAA 3KPPA 4PRPB 4S1QL 4N5EA 1A9EB 1U3JA 1EFXA 4J2XA 2P43B 4NSKB 3L3JA 3ROLB 1XF2B 1YQ2A 3C60D 1ZK9A 3G5XB 3T0EC 4NQEA 3RVUD 4U05A 2AEIT 2FEDD 5HHME 1Y0LB 1ZLUK 1E4WH 3HS0B 3JXAA 1KCVH 4L29B 2DKUA 3D0LA 1SJEA 1UM4H 3N85L 3GNML 1LMKA 3U1SL 2YA2A 1UJTA 5CEZE 4NFCA 4H1LA 3NIGE 1I1YA 3GBLA 2P7TB 3SDAC 1B2WH 3O2DL 1ZWIA 2J12B 2QR0A 4HUVA 1R6VA 2ZPKL 4OLUL 2C3VA 4OF8A 5CCKH 5EU6B 1W72A 2Q76B 5IM7B 4K7PX 3KHQA 4PJDB 3PDOB 1KJ2H 3VD3A 3WO4B 1FVEA 3BP5B 3BYYA 4C55A 4R4BB 2X4TB 3U0TB 1JTPA 1H5BA 1IGJB 4XVUD 1NC4A 4KRNA 2ADJA 3CNKA 4XTRC 1BZ7A 4NKMA 2PO6B 1DLHA 4G8IA 2R1YA 5ENWB 3DURB 1BVKB 2NR6D 4O5LL 1VADA 3MCKB 2IG2H 3PWPD 3GB7A 5TDPB 2EIBA 1YYLH 3Q6GH 5H35B 3HZYA 1NCNA 2NY0B 4XAKD 1MPAL 5HHOA 2YXMA 2R4SH 4PJ5D 1RZJC 2HVKB 2R9HD 2EE2A 3EYSH 2LVCA 4LCUB 1DVFA 1S8DA 4QRPE 1NGQL 4K2UH 2H2PD 3RAJH 1O0VA 4H88L 2MHAB 3QCTL 4JY5H 4JG1L 3SQOL 3DO7B 4RAUA 3O4LA 2QJDA 5EO9B 3VXRD 1CL7H 2VAAB 1CLYH 1VGEH 4M6NH 2VLLB 2AJYL 3RZWA 4NQDE 4RFEA 1Z9MA 5DJYB 4YHIB 3MRLB 5HJ3B 5GZND 1FRGH 5BO1L 4OFIA 3BO8B 5LQBL 3FQWA 2OR7A 3Q0HA 1A6TA 4S0SD 5DJ0A 1W2KT 1S9KC 3QIUD 1A22B 4MWFB 5DYOA 3LIZH 5I73C 3ME0A 4HZLA 2Z91A 1MY5A 2CD0A 2MPAH 4BZ1H 4F7TA 3VFUA 4JANA 1A7OH 5E6IA 3AY4C 1YECH 3EO9H 1CDJA 3MR9B 2FWOA 1RV6X 5GJSH 4YXHH 4LLDA 1CDHA 4HS6A 4RMUA 4F9PA 2NZ9D 2VISA 4HJJH 3B2VL 1QFWI 3IDIA 4ODWA 3RWEA 1IKNC 4G6MH 5E6YA 2HT2C 4OJFH 1NC2B 4Y19A 2D9QB 4GG8A 1HDMA 3MLTB 3QEQA 3VMOA 4TNVF 1SEBA 2P5WD 4GBXD 4NO2A 4QWWD 1I8LC 1KIRA 2NTFB 1S78C 4K3EH 4TRPH 3P3YA 1MCWW 1QHOA 2Z93A 5L9DL 2ZOKA 2ZCLL 4L3ED 2VYRE 3TLRA 4NOFA 5TGBA 2SEBA 3G08A 5DJ8A 1UB5B 4X5LA 4XVTL 1AIFA 1FO0H 1ETZB 5BZDB 5SX4H 3K8MA 2V5MA 1EBPA 5CLTA 4Z7UE 3A6CL 1RUPH 3ZTNH 4M1DH 3FOMB 5I1KL 2HH0H 1C5CL 4Q9QH 1FFPA 1I4FA 3ZKXC 4UZGA 1LO0L 4UOW1 2YPLA 4KZDH 3NPZB 1JNNH 2I9LB 2V6HA 2O5YL 3TO4D 3F65A 4XT1C 5J57B 1GGBH 4KI5F 4PG2A 5GRWA 5E08H 5CEZL 3FRPA 3PHQA 4D0CA 5LAXB 1Z9LA 4UIKL 4J23A 3QQNA 4NP4H 5E5UB 2IPTH 1HH6A 5E4IA 3MUHL 1R3IL 4Z77B 1YEEL 4LNVA 5CWSA 1G9EA 1F6AA 2F54D 2EZ0D 3QG7L 4B5EA 3RGVC 2BNQB 3BQUD 1EHLL 4XWOD 1JV5B 3DUSA 4YH6A 2HTKC 4MJID 5JOPD 4KJPC 4PJ9C 1KCGC 4NQCA 1D5BA 3FN0H 1QYGH 1CGXA 4Y4KC 5TPWH 1QRNB 3BEWB 5ID0B 1F4AA 4X5XA 1R5WA 2BSRA 3L5XH 3GM8A 4RNRB 2FLRT 1UCTA 2ZUSA 4ERSH 1JPST 1IAMA 3RZCC 4XH2A 1MIMH 1JK8B 3F7VA 4FTVE 1XH3A 3ARUA 1FGVH 4LEOA 5KSAB 3ARFB 4KRPC 5GHWL 3SKMA 3HE7B 1A02N 1RI8A 3GMLB 3DVFA 3WJJC 1Y6MR 1XIWC 1JWUB 2BVQB 3V5KB 2QSQA 5J89A 4OZGA 3WJLA 5EBWA 1PG7H 4XX1G 5D5MF 1PZ5B 3TPUE 2OS7A 5K9JH 4LP4A 4DQOH 3DYMA 2J88H 3FOLA 3JV4A 3KPRB 4IBLT 2MOVA 4FXKB 1MCIA 4WTXA 3NACH 4U0RC 5C1MB 3WIHA 4DTGL 3S37H 1DFBH 3NTCH 1MVUA 2D3VA 2VL4A 3X14A 4F37F 5BOPA 4N0YH 4NRZB 1PSKL 2R56L 1J1XL 2AI0H 3ULUE 3GKWL 3W39A 5SWZE 3LPFA 1C5BH 2NY2C 5JW3H 4YHYC 1FNEB 4GG6A 3SKNA 3HCVA 3IRPX 4P9HH 2FIRT 4E41E 3UTQB 3SY0A 2LAGB 1R3LA 4GKSA 4P3WA 3TIDB 1LQVA 4IRSC 3I6LD 3S98A 4N68A 3CZFB 4L4TD 2R15A 1RVFL 2E5EA 3LPWA 3WKNA 1S7VB 5I2IB 2EIZA 4GJTB 3BWAB 3KPPB 2X42A 4RMTA 4KJYA 3VXUD 4J3OC 1F3JA 2C3HA 5DRXA 5ILTH 2XA8H 1EFXB 2YN5A 4N0UE 4ZOBA 3D2UA 2BP3A 3P9MA 3L3JB 3SGKA 5JW5A 2Y07L 2LU7A 4NGHL 3U4BL 4NKQB 5I1CH 4MJ6A 1JPFA 1TQBC 4NQEB 5CSBA 4JO4H 5FA4A 3S88H 3O4OC 1MJ8H 1YEFL 2V17L 1N64L 3D0LB 2CJUH 1F4HA 1SJEB 1EGJA 3QQ3A 1NGWA 1AXTL 4OD1L 1PFCA 3KYKH 5D6DC 4HF5H 4U1GB 2K1MA 3L5HA 1A3LH 1VFOA 2E7BA 4JLRA 1DEDA 4YE4H 5IFHH 5DJ2A 1EO8L 4H1LB 1J5OH 1I1YB 3BE1H 3BDYH 3MJ9L 1B0RA 3LB6D 4WGWB 4WTWA 4LEXH 4IM8A 2BSED 2YKLL 1ZWIB 5HYSA 4HUVB 4P4KC 1RIHL 4NM8L 2C3VB 4OSUL 5F93C 3A6OA 3I02A 2ITDA 1W72B 4KROD 3A6BL 3IVKA 2ED8A 1A6PA 4N0CD 4O4YL 4YWGH 2I24N 3ZO0A 4NN6C 4ELMF 4QOKE 1FVEB 4GOSA 4PP1D 4MD0A 1H5BB 1U93A 2B2XH 3MRQA 3T3PE 1OW0C 4S0UC 1NC4B 2ADJB 3OR6A 5IBTH 1BZ7B 1F8TH 4NKMB 3KJ6L 1DLHB 2XZQL 4G8IB 3FAWA 2R1YB 4XCYA 4NNXA 1U8NA 1VADB 2YC1A 3GB7B 3TZVC 3HZYB 4NQUA 3SGDH 5C0EA 4Y5YC 5HHOB 4Y5VC 5DQ9A 4X98A 3W9EA 1RK1A 4RMVA 3WLWD 4UV7H 3Q1SH 1QR4A 5DURB 1MHPL 3DWTA 1DVFB 1S8DB 4NKOA 3WFBH 2VXSL 3MYJA 2QQNH 4MJ4A 1WV7T 4RAUB 3H9ZA 3O4LB 3MROA 3UDWC 5HGHB 1BWMA 5INCA 2LV4A 1OAKH 1VPOH 4PS4L 5FO9A 2XQBH 3MLRL 1YEKH 1ZANH 5HHVL 1MAKA 5DJ6A 2BHZA 4RFEB 2HAZA 5JOEA 1WIUA 3T77A 3OAZK 3FQWB 3KHOA 1A6TB 4JKWA 2FH6A 3BT2L 3O45A 5DJ0B 5A2IH 3BMVA 1OAZL 2XT1B 1MH5A 2Z91B 4GS7C 4HZLB 5HHNA 5HYQA 2CUHA 4LGRB 5CZXD 2IF7A 3LD8C 3PWPA 5FF6A 4F7TB 3VFUB 3KXFD 4JANB 4KMTL 4WEMB 1NEZG 3OJVC 4X9GA 1SM3L 5E6IB 4AMKL 4HUKB 4HHAA 2FWOB 4PJ5A 5DTFA 5JW4R 4LLDB 4HS6B 3SPVA 3F7QA 2VISB 1YNLL 5HGAA 4M03A 3IDIB 4ODWB 2ATPA 3R0NA 1WWAX 3RWEB 3R8QA 5A2FA 4GSDL 4Y19B 3K2UL 2Q1EA 4HAGA 4GG8B 2FCBA 4I77H 1HDMB 1NH6A 5IWLC 3VXRA 2ZZUT 4UU9A 3QEQB 3O81A 1CFNA 1SEBB 4IRJC 4ENED 4NO2B 3DO3A 1I3VA 4L9LA 5IHUH 5FM4A 1KIRB 2LTQB 4XNUL 5AZ2H 4BQCA 3SQBA 3SJVA 1RUML 4TPRH 2Z93B 2ZOKB 5TGBB 1I3GL 2SEBB 3QIUA 3G08B 5D7KD 5DJ8B 5GQBA 3FZUC 1AIFB 4G6AC 5SV4A 1RZIA 4GLRI 5HHPA 4J4PD 3ARRA 3HTLX 5JMOC 3BGMA 4NBYB 4ODXA 3NCYS 1HXMA 3RKPA 1RUQH 2VDPH 5T3ZD 1FYTE 5J1TC 1OTUC 1RY7B 5A3ID 4P2OD 5GRJH 4QHKJ 1FFPB 1I4FB 1X7QA 2E3VA 2YPLB 3MLYH 2NY6B 2DM3A 4UBDC 1DZBA 1QLEH 4KKNA 4C57C 5HYIA 3PHQB 2Q87A 4P9MH 1RIVH 2GTZA 1X5YA 3QPXH 3OR7A 1B4JL 2BK8A 3HUJF 4Q6IA 2FX8L 3HZKA 4YQXL 4R2GD 1HH6B 1GAFL 2DQGL 2GAZA 4G5ZH 2JJSC 4GBXA 5ADOH 1HKFA 5CWSB 1U92A 1F6AB 1RUKL 2VXVH 4NQSA 4XHQA 1HHIA 5JHDE 2BNRD 1YMMD 1UM6L 4IHOA 4L3EA 1YY9D 3MZTA 4BQ8A 4FQ2L 3BKYH 4AJ0A 4NQCB 4G9FE 4UUJA 1D5BB 1HNGA 4JGJA 5E9DE 3VFNA 5KZCB 3MFGB 4JO2H 4AEEA 1R5WB 2BSRB 4I3RL 4NFDA 4FFEX 3MV7A 1JE6A 4Z7WE 2ADFH 2VR9A 1G9NL 4XH2B 5D7LE 2DI9A 3F7VB 5DD0L 1XH3B 1MRCL 4MJ2A 1H8SA 4KTYA 5AWNH 4LEOB 3TO4A 3SKMB 1OOAA 3B83A 2FNBA 3U4EA 3QDGD 3LKQA 1JGLL 4OZGB 2C3XA 5EBWB 5IFAH 1E4KA 1PG7X 3JWOL 4P9HC 4WU7A 1DQLL 3FOLB 3JV4B 3P11L 2NMSA 3QSKB 4QRQA 3WFZA 4I2XE 4ODUA 2WP3O 1NCTA 4RAVA 5F9AC 3X3FH 2VXQH 1MVUB 5F9DC 3X14B 4R90L 4BSVA 2CDFA 3BQUA 1IGIH 3W39B 5KVEH 4HBQA 4MJIA 1QFWL 3LN5A 4GG6B 1T2QH 1KJ2A 3HCVB 4CNIA 5JTWA 4XP5L 3RHWK 3PWUA 1KPUA 1JHKL 3SY0B 4UB0H 1R3LB 3DX9A 4QF1A 3HG1D 3D85D 4XAWH 3EYFA 1R24A 1MCJA 3K3QA 4I18C 1HHJA 4X7SL 3JVGC 4HIXL 1EZVX 2EIZB 1MF2H 5EORH 2D03H 1FCGA 4C54A 4KJYB 3DNKA 1F3JB 2J5LC 1TZGH 3MLSL 5DRXB 1BFVL 1RHHA 3B4NA 4WWID 3D2UB 3RX8A 1QSFE 4M62L 5FM8A 4NJ9L 3SE8L 4MJ6B 1JPFB 4M7KH 4OLZL 5IJVA 2BVOA 4TYUA 4Y7MA 5FA4B 1FNFA 3O8XD 5CUSH 4QHLA 3K8LA 1G1YA 4CBPA 4BA8A 4K3JH 4GKOA 4JFDD 3QQ3B 3OKYA 2HLFC 1NGWB 3PGFH 5HGGS 5FCSH 3W5NA 4NHUA 2WUCH 4O58H 4EUPA 4JLRB 1SVCP 4ZTOL 4POZC 4HWBA 5DJ2B 1UVQA 4OF0A 1B0RB 4PJIF 3MJ6A 5C0AD 5HYSB 1NCWL 1CK0H 1NBQA 1P4BL 3BKJH 3QIBA 4L4TA 4G3YL 2ITDB 3FQNA 3I02B 1CQYA 3V79C 3MUGA 5I18L 1T1YA 3WE6A 3IVKB 4OCSH 5DGQA 3CDYA 3CXHJ 5D6CA 3R4DA 3L3KA 3VXUA 1U9KA 1VCAA 4MD0B 1U93B 1BHGA 3MRQB 3RA7L 1RFDL 1PD6A 3OR6B 2CK0H 4LNRA 4PRIE 4U7MA 1JUFA 1NGZA 1BOYA 2R29H 3QH3A 4XCYB 2FD6L 4NNXB 1U8NB 4DW2H 3SE3C 4G6FB 4O00A 1A1MA 4NC1E 4Y4HC 2YC1B 2R2EA 4AT6A 5K9QG 4JE4B 3R06A 5C0EB 2LU3A 2VJXA 1ZT4A 5DQ9B 1BJMA 4X98B 4Y2OA 4LCWD 3W9EB 4FQJL 1DBJH 1RK1B 4BFIA 4GMTH 4YXKH 4P5TD 4XP6H 3NIDF 1GHFL 5DF0A 2XYCA 4NKOB 2VDNL 5GGTL 3W11C 4BELD 4NZJA 5B39G 2OSLA 4JRXE 1HSBA 1OLLA 1MEXL 3CU1A 5DK2A 3K4AA 3MROB 4LSPH 4O9HH 2OK0H 2BHUA 3N9GH 1FNGA 5INCB 4ZFGL 5L8KB 5FO9B 2XWJA 1RK0A 5DJ6B 1S7TA 3T04D 5JPMA 4N0CA 1Q0YH 3T77B 5DT1H 4Z9KB 3BSZL 1BAFL 1BBDL 5D2LF 3ZE0F 3T1WA 3MLVH 1FG2A 2CIKB 3PXHA 1PGRB 3V6OE 1MH5B 4R0LA 5HHNB 5E95B 5FGBC 5HYQB 3PWPB 2W9EL 5FF6B 5LBSL 3W82A 2G5BA 3PV6A 3MFFA 2G60H 4HHAB 4PJ5B 2WIMA 5DTFB 4B53A 4ZUSA 3SPVB 4KQ4L 2HRPH 3LQMA 5CINH 5HGAB 1EDQA 4PG9A 3DOSA 2ATPB 1CFVH 5I1AA 4FXGA 5B4MC 2DLEA 5K59F 1U0QA 5HHXH 1CD1A 1R0AL 1T83A 4G8GE 3VXRB 1IGYA 4UU9B 3RX5A 5HY9A 1J0JA 3ERYA 3QISA 2PXYD 1CFNB 4AG4L 4ZO6A 1G7PA 3CFCH 4KPHL 4L9LB 1UB6A 1H3PL 2A9ML 5IP4A 1CLCA 3SJVB 3RBSA 4X6EA 4CVXA 4X6BA 4NOBA 2QLVB 3QIUB 4JB9H 5GS0H 1A6AA 4ACPA 1FLRH 3QUMH 1RZIB 5HHPB 5ELIA 4ONGH 1BZ9A 4JHAH 4PFEA 4W4OC 5DR5L 3BGMB 3U0WH 4ODXB 4RWHA 1HXMB 1UA6H 1HKLL 2QEJA 3KXFA 1BMGA 1EVUA 5D5ME 3TF7A 5B3JF 3CD4A 1RHFA 3IETA 4X9HA 3SDDC 3TV3L 4BSWA 3UJIH 5TQ0H 2A9NL 1JRHH 1X7QB 1LILA 1QBBA 4J1UA 1D6EA 1I1RA 3EGSA 2EYRA 2VH5H 4NM4L 5CJQL 4FFVD 5KAQF 1SYSA 2GTZB 3MA7A 4Y16D 1MHHA 2D4DA 3OR7B 4LVOC 1I7TA 2DI7A 2WUBL 3DV4A 4Q6IB 1LK2B 3HZKB 3TJHD 2BJML 4MA1B 5JR1H 3ARED 2GAZB 4GBXB 3VA2C 4XP4L 2OJZL 2ZUQB 3EIFA 1U92B 5IROC 3DHJA 3N1PC 5IKCA 1O7VA 4NQSB 5D1ZC 1HHIB 5T1DL 1M4KA 4L3EB 4DFIA 4IHOB 1YYML 2FYYA 2RGSA 2Q8AH 5L2KE 4XC1H 4UUJB 3HC3L 3X11A 1CICC 3BPLC 3ZHKA 4J4PA 1MI5E 4NKIH 3VFNB 1NEZA 1OAXL 5CJOH 3JV6A 5I6XB 1IM3A 3MV7B 4HBCH 3IDGA 3QHFL 3U2SA 5BS0E 7FABH 4P3CH 3RL1A 4XMKL 4DOHE 1MWAL 3GM0A 3TO4B 1INEL 5BMFL 2R0LH 1H3GA 3U4EB 2PKDA 3KPOB 5C0RL 5IJKA 1G0DA 1E6JH 1DBML 3LKQB 5ECJE 4HW6A 1GGCL 3LS4L 3SBWA 2R4RH 3L6FA 5GISL 5GZOD 1A6WL 4WU7B 1JMZA 1FN4A 3F7PC 4QRQB 4ODUB 3D5OF 3NIFF 4RAVB 4RFNB 1WICA 1U8HA 2XRAL 5D2NE 4V1DD 3P30H 2MSPA 4BSVB 2BNRA 2CDFB 1YMMA 2UUDK 3BQUB 5GS2H 4IMKC 3HRPA 4MJIB 3PHSA 3LN5B 4LQFL 1E4XI 1KJ2B 5FGSA 4CNIB 4PD4J 3TWCL 3PWUB 1DSFL 1MFBL 1KPUB 25C8H 3DX9B 4QF1B 2Z9TA 2ED9A 3EYFB 1R24B 2Y06H 3DXAD 5C09E 3QCVH 5CBAA 2DQDH 1HHJB 4XBPA 1WISA 1IZKA 3RUGF 5FUZL 1KSRA 2EH8H 4R97B 5JW4N 2IAND 5I1LA 2A73A 4G42A 1LEGA 2A0LD 4WY7L 2H45A 4OQTL 1RHHB 3TFKC 3DSFL 3QDGA 4X6CE 2YD1A 3NCMA 4RGND 4S11A 3PQYE 4L8SA 5DJCA 1FDLH 4U1HA 3HB3D 5FGCB 3W0WE 3PWVA 1GC1H 5IJVB 2BVOB 3PP3K 3EYQC 1OSPL 2CXGA 3U7YL 5I8KH 3RJQB 2QSCH 5HGDA 3HI1A 4QHLB 3FB6A 3QR2A 4M7ZB 1NLDL 5KBNC 4CN4A 3MBXL 2CKNA 2IFFL 3LHPH 2JK5A 1X4ZA 3OGCA 3QWRD 4NHUB 5F7YC 2AEQH 5EBGA 2NY1C 3UTPE 1UVQB 1UM5H 4DKEL 1JIBA 4NO5A 4OFDA 5C2BL 3NZ8A 5I9QB 3HG1A 2XKNA 2V2TA 3AS3A 3QIBB 4L4TB 2OMBA 3HE6C 3STBA 3FQNB 3VGHA 3MUGB 1T1YB 3WE6B 3DX7A 1F4WL 5D6CB 4ONFH 2JCCF 4FXLA 3L3KB 1J8HD 2LFGA 4XI5C 2O5XL 3VXUB 4OCYH 5I8OL 1J8KA 5DVLA 1IQWL 1I7ZA 4RWYL 5B8CC 1K8DA 3KPMA 1QBLL 4S1DC 2DOCA 2EDLA 1HOCA 3L3HA 1CVSC 4LNRB 4M1CC 2QQKH 1JUFB 1NGZB 1WBYA 3I9GL 3QH3B 3WKMH 4YPGA 1MJUL 1QKZL 1A1MB 3OPZL 5EPMA 3V52H 3UX9B 2R2EB 2JB5L 4AT6B 3O8XA 4TTDC 2ZNXA 3R06B 3C08L 3FO9A 5IMLA 1ZT4B 3QFJE 4H20L 4BFIB 5AZEH 4U0QB 1YEHL 2NXZD 2VZ1A 5T3XH 5IVNA 4OZHF 1CD0A 1DE4A 5C9KA 3T0DA 1XZ0A 4TNWF 3L7FA 2QADC 3P0YL 1ORSA 4HUUA 2OSLB 1HSBB 2ZPKH 5DK2B 2DQIH 3O6KL 3CK0L 1U8KA 3B2UD 5ANMA 5F7FA 1FNGB 1YNKL 3DETC 4QEGA 2XWJB 1RK0B 4U1JA 4KROB 1S7TB 4X80L 3JBG7 4XBEL 5DEGA 5JPMB 1KUMA 1T1XA 1MFEL 1TJHL 2EICA 3U46A 1S7WA 1FG2B 2P42B 3ZLQC 4Q0XH 4HG4K 6CGTA 4LSTH 5LCVL 2ZCHH 3BZDA 3GI9H 4M5ZL 4R0LB 4H26A 3HNVH 5FHBL 3B9KC 1U58A 3EKCA 2E7CA 5EU7E 1JF1A 3WJLC 5IV2A 3MGTA 5BRZE 2G5BB 5KN5A 3PV6B 3HUJE 5F7LB 3UC0L 3MFFB 4AQOA 4ZUSB 3RGHA 4LCWA 4O02H 3GIZL 4I8DA 3SGEI 3AS1A 3QT2A 1DN2A 4P5TA 1WAAA 1CGUA 1F45A 2K7PA 4PG9B 1IC5H 3MLUH 5I1AB 1AQDA 4FXGB 1NEUA 3GEWB 4PUBL 1T7ZA 5LKNA 3CMOH 1IGYB 5GS0C 3REVA 2VXUH 5HY9B 3IXAB 5BO1H 4B7IA 2ZJSH 1JYNA 3ILQD 1G7PB 2DBLH 2OYPA 4JFZL 1UB6B 2ORBH 3HMXL 2GCYA 3UBXI 4CVXB 4PJ7A 4X6EB 1TETH 4ZFOL 4X6BB 1L6ZA 1CLOH 2HVJA 1IEBA 5MEPA 3DX6A 1A6AB 1L7IL 3HMWL 3LRGA 3NFSL 4A6YA 1JGVH 4LKCA 3SGKC 1BZ9B 4OV6F 3K4ZA 1JF6A 5DHYA 3KXFB 2ZP0T 5IB2A 3B2VH 3JUZA 3IETB 4BSWB 4JPIA 2H3NA 4MA8L 5DJXA 5B39A 3VFTA 4XMPL 4EI6A 5CZVL 5IHBA 3ULVH 4J1UB 2FO1A 3ZT6A 1D6EB 1UZ6F 1TMCA 4K71B 3EGSB 1B3JA 2E9JA 2EYRB 1CFBA 5IEKA 3SN6N 1SYSB 4EEEA 2E7MA 4CJ0A 1MHHB 1I7TB 3DV4B 5CD5D 4XPAH 3WIFA 3PJSA 2PXYA 1MFNA 2ATKA 3CPLA 4Y88A 4HS8L 1GL4B 1CXKA 2VDQL 1YPZA 5IKCB 3HA0A 3FB8A 2CIIA 4OCXL 2FYYB 3I2CH 1L0YA 1OY3B 4WW2A 3ZT7A 3DGCR 4GXUN 1NEZB 3C60C 2J1KA 3KPTA 3JV6B 4PRHE 4I3SH 1K9TA 1CN4A 1CE6A 1IM3B 5HHQA 3RVUC 3IDGB 4OLYH 4DZ8A 3U2SB 2UUDH 5E0QA 5C7XL 1KFAH 4QTIH 4WHDA 5CEZH 3O11A 3RL1B 1JNLL 3OZ9L 1Q0XH 3NMEA 2QSTA 5GSVA 5ESQA 3RFZC 3N1FC 2YWZA 3GHEL 5LGHL 4LGPB 4MXQD 1NMCC 1JYVA 5F21B 5D7SH 4K23L 1M71A 5GRYA 2J8UE 4Y16A 1H3XA 3L6FB 3P40A 1JBJA 3TJHA 2AV7A 4R2GB 1FN4B 1FVCA 3AREA 4K55A 1A3RL 2FJGA 2CKBH 3V7MA 1NL0H 1U8HB 5KJRH 4OTXL 4P2RD 5D7IA 1IT9H 2BNRB 4JFFD 1YMMB 3VD7A 2X05A 2EDHA 4K94L 2OP4L 3GSNA 4ZSOA 4HQQL 1P7QD 4ALAL 3ALXA 2GJ6D 1OGAE 3KLAA 4QRSA 1HQRA 4PJDF 4PJHA 1SJHA 2YUXA 4Y4FC 5CBAB 5D71H 2Z8RA 4ZMAT 4XBPB 2OTWA 2ESVD 4XXCC 3ZKND 2NY7L 1T0NA 1KGCE 4I13B 3OAUH 3OB0H 5I1LB 1Z9SA 2A73B 4G42B 4M1GL 1LEGB 4HLZH 1FAIL 1T03L 3T0EE 3IDMA 2YK1L 5T33H 2WBKA 4KUZH 4PJFA 3QDGB 1LEIA 2WW8A 3IAQA 3IU3A 5E4EC 3NIDE 4L8SB 2H2PC 5DJCB 4U1HB 4B7LA 2VABA 1YEJL 5FYKE 3TM6A 1I1AD 3PWVB 5IFJA 4M6OH 3QNYA 4IDJH 1ERNA 1UACL 5HGDB 3HI1B 3WBDA 1V3LA 3FB6B 4RSVA 2DQUH 2K7QA 3O9WD 3DMMD 2EDXA 3MA9L 2GEEA 4EQ3A 3EUUA 3GO1L 3HPLA 3RI5K 2JK5B 3OGCB 5DD5L 2NYYD 2PN5A 1HI6A 4PJXF 5ACMA 3ZE0E 1HZHH 3VCLB 4XNZC 4NO5B 3NZ8B 1RVFH 1G6RA 5DMKA 3HG1B 1WT5A 3C8HA 2XKNB 3KR3L 3TH3T 2V2TB 5I30L 3DXAA 4PJGA 4QLRA 3C09B 5D9SA 4YX2L 3GZKA 4CVWA 3DX7B 2CDGA 3ZDXE 2IANA 3QQ9D 2Y07H 4NGHH 3C5ZC 1I7ZB 3KPMB 1O5DT 4OD3H 4M9PA 2E7LA 1HOCB 3L3HB 5IQ7L 4AY0A 2OXGA 1WBYB 1VGKA 2M26A 1UJ3A 2G9HA 4K3DH 4Q97A 4YPGB 5K59E 3C2AL 1N64H 2RCSH 5EPMB 3V4PL 3O8XB 3MC0A 5MEND 1UG9A 3S35L 5IMLB 2UYLA 4NN5C 1DBBL 2IAMC 1EO8H 4QWWC 4DGYL 2P5ED 5EO1A 3U7WL 3QWRA 4UTAH 3F12A 1DE4B 1XZ0B 3L7FB 1S7XA 3RWGA 4EZMA 3T2NH 1P6FA 1ORSB 1CL7I 4HUUB 4B50A 1VKXA 3A6BH 1U8KB 5ANMB 1WC7A 5I66A 4WEBH 5HD8D 4KK6D 4U1JB 4M00A 5HHMD 3TESA 5DEGB 1WCQA 2N7BA 5B3JE 1J8HA 1T1XB 4WUUE 4AQ1B 5DD3L 3U46B 1S7WB 4OI9A 4D2NA 2P8PA 4NFBA 5ISZE 2Q8BH 1HCFX 3ROOA 5CEZD 3HAEG 1IGCL 4J6RH 3GMOA 4QHNA 5DVMA 4H26B 5EA0L 4HKBA 1GGTA 1U58B 5KVFL 1JF1B 5D96C 5IV2B 2A77L 3MGTB 1QHPA 5ALCL 4HLZG 5KN5B 2QSVA 4NT6A 5JXAL 3NCJH 3G5ZA 1RUAL 5C8JA 4LCWB 4LSSL 1LK3H 2EECA