1K5NA

Hla-b*2709 bound to nona-peptide m9
Total Genus 79
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
79
sequence length
276
structure length
276
Chain Sequence
GSHSMRYFHTSVSRPGRGEPRFITVGYVDDTLFVRFDSDAASPREEPRAPWIEQEGPEYWDRETQICKAKAQTDREDLRTLLRYYNQSEAGSHTLQNMYGCDVGPDGRLLRGYHQHAYDGKDYIALNEDLSSWTAADTAAQITQRKWEAARVAEQLRAYLEGECVEWLRRYLENGKETLQRADPPKTHVTHHPISDHEATLRCWALGFYPAEITLTWQRDGEDQTQDTELVETRPAGDRTFQKWAAVVVPSGEEQRYTCHVQHEGLPKPLTLRWEP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title HLA-B27 Subtypes Differentially Associated with Disease Exhibit Subtle Structural Alterations
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
molecule keywords major histocompatibility complex molecule HLA-B*2709
total genus 79
structure length 276
sequence length 276
ec nomenclature
pdb deposition date 2001-10-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00129 MHC_I Class I Histocompatibility antigen, domains alpha 1 and 2
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1k5nA02
3.30.500.10 Alpha Beta 2-Layer Sandwich Murine Class I Major Histocompatibility Complex, H2-DB; Chain A, domain 1 MHC class I-like antigen recognition-like 1k5nA01
4XRCB 1TNMA 3CSPA 3AGVA 3IDJA 3C60C 3RWGB 1CD1B 5EU3B 4EI6A 2DQUH 3ZL4H 3BPLC 2DKUA 2DQHH 3MRNA 1A6WL 1YEEH 4C59B 3FFCB 1FAKT 3QPXL 3U0WH 4RQQA 2FHFA 5TQ0L 3ZE0F 5CBAA 4PBVC 1NCDH 2Z8VC 5FGBA 1JTOA 5C09E 4GW4B 1UXSB 2R1WA 3B6SA 3KXFD 3MRDB 5SWSA 2EDDA 1UM6L 2F5AH 4I77L 5CS7A 2JB6B 5F9JA 1ZHBB 5LWYH 5E9DA 3GMOA 2WAHA 2FO1A 3S8WA 3RHWF 2ZUWA 4RBPH 1HQRA 1K4DB 1RHHA 4I9WD 4MCYB 4CMMB 2ICWA 2XKNA 1IC5L 3ZSTA 4LMQI 4UNTA 5K9QG 1ZS8B 2DYPD 4X4YB 5LGHL 4JFDD 1VESA 1D5ZA 1BBJA 3C5SB 5D7IE 3Q6FA 5E2TH 3UJJH 4HD9A 2FYYB 3ULUL 4YHPB 1MF2L 3ARGC 4RSVA 4WI4A 2BNQE 4MCZB 4G8GA 4KRPC 5EB9A 5HDQH 5I73B 3L6FA 1MELA 4JZNB 1EERB 3RU8H 1RU9L 4IRZL 3QXDB 4Y4FD 1OGAD 5T5FH 5I1JH 5L2KA 4EQ2A 5I0ZA 2IANA 5I8OH 4M6MH 4NT6B 3JTTA 4H8WL 5F3BA 5ALBL 4DVRL 4WCYL 1I7RA 3CH1A 3GMRB 4Z0BL 4R90H 1BOGA 4W6WB 1D9KC 2ERJC 1UGNA 4PYGA 3ZKND 3AXLB 4HUXA 1BFTA 1AC6A 3MOQA 4Z7WE 5CSGA 4JRYE 1FE8H 3LN4A 3BRGC 1FVCA 2VLLB 2PUQT 1PQZB 1B2WL 5CWSA 5K9JL 3QJHA 4AM0B 2BNRB 4GMSH 5L6YH 1H15A 2ZUQB 1QQDA 1WWAX 3ECBB 2WBJA 1UEYA 2GITB 4Z7UF 1GOFA 2RCSH 3FQWB 3PQYA 4PJGB 2GITA 3PGDB 3LEXA 1I8KA 5B8CC 5DJYA 3K8LA 3UJIL 4MXVE 3WYRA 5IHBA 2O5ZH 2ZZUT 1D5IL 1AGEB 3B83A 4OV5B 3T2NL 3TFKC 4PJGE 1KPUA 1OWWA 2BNRD 3MJ9L 4LLVA 3FQRB 3RRQA 5JXAL 4C83B 2HVKA 5HYQB 1JGUL 1CD0A 4YDKH 4PRPB 5JHLL 3O6FD 3VXNB 3O0RL 4U1KB 3VXMB 3TBSA 3OKLA 4JQXC 3LKNA 1D5IH 3RWHB 1C5CL 1A7PH 4A2LA 4Y0GA 1MCIA 5GGUA 4GRWF 1RZGB 4CDHA 5DFVD 2LU7A 3EFDL 5F8QC 2FEEI 3BFOA 5LAXB 5TE4H 3LHPL 2UY6A 4LPWA 2L0DA 5GS2D 4ONGL 3QQ3A 5F7MC 4JJ5B 2PXYB 4NQED 2MTPA 1FFQA 3GSNL 1EJOH 2HT3C 2AEPH 3FFCA 4O9HL 3C8KB 4N0FB 4KRMB 4F7PB 1ZVSB 4WI9A 2X4SA 4ZXBC 5CJ8A 4PRAA 4JFEE 5TDPA 3S4SA 2E9JA 2HTKC 3PUCA 4MVBA 1NLDH 4H25A 1MIEL 4EN3C 4D9QE 3MGOB 4W4OA 3ZTNH 5JR1H 2IBBA 4LSQH 5JQHC 4LF3A 1YN7B 2WWKT 5EORL 2QTEA 1Q9LA 5DUBA 1NMBL 1KBGH 3S35X 3O8XB 4ELKB 5AZEH 1Q9KA 1R24B 4A6YL 4ZUVB 5BV7L 5KVGL 2X1XR 1ZS8A 4X4YA 3L3JB 3VRIA 4L8SB 4G6FB 1BWWA 3ARBC 4Z18A 4L8SA 3T0EA 3DWTA 2IQ9L 1BD2D 3QDJB 5TH2A 5AD0A 2MFNA 1H5BA 4ORGB 5ILTL 5E0QA 5IEHB 1Z5LB 3QI9D 2J7LA 4EKXA 4DOHE 3P4LA 3PGFL 5IROC 1YEDA 4RGND 2J2ZA 2V9TA 3BD5A 2WUBL 1YEDB 5C08E 4HKBB 3VG0H 1XIWB 1IL1B 1MVFA 1C8PA 1OY3B 2XTLA 3LKOA 5D7IB 4XCFH 4AYFA 4E42B 2QQKL 5KOVC 4S1SL 3BW9B 3ARDA 1MRDL 1RUPH 3SGKA 2YC1B 2Q8BL 4LCWE 4LSTH 3GSNH 5EBLB 4K23H 5EBLA 4PRIE 4YFEA 4LHUG 4PIRF 1QQDB 5C07E 4M62H 5GS0H 3BP4B 3CVHH 4JO3L 2ATKA 1P7QA 3IFNH 4WWKA 5F9WB 4BSVB 4WEBL 3UTTB 3QQNA 1TZIB 4IOIB 1WGOA 3ZZ1A 4OGZA 4ZFOB 4N0YH 1N4XL 3STZA 3BIAX 5IGXL 1AXTL 2ZG2A 4J3SA 2CMRL 5LCVL 5K9QI 4N68A 1A5FL 3S37X 2HFFA 5A2JH 2NTSP 4JKMA 5DMGC 1HH6B 1I9JL 1IAIH 4JR9L 3SO3C 3B9KB 4YWGL 3P11L 1JWSA 5KANG 3VGAB 1IE5A 1OAQL 2WK2A 5JXAH 1KTDA 1NBVL 3G6JB 4RMVA 3EHBD 2VR5A 3SKNA 1FFRA 3G6JA 5FGRA 4M1GH 5LXGH 1IZJA 3QDAA 5EZOH 5I1AA 4KZEH 2A77H 1JNJA 3PWJA 3RNKA 2D9CA 4PJCE 2RCSL 2Q8AH 2L7JA 5J89A 4LCYB 3KAAA 3MGAA 2BVPA 3DRQB 3LH2H 1OT1A 1ULVA 2WMPA 4MB4A 2GT9B 3BEWA 5FFLA 2GJZB 2DQTH 3V0WH 2FWOA 3WSQH 4DQOL 3QULA 1FYTA 1IAKB 1CIUA 3IDXL 4FQ1H 3X13A 1GIGL 4JN2B 4JE4B 3TVMC 3EW3B 1IM9A 1JNHB 1QLFB 2Z35B 3EOTL 4M6OL 3N1PC 3QZWA 3DV4B 2YK1L 1OHQA 3NCCB 4TNVF 5GGTL 4CAGA 1GGTA 3HHRB 5EU4B 2EO1A 2Y4SA 3LQAC 2APVA 1ADQH 4MX7A 3HPJB 1DUZB 1J8HA 2G5BA 4MAYA 2DQCH 3QEQE 4Y88A 5F44A 3NCYP 2EDTA 1LO0L 5DD0H 1MHPL 5FUZH 5DDHA 3GEWB 5JZ7C 3UBXA 2WIIA 4UIMA 4KV5E 4LPTA 4LSSL 2AJSH 1BVZA 3O2VL 4H20H 4RQQB 3HZVB 1FNSL 2E7LE 1A6PA 4X7EC 2IAMA 1KN4L 5T1KA 2R2HA 1EIBA 5L2KD 4KI1A 3MLWH 4G43A 5JQ6H 5KS9F 1T83A 2N7BA 2AW2A 4OZGF 4CVUA 4EIZC 1VCAA 5EUOA 2AJVL 5CEYA 4J23A 1YEEL 2WUCL 3LD8B 4JDZA 5I8CB 4HAGA 3KS0J 2A9NH 1EEZB 4IMKA 5JXED 4LAQH 2SEBB 3LDBC 4FQHA 3K74B 1WFNA 2J12B 2A38A 4PB9H 4YQXL 3QUYA 4HS3B 2NY3B 4XHJC 3KPSA 4LSRH 3UTTE 2GEEA 2BSSA 2HWZL 2R0WH 2BRRH 2PW2B 4QOKD 4ETYA 3CZJA 2XV6B 3S96B 3MBEB 3MODH 4KKBC 5C6PB 4PLJC 2A6DB 2Y06H 1BM3H 1JWMB 3EZJB 3GBLA 2AXHA 2L7UA 3WL9A 5J12C 3RDTC 4L8BA 3FL7A 4CVXA 5AG9A 4Q2ZB 2EE6A 5D1XB 4YHLH 4D9RE 3WFBL 4MB5A 4C56E 2YR3A 3QO1A 4QRRD 5JHDD 2FH8A 1L8JA 4HHAA 4NO5A 3D0LB 1A4JA 3L3KB 5IB1A 5L0QC 4PJ5E 4LRNL 2VDOH 3AROA 4KK5D 2V17H 3EGSA 4GT7A 1AD9B 1P2CA 4PGEA 2VLJE 1CLYL 2NY5C 3IU4L 3W5NA 3RGVC 5FYLH 4ERSL 2LQRA 1J9CT 2VSDA 3WFDL 3K8MA 4QYOB 1T1XA 2E6JA 5DVKA 5TDNA 3WJJA 5GSVB 2EIDA 1RUKH 4YLQT 2X9WA 3KLSA 4ERSH 3EOBA 3HR5A 3LQZA 3ARDD 5EOCL 5IMMB 3DRQA 4RX4A 2NY0C 3GRWH 3Q3GA 2V17L 4M7JL 1S9YB 1ZA6B 1AHWC 2Y07H 4PY8I 5FUCE 2ICCA 3MJ7A 3VDAA 12E8H 2PTTB 4NHUA 3WIIL 4K3JH 1S9XB 3FQXA 5EC2A 3SDXA 4X7TA 4WWKD 4L3CB 3ARBD 4YHLL 1D9KA 4HQQH 4OFKA 1FFNA 1YEKH 4CKVX 3E2HC 4KMQA 3QXAB 3LS4H 1KJMB 5D1ZB 1WCQA 2Y06L 2VXSL 5D96C 4JB9L 4Q9RH 5T3XD 4YZFE 3MODL 5DO2D 1F3DJ 1FL6A 4XB8A 3SDDD 1DBML 1PSKH 1QLEH 4PB0H 3WDIA 2EYRA 5I76A 1J86A 5M95B 4PB9L 1HYRC 5D2LE 1NGWB 4NQEA 4Z0XB 1S9VA 2HLFC 4ZXBB 5KS9E 5EBWA 3EJYD 1J12A 1G9NH 2LV4A 5E1AB 3JV6B 5MEQB 1MAJA 2PF6A 4GW4A 3GMPB 4FQIL 2R4SH 3TA3C 4FFEX 1KIUA 2XI9A 4QXGL 3MUHL 2VKWA 3GJEB 2Z0BA 1WFUA 1FBIL 2A83A 4UOW1 1YY9D 3JZ7A 4GQ9H 1DVFD 4IOFC 3MV01 4M9PA 3V6OC 3P40A 5HHPA 3GBNL 3DVIA 1BVLB 4LKXB 3QDGE 4JFXA 5TE7H 3NMEA 4I3GA 3P0VH 1CBVL 1KCGC 4HUWB 3LSOA 25C8L 2AJZB 1BBJB 1D5ZB 3C5SA 1S8DB 4XNQB 1G7IA 4L5FH 3F7VB 1XGPB 2BNUA 1Z5LA 4AG4L 5ACZB 2NW3B 3LKSB 1IILE 4XVSH 5GIRB 1CL7L 3A67H 4OSUH 1NMBH 5GS1A 1X7QB 1MFBL 2PR4H 3WL9B 5D7KE 3GMQA 3VFOB 4R4BB 3JWDH 5E56A 1A7OH 1T6VN 1NFKA 5JA8B 2QHLA 1ZVHA 2VZ1A 5TFSH 1OGAB 1BFSA 1E27B 2GJ6B 4UUJA 3P4MB 3S36L 3MJ8B 4EXKA 4OZIF 4KUZL 3MJ6A 4NDMA 3T3PE 3UROR 4ONGH 3SDYL 3ULVE 5FEBA 4HZAA 3TYFB 5FO8A 4N8VA 4QXWA 1ZSDB 3STBA 1SBSH 1LK2B 4FQLL 3TFKD 2R0ZL 3WNNA 4MJ5B 1UG9A 4QTHB 4XNUL 2AV1B 5T3ZL 4GG6F 3GI9L 3ZE1F 1K4CA 3GSWA 1QFHA 4AT6A 1LEKA 2BDNL 1NBVH 2C1OA 1FG2A 3B9KC 4N0UB 5DWUL 1FCGA 4LPCA 4TRPL 4YC2B 4WO4D 4KI5E 4TSAL 5ADOL 1ACYH 3EOAB 4OQTH 1RJLB 3QHFL 1DQLH 2H6PA 4P2RD 1KELL 4NRXB 1F8TL 3UBXI 2VN4A 4C56B 2EC9U 5EOQL 2XKUA 5AEAA 3PABA 2P46B 1RJYB 1TTFA 4EDWH 3IVKA 2L4OA 4MAYD 2P8LB 1CG9B 2A74A 2VXQH 3B9AA 1S9VB 3ARXA 1CVRA 2VQ1B 5KTEL 4GW1A 2VN7A 4YXHL 4J4PD 4ZOCA 1PX3A 3I9GH 5DMIL 4DW2H 1VDGA 3QYCA 3WNLA 3UO1H 1IM9D 2MQCA 4JPVL 4RMSA 5FKAA 3X12A 4F9PA 1V7NH 2EH8L 1C16B 2DQEL 3WIHH 3GMOB 4WU7B 2B1HL 2FJGA 1QO3B 3OKKA 5I8OL 2GK0A 1HILA 1FZOB 5D70L 1YMHB 1DANU 1XCQB 3C8HA 4AG4H 1F58L 4H1LH 3HFMH 3KWWA 3HFML 1IGTA 3NPSB 1IC1A 4CVZB 3D0VB 1KEGL 2J1KA 3RWCA 3T0EB 2UUDH 4GRLA 4Z7OF 3BGMA 4FZ8L 5FM5M 4AEIH 2MQ0A 1TVDA 3TC9A 2UVEA 5D70H 1EK3A 2NXYB 1RURH 1S7TB 3TYGH 3GMRA 1S7TA 2W60A 3B9DA 3TO2A 3DO7B 4P4RA 5C0RL 2A2QT 3KLAA 2MKLC 1N7MH 5J1SC 2EDXA 3AREC 5HSFA 4OIBA 3MZTA 3BWAA 1JI2A 3CSYA 5F7KC 5C07A 2OL3L 3ZKXC 1S78C 1KCVL 2NW2A 1UXWB 5FA3B 1BF2A 2IPKA 3ILQC 5GGVH 1ZAGA 2M8XA 3CIQA 4G5ZH 3KPSB 8FABA 3DETC 3SJVA 3A6BL 1KJ2H 5C0AE 1G7QB 4L8CA 3PP4H 4PDCE 3DVGA 1NKRA 4QWWD 4R0LB 3SDAD 3IJYA 2AP2A 2DLTA 2BFVH 2OXGA 4MXWH 3WDJA 2ZG3A 3GK8L 5FDWA 4HX1B 1PZ5B 4M1DH 3PXJA 5IESH 2VLKB 4X83A 1UCBL 4JFFD 2E7BA 3GMMA 4NO5B 4N0RA 4TULH 3WNOA 5E2UH 1QSFB 3CDFA 5ENWA 1NJ9A 5I71C 5L8JB 1ZTXH 1MLCB 4RRPA 5HJ3B 3UTSD 3RWHA 1JV5A 4OD2B 1X4XA 1UKSA 4QYOA 3HMXA 4JANB 5JLZA 4MHHI 4LFHD 4WY7L 2DMBA 4PJAB 2QL1A 4NO2B 3MV9D 2VQ1A 1TENA 4HUUA 2IH1A 4GMSL 1AGFA 1K6QH 4DZ8B 5F6HI 3VWJB 2QADB 4LRNH 3FQUA 35C8H 2K1MA 4OJFH 1LEIA 4JQVC 7CGTA 1A6UL 3C8KA 2CK2A 1L4IA 5ECJE 1ZHBA 3ROLA 2EDNA 3F65A 4G42B 1YMME 1BZQK 4D3CL 2Y25A 2PYEA 5TE6L 3WFCL 2MPAL 1QLFA 1YC7A 2A0LC 3MGOA 2GK0B 5CSZA 4NQUA 1V7ML 2DI7A 4Z7WA 5I1JL 2V2XB 3LEVL 2P24B 4NN5C 4F2MB 4ZOEA 5F9DC 1UVQB 4NJ9L 4HULB 4NN6C 1OLLA 2HFGL 1I85A 2AQ1A 3H9SB 4NNPL 3DX8B 3CFKA 1Y6MR 3T4AB 1NDGB 2P49B 1EHNA 1K5NA 5HHQB 5IW1A 3JWNC 4MJIE 3HLAA 3HUJA 4OFIA 5TE7L 4XP4L 4XZUB 3AB0B 3PL6C 2DTMH 5I1CL 3GBNH 3PWUA 3G5VA 3RGVD 1HQ4B 5DZOA 4IRSD 2I9TA 1MI5A 3ELAT 2RR3A 3G5VB 5GSRA 1EXUB 2VDRL 1IGMH 2J88H 4OKDA 1G1YA 3MXVH 1XT5A 3EJJX 4XNXL 5B38B 3LN4B 4P5TD 5JOPD 2Z31D 1OCWH 1DEEB 3VXME 3LRSB 4GAFB 2V7NA 4JFQA 3O3UN 1UXWA 5FA3A 4ZS7H 1L7IL 5KZCB 4ZUWB 5MHSD 1LMKA 3V8CA 3H2WA 3VH8A 1MRCH 3BN9C 2AJYL 2CRZA 3K81A 7FABL 1IC4H 2ATKB 2MHAA 4OLYH 4Y1AA 2AKRA 3S6CA 3QUYC 5FYJU 1J1XL 3TCXA 5IIEB 1FO0L 3WUWA 3DUUA 4LPXA 2R56L 1HHIA 2R29H 4JB9H 2BNQD 3TO4A 4YHYB 3SDDB 3AMLA 3ARPA 2FGWH 1V05A 3H0TA 4J12A 3WDHA 3FMGH 3OR6B 4PJIF 3PWPD 3MRHB 1TCMA 5FECA 5IB4B 4XMPH 2ZUQC 2BP3A 1AD0B 5DFTA 1KN2L 1WT5C 2N56A 2OTUA 2YD9A 4O2CA 3GIZH 1AKJB 1YJDL 4X98A 5F3HA 5BO1L 3FOLA 1OSZA 3DROA 5AWNL 4U05A 1CXEA 4HJJL 4L8SC 3P9WB 3RNKB 2KBGA 3VFVA 2QLVB 1CDHA 2VLKE 1BD2B 3QDJD 1U8NA 5AUMB 4V1DA 1U95B 3T8XA 4K3EL 1TPXB 2NY3D 4XBPA 1JHLH 3U4BH 4RISL 3BEVA 3TT3H 3U46B 4EIGB 4GAGL 1NBQA 3TH4T 4LPYA 1NC4A 4LPUA 4F7CA 4H25B 3FO0H 4OGYL 2XZQL 3RJDA 4JR9H 4UV7L 1XF5B 1T20B 5EIVA 3MUZ1 3RZWA 3SJVD 2AGJL 4D94A 2ZCLL 1KT2A 5DS8B 1D9KB 3VRJA 4IRJA 4LARH 5A16A 2A1WH 3VRJB 2CR6A 2DQFA 4B50A 4Q97A 4JPWL 5DF0A 3LB6D 4Z7WB 3QQ9C 1S7XA 1ZHNA 1EHLH 4G6AC 3U0TA 1MEXH 3P3YA 4WHTA 4EOWL 2HLAB 3KPRB 2CDGA 1KYOK 2XOTA 2EC8A 1B4JL 4BQ8A 2E8YA 4MNQE 2XWJB 2LVCA 5IWLC 3TNMA 5DJ2A 4JN1L 1OAYH 4JFHE 4PRHA 3SDCC 3CX5K 4IOFD 1T2JA 1Z3GL 2IAMB 5T1KB 4FABL 1BP3B 3LKOB 5D7IA 5T1LA 3MCLL 5D7JD 4S1SH 1U6AL 4ONOA 1IGML 2J88L 4MQXD 5DQJA 4ONHB 4NO0D 4S0SD 3GRWA 5C0GA 5BW7A 4KKCD 4LLDB 4G6KH 3LEVH 4UINH 4H1LG 1W0WB 4LQ1A 4PV9A 4FQHB 2AJSL 1EEZA 5D71L 2J6EL 2NNAA 2APWA 3L6FB 3IRZA 3O9WD 5EOCJ 3WHXB 4RMWA 1QRND 3NAAH 1I7UA 5BV7H 4N1HB 4CUCA 5IF0A 4HK0A 1OVZA 4RDQG 4NT6A 5DRXB 5F3BB 4OD1H 1K3IA 2MKWA 1XF3A 1OM3L 4LVNB 4Z6AT 3IFLL 3RBGA 2UZYB 3WMSA 2VITA 4KK5C 2FATL 3PGCA 4WU5B 2CKBB 2X4UA 5F21B 4QXUH 2MWCA 4JY5L 5ANMB 1E6OL 2IALB 1A1NB 3TA3A 5CJOL 3OKNB 4Z7NF 2HN7B 35C8L 2EKSB 1BZ9B 2C9AA 4PJ5A 1DBKH 3FOLB 4TUJA 4GJTB 3WXVH 2DM2A 4NDMB 5KTEH 1J0JA 5HHMB 2FL5A 1I9RL 4F7TA 1T1XB 2P5WE 5F9OL 4ZG1A 2MMXA 3G08A 1UWEL 4ODHL 4GKZB 4WEMB 2FRGP 3NIDF 3W11D 1YNLH 3OGCA 3OXSA 3QB7C 4PRID 4RWYH 3SPVA 3EDDA 2HH0L 3PG2A 3SPVB 2NZ9D 5HHNB 4QTHA 1LP9B 2FO4A 3GZKA 5HTSA 5JNYA 1IAMA 3RWIA 1GZPA 4G8EB 1CDBA 3CPLA 3HS0A 4Z9KB 3RX8A 5BXFB 1F42A 5CMAB 5MP6H 1BQLL 1J8KA 2HVKB 3PHOB 4HWEH 3HUJE 3IGAA 2BVOB 2XYCA 3ULUC 1XIWC 1T2QH 1JGUH 4YDKL 5IHUH 4BSWB 1XF5A 2XN9D 4DKAA 2BDNH 1EO8L 3RY6A 5BZDA 2X4RA 4Q9BA 3UTSA 4JO4L 1FL6B 4TSCH 1CGWA 1Y18A 4KTYA 5JMOC 3DVFA 1UC6A 4NZRL 4RZCB 5H37H 4LNRA 4WO4B 4N9GB 5DC4B 5I1HL 3OKOA 4JM2F 4W6XB 1CDJA 1HZHL 2B39A 2IBGA 4CGTA 5DEZA 2E5EA 2UWEB 3H7BA 1NGPL 2E7MA 3BZ4B 5CJOH 1I8LC 5CBAB 2EDJA 5E8EB 1ZHLB 3WEXA 3F7YB 1EGJL 1TETL 4H8WC 5CILL 2W59A 1RZ7L 4ISVA 3L3GA 1U8PB 4WFEE 1SYVB 1YYLL 4MGXA 5E9DB 2W9EL 4YDLC 3V8OA 4W4OC 4YHNA 5C6TL 2NY1C 1XCQA 3PGFH 1NMAL 3OHXA 1NMAH 3L95A 2GCYA 1FZOA 1TJGH 3F8UB 4IRZH 3NIDE 1ODAA 1FYTD 5A3IC 3NFNB 1RUAL 1WSST 2ESVA 1HH9B 1GGBH 3SY0A 2X4NB 5IFHL 1WZ1H 1AO7D 4P57B 5CILH 1U92B 5EZIH 1BFOA 4HWBL 2BHYA 4Y4KD 2D2OA 1KPVA 1BFOB 1GPOH 2Y1VA 5MI0B 3ZHDA 1JRHH 2R2HB 3QUXA 1FNAA 5C0BB 1RY7B 1N0LA 4Y5VB 2HYMA 2I9LA 3EYQD 2I9LB 3EYOB 4D0CA 1J1PL 4MAUL 4HHAB 1NGXA 1UQSA 5DEFA 5FA4A 3P4OA 2QKIB 4MDIB 1NCDL 4PREA 3K1DA 3BIKA 5TQ2L 3TCLB 3LQAH 3AREA 1A6WH 5F7WC 3UTPE 3S3PA 3R06A 5EC1A 3IDYB 3CXHJ 4PJIE 8FABB 3E6HB 4R6UA 3LAFA 3WIHA 1T0NB 1FZKA 4P2YA 5FYKL 2YSSA 5EU5B 3C09B 2Z8RA 4EDWL 1NFIA 3VFUA 1PKOA 1K8DA 2P44B 3LY6A 4I13B 4JKPH 4JPWH 4XAKE 1WFOA 1U2CA 3FT3A 4U6HA 1WLHA 3PNWA 1LHZA 3IJYB 4JJHA 3U0PA 2YPVH 2HKFL 2CRIA 3T2QA 2OL3B 2VR9A 3AY4C 4UV7H 5E7FA 3BH9B 2MCPL 3TM6A 3QG7L 4HV8A 1VGEL 3O6FB 4K3JL 2E9BA 4JM4H 4B53A 4H88L 5F9OH 4U49A 5JDSA 3TV3H 4IS6A 2A6KA 3AC0A 1NMCB 5EO9A 2DLFL 4X7SL 2X42A 5GS1C 4FQ2L 4PGDB 2XRAH 4KMTH 4N9GA 4DN4L 5FHBH 2VSCA 1OAXL 1U8NB 3IDJB 2R0ZH 5T3ZD 3U9PL 1P84J 43CAA 3HI6H 3GMNA 1T21A 2P42B 5FYLL 3N1QC 4GAJL 4NO2A 1UA6H 4NKMB 3H3PH 3H3KA 3V6ZA 3VXQA 2PCPA 1PYWA 3IXTA 3GMPA 1JRHL 3FQUB 1AH1A 2H32B 3QIUD 1QBLL 2H32A 1B6DA 4ISVB 5A1AA 4TPRH 3KJ6L 1TXKA 3L5WA 3W81A 3F7YA 5HYJD 5HHOA 1JNNH 1ZA3A 2YUVA 2B5IC 3SBWA 1K9TA 2CLZB 1HEZB 2K3TA 4UINL 5F6IC 2GJJA 4XVSL 4YHNB 4HUVA 4YFLF 1HILB 1WZMA 2ZWLT 1MIMH 2R0WL 5CJ5A 4K8RL 3TZVC 4GKOA 4P57A 1A21A 1BGXL 5ITBH 1YMMA 4Z78B 3EYQC 1TQBC 4R9HA 2MSPA 5IMOA 1S3KH 5IUSA 2R4SL 3MV8B 5IVZB 3V0AC 5IKCA 1F6FB 3TP4A 5T1LB 2P4AB 1EH9A 4QRRE 2NY0B 1SM3L 4WI8A 3CZFB 2ZOKA 3ZKSD 4PJCB 1N6VA 4U6YB 4ETQB 1JE6A 3ARYA 3DSFL 4IMLB 4F8QA 5BS0D 5HYFA 4PJFE 1U42A 2YN5A 1A47A 2YD5A 3MV7E 4QXGH 3QCTH 1ZK9A 1U0QA 2O5XH 5I74B 4L3EE 4P46C 1KCRL 4HIXH 5I1CH 1H8SA 5HI5C 4X4ZA 3DI2B 4IMKC 1IKFL 1X5GA 3LKPA 3QPXH 3IF1B 1OAYL 2XTJC 5I1IL 3CH8A 4H20L 3O2VH 2Q76B 4MQXC 3RKDC 2YXMA 5C07B 3GHBH 1E6JL 1H0DB 1HDMB 4MSWB 2DJ4A 3F7RA 4X5XB 4LCCB 5HYSG 4GRLD 5KOMC 4CBPA 2XZQH 3PWLA 3JTCA 3FO9B 1T66D 3RDTD 4NJAL 4OCYL 4S1QH 3ZYZA 1E0OB 3L1OH 1G7QA 3FFDB 4XCYB 2CKBL 2FCBA 3STLA 5HPMB 3MRPA 3MRCA 1OT2A 3U4BL 1OGTA 4ODBD 3GMQB 3VFOA 5HYQA 4HQQL 3EAKA 4BKLB 2AGJH 2X5PA 1BZ7A 3TJHD 1R3HB 5GJTL 1KIRB 1QBLH 4UQ2A 4Y5YB 3UZVB 3P4MA 3VWJD 1KIRA 4UQ2B 5GS3A 3VD7A 1QSFA 4E9LA 4JCMA 4EDXA 5I1GL 4IS6B 4PY7B 3X11A 2WINB 5SX4H 2VDOL 4WUUE 2GTZB 3M45A 3KNBB 4AEFA 4RA0C 5HVHB 1P7KA 4OGAD 5C0IB 1P7KB 4JANA 1AGBB 5JLZB 1JZ2A 3BO8A 3UZQA 1NAKH 1I3VA 3OV6A 2CK0L 3CMOH 1AI1L 2XA8L 1HN1A 3MQIA 2H26A 1OLZA 2G9HB 2EIZA 3SE4C 1XF1A 5FUCC 5HI3D 2VAAB 3O41A 4YHYC 4PJHE 2DQDH 4JY6B 1B0GB 1P7QD 5D5MA 5ISZE 3NFPA 2EDBA 4GKSB 2F5BL 5D2LA 1DBJL 1W8OA 4M43L 1CYGA 3TF7C 3MSPA 5EG6C 1G7LA 1KT2B 1HXYA 4QCIA 5DS8A 1MJ8H 3P2TA 3I2CH 3CXDH 2Z9TA 1JPTL 3EJZC 3RX5A 3RFZC 4L1DA 4Y4HA 1SJXA 4OCYH 1WWBX 3H9HB 3BGAA 2JJVA 3QEUA 4YUEH 4PP2B 5CINH 1U8OB 4PP2A 1FL5A 1DE4A 1CXFA 2VDRH 3QCVH 1EAPB 4GW1B 2UY7A 3MV8E 2AXGB 4P46D 3TNNB 3J8F7 4I0PD 3VXUE 4P23C 5LQBH 4F7PA 1H3XA 1W0VB 4RRPG 5D7LD 4CMHB 5T5NG 4KVCL 1KCRH 5F1IA 4WTWA 4LSSH 5FO9A 1B90A 3U79A 1CK0L 3RTQA 1RPQA 3PDOB 2QQKH 3VJ6A 4POYA 1XGQA 3ARGB 1TQBB 5KSUA 3DECA 3LKQA 1WJ3A 5DRWB 3U1SL 2EEBA 4PLOB 1HSAB 1QPXA 5I1DA 1AR1C 2YZ8A 5I1DB 4KI5F 3VRIB 3OKMB 1YJDC 2YK1H 3HC4H 4JQVA 3KWWB 1WZ1L 3TVMA 3U7WH 1OAUL 4XP9L 1H8NA 5HHOD 4X7CC 3QBTB 1BLNB 3IXAA 3PWPE 4RAUB 3RA7H 4OQ1A 1DSFH 5B38G 3QWOB 1R5WB 4HIJB 1MLBB 5D2NB 3A0OA 1CXKA 1A2YB 3O4OB 3MLVL 1IGJA 1MJJA 4UDUB 1LE5B 2ITDB 1BIIB 3IDGB 4P2QA 4X5LA 5J1TC 2CLVA 5DR5H 2J8OA 2P7TA 2IH3B 1G7MB 2D7MA 4OZGE 3F5WB 5EZOL 3MBEC 4O2EA 1BIHA 1U93A 1J88A 4N90E 1ONQA 4U1HB 4X9BA 2N4IA 1K6QL 1HZHH 5KSBE 3RUGA 5DA4A 1BVKA 3UYRH 5DQDH 3HI6L 5CD3B 1INDL 1LVEA 3U4AA 1NUDA 4XAWH 3ZHKA 1JWUB 2WV3A 5C0CE 5SWZB 1JRHI 1RQ5A 5I30H 4ENED 1I3UA 2IFFH 5JNYB 3SQOH 5TPWL 3PWPB 2HG5A 3C6LC 2AK4E 5IMMA 4J7RA 5HVGB 4LAJH 5JUEH 3PWPA 3U46A 3I6KA 4LHUA 3MX0A 4JKPL 3ROLB 1MUJB 2EDQA 3CX2A 4KKNA 3EO1B 4WEBH 5GGRA 1G1CA 3KPSD 1KTDB 2E6PA 5I8EB 4G80A 4U1SB 1MVUA 5EZLB 1CVSC 5HGDB 1F00I 3CFBA 3ZTJH 4K23L 3OG4B 3KPNB 2C5DC 3BXNA 5D93C 5T3ZH 1KCKA 1IGCH 2VLRD 3FQNB 4GFTB 3MRBA 2IQAB 3CLFL 1KENL 4MAUH 3CVHL 4POUB 3WS3A 5JORA 5EBWB 3VG0L 3S97C 1IC7H 2AK1H 4XX1E 1NGWA 1QSFD 3WNPA 1PVHA 4POZC 3T2OA 1T0PB 1JI1A 3IJSB 1DBAH 3BP7B 5DJZB 4ZUUB 2D0HA 3D3VE 5DJZA 2XZZA 1XMWA 2J8UF 3PDOA 3B2VL 3DGGB 3HMXL 1I8LA 3GSXB 5IW3A 3MLVH 5C0RH 3CFDB 4S0UC 3L3GB 3FB7A 3ZMRA 5F1OB 5C3TA 4ELKA 2EYTB 2X4QB 4FFWD 1T7YA 3ZDYF 3WNKA 3Q6FB 4LOUD 5JHDE 1DTUA 2GCYB 3L95B 4C56D 1T1ZA 2P45B 4L4VD 3SY0B 3VDBA 4P2RB 1S8DA 3L3IB 4QT5A 3HMWL 5IV2A 4CL7A 3T77A 2P5EB 3BAEH 1QPPA 3WXWL 4OUUA 2PYED 1KTLB 3SE3A 3V95A 4PJ8B 1D9KD 4NHUE 1CLCA 2MOVA 4JPVH 3RJQB 4HEME 2FX9L 3VD9A 1ZKAA 2VDMH 5IW6A 3EJZD 4DW2L 5HBBA 1BFVH 1PLGH 2ZCHH 2DLIA 3K3QA 1LO5B 4GQ9L 1PZUB 4HIHA 2PW1A 1W0YT 5ANMA 4X6EA 4Y19E 3TBWA 1M1SA 4HIHB 1VFUA 4YX2L 2ARWA 4MNGA 4J2XA 3GM8A 4O2CB 2O93L 2OJZH 3IDGA 1T6WA 1BIIA 3GSOB 4EN3B 4QHLA 4CDGC 5GGVY 3CC5A 4I4WB 5K9OA 4JO4H 1N3NB 4Q0XH 4AM0A 4LHQB 3MV9E 1OB1A 4XVTL 3RPIA 1S5HB 2DL9A 1MI5D 2FLRT 2ADGA 1CGUA 3VW3H 1BOYA 5EZJA 4PGZA 5ERWB 4XPHH 5DHVH 2YPVL 5ACMA 3UDWC 1SY6H 3MRQB 3B2UD 4JDTL 5CGYD 4MMXC 1XGTA 4L4TA 4LASL 1X4ZA 3U7YL 2YD7A 2AERT 4G8EA 2Y5TB 2BVOA 4XNUH 4TNWF 5I30L 3RZCB 2B8OT 4XAWL 1QSVA 4KK9C 3V5KA 2VUYA 1I1AD 4XI5C 1VADA 3O3EB 5E08H 1TIUA 4OKVA 2HA1A 3TN0B 5I8EA 3KXFE 4OLXH 3O4LA 4YAQA 2Q86B 3V0VA 1YUHB 5EUOE 2ADJA 1YY8B 5IQ7H 4XRCA 5ICYA 1CGTA 2BXYA 3G5YA 2IH1B 4LU5L 3RY6C 2A6JA 1NDMA 4PJHF 5CP7B 1I9RH 5IMKA 1DVFC 5ALBH 1FFOB 1WIPA 5BS0E 1H3WM 3RKDD 1FYTB 1A3LL 1DR9A 1G6RA 4I0PA 3VRLE 5HHVH 4NKDB 5LKNA 1FVDA 1MCLA 5DMJB 3G6JE 4H5SB 3WEXB 3CFDA 2F58L 3C60B 4P48A 2NQCA 2VDKH 3O9WC 1OM3H 1X5HA 4NKIH 3P0VL 2NY4B 1IAIM 1MCDA 4HUWA 5C9JB 2EYTA 1X4YA 2BRRL 4QRTA 1P7HL 1DN0B 1ZEAL 1P9MA 1W8NA 1YYLH 3MOBL 5L8KB 1KPRA 2ZSVB 1MCJA 3MNVB 2V7HA 3TNNA 4HK0B 4Z7UE 2WUCH 4U1JB 4EVNA 4KDTA 2B0SL 4EVNB 3LD8C 4PJCF 2EICA 3KPQB 2O5XL 1L9MA 5BMFH 1GJIA 1S78D 5BRZE 1MFDL 3ESVF 3TPUE 5JOFA 4WTZA 4XTRC 1IGCL 1TITA 3NCBB 4MNGB 3TBTB 5CLWA 1F6AB 3ZLQC 2I25N 3QEHA 3EFFB 2NXZB 3N1MC 3O2WL 3UX9B 5T1DH 1EO8H 2OQJB 3R06B 4WRLA 3VWKD 1ACYL 2HVJA 3OKEB 1VFBB 1ORSA 2P8MB 1TNNA 2DQDL 3QUXD 3HRZA 4NJ9H 3SCMC 1UACL 1U8LB 4X6CE 3T3PF 1NLBH 3OJ2C 5J6GA 4OZIE 4X5WB 3TEUA 3MPCA 2ZCLH 3QJFA 2CLRB 2XFXA 1P6AB 3BH9A 2Q1EA 4Z95H 1RUKL 4KHTH 3T4YA 4KGLA 1MNUL 3DI3B 1KIQB 5HGAA 4J1UA 4KZDL 1RULH 3WIIH 2OTWB 1MLCA 1U3HD 2QR0A 3UC0L 1LD9B 5F1KC 4LQFL 5EOCH 2IADA 1FQ9C 5DTFB 5C0IA 3KPRD 2JK5B 5K9KA 2ENSA 3KNBA 4BM7A 4PJGA 2J4WH 2J4WL 5FDYA 4ZAKC 4Q7DA 1DBBL 4YDVB 5GZOD 2GJZA 4KJQC 4KVNL 3IFLH 5HYIA 4LQFH 4KTDH 4N5ED 3A67L 1YC8A 4KJWC 3V79C 5HGBA 3V4UH 2ARJA 4H88H 4F7CB 1G6RB 1XF2A 5FYKE 3DVNB 3JVGC 4PGCB 5DHVA 3U7WL 4M00A 3QH3B 4WU7A 2OSLA 5D93B 1Q9LB 4QRUA 5DRNA 4FXKB 3OWEA 4FN0A 2R9HC 3KYOB 1JN6B 1OTUC 3ORJA 2V2TA 1A0QH 1ZT7A 1WEJH 2XZAL 3MRMB 3BYYA 1IZKA 1WBZA 2VLRA 1E4KC 1JF5A 3L3JA 4WHYH 3RL2B 4BK4A 1OCWL 2X4NA 4QRTB 4LSRL 1HXMA 4X0KB 1EZVX 1FV1A 4I48B 1F13A 1KJ2A 3Q2CA 2VDPH 5IVZA 5IKCB 2XN9A 3C6LB 2Y36H 3MNVA 1WAAF 5MEQA 3TJEH 3RWDA 3LQAL 1UZ8B 1HQ4A 3C08H 1TLKA 5HD8C 5LG1A 5JHDA 4BZ2H 5DVMA 1ETZB 1KIPA 5JW5B 1RVFL 3GJFH 2I9TB 3O45A 1FORH 1UWXK 3EYSH 2BVTA 5I16B 1FNGA 4F37F 4K8RH 4PY8J 3LRSA 4J4PC 1ND0B 5FV2A 4RNRA 5H37G 5DA0B 5E1HB 4Q9CA 2ZOLB 2BY3A 5IM7B 1OTSC 4M7KH 3QUXC 1SVZA 5SWQB 4HPYL 1FIGH 5EULV 3ZO0A 1CXHA 3B8YA 4L9DA 2F5BH 4PJ7F 3ZT5A 1BGXH 2WBKA 4I8DA 3WO4B 2HFGH 5HGGS 3T1FA 1TJGL 3STLB 3FZUC 3H9SE 4KV5F 1Z9OA 5L7XL 2OI9C 3MUGB 1PZ5A 5FOJA 2VITB 3QFJE 4HT1L 5J6GB 1I3RB 4YHKH 4K7FA 3GUTB 1NAKL 1KTRL 1RMFH 1I85C 3GUTA 4LVHB 5KW9L 3LPWA 4WY7H 3MRHA 5IB4A 3U9PH 3CDCA 3QUML 3C5ZD 1R3HA 3MV9B 3FT4B 3S98A 2HT2C 3WFDH 4Y4KA 4FXLA 4O2EB 2EKSA 4O2FA 3E0GA 4YGVA 3NIFE 1BAFH 4EUPH 5EA0L 3HKFA 1SBBA 3ARFA 1G7JB 3OJDA 4GXUN 5KBNC 3D87B 1MHCA 1NPUA 2CD0A 4Z95L 5AUMA 4HWBA 2XRAL 4DN4H 4ZNEA 1JPFA 1BJ1H 1KELH 5DJCA 1D5XB 2CXKA 1PKQE 5FV1L 4NQSA 5C8JA 4JDVB 1IGYA 3KDMA 1QBML 4NRYA 4UNVA 4JHAH 2VL4A 3S3SA 1JTTA 3L5XL 4I2XE 5CBEA 1JBJA 4KROB 4HKJB 3SDAC 2R69L 4P5MA 3CUPA 1VFMA 1UCBH 4B41A 1CICA 1PDKA 3P73B 2A6KB 3A6OA 4TVPD 4M62L 4L9LC 3LKNB 2V2TB 4LAQL 2W0FB 1L7IH 2V2XA 4Z76B 2K9UA 4LSTL 4GG8A 1GC1H 3KPPB 2UZIH 5T3XH 3S5LG 3WO4C 4E0RA 4PJBF 3QR2A 1A4KA 2H9GB 3NGBB 1O7SA 3CLEH 4JO3H 1X5KA 3BKML 4RAVB 1PLGL 3D39A 3MRFA 2FD6H 3SQBA 4LSPL 3ULVF 4XP4H 4HLZH 1KXVC 4BELD 3PHQB 1RZKH 5DK0B 1WTGT 2FX9H 4I9WE 5FGCE 4I3RL 4F15B 5E94A 1YN7A 1K4DA 1T3FA 4DVRH 4NQCE 5KVDL 3HC0B 3TYGL 4NQTA 4GW5A 5FYLE 2VC2H 1OP3H 4OF6A 1KF9B 2SEBA 4PJFF 3HZYA 3QPQD 1DN0A 1HDMA 3GSRB 4JAMB 5GHWH 1NBZA 2X1WL 1ZLVK 3BZEB 4HG4J 2IQ9H 3QFDB 2R1XB 2NTFB 4U0RC 2R39A 2FJFA 1H5BB 2GAZA 5E2TL 3B2VH 4HG4K 1OTUD 1MCCA 2QADC 2V5MA 5EFIB 4S2SA 3GKWH 3GO1H 1KCUH 4DQOH 3PWUB 3V52L 1I3RA 1WWWX 5DRXA 1U58A 1V3LA 4BFGA 2AXFA 4HBCL 1VB9A 1WV7T 1WZKA 2KPNA 1HYSC 5CEZL 4QRPE 4S11A 4G6FD 4X6EB 3TBWB 1LO5A 4LU5H 5DD5L 2YPLE 2D0GA 2V5TA 4KQ3H 1A1NA 5C0BD 2VLJB 1P4BL 5JW4M 3UO1L 1PW3A 1GC1L 1OSZB 1DBAL 5KSAA 1ZWIB 1QTYT 5MENB 3UTQB 2DLFH 4JN1H 1QBBA 4N8VB 4WDIB 3AS2A 4U1IB 3BJ91 2XQYG 1EAJA 3GGWA 3B3IA 4PV8B 3ZL4L 1IEHA 5TE4L 3SCMB 4U7SA 4LDLB 5J1AB 1U8KB 2Z4QA 3MBEA 4PTUB 2P5ED 3IJHB 3DUHA 2I60H 2Z4QB 2PTVA 1PG7X 3TO4B 4TSCL 2XWTB 3U0PB 4OZFG 4MXQD 5FDWB 3P9MA 4N0UA 1S7RA 3RZCA 2CR3A 3HNSH 4Y1AE 4PJ9B 2X9YA 3VH8G 1CDGA 3X17A 3WKNA 5GRYA 3BRFA 5CBEB 1MOEA 5FHAH 1JPGA 1AY1L 5I6XB 4Y4FC 1G7LB 3TN0A 5BZDB 3I02B 3OKYA 4G5ZL 1VADB 1EO5A 3HB3D 3QDGB 3WXVL 3DARA 4M7JH 1B3JA 1JV5B 4M8QB 4OD2A 5HGDA 3MV7B 4O51B 4NZJA 3LRHA 5IT2H 4POZD 1YNKH 1S9WB 1RJYA 5H35B 2JB5L 5TDNB 1MRDH 1XF4A 4G7YL 4Z8FH 5JPMA 8CGTA 2BVPB 1INDH 4JFYB 3U2SB 1EAPA 1B4RA 1KGCD 1Q38A 3DYPA 3E3QE 4U6XA 4JJ5A 3HPLB 2DD8L 2CUHA 1R5VB 5JTWA 5AWNH 5DFWH 4LHUD 4GBXD 4ZUTA 1T7ZA 5DURB 2VLKD 5L2JA 5TFSL 1QZ1A 3LN5B 3Q5TA 4JY5H 4HWBH 4KAQL 5HYEA 4L3CA 1PGRB 1T1WB 1J11A 1NH6A 4HJGA 2DTSA 5E6YA 1HQRB 3KYOA 1RUAH 4XCCL 2CDEB 5KVGH 1A1MB 5CEZE 3D6GA 1KLUA 2JJWA 2VC2L 2W07A 1J1XH 2AJZA 2W9EH 3X14A 3DSNA 5JR1L 1A6AB 2QQQA 2WANA 2YPKA 3HG1D 2H1PH 4GRLB 4WUUA 1V7NL 1YQVH 4R7NB 5FIEA 3SDCB 3BQUC 5JMRA 3LKSA 1CGYA 5DVLA 5ID0B 4KVCH 3IDIB 2WWKO 3C08L 3KHOA 5IVXA 3C5JA 4PJ9C 1CFNA 1INEH 4QTIL 4Y16B 5B3NA 1FNLA 1XGQB 1TJIH 4WU5A 5HGHA 3ARDB 3CU7A 2HLFD 1Z0MA 1M7DA 2QKIA 1MEXL 4EOWH 2GYSA 3MLWL 5KSAB 4UMGA 4KDVA 1BZ9A 4PJ5B 3I3EA 3GSOA 2EO9A 3BP5B 1T04B 3UZEA 5FB8B 3W5MA 4YHPA 4NKQB 2ARJQ 3I3BA 3GI8L 3N9GH 3TVMB 4NBYB 3PQYB 2OR9L 5J1AA 4Z7NE 1TJHH 2BVQB 3HZMB 5I18H 5JHLH 2NX5D 3N1FC 1MCSA 3SO3B 4U1LA 5IIEA 4MQTB 2EECA 4DCQA 3FRPA 4ZQKB 1U2HA 4R26H 4D0BB 1YEGH 4OD3L 5HDBE 4KK9D 3CXDL 3MUGA 2AI0L 1I1AC 1V7MH 4Y8DC 2A6IB 3GI9H 1HCVA 4PJIA 4XGZA 3I6GA 3RHWK 2VE6B 4K3EH 3CDGB 4FQLH 3I6GB 2YA1A 2GSGB 3I02A 4JLRB 1MFNA 1NFDF 2X4PB 3FT2B 3WO3B 1J0IA 4RGNC 5CWSB 4P23D 5C0NC 2ADJB 4RISH 3KVQA 1N64H 1BD2A 3ULVH 2CIIA 1I7TA 4QRPA 1R5IA 4JG0L 3NA4A 4JY4A 3NACL 3FQWA 3BJLA 2O61A 1FL3A 1MREL 4DGYL 2EH7L 1HSBA 3O6KL 2UYLB 5CIPB 2IG2H 4LSUL 4FFYL 2IC2A 1HSBB 4KZEL 2R4RH 3KPMA 2Q6WB 1NCNA 1SEQL 2BX5A 4KQ4L 1S7QA 1S7SA 4U6XB 1WUNT 1MCKA 4YXKH 4Q6YA 3FQRA 4I0PB 4XNYH 2R29L 2CKBH 1YEGL 4OD3H 4IIQC 3PHOA 4KRNA 4ZPVA 3KLDA 3ARDC 3E3QA 1HOCA 5D5MB 3IFOB 2Z31A 4MNHA 4NO0B 1AC0A 1HKFA 4XMPL 2X4TA 3ARVA 1RJLA 4YQXH 2AK4D 1N6UA 1U8IB 4FQXD 1GSMA 2R56H 1HHKB 5FGBC 3O3DB 3QQ4A 4HC1A 2AJVH 1YDPB 4PBXA 5FM8A 2EYRB 4OUUB 1PX4A 4I2XB 1A6AA 3AVEA 5DI8A 3MLUL 3DSFH 2GJ6D 3SE8L 1S7WB 1G6VK 5ID1A 1R6VA 2DTML 3PHQA 3NZHH 5JW4Q 2H2SC 5JHDB 4HIXL 4L3ED 1MCWW 2DQHL 2BHZA 5ESQB 1X5IA 4XXCC 5B4MC 3DIFB 1DANT 3QT2A 2XTJD 5E7BA 5GRWA 1QLEL 4PB0L 5CINL 5AYQA 1MFEL 1SM3H 4K3GA 4O00A 3LPGA 1LNUA 3HC3L 4PFEA 5FB8A 4J4PA 5L2KE 4OCNC 1T1ZB 2LTQC 1MJ8L 1FVEB 3QUYB 5B3JE 1WK0A 3FJTA 1MQ8A 1A3RL 4HUKB 4LP5A 1KG0B 3D0VA 3BKYH 2XA3A 3BPOC 4QHMB 3KJ6H 5ACZA 1JZ4A 2E9WA 1IMHC 2IJ0C 5DJ0B 1JWMA 4APQC 1BJ1J 3VGDA 3PF2A 1X5FA 4BQBA 5ETUA 4F58H 3W0WD 3CFCH 1QLRA 3QXVA 3CMOL 1CGXA 4OGXH 1NUNB 1SMOA 4Q9QL 2HFEB 3TZVA 1VFAA 5E9DE 43C9B 3HCVA 4WW1B 5FA4B 2ZUVA 4LLYB 2FEDD 2ZCKL 4F7EB 5K9OB 2HJLA 3UCRA 3KJ4B 2RBLA 3I9GL 5DMIH 5AZ2L 4U1HA 5F1NB 4X7SH 4YBLC 5M94B 3RAJL 2IPKB 3E1F1 4ZAKD 5IJKA 3S37L 3K0WA 3EYVA 3G5YB 1HI6A 3RPKA 2ESVE 43CAB 1EEQA 1T5WA 4QRPB 3P11H 3ZYOA 3MBED 1UENA 3OGCB 3OXSB 4DGIL 3UTZB 4K7PL 1AE6L 1PKQA 4HW6A 4PJDB 1FFPA 5HI5D 2ADFL 4Y5YC 3BEWB 3LZFL 4AL8L 3IU3A 2F53D 4NQCA 4KRPB 2NXZD 3ILQD 3PWNA 5C07D 1OL0A 1GZQA 3HI1B 3KDMB 4PRBB 4PGCA 4JRXE 4HV8B 1I3GH 3WE6B 3NABL 4TSAH 4G80B 4U1SA 5E4EC 2Z91A 1UB5A 4UB0L 3QXAA 4QY8A 3HE7A 3FN9A 3O11B 2W0FA 3MACL 3MMEB 3WS6C 2V5SA 1CE6B 4QY8B 3HPJA 1M7XA 3V0VB 4GRWB 3OGOE 1F4WL 2ADIB 3EYFA 5TQ2H 4I3SL 4GG8B 2C3HA 5DI8B 4X0KA 3MRRA 5DJXA 4LK4A 4U7KA 5DJ6A 1CT8B 4HC1L 5IB3A 4HIEB 2ZCHL 3SDYH 2NR6C 3JV6A 5INDB 2HAZA 4NUJA 2OL3H 2GQHA 2VIRA 1OP5H 2DI8A 2CO7B 2ZNXA 4JCLA 4MZ3A 4OLEA 3BRDA 2VDML 3LRGA 4QHNA 5D1QC 2IFGA 3DGGA 1GHFH 1UYWL 1DCLA 5JW4N 4QOKE 1KEGH 3AS1A 1BQHG 2ZG1A 3GMLA 4TTGA 3W82A 4OM0H 3RTQB 1TTGA 3BUTA 1BX2A 2DQCL 1XGRB 2XQBH 4OFPA 2XKNB 5GHWL 5IMLB 5AZEL 4A6YH 4BUHA 3CSGA 4M8VA 1IAII 3L7EB 1UVQA 1G9ML 5HDBF 3L7EA 1QEWB 4P59L 4NKIL 5C0AD 2D7OA 3SE4A 5I1EL 1LQVA 1YMMD 3SKMB 2VDKL 4JVWA 3LN9A 1JL8A 2EEDA 5DJ8A 4X9GA 4NC1E 2FIKA 1I7UB 4K8RC 2FJFB 5MEOB 3SE3C 2VXTL 1CFSB 1X7QA 3QIBB 5DO2C 1KLGB 3GFUA 4G6AD 3H3PL 1QKZL 4I5BA 4I18C 3WHE0 3CGTA 4XMLL 3RVWC 3EUUA 2UV3A 2VDLH 1DQQA 4OCRH 5CGMA 3HNTL 3D25A 1CL7I 1L0XA 2X7LA 2DDQL 5CEYB 2A9ML 1ZT4B 3R8QA 4KMTL 2VISA 3LKPB 2VLJA 4U4BA 2H2SD 2CLVB 1FDLH 4M5ZL 2B4CL 4YXHH 1R3IL 5HY9A 3ZE0E 4BQCA 1KJVB 4P23A 3B3IB 5DUMH 1A9EB 1FCCA 3RGVA 3ARUA 5J3HC 4WFHE 3ZE1E 5E2UL 3OKEA 3LV3B 4EN3D 3EYVB 2ZSWB 1G7JA 3S35L 4L8CB 5H2BB 1PSKL 5CP3H 2E6QA 1G9NC 1LP9A 5IESL 3FFCD 3O6FC 1INQA 5E2WH 1PEZA 2VZVA 3KYMA 3NFSH 1C08B 3UPRA 3ZE2E 1JUFB 4F8TA 2ARJB 5CAYB 1UB6A 3ALXA 1XR9B 2XN9E 2B7DT 5E8NA 1M6OA 4S10A 4PRPA 5E6ZA 5GZNC 3RWJB 5E8NB 4OV6F 4P3DB 5I74C 2Z91B 1MUJA 3S35H 4J1UB 5D7LE 4U6TA 3VXMA 4ZFGL 5A40E 2ED9A 2VLRE 5E00A 2Y07L 2E8ZA 4E41E 4JVPA 2PO6C 3VGGA 1S7XB 1ZHNB 2ZNWA 4G9FB 5I19L 1N7ML 2LFGA 2W1NA 3QI9B 1U95A 3T8XB 3T0BA 1N5YH 5GRUL 2FATH 3QI9A 3VWJC 3FB6B 3K8KA 5JPMB 3HNVH 4LCUB 5FO7A 1S7SB 4IJ3B 5CEZH 3NIFF 4FXGA 2AQ3A 4P49A 2YRLA 2DYPA 3HAEB 2E7LA 1J10A 1NC2D 3BHBB 2VZTA 3DVNA 4NQDE 2FGZA 2YA2A 3TBVB 5I1KH 2H45A 3QO0A 1SYVA 3ROOA 3HMWH 1RIVL 4WIQA 4XBEH 3S9DB 4Y4FB 1HSAA 3JWOH 3VMNA 1CL7H 1DUYB 1RD6A 4IOSD 4ZUSA 5I2IA 2DRUA 1BQUA 2R1XA 3QFDA 4JREB 3FTGA 4OLWH 5B8CA 1TZHA 3WIHL 2PYFB 1K5NB 3GDBA 5IW1B 2BZDA 1MIEH 3SJVE 5HHQA 4I3RH 4MZ2A 4MWFB 3MCLH 4U1GC 5DMYA 2HKHH 5JA9A 1IL1A 4ODXA 1CZ8H 1PY9A 4PS4H 4TVSa 3RTQD 3TWCH 2XY2A 3HE6A 4NCC1 1F4YL 4HGMA 4MJ4A 1BD2E 3KG5A 1ZXQA 4P2QB 2VL5B 1BBDL 3K80A 4GUPB 5H8DA 3DMMB 2ICWJ 4HAFA 2VR4A 1F4WH 5I8CA 1JGLH 4HUMB 3W9EB 5IM7A 1ONQB 3P4NB 3AS3A 3QIBC 1FNSH 1KB9J 1ZWIA 4HJ0C 4ZUWA 3QHFH 3REVB 1IQWL 1LO2H 2KDGA 1HCFX 1X5YA 4P2CG 2YSSB 5EU5A 2W0KA 2DB8A 4OF8A 5D7JA 3M1BB 3TH3T 3SCMA 4MJ5A 4NSKA 3QNXB 3L5XH 2E3VA 2C1OB 3MRQA 5TPWH 4L8BB 4H1LA 1BZ7B 1YEKL 1QA9B 3P9MB 5FECB 3TZVD 2DLEA 2HFEA 2ICES 3CDGA 4WI2A 1VHPA 3MZGB 3DV6B 4M93B 3I3DA 4PJIB 2IALA 1G7MA 1F4HA 1JF1A 4JGJA 1JPGB 5F3HB 4OIAA 3MFGB 3UPCA 1EFXB 2IPTL 1F02I 4YPGB 3S37H 5E8OB 4MNGE 5HJ3A 5K9JH 4D9LL 4X9IA 5GGUB 5IVNA 1YUHA 1KSRA 4CADA 4GBXC 4M6AA 2IQAA 4G9FA 1AGBA 4Z77B 1LDSA 5FK9A 1T5XA 1BECA 1FRGL 3DX9A 3B4NA 1MCRA 3X13B 1D6EA 3SGKC 5DRZA 2BY1A 5IEKA 3KLHD 3C5ZB 1JYVA 4ZUUA 1R3KA 4F9LC 2VAAA 3R4DA 5BS0A 1I7ZA 5BO1H 4DN3H 5E6IC 1Y6KR 4M6NL 3EO1A 4UZGA 1KB5L 3SDXF 4M61A 3U4EA 5L88H 3VXTB 1FLRH 3DV4A 3JVGA 2FNBA 2EC9T 1A64A 4J8RA 1D3CA 25C8H 3K4DA 2NY5L 2FGWL 3OJMB 3HG1E 3BXNB 4MDJA 4KK6C 3GSRA 4JAMA 4JO2H 4FA8A 4L4TD 1HHGB 4YO0B 3RWGA 1KXQE 2AVGA 2H9GA 1Q94B 4G3YL 3TJHC 3X14B 4PLNC 3Q6GL 1QVOA 3C87A 1U6AH 3BPCB 1JHTB 4FQJH 4PGBA 2NLJA 3HZVA 2X4OB 1KEML 4PGBB 5ID1B 4U7MA 4ODVH 4ODVL 3TJEL 5FO9B 4LCIL 1S3KL 3DIFA 4HS8L 1IAOB 2J8UB 4LLQB 2F15A 4HH8A 2APBA 1BJMA 4LLDA 3HR6A 1E4XI 3CC5B 4I4WA 1EBPA 1G6RH 1N5AA 1AQDB 2RB8A 1PG7W 3AM8A 2BCKA 4B7IA 2DWEB 1JPTH 1KN4H 5C0AA 1ADQL 3QWRD 4KDWA 2GY5A 3D3VA 2BSSB 4EI5D 4APQD 5BJTA 2J6EA 3MLSL 4KGJA 1DBJH 1Y6NR 4M43H 4QHMA 5JXEC 4EZMA 4H0HB 2E7HA 3LQMA 4UI2A 4X6FB 5JO5A 4Y89A 3UTOA 2F19H 4FFZH 2Y23A 4W6YB 3SHSA 5SX5H 1JK8B 2WBJC 3D9AL 3QWOA 2UZXB 4XNYL 1J0HA 1FJ1A 4OT1L 4XNZB 3V5HA 4LVHC 3QEQB 4J3OC 1QLRB 3GRWL 3QJFB 1I7RB 1WT5A 5ETUB 4PLJD 1JHLL 1QBAA 2AAVA 2VE6A 2R4RL 4CU7A 2EIBA 4GMTH 1NLDL 4LSUH 4BSJA 2YRZA 4F7EA 4PJXB 5CJXC 4KXZH 4WW1A 1B6UA 3RIAK 4FQ2H 2DICA 3OG6B 3RBSA 1FGNH 1U93B 3FT2A 3V0WL 3WSQL 1BF8A 4U3XA 4UV4L 3ILPA 2R23B 1YJDH 2EDEA 4AQ1B 1EX0A 5E99L 2JK5A 4PJ8C 4TULL 2P8PB 2Y7QA 3QG7H 4YDJB 4RFOL 3WFBH 3Q3GB 4Z77A 3IB4A 2CJUL 4Z7VA 1CR9H 2B1AH 4R0LA 1I1FA 2IWGA 5KSBB 4YDVA 1UB6B 4I18B 3QP3A 4L4JA 4JFPA 1YPZB 4YNYA 1SY6L 1S9XA 3FQXB 1OAQH 3VMPA 1UACH 5L9DL 1HE7A 4HGWB 5EN2B 5J6HA 3VWKB 4YZFF 2E9IA 4YWGH 3VWKA 4OLYL 3O3EA 4WTXA 3OAUH 1IAIL 2Z31B 3C6LD 4IDJH 3EOAA 3V5DA 1EA9C 4QGTA 1HXYB 1CXLA 1S5IL 2BMKB 4QCIB 4Y19A 3WLWD 1I8MB 1YEIH 5C71A 3BH8B 4WO4C 1CGVA 2Q86A 4J3TA 4K94H 4J3WA 5IR1A 1JYNA 3BISA 2VRAA 1LWRA 4Y1AD 1T89C 1UJ3B 1A4KB 4GKNA 5IFAH 2VZUA 3F58L 3HPLA 1GYAA 1WC7B 3IT8D 4NQEE 1JHTA 3RVUD 4KUCF 3V52H 5DZLA 1EEUA 2X4SB 3UTTD 2ZOKB 3GKWL 4WI7A 4ZTOH 3TBVA 5ICXB 1T1WA 1EO7A 2NY4C 1KGCE 3MOBH 1P4IH 1GGBL 3GMLB 4O4YH 1DEEA 1OARH 2AK4A 4OLWL 4Y4FA 1RZIA 3I84A 3MRKA 4JFFB 4F3FA 3UEZA 3KPOB 4HWNA 4XB7A 1WFTA 3H9SA 3SDXE 1GC1C 3H3BC 4ELMA 1QUNA 2YPKB 4CN4A 1CE1L 2MPAH 1B0WA 2FJHB 1JFQL 3MGTB 2HVJB 2GAZB 5F72S 2F58H 5JIIA 2DM4A 4MS8A 1IFHL 4TUKH 3WKML 1TQCB 1PFCA 5MEOA 2JJSA 1JHKL 5IEHA 4NM8L 5C9KA 3FFDA 4XCYA 2E7CA 3OMZA 1R3LB 4UQ3A 4XHQA 5DT1H 4X5WA 3JTTB 4ZNEE 2X1PA 2YPLB 4PR5B 5DJ0A 4P2QE 3MTRA 3C5ZC 3VFSA 3ZKXB 3NN8A 4BYHA 4IMLA 4HPOL 1MJ7L 3KLAB 2H32H 4K55A 3BKJL 4HMEA 3BDBA 5LWYL 1FVCB 2VLLA 3MLRL 5GRUH 1B0RB 3DTXA 4WHCA 3CLFH 5DUPL 4CU6A 2BOBA 4QHLB 3OAZK 3ZDZF 2A77L 2HN7A 1XR8A 2X09A 3D2UD 5I19H 1XR8B 2G75B 2VISB 2NZIA 3U0WL 2Q76A 3ILPB 5LBSH 2BNRA 4PJAF 4TSBH 3OX8A 4AEHH 1HIMH 3ARWA 3VFMB 4U2YA 5H94B 4OF5A 5HI4C 4BZYA 4KKAC 2D3VA 3ARFB 2BVEA 4OCXL 1F3JB 4WTZG 1AGEA 1E28B 5GRJL 5EOQH 3CCHA 3K2UL 3GK8H 3AUVA 1QBMH 3WLWC 4HH9A 1AHWA 2R9HD 3PP3K 3BI9X 1QSZA 1N4XH 3OSKA 5CUSH 4PJ9A 1YPZA 4J3VA 3U36A 3JTSA 9CGTA 4FS0A 3PV7A 4UOJA 2G2RB 2ITCB 3DLQR 3GJFA 1KNOB 4Y5XA 1KIQA 4P3DA 3D18A 4DKFH 3WFEH 4FXKA 4R97C 4U33A 2CIKA 5EO9B 1T22B 1OTTC 4ZAKA 4P3CH 3MV7A 4L4VA 1B2WH 1BAFL 4KUZH 2EDFA 1MY7A 4JY4B 2ZPKH 3DXAD 3NA9L 4XBGB 1P4BH 1T5XB 1CG9A 1C7TA 2A6JB 5FF6A 1OAZH 3ESUF 3VXRE 4JRXB 1DVFA 2Z31C 4E41B 3FB6A 4PJHA 4MAYC 4N0FA 5JDJA 3V6ZB 4NNXA 3VXQB 3VWJA 1BFVL 1U9KA 5CD5D 3OAYK 3M17A 1EEYB 3VXOB 5D4QA 2DYPB 3HAEA 5FUOH 4AEIL 5DK0A 4PG2A 4G42A 4HLJA 4V2CB 4ZS6D 5DHVB 2R15A 4LCWB 1UZ6E 1QSEA 5J11C 2GKIA 4GW5B 5EU4A 3E8UL 4M7KL 3TPKA 4H8WH 3KPOA 4HUVB 3HC0A 4UT7L 1VEOA 1TCRB 2WBJD 3J7HA 4G8GB 4HIIB 3KYNB 1IGFH 2OK0H 1IKNC 3JUZA 1RU9H 2FYYA 5KVDH 1T1YA 2HFTA 2VZSA 2FJHA 3U48A 3SDAA 5T33L 5IMOB 5F8RC 1EFQA 1UWGH 1CICD 3KPLA 4MWFA 3ARSA 1F4XH 4WFFD 4OBRA 1QR1A 1EJOL 4K3HA 4FQXA 3NN8B 1ZHKA 3EO0A 5JZ7D 1FC1A 4YK4C 3OL2A 4HUXB 5DURD 3BYTA 2CSPA 2BOBB 4ORZC 4YEEA 4Q58C 5EUOB 5GGSB 3CFIC 3QJHB 5DJAB 1I1CA 1NCTA 4N8CH 5D5ME 5ISZA 1LO4L 3IAGC 4O02H 5SV3A 4TUJB 4V3DB 2RFXA 2PTUA 3SJVB 4APQA 3KPSE 3UTTA 3S34H 2G5RA 2Y5EA 1J18A 2BVQA 3O3AB 4UB0H 3QEGL 1WBYB 3VE0A 1BQHA 2Z8SA 4PTUA 3NABH 3ZE2F 3KYMB 3BDYH 4HX1A 3OB0K 5HHMD 4C83A 4ZPTA 2A6IA 3BSZH 5B3JF 4K7FB 2J3SA 5D2NA 3V6BR 1GVIA 1DBBH 1AXIB 4XC3L 5IJKC 4PJXA 1YNLL 1RZ8A 5GGSY 1MH5A 1MFCH 3ARFC 2JTDA 3TA3B 1UWEH 3T0XA 5DQDL 4XPGH 3BUYB 4YGVB 4ZO8A 5IOPB 1BMGA 3JWOC 5EBGA 3S3JA 1NGQL 3VI3E 3ARFD 1RZGA 5ICYB 1P5VA 1FE8L 4CADB 4OF0A 5GQBA 4FTVD 5FF6B 3VFPA 2P8LA 3WJLA 4YDJA 1KN2H 2BSRA 5GSVA 4PJGF 4LCYA 2X70B 3FONB 3NCJH 4R90L 1RMFL 4C55A 5C7XL 1LILA 4OCLC 1R0AH 2UWEA 5D8JL 4YHKL 1UEMA 3IJSA 4FXGB 3BZ4A 1DSFL 2YZ1A 3B9VA 4QHNB 1LEIB 1QP1A 2R2BA 4TOYH 1MCOH 5IBUG 5HHXH 5IWLA 1DN2A 4M61B 1CLZH 3S4SB 4NJAH 4H5SA 3CUPB 1MQKL 2VYRE 3O2DA 5FCSH 5AYUL 2B2XL 5L2JB 1EGJA 3V5DB 4BFIA 3HE7B 3QHZH 2YD8A 4LCWA 3O8XA 2VUOA 5IMLA 3VFRA 1FIGL 4XMKH 5EO0A 5JOEA 1ORQB 1WVZA 3O4OC 1XGYL 3KPNA 1Y18B 2W9DH 2VDNL 4PLKD 3KPPA 3RL2A 3RDTB 2F53B 3DRTB 5CLTA 3VGFA 2HWZH 1OW0A 1F90L 3CVHA 4ORGA 4X6CB 5IP4A 3MA7B 1JGVH 4PJ8A 5DD3H 2FEDC 1KC5H 5IBLD 1D6VH 2IPUK 5BMFL 5JQ6L 5EFIA 3FHQA 1IT9L 4H26B 5D7KD 1Z3GH 4M7LT 4XCNA 1ZOXA 4F37K 4PRDB 4G6ML 1ZHKB 2EDWA 4UILL 1JGEA 2X6MA 3ULSA 3MA9L 4W4NA 2C26A 3MLUH 4OUOA 4MA1C 1IAOA 5ITBL 4GUPA 5HHPB 3EO9L 5DRWA 1M7DB 1PEWA 3MRGA 4YC2C 3JV0A 5DJAA 1WCBB 5KSVA 4U1NA 4K94C 3BOVA 4JFEA 5C09B 1U8MB 5FYJL 4FNLL 3NCYS 5C0CD 3L3IA 3O3AA 3VE0B 3HN3A 1T04A 4OIIL 5D7JB 2NNAB 4N0CD 4M6OH 3MNWB 3ME0A 2OM5A 4DFIA 1L7TL 4OGYH 4RCAA 1K85A 3VMOA 4ACPA 1ES0B 5JXEA 4X4XB 3TH2T 3EDFA 3IKCA 4LOUC 1A6UH 1KLGA 4X4XA 3IDNA 4FFWC 3QUYD 1NCAL 4Q2ZA 4ZQKA 5L0QB 2YMXL 3HB3C 3NPZB 1S7RB 1OAKL 5DLMH 4BKLA 2DWDA 3CVIL 5K59E 2CK0H 1SEQH 4KQ4H 1QRNB 5IB1B 2ITDA 2QV2A 3MV9A 1I9IL 4WUUD 5IJVB 1KUMA 1W72A 2HJLB 3BQUA 2ZUYA 1LD9A 3WHE1 2GFBA 1N3NA 1CLYH 3H9ZA 1KJVA 4P23B 3SEPA 1X3DA 4XXCA 4WDIA 5LXGL 4YPGA 3T0VA 3VFVB 2DLGA 1UM4H 2E27H 3PL6A 5K93A 4P2OB 3VFWB 4NKOB 1S7VA 2P8PA 3RWEB 2HT4C 2GUOA 1JTPA 4NKOA 1U8KA 1FGNL 1J87A 3FB5A 1A6TA 2Q7YA 3CFJA 4M1DL 1EUUA 5HDOA 3U7YH 4TVPL 2XACC 3TN0C 5T1LD 2BFVL 3X3GL 1UKQA 2X41A 2I24N 1BM3L 5J7CC 4IRSB 4Y4HD 2CUIA 2BRQA 1CF8L 1ZV5A 4R26L 3NH7L 2FBJH 3PP4L 1Q72H 2PO6A 1JNHA 4O58H 2CXGA 2H2PD 4KJPC 2ATPA 1C1EL 4L9LA 1TJHL 3FFCE 4LRIC 4JHWL 4NYLB 1X5ZA 4XVTH 1A5FH 1DQDH 1F3RB 4MD0A 5F89A 4DEPB 2WQRA 5C3LD 1AO7E 3QIUB 5DYOB 2VZ3A 3T09A 4LGPB 5IGXH 3DYMA 1C5BL 4G9FD 4K71B 4CW1B 4N0YL 4Z7QE 5E24E 3RDTA 3PV6A 3QCTL 4QOKA 5I0DA 1AP2A 2C4XA 2WIIB 1M7IB 4DVBB 2VH5L 3BP6B 5IHLB 2FB4L 4U1JA 1MJUL 5GPRA 4QTIH 4L1HA 3BT2L 1GOHA 1RURL 4YDLB 4LLWB 1WBXA 5DHYA 5ICXA 1AFVL 3TJHA 1RJZB 5ELIA 1FNHA 1GPOL 3VXSD 1QACA 4R0LC 3OPZL 3P0YL 4NOBA 4Y2DD 1A6VH 3TA3D 2NY7H 2M26A 4CNIA 1BX2B 1LO0H 3KPTA 5DD0L 1CI5A 4H0IA 4QXTB 2WUBH 1IGIL 3FHAA 3OXRB 3OHXB 5J9PA 2J8UE 4ZUSB 4QXTA 1AGDA 2HTLC 1LEGA 2XT1B 3EYUL 3REVA 4K8RD 3H42H 3E2HB 1CDCA 1C5BH 3RNQB 4XPTL 5EU6A 5LGKA 2NW3A 3FO9A 4P9ML 5BOZG 4LVEA 2KQNA 4NSKB 4ODTH 4DCQB 3ET9F 1T0MA 3QXDA 1FZMB 1GH7A 15C8L 2M2DA 3IXAB 4YR6A 1HHIB 3T0AA 1T89A 2DM3A 3EIFA 5HPMA 1A3LH 4Y5VA 3OF6A 5KJRL 2VXUH 4OI9A 1KULA 4K9EC 3ZTNL 1MJJB 1J0KA 2W38A 3W9DB 5GRZA 3GHEH 4WGVB 5D8JH 4PJ8D 1VFAB 43C9A 4MDIA 3OKNA 2GJ6A 4UUJB 5MENA 1FRGH 3BKCL 5SV4A 3V9FA 2IADB 2OQJA 5F1NA 1RIHL 5IFJB 4PJDF 2WP3O 3ECBA 4JM4L 4NM4H 3FQTB 5FK9B 3GBMH 5H2BA 4D9LH 5F7YC 2R1YB 5E2VH 1CGSH 4URTB 1LK3H 1T5WB 2RAMA 1SJEB 4TRPH 2XWTA 4U0RB 1AQKL 2ORBH 1ZLVH 2X2YA 3OAZH 1NL0H 4AT6B 1JUFA 1C5CH 5IVOA 4N5UA 1OTSD 2CRYA 2FX8L 5TF1L 3GSVA 2I5YL 4PRBA 2BC4A 2AV7B 4XGZB 4XVJH 4YE4H 4WW2A 1JMXA 1NANH 2C4FT 3MYJB 5D1ZA 4TUOB 1OD7A 4MXQC 3O11A 2XG5A 1CFTB 4Y5XB 4MD0B 5IOPA 3FO2B 2P43B 1U8IA 4RZCA 4NYLA 1ZT7B 4KUCD 3O4LB 2DAVA 3QFJB 3JUYA 4F57L 2JCCA 3VFTB 4FP8H 1QYGL 4YHZH 1NAML 4AENA 3G04A 1RZJH 4M7ZC 3QHTC 1RUQH 2K7QA 1M7IA 2NPLX 3MRLB 1YQ2A 5D7JC 3IKKA 2YBRA 5DFVC 3VCLB 4CN6A 3O2DL 1RFDH 1DFBH 3JBG7 3TNMB 3P30H 4WCYH 3T04D 1Q0YH 5FM4A 4ZSOA 4DEPC 1SVCP 3BD4A 3BPLB 1BHGA 4JFDA 3TO4C 4NZDA 2IGFH 3QDJE 1V5JA 1JFMA 4R2GC 4LF3B 4L3AA 1LDPH 4L5FL 3ZKMC 1FNGB 1OAUH 2NY1B 5FYJD 1A7NH 4MA7L 2J6EH 2WM0A 2HKHL 1N0XL 1JGVL 3VD4A 5LGHH 4WNQB 1W2KT 1HHKA 2VLRB 5M7QA 2AABL 1IC5H 2PYEE 1F90H 3M8OL 1AGDB 5C6TH 4WENB 1CTOA 2OMNA 4QT5B 4JFED 1A3QA 4XP6L 2OXHA 2EXYD 2VDNH 4XWGH 5MI0C 2DQEH 4YIQB 5CJQL 5DQ9A 1NGZA 1RZ7H 1F45A 4HEPG 4OZHE 2NLJB 1P5UA 4YIQA 4XBEL 4WFGD 5DQ9B 1CK0H 1N0XH 5I71B 2KQMA 5HYSA 3EHBC 4P46B 5I73C 3RZCD 5IVXF 1D5MA 4WV1A 4I5BB 2ILLA 1ZE3C 5CSBA 1IRAY 4ETQA 1HWHB 2AJUL 3N85H 1VSCA 4MVBD 4E42A 4WHDA 1OGAA 4QF1A 2FLBT 4J3XA 3HE6C 4S0TD 2NX5B 4QNPE 3P30L 2BCKB 4YXLH 5DD6B 3QEHB 1H15B 3OB0H 1A7PL 4U1IA 2PKDA 4JRYB 5GGQL 3RUGB 3W39A 3MR9A 5BJTB 2DQIL 4G8IB 1P7QB 3HI5L 4DOHB 4G9DA 1A9EA 3UXFA 3PWLB 1NGQH 5IHUL 4P3CL 1JMZA 4Y2DA 3TPUA 4ZDHB 3FO0L 4X7DC 2YKLH 2FX7L 1MHHB 4FMKA 3ARTA 4XPFH 3OZ9L 4M3JA 3QEQA 2OL3A 1M05A 4EJ1C 3QIWD 3VI3F 4BK5A 3UJIH 2LAAA 2I5YH 4PJEE 2ITCA 2H41A 1U36A 2FHBA 4BZ1H 3ARBB 5HVHC 2GSGA 4E41D 3U36B 5DD1L 3TBSB 5HHOE 5ENWB 3MYJA 2ORBL 4NP4H 5JPNA 3GJFK 1NFDA 3QDMD 4M5YL 2AJXH 3RQ3A 1XIWD 3NCFB 3DROB 4M48H 1NFDB 2O26U 4RDQF 3BPNB 1UM5H 3AB0C 3ZSSA 2CIIB 3V7MA 3IS0X 5ABDE 3V4VL 3GIZL 4MNQD 5E5MB 3IVKB 1JGDA 5GGQH 1E6OH 4W68A 3EZ8A 1V3MA 4YHOL 3DOSA 5DJ6B 3KPMB 2Q6WA 1AJ7L 2EDOA 4NKMA 3C5ZA 2Q3ZA 1Z9MA 4AIOA 4IIQA 4ZFFA 5KS9B 4QHKJ 1IAKA 2PO6B 4RMRA 2NMSA 4NQDB 1Q8MA 4LP4A 5TDOA 4PJEB 4JFZH 4PLKC 5D5MF 5JW3L 1T4KA 3RWFA 2DBLH 4IRJB 1I8MA 1XGRA 3D1MC 1CTNA 4HXAL 1A7QL 4PP1C 5T33H 3MJGX 3RL1A 3MO1A 3G5ZB 1G7HA 3MFFB 1NFDE 2H2PC 5D72L 4EUPA 1CE1H 4JO1H 5F71A 4GSDL 3V4PH 4EUPB 1NBZB 3ARRA 1TCRA 4P59H 1U8OA 4K9EL 4R3SB 4R2GB 4WUUB 2ZSVA 4GLRI 4OZHB 2ZKHL 1H8OA 1KYOJ 3E8UH 2NXYC 3D39B 1VERA 3MRFB 4BZ2L 1SYSA 3ARED 4FQIH 2W60B 1NCWL 1C5DB 5LQBL 4UAOC 5F7HA 4P99A 3DBXA 1AIFB 1LE9B 2RHEA 2VDPL 1B88A 4NC2B 4Z5RA 5SWZD 4CNIB 1C12A 1H3PH 2HT3D 4HMDA 3O4LD 3CSYB 5E6IA 2XNAA 3UTQA 3R1GH 5C2BH 4X5XA 2VABA 4JFDE 1UADC 1H0DA 4MSWA 4QHUA 4I3SH 2YD4A 4LARL 1NAMH 4ZYKA 3ZDZE 3EOTH 4PRIB 5D96B 5KN5B 5TE6H 4G9DB 3C2AL 4R96B 1J7VR 3WUWB 4P5KB 4WEUD 4DKFL 1ES0A 2KZWA 4CVXB 4DGVL 2IMMA 1NSNL 4BH7A 4RWHA 1L0QA 3QQ9D 1M6OB 1GGUA 4RA3A 3DNKA 1NCCL 1ZMYA 2V2WA 4GAJH 1D5BA 2OJEB 4DAGH 3DV6A 3MBXL 3VGBA 3FN0H 2IMNA 4O2FB 5D1XD 5D7SL 1KJ3L 4ZAKB 4NFBA 4YAQB 5KG9A 1OB1B 2FL5B 4NM4L 1ZTXL 3RGVB 5H35A 5CGTA 3RUGF 3HE6D 1YNTB 1MWAL 3Q1SH 3K7UA 3QQ3B 3FB5B 3GMNB 1GRWA 3OTTA 4HUUB 4ZS6C 3RIFF 1EMTL 1D5XA 5HYJB 3BEVB 4NQCB 5BVPH 4JN2A 2EIZB 4IRSA 1XGTB 4L4TB 4YNYB 1HHJB 3BGFB 2WY3A 4NQDA 2PNDA 4N1EA 4KK6D 3LDBB 1T03L 4P5TA 1F6LL 4GKSA 4L9LB 5TDOB 2EDRA 4XP5L 2D4DA 4L8DB 5FYKH 4C58B 4LIQH 1I9EA 4F9LA 4Z76A 4ODTL 3CFBB 2IAMD 1EV2E 5T1KD 2ADIA 2OYPA 5FOBB 4XPTH 4Y4HB 1IKFH 1CD1A 5EU3A 1HYSD 4OIIH 3RVTC 3UJTH 2Q8BH 1AGCA 1CU4H 4PJBE 4NQEB 4Z0XA 3MA7A 2K7PA 3EYUH 5GXBB 5I76B 2YWYA 2DMCA 1NUGA 1XFPA 2Y6SC 3EDEA 4R7DB 3QZWG 4R7DA 2X4OA 4R8WH 3W2DH 4KFZC 4RAHA 3QNZA 4HS8H 5KVEH 4TQEL 4FZ8H 3C9NA 3BW9A 2GW5A 5HI4D 3L3HA 1HNFA 2J8UA 4LCWD 1WIUA 4D9QD 5IFHH 4LLUA 5F7DA 4JFQB 1KV3A 2NZ9C 1S7UA 2DWEA 1OOAA 2FR4B 3EFFA 5MENE 1YPZE 4OLVL 2M1KA 4NC1C 5EPMB 2QQLL 2NY6B 1JYXA 1KG0A 4JFOA 5EWIL 3PJSA 3WFCH 5FYKU 4J3UA 1Z0NA 1H3UA 4Y1AB 4X6FA 2R8SL 4GG6B 2EH8H 3PJSB 4ELME 1CD9B 5GS1B 5ADPH 6FABL 3MNZA 5KSAC 3P0GB 2JJUA 2DQTL 3SOBH 3QEQD 3NH7H 4BH7B 4D8PB 1ZGLB 3TF7A 3D0LA 3S36X 1NBYB 3NCEB 1B0RA 4YXKL 4ZFOL 3MLXL 4YHIA 5CHNA 3SKNB 2IAND 4NPYA 5CHNB 3KR3L 1E27A 1A1OB 1OAXH 2QR0B 3RY4A 1AJ7H 3F62A 4PGEB 2F54E 4ENEC 3MLTB 5CKGA 1OF2B 1QRKA 1LK2A 2HTKD 3WFZA 4MNQA 5KVFL 1JWUA 5SWZA 1CFQA 2WWMD 1JNLL 1U3ZA 4HWEL 1LP9F 4LLVB 3FT3B 5DWUH 5MP6L 5EC2B 3T2NH 3DETD 5CMAA 4HKXA 1AXTH 1MCPL 1XR9A 4NHUB 3QDHA 3F7QA 5EOTA 4NO0A 2AV7A 3BSZL 5E8DH 4RX4D 2FEEL 1TZGH 1VEMA 3BQUD 2C7UA 1YEHH 4NGHH 4LVNC 3FO2A 2OTWA 3QDMB 1U3HB 1KCVH 5GGVL 4C56A 2VMFA 5DYOA 4UDTB 4YHML 2OR9H 3MRBB 5I18L 1DBKL 1ZLSH 1J05B 2R0KL 3EKCA 3S36H 2VQUA 4I0PC 4XH2B 5FOBA 6CGTA 1IQWH 3QDME 2OZ4L 2F74A 3O9WA 4FFVD 3FOMA 2O61B 3RVUC 1DQMH 2YWZA 3FOMB 3V7AG 3PV6B 5E1AA 4XC1H 4Z0BH 4ZXBA 2FECL 1MFBH 3AAZB 1I7ZB 1HKLH 1VEPA 5EUKB 2JB6A 3DPBA 3MA9H 3BVNB 5ESQA 4LLWA 4LCIH 3K4ZA 1EZVY 3K2MC 3CDYA 4GOSA 1NAMB 2EEAA 1ZVYA 2HTLD 1RSFA 2GIYA 3QH3A 5E5UB 1MF2H 5GISL 1RAMA 1YQVL 2EE2A 1U91B 5C6WH 1LQSR 3WFHA 2ZKHH 5HI3C 2XZCH 4G59A 1FVEA 1U92A 1YDPA 1FPTL 5CIPH 1GCFA 4GO6B 4LSVL 2PYFA 4LSQL 4UIKL 2P5WB 1AR1D 4KJPD 4X6DB 5EU6E 4KJYA 4P2QD 2AEQL 4RGOH 2XN9B 1BLNA 3C6LA 3KYKL 4PD4K 3VG9B 4WJ5A 1R3LA 4UQ3B 4Z7VE 1JK8A 4FQCH 4OCSH 3ULVD 2DBLL 1FZMA 5FYLD 2AXJA 1FLRL 1BPVA 5EBMB 3IFPA 4KH2A 1AO7A 1NGPH 1LDPL 1PAMA 2EDLA 2AXFB 2YPLD 4XPAH 3WD5L 4PTTB 1MLBA 4PJCA 3IDYC 3VFSB 3JV5A 2Q20A 2VL5A 5I1HH 3P9LB 3AXLA 1LO3H 3BPOB 2P1YA 1AQDA 4FZEH 2IPUG 3CAFA 1MI5E 4OFYD 4P4KA 3ZKNC 5B4MD 1T0NA 2QHRL 4KI5D 1DQML 4KJWD 4Q9RL 4QHUB 1YECL 2VXSH 4F7TB 5IQ9A 4AY0A 1QR4A 5BQ7A 5CZXD 4L3EA 4ZFOA 4G8GD 4Y4HC 2R0KH 1UM5L 3UTZA 3I50L 1EBAA 4U1LB 4HF5H 1RK0B 1K8DB 1WISA 1GZPB 4X6BB 3T1WA 2PXYD 1ACZA 2HFFB 1Q9OB 4W70A 1SEBB 3ES6A 5E8DL 3GSVB 4X80H 5A43C 4ZD3L 5FCUL 1GZQB 3HI1A 1QA9A 2YD3A 4LGRB 3SO5A 2Q87A 3B8SA 4KXZI 5IROA 5FCUH 1PY4A 1QSFE 2KUTA 3MUY1 4WW2B 1SMAA 2X4PA 1Q9WB 4MA1B 4MA3B 5E8OA 3NVQA 2H6PB 4PJXE 5T1MA 4BFBD 5L6YL 1NEZA 1O7VA 4JQXA 5IB5B 4M03A 3NTCH 5E5RB 3EYFB 3ZYIA 4L4VB 1Q1JH 5LAXA 3SKOA 5I15H 1J05A 4AEHL 3LIZL 1IQDA 4UTAH 1VACB 1RZFL 1SY6A 4M9OA 3LMJH 4EBQL 2ED7A 2X70A 1DVFB 3ZTJG 5FO7B 3QNYB 3G5XA 1MFAH 5FM5O 3S88H 1WC7A 3G5XB 4OCWL 1A7RH 3BZDA 5DRZB 1BREA 1H3TA 4CN1A 4DZ8A 5IEKB 5F6HJ 1PYWB 3IXTB 2AEQH 4RGOL 1FIEA 3UYPA 5E8EA 2VJXA 4N1CA 1A6ZA 4OSUL 2N1KA 4OCRL 1MJ7H 3CXHK 3W11C 3ISWA 4N0CC 4QHKI 5HHOB 3IFOA 4P9HC 4ONFL 5DGQA 3L5WB 3WD5H 2W65B 3L3OB 2AEIT 3VXTA 3ETBF 3GM0A 4YJZL 3C60A 7FABH 2BMKA