1K5NA

Hla-b*2709 bound to nona-peptide m9
Total Genus 79
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
79
sequence length
276
structure length
276
Chain Sequence
GSHSMRYFHTSVSRPGRGEPRFITVGYVDDTLFVRFDSDAASPREEPRAPWIEQEGPEYWDRETQICKAKAQTDREDLRTLLRYYNQSEAGSHTLQNMYGCDVGPDGRLLRGYHQHAYDGKDYIALNEDLSSWTAADTAAQITQRKWEAARVAEQLRAYLEGECVEWLRRYLENGKETLQRADPPKTHVTHHPISDHEATLRCWALGFYPAEITLTWQRDGEDQTQDTELVETRPAGDRTFQKWAAVVVPSGEEQRYTCHVQHEGLPKPLTLRWEP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords major histocompatibility complex molecule HLA-B*2709
publication title HLA-B27 Subtypes Differentially Associated with Disease Exhibit Subtle Structural Alterations
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 79
structure length 276
sequence length 276
ec nomenclature
pdb deposition date 2001-10-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00129 MHC_I Class I Histocompatibility antigen, domains alpha 1 and 2
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1k5nA02
3.30.500.10 Alpha Beta 2-Layer Sandwich Murine Class I Major Histocompatibility Complex, H2-DB; Chain A, domain 1 MHC class I-like antigen recognition-like 1k5nA01
1B90A 2YKLH 4CKVX 4Z7VA 3PWPD 4NHCL 1FGNL 2HG5A 2IANE 4X4ME 2R0WH 1V05A 1ZANH 4UV7L 5CIPB 3TFKA 3U0PA 5I8KL 5DZOA 4I2XB 3ZLQC 1RFDH 5DJ6A 3VD3A 1JF6A 4MHHI 5I73C 1IC1A 2OR7A 3GB7A 4JCLA 3PWLB 1QFPA 1FO0L 4DUWA 3BGMA 3V4PH 3AY4A 5DJ2B 3T4YA 2YA1A 4RBPK 3ILQD 3VG9B 1P1ZB 4WI6A 3BT2H 2H2PD 5GS2H 5F7MC 2WV3A 4FP8L 4KGLA 5H8DA 3S37L 5CILH 5F6HJ 2VLKE 3MLTB 4XMPL 1EEYB 2HTLD 2G9HB 4RGMC 4QRPA 1KN4H 2AK4B 3IAGC 2I5YL 1NC4A 3C6LC 1YECH 4HWUA 4KDTA 3TJHA 2XT1B 5L0QB 1B9ZA 3HTLX 2BNQE 3RDTC 1OTUC 3WXVL 1SQ2N 2FDBP 1Z9LA 1A7QL 3P73A 1CD1A 5B38B 2YMXH 1JPGB 3QEGH 1WBXA 4ZMAT 5T1MB 1BIHA 3TO4D 4C57C 3LQAH 4X80L 5CSZB 2BOBA 1AIFA 4I8DA 5FB8A 3HI5L 4PBXA 2Y6SD 4JB9H 4OCRH 4YFDB 2NTSP 2HVJB 3CH1B 1Q72L 3P11L 2ERJC 3OJDB 4PRID 4S1DC 2DLEA 4XWGH 5I8EA 3VWJC 3IFLL 4JM4H 1S7QA 3G6JF 3RVTD 4KKLD 4PTUB 1XIWC 2FL5B 2JELL 1DSFH 1FVDB 4HIXL 2Y06H 1MCWM 5CP3H 3ZHKA 3QWRD 3I3EA 1WZ1L 2GJZA 1CU4H 2APWA 4XPFL 5IJVB 1VGKB 1CLOH 1PZUB 1U41A 5TF0A 2DYPB 2LV4A 4HS8L 2AJZB 3H42L 4HIEB 3L9RB 2P5EA 3DUSA 1Q94A 3ULSA 1CG9A 3SKUD 2IEPA 3T8XB 5I76A 5DC9B 4Y5YC 5JQ6H 1J0JA 3P4NB 4D8PA 3T3ME 4U7SA 4XNQB 2OTWA 2NY4D 4R8WH 3RKDD 1DUZB 1UXSB 5ILTH 1ZLVH 5I17B 3CXDL 4JFYB 7FABH 1XF5B 1A6ZB 1C08B 1FLTX 2OL3A 4NO2B 1SY6H 4FTVD 4R0LB 3TV3H 1CR9H 1AH1A 2PCPA 1XGTA 2VZOA 3KYMA 2KQNA 4LK4A 3BH9A 3LKSA 4KVNH 1LQVA 4ZS6C 1UWXK 1VADA 1BVLA 2KUTA 3NTCL 1SYSA 3AC0A 2VLJE 3IFPB 1H3TA 2FYYB 1RUML 3MX0A 4H25A 4KV5E 4GW4B 1EERB 4TSBL 1E4KC 3Q5TA 5T33L 1AO7A 2MFNA 3HI6L 5DURD 4W81A 5CCKL 3GRWH 4F15B 3AFLA 2XI9A 4NZDA 3Q1SH 1S7UA 1IGJB 1KJVB 3LMJH 2NY1B 5C0BA 3T0EC 3MBXH 5EPMB 3RBSA 1F4WL 1Q8MA 1QLEL 4OB5L 2Q6WA 3RJQB 4UOW0 3TNNA 1ZAGA 5IB5A 3L3DA 2BNRE 4CN4A 3KJ4C 3IVKA 4HUVB 3H7BA 1R5WA 1MHHB 1IAKB 4ZOCA 2C5DC 4K23L 1AY1H 1G9MH 4NRYA 3U46B 3EDFA 4LLAA 5F1SA 5ALBL 1EGJA 3B9VA 1A64A 1KYOK 5FDYA 4ZODA 2CLRA 1CDBA 3LQAC 1HSBA 4J2XA 4XZUB 5DUPH 4XRCB 3GMNA 2WBJB 3FQNA 2ICCA 1A4JB 3BI9X 1A6TA 1ZLSL 1NFDA 3QDJE 3H9YA 4NQDA 5EBWA 5GS0L 4PPTA 4UV4L 3T2QA 1MWAB 4X99B 3BW9B 5SWSD 4RA3A 4M03A 1SVZA 4HJGA 5GRYA 5B4MD 3EAKA 3H0TA 2E8YA 4I0PB 4LHUA 1FDLL 1XF3B 4KK9D 1CFQA 4P57B 4GG6B 1R5VB 3GMOA 5EU6A 5JXAH 5JW3H 1HXYA 4L8SA 1NH6A 1INDH 1E4JA 3QIBA 4Z7UE 3VW3L 3BKYH 3C87A 4P3CL 2R0LL 3PABB 2X10A 5I1LA 2I07A 4QT5B 3NZ8B 5SX5H 2ZCLL 2WY3A 5T1KD 1KJ3H 2CRMA 4WEBH 2HLAA 5FK9B 4OQTL 3RWCB 2BDNH 4QKXB 1E6JH 4G6JH 4TTGA 5LJYH 2IH3A 1VFAB 5DUML 5ESVA 1ULVA 3TBTB 4XNUH 4PP1C 1MJ7H 4N8CL 4KKBC 3WDHA 3R06A 2JJSA 3MV9D 3VD9A 4XPAH 2AEQL 5IMOA 3OKYA 4X6EB 2AXJA 1DP0A 5D8JH 4QRRD 4PJIA 3TPKA 5KSBA 1CICC 3O9WA 4IOFD 5DZLA 4MNHA 4IBLT 2AABL 3E3QE 3F12A 3NACH 4X6DF 1IC7L 3C09C 4LFHD 2ZCHH 1U91A 5CJXC 3QQ4B 2P42B 4AG4H 1KJMB 5B3JE 1RPQA 3HMXH 3VXOA 4DJMA 3T77B 4RBPH 3CFKA 2EDXA 1MAMH 3G9AB 2ICES 2Y5TB 3A67H 3PWVB 1OCWH 4JY5L 4MXQA 3SN6N 2C3WA 1GZQA 5E8OB 2YBRB 1RHHB 1C8PA 2BY2A 2L0DA 1OGAD 4ACPA 4K7FB 1BFOA 1G9MC 4APQC 1TVBB 3C60A 4GLRH 1EEQA 4Q9RH 1JZ3A 1U3HB 2J4WL 4I0CC 3WFEL 1DLHA 2X4NB 4KKCD 2R4SL 5TE4H 3NA9L 5ID1A 3ZHDA 5T3XE 1NGXA 3BEWB 2YD9A 1G7QA 4GRWB 5EN2A 4NC2B 5GGRB 5C07D 2FZ3B 4YK4B 3WHE1 5T5NF 1CFVH 3QUKA 5EG6C 4FNLH 1IL1A 4OT1H 1I1AA 2Z31B 5I0ZA 5HYSB 4XVUC 1T7ZA 3GI8H 2DTSA 4NNPH 3WFDH 4WO4D 5C0JA 5ICYA 5GJTL 4XNMB 1N0XH 3QFJE 4O2FB 1WGOA 4JO3L 4YHIB 1BX2A 5DJDA 1I3RA 4NSKA 4KK5C 1PFCA 2UY7A 4FZ8H 1J8HA 2XQBL 4NKIH 1YEHL 3CD4A 5BMFL 4GXVL 5FA3A 1CDJA 2LU4A 2EC9T 3S3SA 2FBJH 3V5DA 4J8RB 2AVGA 1DUYA 1DEEA 4JDZB 3TYFB 4C56D 1HIML 4Y7MA 3UPCA 3KPSA 1OB1B 4XNXH 2FO4A 5EH1A 5LAXA 3ZDXF 3VE0A 1G7HB 4YC2C 3SKMB 2JJTC 1CFNA 2VO5A 2W0FA 1OAKH 3BP7A 3GSUA 1OTTD 2X9XA 4MD0A 3OF6D 2J8UA 1HNFA 5DMGD 4HWNA 2LTQC 4IHOB 3VFVA 4P2RA 3SKNB 3IFNL 3HG1B 4H1LB 4GG8B 1PSKH 2CDGA 5KSVB 1U6AL 3HUJB 5FCSH 4ODXB 3VGHA 4OKDA 1MLBB 3VWKD 2FHCA 4OZGE 1V3LA 2F5AH 4PRDB 3MLXH 3QJHA 5DD3H 4OJFL 5DRNB 2G5BA 1FJ1A 3MBEA 1T66C 1L4IA 1OHQA 4LNRA 1UWXH 1UZ8B 4B0MM 1UKTA 4Y5XA 5IESH 2DQEL 4R96A 2PNDA 1MCHA 3VG0H 1S7SB 2F53D 3NFNA 2FD6H 4WCYL 4X6CA 1XGYH 3HE6B 1REIA 4JANB 5D7LB 4A6YL 3BP6A 5J3HC 5IBLC 1OAYH 1FYTE 3ZKSD 2GI7A 1VPOH 1W72A 2P7TA 3U7YH 4WEUD 2OCFD 4EDXB 1KLGA 5E95B 1DQMH 2YKLL 1F3RB 5TPWH 3RZCC 1FFPB 2R0WL 4RMQA 2MHAA 5D2NA 1FNSH 3P3YA 1RFDL 3D3VB 4JRYD 3DSFH 4OGAD 1S9WA 5B39B 5AEAA 1YY8A 5D7KD 1HKLH 5CINL 4EOWL 3V4PL 4DVRH 2QSTA 3QDMD 4NHUA 4N90E 1UYWH 3J8F7 5I0DA 3W0WE 4RISH 1TJIH 5CILL 2BSED 5FGCE 3U6RA 5DYOA 2KPNA 3QWQB 1U8OA 3TBSB 1ED3A 1RZ7H 4Y2DC 1BZ9A 1UGNA 3VXPA 3F5WB 1C5DA 3BN9C 1LP9E 3PDOB 2PTTA 5IB4B 1EFXD 1YECL 3QZWG 4W6WB 1T1XA 5IHLB 5ACMA 4JKPH 4MNGE 4MJ4A 3P0GB 2GJ6E 1OPGH 3BP5A 2X4OB 3SDCC 3REWB 1BBDH 2AQ2A 1RJYA 3V6OC 2Z0BA 4PJFF 1D5ZB 3GHBH 1CD9B 1A1OA 3BH8A 5EO1A 5CP7A 2KDGA 3WJLA 1WCBB 5C6PB 4OCRL 1AXSA 4YR6B 1LEIB 5IHZA 1GAFH 4NC1E 3HKFA 2RFXB 5E8NB 4XWGL 1YNKH 1N59A 4Q7DA 3VXRD 3GSNB 2NY2B 5HJ3A 1TZIB 5IMKB 5MERA 2Y06L 4CJ1A 1XGUA 3U1SH 4YUEH 4GRLB 2A73A 1PGRB 4S11A 3QEHA 4I77H 1CU4L 3HS0A 2X41A 3SGKC 1L0QA 1J0KA 3OR7B 3PL6B 1LO2L 3QDGA 4NNYB 5BV7B 2R29H 3IDMA 4HHAA 1ZK9A 2R9HC 3T0XA 1QSEA 4NKOB 1BZ7B 1IEBA 4QY8B 1Q9LB 4MQTB 2UY6A 5MP6L 3GSVB 5JZ7C 4H8WH 5FUOH 3TPUE 2VZ3A 3L3JB 5ILTL 4PJHB 4DAGH 4O2EB 2LQRA 5D6CA 2ARWA 7FABL 3RKPA 3BOVA 3VXSD 1T22A 1G6RA 4F7EB 1SY6L 3TV3L 1CR9L 1NKRA 4U6TA 5FXCH 1TIUA 4I2XE 1OD9A 5T3XH 2VMFA 1Z6JT 1KCUH 3FQTA 4HWEL 4G5ZH 1T1YA 4KVNL 4L5FL 3LH2H 5DVMA 4P46B 1X5XA 1LE5A 2AEPH 4OLVH 5FKAB 4D2NA 2VAAA 3HHRB 3U0PB 2A2QT 3DX6B 4GMTH 3GRWL 3S36H 2M2DA 2RJMA 4G8GD 2YD4A 2AK4E 5H37H 1MRDL 3MGAA 3Q1SL 3BGMB 4Z9KB 2CDFA 5HYQA 2A9NL 4NRZB 4X5XA 2OJZH 4MDJB 2WZPD 3OXRA 3C6SA 4LLVB 1WSST 3ARBD 1I8IA 5HYJA 1YNTB 3AS0A 1T3FA 1ROWA 1P4LA 4N5EA 1AY1L 4YDLC 1DQDL 1LK2B 1EMTH 4OGYL 3KXFD 4XH2B 1CE1H 1JHKH 1EUTA 4TNWF 5SX4H 4S0SD 3QO1A 5FO8B 3ULUE 5CEYB 3P73B 3UEZA 5DUPL 3X12A 1YEKH 3SEPA 5HGDB 5J89A 1W0VB 3H3BC 1MUJB 2X7LA 1TJGH 4NQVA 3T3PE 3OBAA 3GSXA 1AIFB 1G84A 1MHEA 5FB8B 3FB7A 2YEZB 3IU4H 5DVKA 1RK0A 3O11A 3TIDA 2HMID 2YUXA 3WNKA 3DOSA 4UIMB 1XR8A 4ODWB 1S7QB 5CAYB 4NBXB 1YQVL 4FG6D 1L7IH 4UU9A 4F7TB 5JXAL 4X4YA 3NMEA 1INDL 2O61A 2EXWD 3FQUA 4IIQC 5GRUL 5HHNA 3FN0H 3BKYL 3OL2A 4PLKC 1KEMH 2VABA 4JN1H 1Z9SA 5BW7C 1NFIB 4YHZL 3VFOA 2HFGH 3BIBX 4H8WC 4O9HH 2P5EB 1Q94B 3E6HA 1CG9B 3ULSB 4YHPA 4WEBL 4LPWA 4HG4J 4KTYA 1IEAA 1GIGH 4G6JL 2OTWB 2H9GB 1EPFA 3KJ6H 4LGPB 1XGPB 3D1MC 1V8HA 1KB9K 4XNUL 2DYPD 4HCRA 4XNYL 1MJ7L 4IRJC 2PCPB 2YN5A 4XPAL 3P9LA 2J6EH 4AH2B 5EZOH 1Q38A 3KYMB 3SE8H 4X7CC 1IGCH 2PF6A 4OFDA 1K6QL 2VLRA 3BEVB 4UB0H 2PW2A 1VADB 1JYWA 1JPST 1BVLB 4NQCD 2X4UA 5L8LB 1BGXH 3QO0A 3NACL 1YNLH 4P5MB 5I74C 3PHOB 4XPHH 4L9LA 2HFFB 1S9YA 4HS6B 4AG4L 1SEQH 3HMXL 2YPVH 4AK1A 3K8KA 5IVZB 4N0UB 3C9NA 3CU7A 3QIUA 1MHPH 2UZYB 5I9QC 1MAML 1S7UB 5K9QI 2VSDA 5C0BB 1P53A 3A67L 5ICXA 3VMPA 4JG0L 4EN3B 1DVFA 1DBAH 1OCWL 2XWBA 5TDPB 1ZOXA 4Q9BA 3T08A 4ELMF 4N1CA 3O2WH 3LPFA 4CMMB 3TNNB 2GJJA 1J1OH 3L3DB 1B6UA 4N8PA 3IDJA 1JN6B 3BQUC 4Q9RL 4LLYA 2Q3AA 5I8OL 5TE4L 1OD7A 3I3BA 2C1PA 4NRYB 1U2CA 1GOHA 4BQ9A 1BQHG 1YEEL 5J8OA 3LKQA 3MR9A 3RI5K 1H8SA 3EYOB 1QO3A 5KAQG 4FNLL 4OT1L 3BIKA 3QUYC 4OAWA 1JWMB 1K4CA 3PNWA 4HF5H 4GG6E 1N0XL 3TNMA 1A6TB 1NFDB 5DD6A 1DBBH 5DRWA 5FGSA 4F57L 4Z7OE 5EBWB 5C2UB 5DQJA 4ODBD 5HBBA 3MLYL 1KCVH 3QDHA 4F9PC 4NQSB 4HJGB 1AHWC 3H0TB 1GHFH 3ARGC 4LHUB 5DJYB 2FBJL 2X6MA 1XCTA 3FMGH 4G43A 1YUHA 3GMPA 3LS5H 2P48B 3OAUH 1CFQB 5CIPH 5EU6B 2WBJD 3GMOB 3GBML 4L8SB 3MV8D 2HRLA 3NZHL 1IGFH 3QIBB 2X4TA 1QFWH 1OY3B 4MAYD 5T3ZE 3RL1A 5A1AA 3UJJH 1OAKL 4XCNA 5M94B 3BO8A 4CU7A 3SCMB 3C6LD 3CNKA 1GZPB 2RCSH 5BOPA 1PSKL 5C0EA 5K59F 2NY0D 2ATPA 1KLUA 3GMQB 2IGFH 2IH3B 3VXQB 1A3QA 4L3AA 1MIEL 5ESVB 4CN6A 3WHE0 2F5AL 4U4BA 4LCWD 3VA6A 2MOVA 1ZT4A 3MLXL 5D96C 5DD3L 5JW4R 4HT1H 1DBKL 1MH5A 4GW5B 3B9KC 1HH6B 5IESL 4MX7B 4IRZH 3I84A 1P7QA 1IAIM 4S1DD 4ZO6A 4V1DA 1QFHA 3PQYA 2FD6L 5DXWA 4PJIB 4N1EA 3U7AA 4JFQB 1XIWD 1RURH 3O9WB 1IGTB 3G6AB 1TQCB 4N68A 3U7YL 4PBWD 4RMVA 3MYJA 4NZRH 5HY9A 5H37G 1DQML 1P9MC 2VJXA 1A3RH 3ULUH 3TVMA 2RIKA 1L6ZA 3VXOB 4FQJH 4KRNA 5F9WC 3CFKB 4NC1C 4WW1A 5EOTA 3UBXI 3O6FA 3WIFB 4U49A 1FNSL 4XCFH 3H3PH 4S10A 4GRWE 5HVHB 3ZT5A 3LRSA 1ZE3C 3DSFL 2B1AL 1U8IA 1GGBL 1ZVYA 4Y1AA 1HKLL 4P4KC 2B4CH 4G9FD 4XHJD 4DVRL 2VQUA 3IDNA 1BFOB 4N9GB 4U1IA 4RISL 2VLME 1WZMA 4I13B 1TJIL 2CLZB 4MGXA 3Q0HA 1RZ7L 3A6OA 3VGDA 5EN2B 3ARFB 1WAAA 3CZFA 2Q8BL 1ORSA 1IAOB 1UB6A 4JPKL 1B0RA 1IL1B 2Z92B 15C8H 1DLFH 1JTPA 3DV6A 4G3YH 5C0JB 4DCQB 5ICYB 2PTUA 1OPGL 4BZYA 1P84K 5DJDB 1BX2B 4NSKB 3QULA 1LE9A 4AEHH 1J8HB 3GHBL 4LSSL 1F3DJ 3RNQA 4MS8A 5FA3B 1J0ZA 2K7QA 2HFEA 1K5NA 1NCBH 4YXKH 2Z31D 1DEEB 3HG1E 1WC7B 1YNKL 4K55A 4K9EL 5HDOA 3L3KB 1DTUA 3HUJE 1DQJA 1MCWW 3VG9C 4DQOH 1CXFA 2FO4B 2P8MA 3U1SL 4YUEL 3VE0B 1CFNB 4MAUL 4K07A 3QI9D 2E9WA 5C0AB 2J8UB 5DJCA 5AWNH 3PGFL 3VFVB 3MA9H 5DJAA 1GXEA 2R29L 5L2KA 1T83A 4YDKH 2CDGB 2JJVA 4PRBA 3GMRB 3SJVA 4JDTH 4CL7A 1Z5LA 2B5IC 5DK2A 4JHAH 4HIIB 1UG9A 2XQYK 2HT4C 1T20A 3RU8L 5FUOL 4GKOA 3KG5A 3MRIA 4DAGL 5D1ZB 2J1KA 4Z7QF 1HI6A 3B43A 3OB0K 2GFBB 3QXDB 1DFBL 1G7MA 5GGTL 2VDRL 3P0VH 4KMLB 1NLBH 4PJAF 3K81A 2W60A 2VXUL 1OWRM 3SDAD 4XCEB 3FB5A 3KWWA 5T3XL 5KVFH 5HVFB 3D3VE 1MWAH 4YHLH 3K8MA 4YIQA 3BP6B 4U33A 2Q86A 1KCUL 1EBPA 4G5ZL 3RY6A 4K3GA 3LH2L 1FO0A 1KLGB 2DB8A 2PN5A 5TE7H 2NPLX 4NRXA 4K2UL 3SQOH 1VESA 1N6UA 4OLVL 3ULVC 3QQ9C 2CK0H 2BCKA 5HHVL 2IFFH 1FN4B 3WFCH 3HNSL 3R0NA 5D2NB 2R0ZH 1P5VA 4P9MH 1XH3A 2MTPA 4GMTL 3EOYG 5D7JD 3LPWA 1G9NL 4OF7A 4UDTA 5D7LD 1YY8B 1A8JH 3DUUA 4MYWB 4G8FA 4FOMA 4NHUB 1CGWA 4RMWA 2CK2A 1CXEA 4OI8A 4BA8A 1J87A 5H2BA 4MCYA 1NGYA 3OQ3B 2BVYA 5B8CA 3U6RB 3DVNA 4Y4FB 1ED3B 3IETA 5GGVH 3MJ9H 3G6JA 1C5DB 2PTTB 3RTQA 4S0UC 1HZHL 1XFPA 1EMTL 2X4SA 4M3JA 1CE1L 2LAGB 4PJ9D 1CICD 3QUXB 1IMHC 5FA4A 4JREB 4FQCL 1RJYB 5A3ID 1QSFB 1YEKL 4CU6A 1QACA 1BFVH 1A1OB 2H32A 3V9FA 3SDDB 3BN3B 4M7LT 4C58B 2ZUQB 3ZYIA 1T6VN 4OZ4B 4XWOD 3ARYA 3IU4L 5HVWA 2XN9B 4F15C 4P5TD 4ODVL 5T1LD 2FEDC 2FIKB 1BBJA 5KANG 4XI5C 1N59B 1AD9B 3S88L 4PTTA 4NKMA 3FO9B 1KTLA 5HJ3B 3W9DA 1MCKA 1HWGB 2FHBA 4G59A 3DJ9A 1MCOH 2XKNB 4MNQB 5F7DA 3HS0B 1K2DB 3TBWB 4KJQD 5E2TH 1HHHA 1CZ8H 4OFPA 4PJHE 3UBXA 1NCAH 1KEML 4JN1L 3QDGB 4I9WE 4ETQB 1KCRH 3ZHLA 4HHAB 3RJDA 3OGOE 4O9HL 3WNNA 1IEBB 2D31A 4KRPC 12E8H 4GRWH 1VACA 2O5YH 1GIGL 4OZFA 5E56A 4NFCA 3G08B 3BHBB 3BESR 5DUBA 2J7LA 3U0WH 1FFRA 4WUKH 3DWTA 5F89B 3ZE0F 3PL6D 2OI9A 1T22B 1G6RB 1YN7B 5CD3A 1CLCA 5C0GA 4WUUA 5MHSE 3QUMA 4WWKA 4I0PC 2J6EL 5TE6H 1AGEB 3SE8L 2DAVA 1IGCL 1EX0A 3FQTB 3VH8G 4YFEA 1T1YB 2CKBB 4UB0L 4K3HA 4ISVB 1T89C 1CLZH 1XEDA 1LE5B 1BGXL 3PUCA 3ARPA 3WJJC 2MKWA 2VAAB 1T0MA 1RULL 3LB6D 1YNLL 1E4XI 3B5HA 4LHJB 1DBMH 2YD7A 1KENL 3HE7A 4XPHL 1SEQL 1B2WL 5C86A 2YPVL 3D39A 1AGBA 2EDHA 1O7SA 4QRPE 4ZG1A 1MFEL 4NZJA 3O2VH 3KLAA 4MD4A 4O58L 3TBVA 2DKSA 8CGTA 2NY7H 1VDGA 4P46D 2VZVA 3D25A 1AC0A 4X5XB 3HB3D 1WWCA 3ZE2E 3O2WL 4H1LH 1IKNC 3RPIA 2EKSA 1J1OL 2NW3A 3OXRB 3C6SB 3WN5C 4P2OA 5MHSD 4L8CA 2BXYA 3VXMB 3MJ8A 1I8IB 2WP3O 5HYJB 1T66D 1NCNA 4YHKL 5C71A 1P4LB 1QBBA 5DD0H 4XAWH 1MJUH 1URLA 4PRAB 4G6AC 1R3HA 4PJGF 5ICZA 1FYHB 1FRGH 3TZVA 1FNHA 3R0MA 1WQVT 4FMKA 3GSQA 3QO1B 4MD5A 3KLHC 1YJDH 2CXKA 3BWUC 4HF5L 1A47A 2ICWA 1OTSD 2DWEB 3IJSA 4NQVB 1E4WL 3BVNA 1DBBL 2WWMD 3GSXB 5MENA 5AZ2H 5GS1A 4XPTH 2R2CA 1RK0B 1KCVL 1NUGA 3M1BA 3NABH 3O11B 3TIDB 4PJXA 1GHFL 3RVWC 2XWJA 1CTNA 2P5EE 2EDQA 2R4RH 3FMGL 4J1UA 5CZXD 5IJKA 2OK0H 2EH7H 1X5LA 2YS4A 1QBLH 4F7CA 1NBYB 4OQTA 4X4YB 3FRPG 4AENA 1F90L 4HH9A 3FQUB 5HHNB 3AS3A 1QFWL 2BVUA 1U3HC 1YPZB 2HWZH 4QWWC 5HI4C 5DA0B 3CUPA 2X09A 2RAMA 1ZLWK 5DSCB 4WTZG 4ZXBA 1IJ9A 2AXGB 3UJJL 4FFVC 2P24B 3UTSA 3LSOB 3VFOB 4DW2L 1EHXA 4JGMA 4D0CB 1LNUA 3NGBB 1AKJB 4YK4C 4H0GA 5ISZA 2RCSL 4WHYH 4X6DA 4BQCA 1FZOA 3FO1A 5DT1H 2BVTA 1LD9A 2RQ8A 3OB0H 2CMRL 2IGFL 3HA0A 3SDCD 4MQXC 5JHLH 4LIQH 4R6UA 2OS7A 4MJIB 4ZOEA 1L7TH 3SBWA 3MRFA 5JPMA 4J3OC 4J6RL 4YXLL 2W65B 4OLXH 2F5BH 3JVGA 4M93B 2FR4A 1X9QA 3VFMA 1FORH 4ERSH 4WU7A 2QEJA 1AO7E 3MXVH 3UAJC 5D71H 4N0UE 3ZO0A 1WFUA 2NCMA 1IC5H 2VUYA 4OCXL 3W82A 3A6BH 3PWUA 1Q1JL 4QTIH 5C0BE 1J12A 2HP4A 5EZIH 2XYCA 4HUUA 4HWZA 4PY7A 4YDJA 3RIAK 1EXUA 5IOPB 1A3RL 3ULUL 4KVCH 5TH2A 4GBXA 3GSNH 4FQJL 3T0AA 3C9NB 3OKKA 4PRHD 3BDYH 4S1RH 2HJFB 4I48B 4XCFL 5E7FA 1FFQA 3EJJX 2IWGA 3H3PL 4X4XA 3T0VA 3OR6B 3NIFE 2OM5A 3HRPA 1DVFB 2IBZX 2XWBB 1TCRA 4XAKE 3MFGB 1EHAA 5BV7H 3T2NL 2IF7A 5DC4B 2B4CL 1KIQA 3WEXA 5JUEH 3JWDC 2BVOA 3MODH 2R2BB 3IDJB 5HDLA 4RFEB 1S7WA 1YMMB 4LLYB 1LO0H 3NFPA 4F9LA 2W59A 3FO0H 4S1SH 1NFDE 43C9B 1S5IH 4M5YH 1RUQH 2F74A 5C0ND 1MFAH 2C1PB 4MQ7A 1YJDC 4JLRA 4M7LL 3MR9B 4EN3D 4KPHH 3QIWA 4ORGA 3DGCR 1QO3B 3HE6C 3JXAA 3BIKB 4EUPA 15C8L 1DLFL 3KPLB 3MYZA 4P23C 1A1NA 1K4CB 3PNWB 2AJXH 5EU6E 1PD6A 3TNMB 5KSAA 1CDIA 1JCKA 1ZTXL 1JWUB 4AEHL 1HHGB 3KPRD 1QOKA 5HHMA 4NIKB 3ARXA 3EYVA 1GPOL 4JY6A 3C08H 2MQ0A 2KZWA 4J4PD 4X0KA 1P6AB 3GMLA 1NCBL 5KW9H 1NUFA 4WV1B 5KVGH 5C09B 2PO6A 3NH7L 3ROOA 4PRPA 5F8RC 1SJHA 3IXAA 4L4VD 2W9DL 4LF3A 3L95A 3W11C 5DRZB 1D5MB 3DRTA 1FZKA 1U93B 5IB3A 3RFZC 1IGMH 4XCNB 1RZKL 2VNCA 4EQ2A 5E6IC 5AWNL 3D9AH 5M7QA 1G7JB 3MA9L 1YQ2A 3QCVH 4Y5YA 3DTXA 3K2UH 1X7QA 4LQFH 3SE3C 4YDKL 2JCCF 1GC1H 1KLUB 5DJ8A 3RIFK 4JHAL 1KLFA 4PJIE 3VFWA 4CVWA 1A14H 4LCYA 1NSNH 3HRZB 5BVPH 3QP3A 2ZG1A 4JHWH 5J12B 3L5HA 3FFDB 3VGEA 4UBDD 3SCMD 5LCVH 1SMOA 3ZTJG 1MH5B 3R1GH 1IQDA 3WXWH 1P5UA 3P0VL 1NLBL 4ZO8A 2P43B 1RUPH 3RBGA 3QA3A 3G5VA 3RHWF 3MRPA 2BXZA 1MWAL 5KOVC 4YHLL 2ZZUT 1TDQA 2VAJA 4EEEA 4QHUA 4MCZA 2YRPA 3QEQB 4O5LH 3AREB 4GRLC 2ADIB 2QSCH 5HY9B 5TE7L 2QQLL 3SQOL 4PLKD 5MEPA 5FGBA 3A6CL 2CK0L 1IC4H 5IROA 5HGGS 1UWEH 2ENYA 2IFFL 3WFCL 3O6FB 5BV7C 2R0ZL 4P9ML 4U1SA 2NXYD 3BAEH 3QBTB 4NQEA 5D4QA 5HGHB 3LRSB 4Y1AB 5CEZD 4L3EA 3IDNB 1MSPA 4NYLA 5IBUB 1P2CA 2PR4H 3W9EB 4MXVF 3VFPB 4Y4HB 1J8HE 4XT1C 3CSYB 3MJ9L 4IRJD 1LO3H 3VGGA 1UB6B 1FNLA 3MRDB 1B0RB 1JNLL 4QXUH 3L6FA 4J12A 1A5FH 4LP5A 2OL3H 5ESQB 1CVRA 4PJCB 2VOTA 3TA3C 2XTJB 2DM4A 4WHCA 1MJJB 2DKMA 2FEEI 3EO0A 1BWMA 1CLYH 4L3CA 4NKQB 1LE9B 3W2DH 1BFVL 3ZKXC 1YEJH 1BZQK 5E4EC 3TFKC 4JHBA 4JQXA 2OP4H 3ES6A 1J10A 1T21B 3RNQB 1FQ9C 5C0AE 2J8UE 2VE6B 3IKCA 1SEBB 2HFEB 5D5MA 3BRGC 3BUYA 3GEWB 3AY4C 3HI1B 3OKDA 1ZLWH 4KUZH 5BS0D 1MCPL 3H3KA 4DGIL 4ZFFB 2OR9H 1DQJB 1NMAH 4EZMA 4HKJB 3BYYA 1D7FA 2I24N 4LU5H 3LN5A 2IAMD 1MCOL 2EDFA 2QHRL 2YK1H 4Q6IB 2GHWB 3T04D 2GTWA 4X98B 5E2TL 2YUVA 1NCAL 2WQRA 1QD0A 5ETUA 1JPFB 5GGSY 4KDTC 1KCRL 3TJHC 5FYKE 5C0DB 4TULH 1ZT7B 4WU5B 3SJVB 1FZJB 1SY6A 1IAMA 4X6CE 12E8L 1T20B 5EU4A 4JVUA 4PDCE 3MV7A 3NBNA 2VZUA 3K7UA 3U0WL 3MRGA 1EGJH 1EO5A 1HI6B 4LMQE 3ZDYE 1WTGT 3RGVD 3DV4B 1G7MB 4G6FB 1NBQA 1YYLH 4LVNC 1CE6A 5A2IH 4FQXB 5DQ9A 2NY5H 5C3TA 1RMFH 4PUBH 1RUAH 4XCYA 5D2NE 3FOMB 3KWWB 2X89D 2N56A 5I1DB 5EZJB 2ZCKH 2Q3ZA 1U8LB 3GRWA 4YIQB 4DKEH 4PRNB 5IQ9B 5JQHC 2A9MH 3IB4A 3GIZH 4NHUE 3V8OA 5D1ZD 4FQPA 4OCYL 1CLZL 4NRXB 2R1YA 3MRCA 2DMKA 2BCKB 1DBML 5HDQH 2BHZA 2D7MA 4H20H 5BRZA 2YD3A 3W5NA 1IGIH 5EOCJ 2R23B 1XH3B 2FJFA 4H26A 2BHYA 5JORB 1NPUA 2EDLA 2R8SH 5K9OA 3QG6A 2DN7A 2BNUA 3TH4T 5EUOF 2A6DB 2EYRA 2NY7L 4WRLA 4G8FB 4FQHB 4U1GB 1N7MH 4HKXA 1X5JA 5JO5B 1PEWA 4DN3H 3B9DA 1AJ7L 3S6CA 3PWPA 5J9PA 5H2BB 2OYPA 5DQDL 4MCYB 2X4RA 5B8CB 2ICEA 3DVNB 3QQ3A 1QSFE 2Y7QB 3TYGH 3G6JB 3U82B 2Q8AL 3B9KD 5D9SB 3RTQB 3CFDA 3RRQA 4JPIA 4P0DA 3HMWH 4XBPA 5DD0L 3UTTA 2X4SB 1BQSA 4X8JA 2XN9E 4LL9A 1WK0A 4WY7H 4OLEA 5FA4B 2IQ9H 4JZJB 4LSUH 2GSIA 1UQSB 4QRUA 2UUDK 1C12A 4QO1A 2H32B 1S7VA 3C2SA 4FFWD 4LVEA 4M1GL 5AZ2L 1K4DA 5CEZH 2DWDA 2P47B 5EC2A 3NABL 4KK8C 3QDGE 2YD5A 5I15L 3WV0A 1BBJB 2EZ0D 5D6DA 5GIRA 3NIDE 3QUXD 2R4RL 2IPUK 3F7VB 4PTTB 2Y07H 4NKMB 3TO2B 3WUWB 1QRND 2OK0L 2EH7L 4PJ5B 1MEXH 1QSFD 3W9DB 3UO1H 4EIGB 5F7DB 1AFVH 3W39A 3AXLA 5KVDH 4PLJC 2HWZL 1F5WA 5EORL 1OL0A 3AS1A 2XN9D 4YEEA 4PV9A 1L8JA 4LCIH 1KGCD 4R4ND 5I1CH 3MOQA 1N5AA 5I1JH 2VLKA 5DT1L 4G42A 1KOAA 1IEHA 1U8PA 3QWRA 4OZFB 3AS2A 4MNQD 5JHLL 5DUBB 4LIQL 1MRFL 2H3NA 2DQJH 2NNAB 4GAGH 2AQ3A 1LQSR 4OLXL 4LEOA 3KPMB 2F5BL 2BY0A 2BNQA 4Y19D 5CD3B 1JGVL 4ERSL 1DN0A 3OGCA 5C0GB 4GH7B 4I3RH 3QUMB 5IVXF 4ELMA 4ONGH 3WL9A 1CN4A 3HMXA 4MLSA 4YE4L 1IC5L 3EYSL 3QR2A 5DDHA 2BVQA 5C0IA 1B0GA 3A6BL 3KGRA 3BWAB 3EW3B 4FQ1H 4L8SC 4PJ8A 5EZIL 1A6WH 1CTOA 1MCSA 4KQ3H 3HZMA 2UVEA 2CUHA 3QIBC 4LLQB 1CDGA 4WGWB 5FYKU 1T0MB 4I3GA 1YC7A 4WJ5B 5JMOC 3MRNA 4PGEB 3HE7B 4KVCL 4PY8I 4LRIA 3D39B 3VXME 1MRCH 4S1RL 2XRAL 4URTB 5IBTH 5HYJE 5C0RH 4KU1A 5BCAA 5SWZD 2XG5A 5DR5H 4NOFA 1GGTA 3E2HA 1RHFA 4AQOA 4OBSA 5SV3A 3KLAB 1WIUA 4KI5E 4MD4B 2VIRA 3KPNB 5IB1B 4Q9CA 2HT4D 3D25B 1G0DA 4M6MH 3IJHB 5BV7L 5JUEL 2CR3A 4WTXA 1INEH 3S4SA 4HUKB 4U3XA 3MODL 2EKSB 2PXYD 5IWLA 3O3AB 4P2OB 3RWDB 1LO0L 4KJWD 3I3DA 3FO0L 1XF4A 4S1SL 2JF1A 3WCYA 2YD1A 5EU7C 2AI0H 2JJSC 1RUQL 1A6AA 1RZGA 1ZS8A 1F3JB 1MFAL 3PJSB 1R3HB 1YEGH 3VA2C 3TZVB 4NQXB 5FYKH 3GSQB 4JKKA 5BQ7B 3O9WC 5FCUH 1TQCC 4Q9QH 3VJ6B 2AJXL 3CAFA 2ICWB 1LWRA 2DJSA 1JF5A 3DURA 4U3CA 1AE6H 3VXMD 5ABDE 3ULVD 3HNTH 5MENB 4ODTL 1YPZE 4F37K 3C08L 3PP4H 3IKKA 5I75C 4XHQA 1Q9KA 3Q3GB 5JLZA 3HZVA 4MXQC 2VC2H 3X3FL 4CNIA 5IV2A 2AK1L 2HLFD 4AENB 4ENED 5EO0A 3TT3H 3C60C 4TVPE 4MJIE 3CUPB 4JO4H 4E0RA 1H3GA 1PEZA 2UZIH 5SWSA 3MJ6A 5SX4I 3CVIH 3C8KA 4Q0XH 4MB5A 3D9AL 1RVFL 4NZUH 2AV1A 3IGAA 3K2UL 4X6DB 2Z8VC 3FO2B 1FZOB 1I1AC 4P4RA 3LRHA 1GC1L 2F15A 2VLRE 1A14L 4NN6C 1MY7A 3VD5A 1XGQA 1NSNL 5BVPL 4LKCA 3WUZA 4XP6L 4UT7H 5GGUA 1N3NA 2YRZA 4WU7B 1SYVB 4BSWA 1KELH 1AKJD 2E6PA 5T1KA 3MA7A 3JTTA 5IM7A 5EBMA 3WXWL 2ZKHL 1MI5D 1RUPL 4XI5D 5C0FA 5IFAH 2WINB 3OTTA 4MJID 4JR9H 4WW2F 1OVZA 4PY7B 4YDJB 2YA0A 3DROB 4I0KA 4O5LL 4ZUWA 4JJHA 1X4YA 2QSCL 4BH7A 1YEDA 1MAKA 2OZ4H 2OJEA 4R4BA 4L4TB 5TH2B 2HJKA 2VQ1A 1YMME 2VQTA 3MV9A 3RA7H 1IC4L 4MJ6B 3QQNA 4AMKL 3OKEA 4X4XB 5F7EH 4NUGH 4QRRA 3V7AE 4Z7UA 1TFHA 3HPLB 1C7SA 1TCRB 1F4YH 2OLDA 4MDIB 1U3JA 3G5ZB 1KIQB 1U92A 3WEXB 3T3MF 4RIRA 4POZD 3BKCH 4U1KB 3FFCD 2PR4L 3MBEC 3ET9F 2F74B 1LK3H 2H2SC 4Y5XC 2CJUH 1HK6A 1LO3L 4K3DH 4MQ7B 4JLRB 4RQQA 1K8DA 2UUDH 3QIWB 4ORGB 2BVEA 3D0LA 1V5JA 1A5FL 1QFUH 4JO1H 4EUPB 1G6RH 3CX5J 2E9JA 4JQVA 3IFOB 2I26N 5I8CB 1A1NB 4TYUA 4J7RA 5DHXB 3SGJA 3GSOB 5C09E 3DVFA 1CLYL 2DF3A 4IJ3B 3V4UH 5F7UA 5I6XB 2B8OT 3P4MA 1N4XH 5L6YH 4ALAH 4KJPC 3W2DL 3Q6GH 2FRGP 1YEJL 2CKBH 3EYVB 2DIAA 5C07A 3DIFA 4U1MA 2FX9H 3PGCA 5D2NC 1A7RH 4RFNB 1RK1A 3E3QA 1PYWA 1P4BL 2W38A 3RY4A 3S5LG 3FN3A 3UPRB 4WO4A 3RP1A 1JFMA 4KUZL 4PRPB 2FATH 1M05B 3IXAB 3MXWH 2OR9L 3HCVA 2HKFH 1IKFH 2FH6A 2EEBA 3L95B 1I7TA 2F8OA 4LU5L 1EBAA 3DRTB 1J8KA 1FZKB 1NCCH 2YK1L 2A0LC 1A1MB 3QNZB 2DQDH 5SV4A 1R0AH 2DIJA 4OZHF 2C3VB 3D87B 1I1FB 3OMZA 3T65A 3K1KC 4TULL 4C56A 3UP1A 5GGTA 2IPTL 2ZUTA 4V1DE 4N9OB 2ADJA 2BJML 3U7WH 3KPOA 4FRWA 3VFWB 1DQQA 2VL4A 3OKNA 3MO1B 3QEQE 2O5XH 3FOLB 3WJLC 4MSWB 2ZUQC 1YYLL 3WFBH 4PJBA 2NY5L 3U30B 5A2KH 1RMFL 3QA3B 3G5VB 1Z0MA 4I4WB 1JNJA 3BZFB 4QHKI 4RGOH 1I8MA 4QHUB 3TWCH 4DKEL 2AXFB 2RGSA 4Y1AE 3VWKA 4GSDH 4E41D 4U1LB 2A9ML 2EXYC 3ARSA 3DX7A 5IFJA 3GIZL 5ENWB 1A7OH 4GKNA 4BH8B 1AGCB 1YEFH 4EKXA 1T1WB 3EBAA 2V2WA 4JN2A 1IGIL 2BOCA 4U1SB 1LO5A 1ZVSA 1BLNA 4HC1L 3B4NA 5C08B 3I6LE 4XGZB 5F7LB 3SPVB 3B5TA 4PJFB 6FABH 3L7FA 4P2YA 4QF1B 4XBGA 3P77A 2HTKC 3QEQD 2IJ0C 3ARED 3ILPA 4MQXD 4NYLB 3V4VH 4TPRL 3MRRA 5KAQF 4K71B 2XTJE 4DN3L 1P2CB 1M7IA 4LDOB 3N1GC 1A6UH 1RJLB 2E6QA 1CI5A 1FL3B 3TYGL 4R3SA 2M8XA 4TVPH 3LDBB 4NPYA 4B53A 2D2OA 4JRYA 5IMMA 3HMWL 3LVEA 3EYFA 2X42A 4FN0A 4XBEH 2NXZD 1G7LB 4HCRH 3B5GA 2ITCA 3QDMA 4NJAL 4LVHB 2J5LB 4HULB 3D5OF 4WY7L 4MQSB 4JY4B 4LSUL 5A16A 3U2SB 4I18B 3F6LA 5GZOC 5J4MA 1QLRA 2YRLA 3FB6A 4LCUA 1MVFA 4D9QD 5CEZL 1EFXA 1FYTA 4OLYL 2DBJA 1WISA 4NO0D 2G75B 3OKDB 1SJEA 1EO7A 2X1OA 3IF1A 1S9VA 3SJVE 2Y07L 4HPOH 1UCBH 5J13B 2ZUYA 4Y0GA 4MJ5B 1MEXL 4NT6B 1FHGA 3LN5B 5GGVY 1LVEA 1F6AA 4UNUA 3UO1L 4XPBH 3T1FA 1AFVL 2AJ3A 4QNPF 2NLJB 1F02I 1FPTH 3RWJB 4NM8H 4JFZH 2GTZB 5HD8C 1ND0B 3VXUD 4N5EC 4KI5C 1YYMH 1M7DB 1RI8A 1U8NB 3VXRA 4QTHA 1JP5A 1FL5A 4P3DA 1EZVY 2C3HA 4XP4H 3MV7B 1H3XA 3E6FB 1QFWM 1IVLA 3LQMA 1SHMA 4F7MB 4CDGC 2DQJL 1YY9D 4EI5B 1KCSH 5INDA 3MLZL 1CBVH 1Q0XH 2HVKA 3STLA 4E5XA 1JHLH 2A1WH 4NM4H 3QXWA 4HDIB 5D2LF 1D9KA 3MLWH 3QEUA 3S37X 1GCFA 4OSUH 4QCIB 1BD2D 4ONGL 4YFLI 4TOYL 3I50H 2Z35B 3N85H 3NCEB 4KJYA 4ZAKA 3NAAL 5DMIH 1EHNA 3EYQD 4NNXB 3JZ7A 4FQ1L 4G7VH 5GISH 1A6WL 4GS7B 2R1YB 3MRCB 4KTDL 4P99A 1N2RA 1GJIA 4FQXD 4JFHE 4M43H 2HA1A 5EBLA 2FJFB 4R2GB 3G6JE 1KTDB 5C0RL 2DM7A 2BNUB 2G2RA 2XZAH 2ZUUA 1CD8A 3P9WB 4HKXB 5CJQL 1N6QH 2EDBA 3CDGA 4M6ML 5FHAH 1WF5A 3N1QC 3PWPB 2WUCH 2ESVD 2X4RB 4U0RC 4X9GA 2ICEB 3QQ3B 2GYSA 3VRIA 1JI1A 2ZOKA 4K7PY 3RUGF 2AI0L 1I1RA 2XNAA 4G8GA 3GZKA 5KBNC 1AXTH 1YEGL 1VGEH 4Q74A 3I6KA 4LOUD 3U36A 1X5AA 3AB0C 5DD1L 3MUGA 2GSIB 4LRNL 4Q9QL 4WFHD 4QRUB 3OZ9H 1JTTA 5DEZA 4JM2D 4K8RD 1C12B 1T6WA 5CIPA 2FX8H 1S7VB 2H1PH 3ARBA 3GM0A 4L9LC 1QLFA 1L0XA 3HNTL 1U42A 3UJTH 2GQHA 2R0KH 3KXFA 2HT3C 3DETC 3QIUC 2Z93A 2XV6B 1PLGL 3MRBB 1DVFC 3CSGA 2VC2L 1CFSB 1EEYA 2XY1A 3I2CL 3S98A 3TO4B 3TT3L 3W39B 2DTMH 3QUZB 2X1XR 3PHQB 1RZJH 1F4XH 3C5ZB 4Q0XL 4PRIB 2EDYA 1LP9F 2HT2C 3BISA 4NZUL 1QTYT 4ONHA 1NANH 2N4IA 4PP2B 5EIQA 4G42B 4PJ5D 5B38A 3TA3D 4X8XA 1HINH 3CFJB 1JPGA 3VFGH 3DX8B 2BY1A 2H3NB 3HN3A 1T0PB 3NCFB 3ZZ1A 2HVJA 2GKIA 3CH1A 1T7WA 4OM0H 5B21A 5BJTA 4UT7L 1RJZA 3BPLC 3OJDA 4BUHA 3BZ4B 5E6ZA 4F3FB 3OGCB 4LASH 4NO3B 4EXKA 5HYIA 4ELMB 1NDGB 3D39E 3EDJA 3WL9B 5ESAB 2FL5A 2E6JA 4LAQL 1FVDA 2EDDA 1PY9A 2A77H 2QADB 5AZEH 4ZPTA 5DDHB 5C0IB 1YDPB 2BVQB 2NY4B 1B0GB 4PG9A 1P4IL 3MV01 5IFAL 2ARJQ 5L88H 1I7RB 4FXGA 1VGKA 2YC1A 1QFOA 1NGPL 2IPKA 1F97A 2DYPA 3MRNB 2OZ4L 4FTVB 3B2UD 2AJZA 2NZIA 3RA7L 1IAIH 1ONQA 1WJ3A 5L9DH 1NC4D 3THMH 3R8BB 3TJHD 2OBGA 1A4KB 4AEIH 4Z7WF 5F7EL 3DECA 5GSVB 1BF8A 1XCQA 3RVUC 4YAQA 5C3LD 3GJFB 2XY2A 1RAMA 1DUZA 4NQCA 4QXTA 1F4YL 3G04B 5I17A 4D3CH 4AEFA 3B8YA 3ZE1F 5F7HA 2Z4QB 1C5CH 1U0QA 4XCCH 4R0LA 5JW4Q 5DURB 1T5WA 1XF4B 2YPLD 1JF1B 1A6AB 1LK3L 5MENE 5JIHA 4K3DL 1CGTA 5HGBA 3MMEA 3M07A 2VXTL 1QFUL 3IFPA 3LKNB 3OKLB 2FYYA 3BDXA 1G6RL 2WP3T 3FAXA 5F1IB 4GW4A 3I9GH 2FLRT 4PJEF 1D5XB 5I8KH 1J0HA 3DURB 3V4UL 1UJ3B 1I9RH 3JV4B 1N4XL 3TVMC 5L6YL 4ALAL 3Q6GL 2CKBL 1L9NA 1R24A 1RZ8A 2JCCA 2FX9L 3SGEH 3O6FC 1IGJA 3UTSE 1CDUA 5EPMA 3RZWA 2YD8A 4YEFA 3QCTH 3ZKNC 2UWEF 3O6LH 5ISZE 4FP8H 3FQXB 3WLBB 3DBXB 4X6DE 3S37H 4CNIB 1AGFB 1RZJC 2PETA 3N1MC 3UDWA 3MXWL 1IFHH 2HKFL 5EO0B 2EDRA 4HUVA 5F9AC 1MHHA 1GRWA 1L9MA 4JFDD 4V2CB 4E0RB 1NCCL 4DN4L 1ORQA 5F9DC 1JWSB 4M5ZL 4MWFB 3DARA 3U46A 3C8KB 1A3LH 5MI0C 4BQ6A 3V7AG 2DQDL 1R0AL 1JJUA 1S7XA 4KZDH 4OZIF 2AV1B 2ED9A 4YBQC 2QKIA 5BOZG 5HHOD 5FYLD 2WBJA 4F7PB 4P4RB 4X6FA 1A4JA 3MV8A 2XTJC 5ITFA 4Z76A 2VZSA 2YOCA 4U6VH 2H6PA 4HLZH 3FQRB 1FNEB 3ZYOA 4N0FA 1MWAA 1XGQB 4X99A 3BW9A 4LKCB 1HYSC 2GT9A 3P11H 2BRRH 2EIBA 2O5XL 1N3NB 2BP3A 3QPQD 4BSWB 1S5HB 3ULVF 4L4TE 3MA7B 3JTTB 4KK8D 4MS8C 3WFBL 1XF3A 1X4ZA 3KYNB 4P57A 2H32H 4HIXH 1N64L 1X5HA 5GS3A 3CZJA 3LQZB 4RGOL 4DGVH 3TWCL 1NFKA 5JOPE 5C0CD 4LCWA 3NZ8A 4QT5A 4BH7B 4Q6IC 2CDEB 1LEKA 1YEFL 3HLAA 3MV9B 5FK9A 3RWCA 4Z0XA 4HJ0D 3RNKA 1NJ9A 1KSRA 4WFGE 1T83C 3VD7A 3MJ9A 3MC0A 6FABL 3QWOB 2KZ1B 2XKUA 3ZDXE 3CXDH 5FUZH 1WFOA 2EDWA 1U92B 4RIRB 4UT9H 3TBTA 3V4VL 4XNZB 4GAFB 4OD3H 4ZTOL 4L4TD 4LARH 3FONB 4OF0A 4NQDD 1A6UL 4ORZC 5E1AA 4OZFH 4TVPL 3NVQA 2JIXB 5CZVL 1K8DB 3D0LB 4HIJB 3ZT6A 4R90H 2OXGA 1F6FB 4HIHB 1OGAB 5D1XB 4J3TA 3RY6C 3V5HB 1PDKA 4YFLF 3QUMH 4EVNA 4JKWA 3QQ4A 1KJMA 4PRPE 3P4MB 3T77A 1JFQH 1UM6H 5I66B 5I1HL 5C07B 4U1MB 4OI7A 5F9OL 4PR5B 2Y5TA 3H9SB 4Y4KD 2NY6C 4KK6D 3QFDA 1F4WH 2VDQH 4MA7L 2E9BA 3TT1H 1QLEH 2FJHA 1RHHA 3LZFH 1Q0YH 2DQUH 2YXMA 1UVQA 5TFSH 4P9HL 1JZ4A 4WO4B 2X9WA 1TVBA 2BZDA 4PREA 3WO4C 1UCBL 1M4KA 5I16A 4KROB 1KXQE 3BEWA 5B8CC 1X5KA 4PJAB 4AJ0A 5IEKA 4PS4H 1FPTL 3T0BA 4NM8L 2FZ3A 1VCAA 3ETBF 1LMKA 5CJ5A 3RTQC 3T65B 2Z31A 1TENA 1YYML 2ENSA 4PGZA 3P30L 3M17A 4C56B 2WUBH 4O2FA 5J06A 2X70B 4OI9A 4Q2ZA 5TGBA 3KPOB 1I9JH 4GXUN 1NBZB 5GS0H 1QR1B 5T5FL 4UV4H 3IU3A 1E28B 3QI9A 4Z7OF 1CBVL 1Q0XL 4P2QB 4WFFD 1RIHL 4TUOA 5EUOA 2A1WL 4NM4L 5FFLA 4A2MA 4L8DA 3BFOA 1BFSA 4JO2H 5BXFA 1CYGA 3U4AA 4HV8B 4OSUL 1KXVC 4TSCH 4PLOB 4MXQD 3L3GB 5C08E 1XF2B 3I50L 3N85L 3INUH 1ZA3B 4Z5RB 1I8MB 3SKJL 3VW3H 1OWWA 4OGXH 3WIHA 3SKMA 4P3CH 2R0LH 5CLTA 1FNAA 5DMIL 3AUVA 5GISL 4G7VL 3DX7B 2D0FA 5IFJB 4GKNB 2ZCLH 2OQJB 2L7UA 3DVIA 4IHOA 2NYYD 2P5WD 5FYLH 4BKLB 4OQTH 4H1LA 4GG8A 4JN2B 3T2OA 2Z91B 3CXHJ 3GIVA 4M43L 5K9QG 2F53B 3SDAA 3HUJA 5MEOA 5ADOL 3L7FB 5FF6B 3AROA 2Z9TA 4NN7B 4TVSa 3RX8A 3P77B 2XZAL 4GKZB 4HFWB 1MQKL 4PRDA 3MRRB 5FHAL 5E00B 3QXAB 3SKOB 3LN4B 1UZ8A 2AEQH 2J88H 4UT6L 3PIQB 1ZLVK 1KNOA 1MCDA 1V3JA 1H15B 2OI9C 4HWBH 1S7SA 4NPYB 3UZEA 3MUY1 5D7JA 1F3DH 4WWKC 2LE9A 3EYFB 4JANA 5D7LA 2UV3A 1N26A 1AXTL 5FOBB 3SDXF 4YO0A 1VGEL 2JTDA 3QDMB 4EDXA 4UAOB 5KZCD 1IC7H 3UZQA 3KPSD 4LSQL 1ZA6B 1ETZB 2XWTA 1FFPA 3OZ9L 1YA5A 1NEZB 2R56H 2FX8L 5DEFA 3C5SA 3HE7C 3FB6B 3D3VA 1BQLH 4M1CC 1EFXB 4P2RD 3UJTL 4JY5H 4MA8H 2R0KL 3BZDA 4FA8A 1JZ2A 3Q5YA 4PJ9A 4LSVL 2IQAA 35C8H 1S9VB 1SJVA 3MRKB 1TTFA 2NX5B 1WIOA 3V0VB 3NA9H 3TBSA 1F6AB 3MV7E 5IFHL 3F5WA 2EIEA 5IVXA 1NDMA 4P2OC 3K74B 1UJTA 4TNWK 3MBED 2DTML 5IB4A 5J56B 1RZJL 4UMGA 1F4XL 3L7EA 4J3WA 4P5TA 2P45B 2COQA 2CD0A 5GS0C 4XX1E 5DO2C 5T1LA 5CS7A 2WLZA 2C4XA 3VXRB 3TZVC 3VMNA 3KHOA 3REWA 4JO3H 1FL5B 3V79C 4P3DB 1T0NB 1D5ZA 1HINL 5CUSL 3B2VH 2X05A 3PWNA 1U3YA 1F8TH 1KN2H 4EUPH 1IM3B 4YR6A 1LEIA 5GS1C 5D7IF 4OM0L 4E5XB 2WIIA 2Q1EA 2GW5A 2RFXA 3QEUB 4LASL 5BRZE 1HIMH 3AMKA 4NCC2 4PY8J 3QZWA 3MRHA 4RCAA 3SY0B 1TZIA 5IMKA 4KJYB 2A77L 5IJKC 4X7TA 1YEIH 4GQ9L 3SO3B 5L88L 1S7TA 3S7GA 3OR7A 3PL6A 4NNYA 4LEXL 5CKGA 3PWPE 4ZDHB 3UBXG 3IFNH 3VXSB 4PJGB 1TVDA 1N2RB 4ZXBC 4NKOA 4U2YA 1BZ7A 3ZTNL 2Q87A 1Q9LA 5L9DL 4OCMC 3THML 4I5BA 1F13A 2DJ4A 4AEIL 1RUKH 1SMAA 1L0YA 4LSRH 4PJHA 1TCMA 2LFGA 3O2DA 4D3CL 4P2CG 3SBWC 1C5CL 4WI7A 1UWGH 2DQEH 4XCCL 4F7EA 5CJOH 3JVGC 3DXAB 1QZ1A 1QEWB 4R2GD 2EYTB 1AQDB 4WCYH 3ARZA 1NUDA 2XNAB 4U7KA 4G8GB 2DI8A 5IF0A 5HI3D 3I6KB 4P46A 5D7SH 3NPSB 3ZDZE 5FKAA 3MUGB 3O4OB 2NZ9D 3I9GL 2QTEA 3ARBB 1QLFB 3DX6A 3RWIB 1I9RL 4GBXC 3F7RA 4RRPA 2G60H 3TLRA 3JV5A 3FKUS 3KXFB 1T1ZA 3QRGL 5CINH 4EOWH 4KRMB 2CRIA 2VTFA 5I1IH 2Z93B 4PRIE 5D1QD 4NRZA 3QCTL 3Q48A 3O6LL 4O02H 3ARVA 4TSAH 1NAKH 2ZWLT 4H0IA 4MDJA 4NO5A 3GI9H 5FV2A 4LLVA 3ZKMD 1IFHL 2CIIA 1YNTA 4F9LC 2VXSH 2AW2A 1T04A 1LK2A 3QHZH 4XH2A 1PAMA 1A3LL 5BZWB 4WW2A 4KZDL 2CUMA 2J8OA 4U0QB 3QIWC 4ONHB 4K8RL 4ELME 4GAJL 5FO8A 5CEYA 3R4DA 1KPUA 4PD4K 5DK0A 5HGDA 1W0VA 3DPBA 1JTOA 1MUJA 1JGLL 3RL2B 3RVXD 1GOFA 1X44A 1DDHB 4DVBA 1Z9OA 4U6VL 4X6BB 2V9RA 5KSAC 4GW1A 4ZPVA 4GMSH 1WTLA 3QUZD 2YEZA 5I6XC 2BRRL 5DGQA 5BJTB 3C5ZD 1RJZB 3O3UN 1NBVL 4JM2F 3MCKA 3IS0X 4FTVE 3ZKQD 4UIMA 1QYGL 4ODWA 3EDDA 3OG4B 3EHBC 3MZGB 4RFNC 1KIPB 3KDMA 4F7TA 2DMCA 4RAUA 1KIUA 4M7JH 1QNZL 2O5ZH 4RAHA 4ZPTB 1FVCA 4PG9B 4Z0BL 2PO6C 5AAWA 3CGTA 4FXGB 4DGVL 3SHSA 2YC1B 1LO2H 1NFIA 2IPKB 3IT8D 4PFEA 4BUGA 1VFBA 1AQKL 1ONQB 4D9RD 5MP6H 3HAEG 2QADD 4IRSB 1QA9B 3ZL4H 1XCQB 4YAQB 2H9GA 5C6TL 4NQCB 4QXTB 5IW1A 1XGPA 1ACZA 1W8NA 5IIEB 5FUZL 5ERWA 4UT9L 3V52L 1ZGLB 4OD3L 1T5WB 1OLLA 4LARL 2UYLA 4AH2A 4Z7VF 3WE6A 2J2ZA 1B4RA 4OV5B 5K59E 3KYOA 1X4XA 1I3GL 4HWEH 1JK8B 3U30C 3BEVA 4JCMA 3BIAX 5HGBB 4L5FH 3MMEB 1B0WA 3GUTB 4R90L 4P59H 2EC9U 5KSUB 4IMKA 4P5MA 4XVSH 3PHOA 1JYVA 2HFFA 3QUML 4HS6A 4ZD3H 4KRLB 4OZHA 4NBZB 3L5WA 4N0UA 5IVZA 43CAA 1JFQL 1UM6L 5FGBC 2EE6A 1BM3L 5IROC 1R24B 1RZ8B 4LGRB 2JCCB 1MRDH 1U2HA 5SWSE 4BSVB 5L7XH 4XVTH 4EN3A 5FM5M 2P44B 2VDQL 2A9NH 3TT1L 5TDPA 2Z8WC 5HPOA 3LZFL 1Q0YL 2DQUL 5TFSL 1I8LA 3BD5A 4CMMA 1I4FA 4HK0A 4QGTA 1JN6A 4Y16D 4K71C 1BMGA 3OWEA 3KPRA 3RWEA 1DQDH 1BECA 5JA9A 1ORQB 4OGYH 4PS4L 4IOIB 3EYUH 5I73B 4J4PA 1S7XB 3EYOA 2P49B 4XMKL 1MVUB 2EIZB 2QKIB 4V3EB 1JWMA 5I71B 4EUPG 4X6FB 2WUBL 3LKOB 3MV8B 3V6FB 2J5LC 4L4VA 4RFOL 5ITFB 4Z76B 1I9JL 2H6PB 4MAYB 2NY3C 4LMQI 4N0FB 5F96H 1HQRA 5GGSA 2GT9B 4BQBA 4NQSA 2WNGA 4JPVH 4JQXC 3C6LB 4JFFD 1GGIL 5DJYA 1KPRA 1YQVH 3G5YB 3MV9E 4POYA 5C8JB 3RDTB 2NY0B 4JO2L 3K1DA 4TSCL 4QRRE 5GRUH 2ZG2A 2BHUA 4HC1A 3INUL 5J13C 4OGXL 4YHZH 5ACZA 5HPMA 4LCWB 4UTAH 1PG7X 3SCMA 1LEKB 4U05A 3HLAB 3FZUC 4UQ3B 5FYLL 1GZPA 4XP1H 2ERJB 5DD5H 1GGYA 4Z0XB 3PP3K 2R2HB 3RNKB 1NJ9B 3GMQA 1FG2A 1FG9C 3EFFA 1XIWB 4NWUL 3VXQA 4XC3H 2D7TH 3FJTA 1OGAE 3X17A 4XNYH 3MGOA 3S35X 4GW5A 3QXTA 2AKRB 2J88L 1HH6A 3VRLF 4MX7A 4BELD 5E1AB 4HWBL 4Z78B 1K6QH 5C07E 1GOGA 2V2XA 1JNNH 4JFQA 1R3KA 5LKNA 4EIZC 1IGTA 3G6AA 1TPXC 1IM9D 4NGHH 4G9FB 5CGYD 4X9BA 5IK3A 4EVNB 4Z7QE 4GS7C 1R3IL 3VFUA 2R56L 4CAGA 3WIFA 4RA0C 3FQWA 4G8IB 5L2JA 1SJXA 4PJAE 2JIXD 1BQLL 1AD0B 3QFDB 4JG0H 4MA8L 1HDMA 2FJHB 3MOBL 1RZFL 1UVQB 1TVHB 3EJZD 1T7VA 5D1XD 3NIFF 4N9GA 2K3TA 4C56E 35C8L 4PREB 3V95A 4MVBD 4ZTPH 5TDOB 4Q58C 1TLKA 5I8OH 2CLZA 3UX9B 5I16B 1WEJL 1FH5L 3ARFA 5IEKB 5C9JB 1IAOA 1YEEH 3H9SD 1I3UA 2DLIA 3OX8A 1FVEA 3IDUA 5EB9A 4P2QE 2Z92A 5H35B 3T0EB 2DI7A 4PJBE 2FHFA 3M17B 3PQYD 4DCQA 2VDML 1V7NH 4Q2ZB 5TGBB 4FQQA 3EO9H 4R26H 2H2PC 4F57H 1S78D 2IAMA 4KROD 1HKFA 2NR6C 4WI9A 4YHNB 3MLYH 2CO6B 3B2VL 3IU3B 3QI9B 4TTDD 4JZNA 4ZSOA 1F8TL 1KN2L 5JDJA 4TUOB 5EUOB 3O3DB 5JA8B 4NBYB 2Y36H 1GSMA 3CX2A 4L8DB 5BXFB 1WC7A 3GBMH 2XA3A 3ZKND 5FYJD 3L3KA 2F53E 4RGND 2Q76B 3VDAA 3NZHH 4TUJA 5D6DC 2J8HA 4PB0H 1NC2B 4ELKB 1YEIL 5E2WH 1CQKA 3JTSB 3QXVA 1KCLA 3RUGA 5TQ2L 5C0AA 1F2XK 3LKRB 1MFDL 4P2QD 3RGVA 2Y6SC 1K8IA 3I75B 4RAVA 4Y8AA 1HEZB 2E7CA 1QBML 2DDQH 3GIVB 3GMRA 4Y5VA 3SDAB 2APVA 1U95B 2DBLH 1TZGL 2EKJA 4HIIA 3RVTC 3CVHB 1WWAX 4JRYE 5MEOB 3X14A 5HSFA 2GY5A 1RUKL 4NOBA 3ESUF 1MIEH 5HHPA 5D7KE 4LSRL 4G80A 3QDME 4PYHA 3CLFH 4GUPB 2N7AA 5D1ZA 1DBKH 3I85A 3QXDA 2GFBA 5KSBF 2CH8A 1UWGL 3DHJA 3HC4H 3O3BA 2V9TA 5CJOL 1KNOB 2YPKB 3CLEH 2GUOB 3ARDD 5J1TC 3PWJA 4XCEA 5D7JB 1YC8A 5E2JA 1E6OL 4AEEA 3O6KH 4N5UA 4NFDA 4YO0B 5J1SC 5LGJB 1T2XA 1O7VA 2NY4C 5DWUL 3RKDC 1HHKA 5D7SL 3O45B 4PJ8C 3P0YH 3ZE0E 3SGDI 2XWTB 1FN4A 3X11A 5E8PA 4MMXC 5DEFB 2V5SA 4NKDB 3C5SB 4AIZB 1IE5A 4LRIC 5F71A 2G60L 2B1AH 32C2B 1GGBH 3HZKB 4F2MB 2GK2A 5L2KD 1C5BH 3E2HC 1OARH 4PJ9B 4YDVA 1AR1D 5I1IL 1AXIB 1CICB 3DX9A 2IQAB 3VI3E 1UH3A 2MJWA 3VXRE 4BFBD 4O02L 4TSAL 3C09B 1EDQA 1NAKL 3GI9L 4Y4FA 1UZ6F 3BRFA 1P7HL 2J3SA 5IVXB 1NDMB 3MREB 5IWLC 2Q8BH 4JZOA 3E8UH 4JPKH 1NGQL 2VXSL 1R3LB 4MLIA 5EFIB 4DUXA 5EO9B 4HLJA 4GAYB 5E9DB 3S9DB 3QHZL 3L7EB 4P5TB 5DFVD 1PG7H 5GSRA 1F4AA 1M71A 5T1LB 3MUHL 1JZ8A 3W81A 2BY3A 3QUXA 4DGYH 1TZHA 5J6HA 1WZKA 1VEOA 4WI3A 2NX5D 1QSFA 4X7SH 2K9UA 4LSSH 3SDDA 5IMLB 4D0BB 3PWNB 4GMSL 4YLQT 4Z7WA 4OZ4A 4XVJL 4OIAA 4M8VA 4FQIH 2WIIB 2XN9A 3VXSE 1NAML 3S35H 4PJGE 4W68A 2FIKA 4OF6A 5JW4N 1AD9A 3QZWB 2OZ4A 3ECBB 4K9EH 4ZUVA 1CT8B 5EOCH 3MRHB 3TF7A 3FO9A 3KHQA 4FABH 3OG6B 4Q6YA 2BVPB 5KOMC 1OP3K 5HI5C 3WKML 3RGHA 4M7JL 2O5ZL 4X7TB 4J3XA 1U8QB 2XKNA 2WBKA 4MNQA 3DMMD 4MAUH 1K2DA 1S7TB 3TBWA 5KN5B 5KJRH 3PP3H 2YA2A 5E5MB 3PGFH 3QDAA 5F7WC 1I1CA 4ETQA 4Y19A 5DMJB 4R7DB 2NTFA 2CLVA 5B4MC 3K4AA 2P46B 4K94H 4I5BB 4U6HA 4JEGB 4KK9C 3RU8H 3WFHB 4G8GE 1X5GA 3GO1L 3ZL4L 5F7YC 3G08A 3BHBA 1KV3A 4QRQB 4MXWL 5BZDA 1JPSH 3TJEH 2IANB 1Q9OB 4YC2B 5F89A 1OF2B 4AIXA 1DFBH 3QNYB 1YN7A 5GGTH 2VDRH 1I7UA 5FYJH 5JW5A 1JYNA 2VXUH 3O41B 1UKQA 2M1KA 2Z8SA 3CX5K 5CD5D 5SWZA 2H26B 2V2TB 1AGEA 3KXFE 3BPOB 2CKBA 4M3KB 5E7BA 5IF0B 4ISVA 5A2LH 2D0GA 4K2UH 4P59L 2EO9A 2B0SH 1G0YR 1TTUA 4OCNC 4XVSL 2DLGA 5HHVH 2PW1B 2PXYA 4ODUA 3HNSH 3ME0A 3DXAD 4WHTB 4ZD3L 2VDNH 1P84J 2EYSA 1OSPH 4HSQA 1G9NH 2A6JA 4OIBA 2WK2A 3BYTA 4C4KO 3TESA 1T1ZB 1CQYA 1J05A 5L7XL 2WWKO 4XVTL 5CZKA 3EJYD 3WMSA 3ZT7A 4ZYKA 5GZNC 4IOFC 4NO5B 5KVEH 5JXEA 1W2KT 1DBJH 3S4SG 3VU2A 3VXMA 4F58L 3RZCB 4XNZC 2CIIB 1C16B 2AAVA 2DQIH 3O8XD 1HZHH 1T04B 4PRAA 3EYUL 3DYPA 1A0QH 4WWKD 4WW2B 4ZUSB 1DEDA 2CSPA 3TN0D 4J3SA 2E8ZA 4NDMB 4FQCH 2A83A 2C3XA 3CIQA 1KPUB 5DK0B 1DQLH 4JQVC 3EZ8A 4NP4H 2DWEA 5TDNA 4DVBB 3SGJC 1HQ4B 4BFEA 1HHJB 4GW1B 3CFBB 4ZPVB 3MUZ1 4K9EC 4KKCC 1A02N 3KPQA 5F96L 2ORBH 3GSRA 1FSKB 3TCLB 1J88A 4ODVH 4JPVL 3MCKB 2FNBA 3S88H 3KDMB 3E3QC 1MHCA 2NMSA 4RAUB 3BMWA 3QNXB 5FIEA 1NBYA 5M95B 3TEUA 1FVCB 4WO4C 4OD1L 3SDCB 5CEXB 1YPZA 4NQCE 3MPCA 3IDIB 5DSCA 4K94C 2AXGA 2P24A 3HC0A 3BGAA 3LSOA 1NANI 4U1JA 4D0CA 1BHGA 4UTAL 1QQDB 1VFBB 1AKJA 5DRXB 4XP1L 5DD5L 4OV6F 1MI5A 4JFPB 2VDPH 3QHFH 3T09A 5JDSB 3VI4F 2OXHA 2W0LA 7CGTA 1J18A 4MJIA 5IW1B 3WSQH 4XC3L 3MLPA 3L5XL 1XGRA 2D7TL 2W65A 4HUXB 5ERWB 4OF5A 2ZG3A 1D5IL 3F62A 1X5FA 3RHWK 1OTTC 1LHZA 2W0PA 3VFSA 5DMGC 2UYLB 4PRHB 3WE6B 1ZSDA 3MCLL 1BIIB 4LLMA 5J1AB 4IRSD 3KYOB 4WNQB 2JCCE 5E08H 1JNNL 3VDBA 1S9XB 5E03A 4NGHL 4M02A 3CC5A 5I30L 2BNRB 1RULH 1IAII 1G9NC 1U9KA 2D9QB 3VWKC 1KENH 5IOPA 1MF2H 4N0CD 3DYOA 2X40A 4OZHB 3U0TA 1B2WH 1OP5K 3L5WB 43CAB 4HGWB 4WI8A 5T1DH 2VDKH 4ZXBD 5C1MB 2HJFA 1MFEH 4I48A 2YD2A 4O58H 1MCRA 3OR6A 2Z8RA 4PG2A 3NCMA 5CKAA 4Y2OA 2YD6A 4DKFH 3FCTA 3U9UB 1OAZH 2XZQL 4NN7C 1I4FB 4HK0B 2R2BA 3MLVH 4RMTA 4RFEA 3EOBB 1YMMA 3MV8E 3QSKB 4ZTPL 1DE4A 4YHKH 43C9A 3E1F1 3ZMRA 3KPRB 2VUOA 3MRLB 3RWEB 1VERA 1AI1L 2W9EL 1LDPH 4WVRA 1MLCA 1KFAH 4XXCA 3IXTB 4YBLC 5J57B 3KPLA 4LLUA 1WICA 1T7XA 4UAOC 1NGZA 4D94A 4UDUA 4L4VB 1V7NL 1E4WH 4OTXH 3EO9L 3K2MC 4R26L 1JWUA 1J1PL 4MXVE 1HHGA 2VSCA 2H8PA 1HQRB 2XFXB 3JWNC 5GGSB 3RX5A 1F58H 3U79A 3KS0H 4GBXD 3VGAB 4LCWE 1OP3H 4W4NA 1DJSA 1X5YA 4YDLB 3ARWA 1KPRB 4YHMH 4QOKD 1BQHB 2Y36L 4WV1A 3FTGB 4WI5A 5C09A 3NPZB 5DFWH 2XACC 1F90H 1EO8H 3GJEA 4PB0L 2DICA 4HGMA 4U2ZA 5DRZA 1D5MA 1FCGA 5E2WL 1U93A 3IAQA 5BVJB 4DW2H 5ACZB 5HPMB 4QHMB 3SE4A 1G7JA 3C8HA 1JGDB 3SDXA 3RDTD 5DK3A 1J9CT 2DDQL 1OTUD 2CMRH 1CXLA 1FG2B 5AG9A 2DBLL 3EFFB 4OQ1A 3ZSTA 1FV1B 4ZO7A 4AQ1B 2QR0B 3HRZA 4E41A 4J6RH 4YXLH 5GQBA 4G9FE 3CLFL 3FFDA 4GRMB 3P4OB 3MGOB 5CHNA 3HZYA 3H2WA 3CCHA 5HDBE 3HC4L 3CLEL 1KB5B 4OCXH 1D9KC 2NXYB 1I9EA 3DRQB 3VWJD 4EQ3A 2V2XB 4XB8A 1Q1JH 1R3KB 3O6KL 5CGTA 3IRZA 3C8DA 2XIDA 3BP4B 3ARRA 3QEQA 3VDCA 3AREA 2PO6D 2ADIA 4ZAKC 5IK3B 3SO3C 3N9GL 3P0YL 1ITCA 2MNUA 3VFUB 1IZKA 1I1YB 4IRJB 3FQWB 5L2JB 4RNRA 4HK3J 5HGHA 1HNGA 1HDMB 4HFUH 3KR3L 3T2NH 1C5BL 1OAXH 5EDXA 1NMBH 1OARL 3KPTA 1UT9A 5D2LB 3W9EA 5I74B 3VFPA 4Y4HA 3U4EB 3F7YB 3CSYA 4PJ7F 1A6VL 3GSWB 3E8UL 4NUJB 4M7LH 3MRDA 3OX8B 1FVEB 5I9QB 1PG7L 5EUOE 1A9EB 4ZS6D 1EFQA 5ESQA 4NO0A 4PJCA 3V7MA 5IHUH 1MJJA 4GFTB 4DGYL 5BS0B 4FQQB 3VGFA 3NPSC 1ZTXH 4X7SL 4RDQG 2IAMB 3BQUB 1GPOH 3ARBC 1T21A 1JHTA 4MA3B 4JZNB 4ZSOB 5F44A 2VE6A 1SEBA 2QV2A 5GS2D 3VXUA 1LO4L 4FQIL 2XPGB 3QB7C 1T4KB 2YWZA 2JJUA 5A2FA 3T0ED 3S35L 5AG8A 2F54D 3HI1A 3NH7H 2DLFH 4NQED 1E27A 5EOCL 1F00I 3SO5A 4ZFFA 4TUJB 2W9DH 3QUYB 4FABL 1MPAH 4HKJA 4WENB 1W0WB 2BFVH 2EEDA 4OZGB 1WBZA 3UYRL 3JWOL 3J7HA 1FNGB 5DHVB 4Q6IA 3WNLA 4X98A 3X3GH 1RZKH 3RUGB 3JSSA 5KJRL 1UH2A 2WAHA 1QHOA 3RGVB 1JE6A 1FIEA 1JPFA 4CW1A 1K8IB 4AT6A 5C0DA 2PUQT 4RAVB 4AZ8A 2HMIC 1ZT7A 5L0QC 4WU5A 5JOEA 4Y5VB 1FZJA 1BD2A 4K94L 4WFED 3X14B 1NC2D 2VLLB 5D7LE 3L3IA 2PYED 1VHPA 2ZPKH 5HHPB 2VH5L 5LGKA 1CF8L 1Y0LA 1DR9A 4G80B 1JPSL 3TJEL 2NY3D 3O4LD 3EIFA 2ICWI 1CK0H 1T80A 3DV4A 1CGVA 5EC1B 3HNVH 1EJOL 4P5KA 3O3BB 4YH6A 4CVXB 4FQXA 5FYJL 4HUNB 3PWJB 3Q6FB 1UCTA 3FOMA 5I1DA 5EZJA 3ULUC 4HS3A 1U8LA 2W91A 5FHBL 1JMZA 4PRNA 5IQ9A 5I19H 1OP5H 4Z95H 3UTQB 3W0WB 3LCYA 3MJGX 1HHKB 4KY1L 1AGDA 2QQLH 1UADC 2B0SL 4ZOAA 3A6CH 1KG0B 2ESVA 3KYKH 4JPWH 3QISA 1JV5B 3X11B 1I8KA 5E8PB 1LP9B 1RSFA 3K8LA 2R23A 2B4CC 2VDNL 3BD4A 5JORA 3B9KB 3FZUD 5IVXE 1U8MB 1OSPL 3GNMH 4JFEB 4OM1H 4LIQE 4X7FC 2A6DA 1A21A 4FQHA 5E2UH 4YDVB 1WAAF 4PGDB 5JO5A 4JRXD 3DX9B 2C4FT 2WANA 1VENA 4KHXH 5E94A 1ES0A 5KVEL 1Z0NA 5JHDB 4PP1D 5EZLA 1DBJL 2Y7QA 4KKBD 4ZO9A 1YMHB 3U9PH 5IEHA 4JZOB 4R0LC 5D9SA 2DQIL 5F9WB 4POUB 1JNLH 5CFHA 1ZV5A 3OJMB 4GOSA 5GSRB 4IMLA 1A0QL 1M71B 5HXMA 4FZEL 1TZHB 5J6HB 4JZJA 3IDXH 1QRNB 1UQSA 5KG9B 5FM4A 1DQLL 4NP4L 4Z77A 2EDJA 4B5EA 3FHQA 3K3QA 1JNHA 2H45A 2R39A 4Z7WB 3CSBA 1MREL 4LPCA 5E9DD 2ORBL 4Y8DC 2O93L 2FGZA 2NY1C 4ZUVB 3F7VA 1MCPH 3WUWA 3TO2A 4DGIH 1RZKC 4HMDA 4S2SB 2D7PA 4YGVA 4PJ5A 3TPUB 4APQD 1VFMA 1BOYA 4ONFH 5DMYA 2QHRH 3UDWC 1S9KC 2F58H 1DANT 2V7HB 3QRFM 3PGDA 1DCLA 4Y19B 3UTPD 2NTFB 2CLVB 4M9PA 3UTTD 4U6HB 4XVUD 2EE9A 3QHTC 2VDPL 3QHFL 4PJEB 5EU5A 5B38G 2WBJC 5I71C 1EIBA 1WT5A 5BZDB 1G6VK 3FRUA 1HHIA 4KK5D 3LHPL 2NNAA 3WSQL 4NWTH 2A6KB 3MGTB 4MAYC 2NR6D 4M7ZB 3KPMA 1FNFA 4W70A 3KLSA 1I7UB 5JW5B 2DJUA 1D6EA 5FOJA 5I2IB 2VL5B 1R5IB 2UWEB 1OOAA 4F33A 3GGWA 5SWZB 5E08L 2NY0C 2B5IB 3BWAA 2IAND 4OCYH 1MAJA 4LLQA 3B9EA 3NIGF 1WFNA 1NGWB 4KMTL 4WJ5A 2CIKA 4PGEA 2PXYB 5AYQA 3MNWB 1MF2L 4ODUB 3H9ZA 4BZ1H 2E5EA 3MRJA 4OZIB 2YPLA 2EYSB 5T1DL 3WIHH 2VDKL 2A6JB 2FIRT 4OLUH 1A2YB 4FFZH 1J05B 3KPNA 3AAZA 5IB1A 3BJ91 3F58H 1A7NL 4ZYKB 3VH8B 1AJ7H 1KJ2L 2GAZB 2VLKD 3IJHA 5CSBA 4DKFL 1F6LL 1EV2E 1OAZL 5DQDH 2J12B 3X13A 5DJXB 1OM3L 1CD0A 3MLVL 3K4ZA 3O3AA 3RWDA 4HMCA 3STZB 2Q8AH 3CVHH 5I1EH 1F3JA 1I85A 4MMZC 2HKHH 3PJSA 2BNQD 1X3DA 2P8LA 3WS6A 1LDPL 4LCCA 1KFAL 4NQXA 5J3HD 3RWGB 5IBLD 5BQ7A 4R9HA 2A83B 3VJ6A 4XHJC 4PJ8D 5JW4M 5TDNB 3RZCD 4OTXL 4M1GH 4JFDA 1MCNA 3V6OE 1EAPB 3KPQB 1YN6B 3GSRB 3LEXB 3LPGA 1F58L 3D2UD 4CVZB 5I15H 4EDWH 2Y72A 1N5YH 2V9QA 3Q3GA 4TQEH 3AM8A 4YHML 3MRQA 2YWYA 1TMCA 5HHOA 1MHCB 1B3JA 1P6FA 5D72H 2V5YA 3T2PA 4LVOB 3EOTL 5IT2H 2VWEE 1EO8L 1LDSA 5EORH 3CXHK 4Y2DD 1TTGA 3HC0B 4U1JB 3BN9D 1UH4A 4DK3A 4YHOL 3FO2A 4PRHE 1MI5B 25C8H 3IDYB 2Z31C 1O5DT 4HWBA 1BPVA 5JPNA 3D85D 2W9LA 3EFDH 1MRFH 3NCYP 1NLDH 5ALCL 2DS4A 1XGRB 2C1OA 2ARJA 5C0CA 2VZ1A 4NQTA 5FECA 1JGVH 1SYVA 3QI9C 3OSKA 4B41A 4JDVA 3VFSB 4OZHE 2X9YA 2KQMA 1ZSDB 4YE4H 4LLMB 4LP4A 4KDVA 4QRTA 5K9KB 3EYSH 2WINA 2VLJD 4KRPB 3DVGB 2YR3A 5HI5D 3ELAT 4UQ2A 3DROA 3CC5B 2VDOL 5GRXG 4PGCB 4L4TA 5JR1L 3FFCB 3LS4H 2EDKA 2FJGB 3QCUH 3U0TB 3G5XA 2XRAH 4MJ6A 1VEMA 2CRZA 2R9HD 3KPRE 2IMMA 3BGFB 3SDAC 3HPLA 5LWYH 4QHLB 4HFUL 4MDIA 1FC1A 3FCTB 5JZ7D 3G5ZA 1OAXL 1NMBL 4ZQKA 2BNRD 3TCXA 1PZ5A 5DTFB 3O3EB 4W4OA 5EWIL 4U1KA 1VFOA 1DE4B 4L4VE 4U6YA 3UXFA 3F65A 1X6LA 4GQPH 4Y4KA 3O2DH 1MLCB 5D7JC 2D7NA 1S8DA 2QQKL 4LLUB 3IFOA 3P2TA 5I8CA 4C55A 5IHUL 3DI3B 3GSOA 1FIGL 1NGZB 3LIZL 4PJXF 3QDJD 4UDUB 4E9LA 2DLTA 3GK8H 4M6OL 1S3KH 4M48L 4AYFA 4HW6A 1TETH 4ODTH 1H0DA 3WN5B 3L3HA 4TRPL 1N8ZB 2H8PB 1Y6KR 2LU3A 5DJ0A 1ZVHA 5IQ7H 4F80A 4M9OA 3BZEA 5CJ8A 5EA0H 4M4RA 1A7PH 2DQTH 3X3FH 3UPRA 2PYFB 2R2EA 3G9VA 2DLFL 4PJ9C 1HH9A 1M05A 5GZND 2AK1H 5F1NB 1MPAL 2HJLB 3GJEB 2BFVL 3OPZL 2CRYA 5A3IC 1U58A 3B9AA 1A1MA 2MKLC 3CMGA 3QNZA 4OCSL 3X3GL 3MJ7A 1KPVA 4LGSB 1BF2A 3LKPA 1RVFH 2AJSH 2C3VA 1I1FA 1XT5A 4XWOC 3SDXB 4P5TC 5HYSG 3CJJA 1A6PA 2AEWA 2VR9A 2C3GA 3RX7A 3S5LA 4LKXB 2ZPKL 4E41B 5CEZE 4BFGA 3MO1A 3LEYH 4XP6H 1PJ9A 4QNPE 4MA1B 4YZFF 4KJQC 5CHNB 3FOLA 3HZYB 4MSWA 1CK0L 2P5WA 3CCHB 3NN8B 3EDKA 3HNVL 2OMBA 4BJLA 4XC1H 2ZKHH 4N8VA 1ZHNB 4RMRA 1NUNB 1WBYB 2X1PA 4I4WA 3BZFA 5J6GA 5L8JB 5KVMC 3D0VB 3UYOD 5HHQB 2NY2C 5F7FA 2AXFA 3BPCA 1ZT1A 5I19L 4U1LA 4Z95L 3GMMB 5AD0B 5ENWA 4HQQH 3LRGA 1FAIH 4N0YH 2X2YA 4BH8A 4O51A 3V0WL 1AGCA 3KYKL 3S36X 3B6SA 4JPWL 1T1WA 4HKZB 5D2LE 3PL6C 2YSSB 4ODHH 4AMKH 1S7RA 3TIEB 5FDWA 4H1LG 4RNRB 5C08A 4XGZA 2HN7B 2AV7A 3FHAA 2V17L 3GNML 3SPVA 4PJFA 4OM1L 3P9MB 3PXJA 4ZUTA 1BEYH 4QF1A 4U31A 2NXZB 1FZMB 5E2UL 4PV8A 4PP8C 5CMAB 1MNUH 1NMCB 5BS0E 5T3XD 1EHLH 4KHXL 5D7IB 3SE9L 4R4FH 4OLWL 1IGYB 1RJLA 3LB6C 1FL3A 1FFOB 1PQZB 3U9PL 5EBGA 3VCLB 4JKLA 4MB4A 3SDYH 4ZSOE 4GT7A 1G7LA 3QFJD 4NO0B 3BPOC 1E4XL 5GXBB 1NAMA 1MCCA 4P46C 3IDXL 4JFXA 4JY4A 3U2SA 4I18A 4HUWB 2Y1VA 3HB3C 5IW3A 1KCGC 2FWOB 3QYCA 5ITBL 4GKSB 1JHTB 2B7DT 2VYRE 4HUMB 4HXBH 3RUGE 4OFYD 3OJVC 4GLRI 2MCG1 1B88A 3VXUB 5B39G 1P4BH 2A6IB 2G75A 1E27B 1R6VA 4RX4A 2XOTA 2XQYG 4K3EL 4P23B 2VR5A 4MJ5A 1WBZB 2G5RA 4NT6A 4X9HA 4ONFL 3BQUD 4WHYG 4M8QB 2NLJA 4TNVF 2F58L 2ZJSH 1OTSC 3RWJA 4B7LA 1GC1C 2GTZA 3RWHA 1ND0A 2WWMC 4X5WB 1ZANL 1EJ6A 1H5BA 5BO1H 2JKXA 4CW1B 3BSZH 4AT6B 5ID0B 1M7DA 1U8NA 2MCPH 2APXA 3DYMA 4WHDA 2IPTH 4XB7A 1BD2B 4DZBA 2WIMA 4WW2C 2GCYA 3CFCH 2BJMH 3QUYD 5CZXC 2QQNH 3L3IB