1K5NA

Hla-b*2709 bound to nona-peptide m9
Total Genus 79
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
79
sequence length
276
structure length
276
Chain Sequence
GSHSMRYFHTSVSRPGRGEPRFITVGYVDDTLFVRFDSDAASPREEPRAPWIEQEGPEYWDRETQICKAKAQTDREDLRTLLRYYNQSEAGSHTLQNMYGCDVGPDGRLLRGYHQHAYDGKDYIALNEDLSSWTAADTAAQITQRKWEAARVAEQLRAYLEGECVEWLRRYLENGKETLQRADPPKTHVTHHPISDHEATLRCWALGFYPAEITLTWQRDGEDQTQDTELVETRPAGDRTFQKWAAVVVPSGEEQRYTCHVQHEGLPKPLTLRWEP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title HLA-B27 Subtypes Differentially Associated with Disease Exhibit Subtle Structural Alterations
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
molecule keywords major histocompatibility complex molecule HLA-B*2709
total genus 79
structure length 276
sequence length 276
ec nomenclature
pdb deposition date 2001-10-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00129 MHC_I Class I Histocompatibility antigen, domains alpha 1 and 2
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1k5nA02
3.30.500.10 Alpha Beta 2-Layer Sandwich Murine Class I Major Histocompatibility Complex, H2-DB; Chain A, domain 1 MHC class I-like antigen recognition-like 1k5nA01
4X0KB 1CXKA 1O7SA 1WZ1H 3NZ8A 1CXEA 5DEGA 5KZCD 4PLKD 1OTSC 3MRPA 1UVQB 1C12B 2XWTB 4WV1B 2I5YH 2VLKE 5TDOB 4ZO8A 2EDJA 5I71B 3G9AB 1Z5LA 4OV6F 5ICYA 2UZIH 4UUJB 3PXHA 3VA2C 2FR4A 3GJFA 5FO7A 1X6LA 3C6LC 2EYTB 3TBWA 4DUVA 3QO1B 4HD9A 1K2DA 4P57A 4R0LC 3H9SB 4JDZB 1OCWL 3EAKA 3SY0A 2JK5A 5IW1B 3EJZD 4FQQA 1BEYL 4X4ME 2DQHL 1X5KA 3G6AB 1A21A 4O51A 5FYJD 4OV5B 1JPFB 1R5VA 4CW1A 3B9EA 5D93C 1ZA3B 3MNWB 4K8RH 4XCCH 5DRNA 1DBKH 5MEOB 4XAWL 2DJ4A 4BUGA 2W0FA 1IMHC 3GSQA 4I18B 1CGUA 2OZ4L 2V2XB 3UTOA 4PJEE 4FQXB 2QSVA 1XF5A 2ZUWA 3WXVL 3QJHA 4E42A 3S96B 3GSNH 2PYEA 2RIKA 4KGJA 4P23B 5JIKA 1B2WH 4PJDA 1QA9B 4U1JA 4PY7A 1QSFA 4P3CH 5DMGD 4KDTA 2XPGB 4AG4H 4NQXB 2VDLL 1IAOA 1A14H 5HD8C 2JF1A 4EI6B 3OAYK 4D2NA 4JFFA 2XY2A 3THML 3QXWA 3GK8H 4GRMA 4LSSL 4OT1L 1MRCL 4O5LH 5GJTL 3IDIB 3I85A 3RZCA 4QLRA 5JA8B 2PW1B 2F53D 3CK0L 2NX5B 1BJ1J 3ARDD 1KJ3L 3RNKA 2PXYB 4DZBB 3GMRA 5HYJA 2VN7A 1QOKA 5D9SA 5GGUB 3RZCC 1DUZA 4M6AA 3TBYA 1IGMH 1CFTA 4MJID 4RMTA 5EC2B 1FHGA 1FO0A 3ZL4L 1RV6X 4XCFL 1H9VA 1X4YA 1IGIL 4NM8L 3QCTL 1QVOB 5EUOA 3BYTA 5T1DL 4XNUL 4OZFH 1OGAB 4HIIB 4D0CA 2VL5A 3C08H 2WIMA 2Y6SD 3HKFA 4LP5A 4NT6A 4NQSA 3UDWA 4GJTB 2AXGB 5E8OA 1T21A 4QT5A 2C4FT 5B8CC 1E6JL 5MHSE 3H7BA 1FFOA 3MA9L 3CDFA 4M7JL 3DX9B 5KSUB 1U8NA 1PX4A 3QUYC 3TBSB 3QEQD 3MV7B 5F71A 1LGVA 3DX9A 4K7PL 5D6DC 4R9HA 4X5WA 4DN3H 1QBBA 2JJSC 4J3OC 4YZFF 3NCYP 4GBXB 5KVFL 4U7KA 5T1KB 5I1AB 4P99A 1LP9E 3U46B 1ZS8A 3DO3A 3GSRA 4ZQKA 3REWB 4DOHB 4GSDL 4GW1B 3GHBH 2DM3A 1T2QH 3GJFH 3G6JF 2J8UB 3CFDA 3IJHA 5HD8D 2IH1A 4RDQG 3ESVF 3FFCA 3KG5A 1L7TH 1CICB 3CH8A 1QFHA 2MOVA 3TJEL 3EFDL 3ELAT 4NHCL 1A7PH 4NKOA 1RVFL 4U7SA 4X9HA 2YD1A 1PY4A 1U8KA 5K9OA 4MXQC 3BPCA 5CAYB 3ARDC 4N1EA 4HK3J 5DYOA 4ZPVA 2ORBL 1DFBL 2DTSA 4JRXB 4KH2A 4X4YA 2GY5A 3DI2B 1F3JB 1F4YL 3BEVA 3G5YB 2BHZA 1BQLL 3BSZH 5D7IB 5GGVY 1DQDH 3MRKA 3MJ8A 2CD0A 1A5FH 3S96A 2LU7A 5I9QC 1FNAA 3TZVB 1NLBL 5KS9A 3RL2A 3PL6C 5DHVB 5I15H 1FBIL 1JE6A 2EO1A 3GSXB 1AJ7H 3CAFA 1RJLB 4M6OL 1H3UA 1EO5A 4BSWA 1CU4H 4JFEB 2GTZA 1E0OB 4GAYB 4DKEH 1G7MA 4PGDA 4I3SH 3VXSE 4HWNA 4OKVA 4FQ2H 5D8JL 3AS3A 3VWKA 4HUXA 1X5JA 5JTWA 2NW2B 3ARYA 5KVEH 1WC7A 2OTUB 4N9GB 2DQDL 5I1DB 1MFBL 1Z2KA 3BKYH 3FQRB 2ORBH 4BZ2H 4JFDA 1NL0L 3QHFL 5D5MB 1U92B 4X6EB 4NQEE 3RWDB 4LLMB 4PJEF 4L4TB 3C60A 2Q1EA 3PP4H 1T80A 4W81A 5MP6H 3VXQA 5DEGB 4OLYL 2ZOKB 1P4IL 5EOQH 5GS1A 1VGEL 4BSVB 3TN0C 1OP9A 2R0LL 3SGDI 2E7MA 2X4PA 2EEDA 2J7LA 5IVXF 1HWHB 5J9PA 1N7ML 1MEXL 5MENA 4RNRA 1DQJA 4MLIA 3UTSB 4W6WB 3GDBA 3CIQA 2R1YA 4ZS6D 4YK4B 1KULA 2ADGA 1F2QA 1JN6B 4I3RL 1A9EB 1NCDL 4K8RL 3WHXA 1TJGL 4D0DB 3FN9A 1I8KA 4XBGB 5FGBA 2AJVH 3F65A 3LQAH 3NCCB 3JWOL 4X8JA 3VI3E 1N64H 3WDIA 3E3QC 3MFFA 1FZMA 4WO4A 3BD4A 4X7TA 4N0FB 5JHDD 4OCWL 4QHLB 3BUYB 1UFUA 5MP6L 4D0BB 1HHKA 5JW3H 3HC4H 4XT1C 3G04B 3MRLB 4MNQE 4M43H 2JCCA 1WAAE 2GI7A 3CNKA 5C08A 3VXTB 4K94H 3V6ZA 4ZNEA 3V0AC 2BP3A 4BFEA 1NMAL 1ED3A 1GGIL 3BT2H 4WWKB 2YR3A 5EOCL 2ARJA 1GGUA 3IFPA 3V2AR 1JGDB 4EVNB 2P5ED 4NC2B 5JUEH 1GL4B 3GKWL 4PJHB 1A1MA 3LEXA 4D9QE 4OD1L 5FGRA 1ORSA 1HXMA 4HKXB 1VDGA 2VDQL 4QHKI 2D7QA 5C6WH 4Z18A 1S7XA 1ZHLA 4OFKA 4X80H 4M4RA 5CCKH 1AE6H 2ZCHH 4HMDA 1N0LA 2IWGA 3VFVA 4RISL 4TQEL 4L8DA 3FB5B 4NC1E 3QA3A 1AI1H 1LK2B 3T0EB 4W4NA 2R2HA 4MA7H 2YN3A 4MDJB 5FA3A 2QADC 3JWNC 1EEYA 2Q3AA 3D0LB 4HS3A 5HPOA 4WNQB 5IB3B 2GTWB 1KTLA 2OS7A 2RQ8A 2DBLH 2L7UA 1ED3B 2ZP0T 1WJ3A 4PJIA 1KN4H 4U0RC 4Y7MA 1J1PH 3BZ4A 4RFEB 5I73B 2V5TA 4N90D 1QSFE 3L9RA 2A2QT 1OAQL 3MRLA 1JUFB 1Z3GL 2EDDA 2CR6A 2X89D 3MLWL 1MHEA 2Z8RA 2OI9B 4UV7H 4D0BA 2XKNB 3ARTA 3RUGB 1TVBA 4AENA 3MX0A 1XEDA 3RDTB 1H3VA 3VGAC 4F37K 3FOLB 1CFSB 1EFXA 2HKHH 3VXME 1IGTA 2AABH 4IEFB 3IF1A 2IQ9L 4K23H 2FCBA 43CAA 3PWPB 2ICEA 5ISZA 3D18A 5C3TA 3QG6A 5C0JA 5AD0B 3X13A 5EBGA 2R2CA 1A9EA 1U93A 2FLBT 4OB5H 2D7MA 4LSVL 1VFMA 1II4E 2P8MB 3IKCA 4ODWB 5D96B 2VTFA 4HS6B 1QSZA 5GS0H 4N5ED 5J9PB 3NGBC 5IG7A 1JZ5A 3ZKXB 1PY9A 3VMOA 1BQSA 5DEFA 1PX3A 3GSVA 4LKXA 1CR9L 3QIBD 1G9NH 5GISL 1UKTA 4OD3H 1TCRA 1LEIB 3K8KA 4J1UB 4YHIB 5FK9B 6FABH 1I3RB 3C60B 3QEQA 2WQRA 4LLMA 1F3RB 2X4UA 5HI5C 1JPGA 1UH3A 4PB0L 5D5MA 3O9WC 4Y88A 5J0BA 4K7FA 3CCHB 8FABA 4HWBL 4TRPL 2CQVA 2APFA 5HVHC 3TIEA 2HT4D 5FUCC 1FVDA 1D9KC 4Z9KB 1T5WA 3ROLA 3S88L 4Z7WE 3LVEA 5J11B 2X4RB 1A7QH 1JMZA 3VW3H 3VA6A 1SEQL 2X4SB 4CRPA 3DV4B 4Y1AB 5IP4A 4XXCA 4PGBA 4CNIB 1Q1JL 3MNVB 4L4TE 2ITCB 4KWUA 1HI6A 2A1WH 2QV2A 3PUCA 4PV8B 5GGRY 1P1ZB 1KT2B 3VWJD 1N7MH 1TXKA 2R0WH 5EOCJ 1JGVL 1YUHB 3WLBB 4F3FA 4JY4B 4L3EE 4BM7A 4UTBL 1L7IH 1MFAL 1L0YA 3HZYB 1KB5A 3LRGA 5CP3H 3TA3B 4F9LA 1FL3A 1QPPA 2BHUA 5C09D 1QR1A 3L3KA 1TQBB 2KH2B 4JGJA 4JQIL 4LLQA 4D9LL 4GG6F 4OB5L 5DYOB 4Z0BH 1P6AB 1U8KB 1MCOH 2MKWA 2PYED 3TT3H 4U2ZA 3QFJE 4N8VB 5JOFB 2G5BB 4DKFL 1WK0A 1E4WL 3QQNA 4WUUD 4QHUA 3EO9L 2ZSWB 2E8ZA 4UU9B 3BDBA 1KCRL 3M1BB 3OKEA 4MXWL 3IFOB 4C83B 5HVFB 1J0YA 3MV9E 3N1QC 4JRXE 3CMOH 1OVZA 4BK4A 4H20H 1IQWH 2VSCA 5GRVL 1QACA 3K7UA 1OF2B 1IAIM 2BSRB 3O6FA 1T22B 2JJWA 3KYMB 1YNKL 3GJEB 5D1QA 1U8MB 2H8PB 1MFAH 4XMLH 4D3CH 5H37G 4HIEA 1Q8MA 5IK3A 3GMLB 1NCUA 1DBML 3PWVB 1MWAH 3OKNA 1JRHL 4IRZH 2XZCH 2VABA 4OZGA 3B9DA 5I8CA 5IFHH 5I0ZA 3O3DA 4I2XE 1AGDB 2YPVL 5IB1A 1RZJC 2NY1C 3U4AA 3QPXL 1UZ8B 4DCQA 2ZCHL 4M61B 2VR4A 5EUOB 4D0CB 3RVXD 5B8CB 2NY3B 3C6SB 3L3HB 4DEPC 3JV4A 4MZ2A 4FRWA 3TV3L 1T6WA 5EC2A 3QQ9C 3UPAA 5BXFB 4F7PB 5IF0A 4RMRA 3MODH 3T4AA 3ZZ1A 1P69B 1RK1B 1D5MB 3T0EE 5JDJA 3RZCB 2WBJA 5D7LD 4D9LH 1OB1B 1LDPH 2YWZA 2PXYC 4Z0BL 1X5IA 1NEZG 5ERWA 4PJ9B 5GGQL 3SKOA 1SVCP 1RZGA 2ENYA 3E8UH 4JFHE 5E6ID 2Z93B 4GXVH 4HJ0C 5DJYB 1HNGA 4L9DA 3WJJA 1YY8B 3GEWB 2XPGA 1B2WL 1DEEB 1W0WB 3VFUB 1QSFB 3GI8L 5HVWA 1IQDB 4JY6A 5CD5D 4X9GA 3GSWA 4U1LA 1QQDA 2ADIA 4JRYE 1KPRB 4AT6B 4FQXA 4LCUB 1PQZB 1MLBA 2X1XR 3U1SH 2XQYG 1KPVB 5MEOA 3CMOL 5T3XH 3D87B 3QWOA 3MXVL 4NUJA 3ARUA 5CKAA 2AQ3A 3BGMA 4M1DH 3RIFF 5E4EB 2KQMA 4O51B 3P0GB 1HQ4A 4RGND 1OP3H 4MA1C 3ZL4H 4OKDA 4XPBL 5GS0L 3PQYE 1UEMA 1R6VA 2YRLA 4ZG1A 4YAQA 1D6EA 5LWYL 3QCVH 3B2VL 3V6OE 1OTTC 3F7YA 1FZOB 2QADD 3HC3H 3BVNA 1QRNE 3MBED 3O81A 1FYTD 1RJYA 3FQWA 1JYVA 3EDKA 4KROD 1Q9LB 2F53E 3C5JB 4KFZC 4BQ6A 1QNZH 4PJDF 3RWHB 3F8UB 2ZCKH 2AJ3B 3TV3H 4B53A 3TH2T 3KPPB 4GS7B 1MLBB 1U36A 3MV7E 2BRQA 3W0WD 1UB6B 4CJ0A 5CJ5A 5FV1L 4ODUA 3CVHH 3D2UD 4HXBH 1UJ3C 5DD0L 2HVKA 3G5XA 4XPTH 3QIWB 5ACMA 1EK3A 1SJHB 3GB7B 3QRGH 2HTLC 4G8FB 5T1DH 1A22B 3ULVH 1GGBL 1T89A 2DQGL 3EOBA 3LV3B 3VXSD 5ERWB 5E9DE 1OB1A 1TPXC 4IM8A 5EG6C 4YXHH 2YPLD 3F7QA 4NNXB 2ICWJ 4Z95H 4XBEH 4G6ML 5DXWA 3UYOD 4FNLL 1D5BA 1BD2A 4NQCE 1A6AA 1RY7B 4LFHD 1MCJA 1I7ZB 5J11C 4Y4KD 4BJLA 5IGXL 1D9KB 1F4WH 5IBUG 2WIIA 3H42L 4JQIH 3QDGA 3UYPA 5CJOL 1KJMA 3OGOE 3P77B 4CVUA 4LF3A 4XC1H 4YXKH 5JR1L 4L5FL 5KW9H 3QUMA 2YUZA 3T2QA 2CGRL 2HH0L 2Q8AH 2OP4L 1OD7A 4WI2A 3D3VB 3PWVA 1U41A 3T3ME 5CINH 3F7RA 4XVSH 2D03H 3O6ML 3VWKD 4OFYA 1RU9L 3AM8C 2WNGA 5TQ0H 4PY8J 1UB5A 4KKCC 4QGTA 4HS8L 3BQUC 5DD6A 4HC1A 2D0HA 1DDHA 3G08B 4PRDA 4MQTB 3B4NA 1HCVA 3WHE0 3QEGL 4JM2D 1K4CA 1MCWW 3KPMB 4FQLH 2NXYC 5HYJD 3W5NA 2AP2A 2Z91B 3KHOA 1T1XB 4TSBL 3MV8E 1BZ9A 1JGEA 3UJTH 4I1NB 4LPTA 1P84J 2F19L 3O4LD 3H6JA 2P5WE 4OGXL 1TTGA 1X44A 4PJBA 2AEWA 1WQVT 4M5ZH 3RGVB 4ZXBD 3M07A 5CMAA 3TN0A 4CU8A 4HKJA 1DSFH 1UM5H 3DRTB 1OTUD 3DHJA 2ZWLT 4UIMA 3U0TB 3LHPL 3CH1A 4XTRD 4JQVC 3IDJA 5EZLA 1ZT4B 4K8RC 1S5HB 5I66A 2HWZL 5ITBH 1T20B 2EDHA 5KAQF 2C9AA 4Y19B 5I73C 1U3HA 4JE4B 1YUHA 3I3DA 3GMQB 2XA8H 1UC6A 3CFBA 1Y18B 5F6IC 4LHUG 1NMBH 1MPAH 1XF2A 3CK0H 4G6KH 3GSUA 5DVOA 2AJZA 3CFEA 4FFVD 3PP4L 3QEHA 4OCXH 1Q0XL 1M05A 3SO3C 4X7SH 4UT7L 2J88L 1EJOL 3DIFA 4NO3A 3V6FA 4G9FB 1ZLVK 3QRFM 1A1NB 3CFCH 1KEGL 5BS0D 3MV9A 3MRMB 4OLZL 1MEXH 2DMBA 3IDYB 1KEMH 2IANA 4CVXB 4N8CL 1VA9A 5GGSB 3REVA 2D2OA 5DO2D 2JJTA 2L4OA 3V52H 1PLGH 4YGAB 3D39D 1MAMH 3BPLB 1U58A 1AO7B 2HLAA 5GRWA 3ZYIA 5J13B 1AD0A 4NQDD 2P43B 5J1SC 1G9EA 3OV6A 5JPNA 4PLJC 1BFOA 1KTDA 2GK0B 3GSVB 2DM7A 3DUUB 2JIXD 1MIEL 2Y07H 4XPAL 5DJZB 4OCWH 5MEPB 3S37X 1JNLH 1LQSR 1I8MA 5F89B 4HULB 3T77B 2FX7H 1KIRB 3EFFA 2HA1A 4P2OB 4PJFA 1A1NA 1ZMYA 5D2NA 4Z7VA 4HSQA 3VXRE 3WUWA 4EN3B 2IFFH 3RI5F 2Z9TA 4NBZB 4IJ3C 3T2NH 1NC4A 2Z92B 4MA7L 4Z78A 4HAGA 3L3JB 5MI0C 3MGTB 4ZAKD 5KS9F 4S11A 2J4WH 1TTUA 5IHUH 5I1IH 3MLYH 3MV8B 1C7SA 3L7EA 5I66B 4U33A 4OUOA 4AMKH 2IGFH 2VWEE 5EH1A 1MWAA 1Z3GH 1KLUB 2DL9A 2I60L 3I6KB 2BRRH 5AUMA 1L7TL 2A38A 4QHMB 4JFEE 4WFFE 3P2TA 1DLHA 3QQ4B 5AEAA 3U79A 5I19L 3DLQR 1HIMH 1FP5A 2DQDH 1LK2A 4DZ8B 1S7RB 4LHUB 1QBML 1MRCH 4O5LL 3BUTA 5E94B 1QPXA 4EEEA 1KNOA 2R69H 3S5LA 4F57L 5BZWB 1TJHL 5F1SA 1X9QA 1TTFA 5KG9B 5T3XD 4F7TA 1MJ8H 4PTUB 5FO9A 4PP1C 3UJJL 2MTPA 1NLBH 1A1MB 2XNAB 1K5NA 5J6HA 2APTA 4B7LA 3SCMC 5ACZA 3OBAA 2G60H 3D3VA 2DTML 5EOQL 4LNVA 3BIKB 4NWTH 2E9BA 4ZNCD 4YEFA 1YEHH 3A6CL 3WS3A 2NY7H 3DETD 2FATL 4M03A 4OLUL 4NZTL 4J3TA 2AQ1A 4F7TB 4FTVA 2VDNH 2Z4QB 4KI5F 4OLVH 1V3MA 4ZSOB 4TVPE 3QP3A 3QDME 1YYML 3MLYL 3SQBA 3TFKA 5FO8A 1HH6A 1INDH 4U1SA 4WO4B 1A2YB 5FEBA 4P23D 1N26A 4Y5YA 4X99A 1T1WB 3ZT7A 3ZO0A 4ZUSB 1LEGA 1VFBB 2WY3A 5HGDB 1T2QL 4HUMB 4LSTL 3TFKC 1T66C 5J89A 1FGNL 4PJAF 2X05A 1CTOA 3WL9A 2BRRL 3MCLL 3EOBB 2R0WL 1NGPL 5I1LA 1MWAB 3ZKND 1QTYT 5E03A 2A6IB 3KR3L 3GMMA 5DD1L 1BOGB 1DQML 2R1XA 3FFDB 1KIPA 4HUKB 2HVKB 2VB5A 4EXPX 3LEYH 5DQDL 4GBXC 3TO2B 2QSCH 3GRWH 4YDIL 3VMPA 3S6CA 1W8OA 3NIFF 4P2RE 1OWWA 1CN4A 1NEZB 1SM3H 1YC7A 4PJGA 4XMKL 4L3ED 3PL6D 3U7AA 2YEZA 1SEQH 4YBLB 4E41D 5JOEA 1KENL 2BSSB 2EIBA 3CGTA 1DQTA 5EBLB 1AKJD 5CBAA 1OGAD 4X6EA 2NY5H 5TPWH 5D2NB 4NQCB 4R7DB 1R3HA 1D6EB 2W9DH 2BNRA 3LB6D 4U4BA 4PP8C 4HX1A 1FLRL 4ODHH 4YHKH 4P2OC 3WUZA 4L4JA 5JMOC 1HQ4B 3BPOB 4FQ2L 4GAYA 2GTZB 2VLRE 4HCRH 4BSWB 2YD9A 4GBXD 2YZ1A 4G6FB 1OARL 3H2WA 2BC4B 4JKWA 1ZHKA 4XPHH 2VERN 4LAQH 1AIFA 5C0AA 4C57C 4MJ5B 3RY5A 4CBPA 4KJQC 4F2MB 2LAGB 1J88A 2WINB 4G9DA 4JGMA 3UTSE 3WXWH 3BPLC 4G3YH 3MZTA 4YWGL 4D9RE 3VG0H 4HJGB 5KVGL 4JZNB 3W5MA 4X4YB 4POUB 4M6MH 5DJYA 5DC4B 3MCLH 1TZHA 3A6BL 4H20L 5DQ9B 3KLHC 1BZQK 3IDYC 3HZKA 3BPCB 1NGPH 4JFPB 2AABL 4OIIL 5AZEH 2I9LA 2WBJB 1CZ8L 3GBML 1XF1A 4ODSH 1CXLA 1QLRA 5BV7L 1P7QA 4JFOA 4WI5A 4EXKA 1BQUA 5C0CD 1DUYB 3QFJB 2Z8WC 2IH1B 1IT9L 2AEQL 1A7OH 1RZ7L 4LRIC 4LHQB 4MD5B 5CIPA 3P11H 4R90L 3GSRB 5CWSA 3FHAA 4KVNH 4R3SA 1IAMA 1SJVA 5F6IB 1JNHB 4V3DB 4IRSA 6CGTA 5EZLB 4OZGE 4HWEL 3PWUB 4HDIB 3KPRB 4JO1H 4TUKH 1GC1L 3VRIA 4Z7UE 1JNJA 4JFED 1I1RA 2FL5A 3MRRB 2I27N 5I19H 3TNNB 1WFUA 4OSUL 1YEKH 5FB8B 5IK3B 4YHNA 4BQ9A 1NH6A 1G0DA 1XGRB 4FQCL 5TF1L 1E4JA 1F3DH 1JPSL 2HN7B 4JFHD 4XP4H 1T1XA 5ICXB 3W9EB 3BWAA 4G80B 2EDRA 1X5XA 3KPMA 5DO2C 5DJ2A 3SDCD 4OQTL 2FJGA 4KUCF 5JUEL 5EU7C 1ZSDA 2D7PA 2YA2A 1T89C 1ZA6A 4A6YA 3HRZB 5F3BB 3RNKB 1QFWL 5LXGL 1FZJA 3HI5H 1HILB 1HINH 3BQUB 2PW1A 4NP4L 3HNVH 4X4ZA 4QNPE 3IDIA 3MRIA 4QO1A 5IV2A 1U8LB 2AJXH 3QHZH 2GKIA 5BVPL 2E7LE 3V7MA 5BS0E 2P49B 2IF7A 4TTDD 4APQB 1DBAH 1W0VB 3OR7A 3PQYD 5MENE 2XTLA 1KIUA 5TE7H 5C07A 3B43A 3OGCB 1J0JA 4LPWA 3NPSB 1FPTH 3R8BB 5JXEC 1KFAH 3HRPA 5GS0D 5DZLA 5K9QG 3TH4T 5FDYA 4ZTOL 1ZLSH 2OL3H 3OJDB 4U1MB 3LIZH 1XGQA 8CGTA 2Z8VC 1S3KH 2EH7L 4WWKD 1MI5D 2FNBA 1KXVC 1KJVA 1CGSH 5HSFA 1OW0A 2NTFA 3D2UA 5DD0H 3GRWL 4C4KT 4X7FC 4NQTA 4ODUB 1MRFH 1RZKL 3UDWC 3WKMH 3WO4C 1FZKB 5JXAH 4JRYD 2R1WB 2XICA 1J0IA 3GM0A 4O4YH 1T0MA 3MOQA 4LKCB 3RUGF 2X1PA 3QUYA 2FX9L 2BXZA 3G5VA 3E2HB 4GQPH 1FN4B 3WEXA 2NY2C 5DT1L 5T3ZL 3V4UH 1G9NL 1LDSA 4R96A 1MFDL 4GKZB 3VFSB 4M5YL 1A0QL 2V17L 4J3VA 4O9HH 1OCWH 3DV6B 2UVFA 1ZLSL 3BJ91 2X41A 1NFDE 5E8EA 1A7RL 4U6HB 1A4KB 1JWUB 3EHBD 3RUGE 1IQWL 1MHCB 5ANMB 4F15B 4JPKL 3UTZB 1DBKL 4X6CA 4Y4KC 4HCRL 2W65A 3FL7A 3MLZH 5F1NB 2HTKC 5GS2D 5AG9A 2XY1A 1NPUA 3HE7B 4R8WL 5L2KD 2D9QB 1J8KA 2A9ML 3IF1B 4NUJB 4U2YA 3VFMB 1LDPL 1O7VA 3HPJB 1VENA 4MXQA 4UZGA 1ZANH 1I9IH 1CD9B 1TVBB 1ZT1A 3MRBA 3VU2A 4U1LB 3GSWB 2DI8A 1KYOK 2X09A 4PJHF 2OI9A 2JJVA 3THMH 1JUFA 3UPCA 5J6GA 3MJ9A 3MQIA 1WEJH 3MRNB 4KRLB 2Z93A 4KAQL 1L7IL 5J6GB 4P4RB 1BWMA 4ZUUB 3JTCA 1A6TA 3DUHA 1NBZB 3W82A 3QAZB 2F5AL 4NZRH 2CSPA 4N68A 1T04B 4XNXH 4BH7A 4BFBD 4XP5L 2X89A 3OAUL 1JZ7A 1AXSA 1LO3H 4H88L 1JYXA 1I3VA 2OK0L 3VFVB 3STLB 3CSBA 4MXVE 4I4WB 2EC9U 2VDOL 3ULUL 3VWKC 3WNOA 3EYSL 3NACL 4OZIA 2VQ1A 2XI9A 4UDTA 4D9QD 4Y16C 3WFHA 3QDJB 2A9NH 2XA3A 4PRPB 1F6AA 5BRZE 1FSKC 1MHCA 1LO2L 1ORSB 4DEPB 4CDGC 2Q8BL 4HGKC 4TYUA 3BW9A 1G7PA 1KB5L 1VFUA 1WT5A 2DQFB 2EDXA 4HH8A 3CVHA 2Y25A 1A8JH 3MREB 5L9DL 2G9HA 3DX7A 5C09E 2BVEA 3B9KB 4R96B 2P44B 4MSWA 3WJLA 5DFWH 2EECA 3AREB 3G5VB 3GJEA 1HSAB 4JLRB 4JANB 5D1QB 3L5WB 4I77H 3CFKB 1PKQE 2R8SL 3NH7H 4XCEA 5GQBA 3CXDH 1SY6A 4HHAB 1NC2B 1DBJL 3U4EA 2YUWA 4QCIA 2H32B 3IU3B 5C3LD 5IR1A 1ONQA 1YEDB 2P8LB 2ZUTA 1PBYA 1NCCL 3VXMB 3T8XB 4MCZB 3BZEA 2I25N 3ZE0E 4LSSH 4FQJH 4OT1H 5I75B 4NKQB 5H2BA 5SWSD 1ZGLA 3QI9C 4X8JB 5GGVH 2VDLH 4N8VA 2HLFD 4X7CC 3MRFA 3ZKMD 3RAJL 3S35L 3AXLA 1OAUL 4YUEH 1F3DJ 1VADB 4U1MA 2Q76B 5IQ9B 4DUXA 2R1YB 3K74B 2PNDA 3KDMA 5JQHC 1FV1B 1LE9B 3QRGL 4RGMB 3HZYA 5MENB 4NN6C 5E7BA 4XVSL 3O4LA 1AGBA 4JY4A 2CGRH 4Y4FA 4ZS6C 4FQHA 1BFTA 2I60H 3U2SA 2AJUH 1A6VH 3ARBC 1KOAA 5HI3C 4CN4A 2NY0D 4A2MA 3MNVA 1ORQA 2KDGA 3IGAA 2GITA 3MCKA 5I74B 3EYFA 5ID1A 3QXVA 2HVJB 2JELL 4HV8B 3HE6B 5GGVL 3ZDXE 5I0DA 5E2WH 2OTUA 2FBJH 1TVHB 1LD9B 1PD6A 4ETQA 2C1OB 4U1KA 1AD9B 4XCNA 1U8JB 4UV4H 1W8NA 2BY3A 4HT1H 4I2XA 4JHBA 1X5ZA 3TO4A 3HMWL 3EYFB 3QR2A 1YDPA 2J8UF 3CXDL 3LHPH 3O2WL 3MLXL 3Q2CA 4UBDC 2QQNL 3GSXA 3KYNA 3T0WA 1XR9A 3QDHA 5F7KC 4J4PD 1I3GL 1J5OL 1PDKA 3TZVA 4NSKB 4P5TD 5HHOE 5EWIL 5HYSA 5IEKA 2NZIA 5A2LH 4HJJH 3QEUA 4MHHI 3KDMB 1JP5A 4HS6A 5CGTA 4YBQC 3NIDF 4JRXA 1G9ML 1N6VA 4WHTB 1ULVA 1DVFB 1U93B 3QIUB 5B3NA 1ACZA 3WDJA 4KPHH 2X5PA 1MPAL 4R0LA 5CBEA 1OQXA 5BW7A 1CLCA 3QXDB 3V8CA 3PGFL 4BQCA 2F8XC 5J4MA 4CADA 5KTEL 4NKMA 1NKRA 4NWTL 3MJGX 3NAAH 2X9XA 4IS6A 5K9JL 4V1DD 3RX8A 3CSYB 4AENB 5DC9B 4NQEB 2F8OA 2QQNH 1TETL 1EEZA 4YDJA 1F4AA 2PO6A 3MRHA 4LLDB 3K80A 1AY1L 4KAQH 5AWNH 5T1KA 3RU8L 5LQBH 5FYKE 4J3SA 4X98A 4LCYA 2DBLL 3S37L 2AV7B 4PG9B 1NMBL 3FB6B 4OCSH 4X5WB 2Q6WA 2FX8L 1BX2B 4YX2L 4G9DB 1QFUH 4H26A 1QG3A 4HS3B 2UZYB 5F7DA 1AIFB 4TUJA 4YDVA 4F8TA 1WFNA 2J88H 4PJIE 2Q8AL 4KPHL 3NN8B 5I1EL 5E8OB 1MELA 5I1JL 4NT6B 2QADB 1I8IA 3O2WH 4MDIB 1X5YA 4G8IA 3WFHB 4XNUH 5KAQG 5KN5A 1OAKL 4DGVH 2VQ1B 5ETUA 1WUNT 5EBMB 2H26B 2AK4A 2OJZH 4W4OA 3HG1D 2FD6L 1TZIB 5FM8A 1Z9OA 4D8PA 3QDJE 3OG4B 4PRPE 5EIIA 1G6RB 4OF0A 1ZXQA 1Q72L 1WWCA 3W0WB 2APWA 3BGAA 1XF3B 3PIQB 4JPVL 2N1KA 4R7DA 4U6XA 2B7DT 5AWNL 3RU8H 1VKXA 5DVLA 1SHMA 4M7KL 4PY8I 4P4RA 5KVDL 1F2XK 1HDMB 2BSSA 4EBQH 2XKUA 5TJWK 3V6ZB 4L29A 4N1CA 4XCFH 1FL6B 4OGXH 5HYQB 3IETA 5C08B 2OTWA 3AGVA 3BYYA 4P49A 2X4OA 1K8DB 5TF0A 3ARGC 2V7NA 4YHYC 4NNPL 3BUYA 1CGYA 2PW2B 1ZT1B 3MRBB 1XF5B 4E42B 4G7YH 5KANI 1U91B 3R06B 4XB8A 4L3CB 3DWTA 5I1LB 3VFRB 1K8IB 2VC2H 3DROA 3SGDH 2W0KA 4X6FB 4ISVB 5BJTB 1U6AH 1QO3B 3IRPX 1OARH 3MNWA 3WNLA 2HFTA 5A2IH 5I76B 3ZHDA 2NLJA 1EXUA 4Y4HC 5IB5B 1IT9H 2F74A 4RX4A 4FQQB 1N6QL 1Z0NA 2X10A 2XQYK 4G8GB 2IQAB 5KVMC 4NUGH 3D3VD 3SE9L 1DVFC 1J12A 4JKKA 2J6EL 3X12A 3MRDA 4ZSOA 1PZ5B 4IOFD 2X4TA 2X4PB 4WDIA 3WFCL 2GUOA 4ZO7A 3AMKA 3OQ3B 4DKAA 2HAZA 4FQ1H 3RKPA 1AXTL 3EYQC 1VEMA 1SYVB 5BOPA 5EU6D 1P5UA 3B3IB 4JO2L 1QBLH 4H8WH 5EZOL 3NIDE 1OAYH 2RAMA 2BJML 4QRPB 4TULL 2BERA 3RGHA 3FQRA 2KPNA 3BIBX 5I1HL 5DUPL 4BZYA 3BP5B 1WWWX 4AIZB 1WIOA 1X7QA 3VXPB 5FO9B 1DQQB 1WCQA 3BI9X 4PLNC 4WW2A 3TPKA 4MX7B 1BBDL 1HYSD 4MD4B 3HMXH 2FX7L 3FB7A 5JHDA 3HI6L 5EZJB 3L5IA 3MLRL 3SJVB 4O2CA 5DR5H 1XGUB 2ARJQ 1DLHB 3QQ4A 2Y5TA 3WFBH 4GXUM 4WI8A 5ADPH 1FNGA 3D85B 3MRKB 1AQKH 3ARBB 4OZHE 1BECA 1LEKB 1GGCL 3IDMA 4U6VH 3F12A 4KTDH 5T5FH 1YJDL 3DSFH 3SE8L 5CGYC 3FT3B 4GRLC 4H1LB 3HR6A 4ZYKA 2HG5B 4LRNH 3KLDA 3VE0B 3HFML 3MV8A 3ZYZA 4MXWH 3RWFB 3MRCA 1R3JB 1QFWH 1WBYB 4PTTB 4LNRB 4MAYD 5LXGH 2GW5A 4UV7L 5IMMA 5CGYD 5F7WC 4P46D 4AL8L 1M7DB 1M71B 4YHKL 5F3BA 4ZXBC 4YDKL 3R0NA 3IFNL 3QI9B 2DBJA 1NC4B 5E5MB 3JV5A 1S3KL 3IDXL 2AEIT 4POZD 5ILTH 2DLIA 3SE3A 1S7SB 4FFEX 4Q6IC 1GCFA 1KIRA 3EFFB 4MA1B 1ETZB 5FGCB 3S98A 4FQPA 4PJBF 5MERA 1I8MB 3BKCL 5ICXA 1S7UB 1P2CB 5IVXE 2BNQB 5A3ID 2R0KH 3HUJA 4RRPA 4HK0A 2EDEA 3FCTB 3V8OA 4OGAD 5IM7A 3OKDB 4LCWD 2WQ8A 2AGJL 2OL3A 5F7LB 1MCCA 1AR2A 4R26H 5T1MA 2XFXB 4DWHA 4A2LA 4BKLA 3HFMH 1SYSB 4DGYL 1MFDH 2X7LB 3EKCA 3ZE1F 4HWUA 2YUXA 1KG0B 2QKIA 4ZPTA 3ZTNH 4R3SB 4P9ML 3MXVH 4MNGA 2WP3O 1I8LA 1FSKB 4JFXA 3I02B 1PJ9A 5HHMD 5DMKB 3QXAA 1CFTB 3TCLB 4UTBH 3NZHH 1DUYA 3UZQA 3GKZA 4U05A 4JO4H 3IJSB 3QNZA 2ED7A 4G9FA 2YPKB 2I9LB 5DI8A 1CGXA 5FGCE 4JFPA 3PHQA 1T3FB 2DLEA 3OX8B 2AJZB 3CFEB 3HZKB 1U8HB 4AEIH 5EUKA 1RK0A 1QYGL 2H3NA 1IC4L 4YWGH 1T2XA 2N7AA 4NNPH 1V7NH 3C9NA 5DMKA 2WBKA 3RI5K 3RWJA 3NCYS 2J2ZA 1MCWM 2NY1B 5T3ZD 1U3HB 5LGJA 1OM3L 3QUKA 5EDXA 32C2B 4Q9QL 3GMOA 4Y8AA 1NDGB 3GMPA 2B0SL 4PJAE 5L2KA 3DBXB 3FRPA 3FO2B 2BFVH 2MQ3A 2F9BT 2KZWA 3QH3A 4P5MB 2FEEI 4LPXA 1RZ7H 1YPZB 1B0WA 5L7XL 3QDMD 4XMKH 5KSBB 5IW1A 3SY0B 3SE9H 3GSNL 3X14B 4K55A 2BNQA 2ICWI 4P57B 4JZJB 4LQFH 4K71B 4NBXB 4KDWA 4JY5L 2QSTA 1MJ7H 4HG4J 2ZCKL 1OW0C 4C55A 3TYGL 2ZUYA 2Y72A 5E5MA 3T0DA 2VQUA 3BXNA 2XZQL 5KZCB 3H9ZA 5BMFL 3NA9L 4QYOB 5IESL 4NO0A 2F54B 3SDXB 3F6LA 4WV1C 4FQCH 2JLLA 4KZDH 1UH2A 3AY4C 5DJAB 2VIRB 1Z6JT 2W91A 1WBYA 3IB4A 3MLUH 4XMLL 3O4OB 2OZ4H 3T0BA 3FJTA 1SJEA 4WO4D 1AGEA 2CIIA 3LQZB 3VXRD 4PJAB 4LAQL 3H9SD 3TJHA 4I48A 3SOBH 1M6OB 4X4XA 4HH9A 3NABH 3F12B 3ZSSA 1ERNA 4OD3L 3VXSA 1E28A 5BO1H 4TPRH 4HMEA 1VFBA 2Z8SA 3WFDL 2W1NA 4JY5H 3VWJA 3QNYA 4CU7A 5FO8B 2DWEB 2HTLD 5E5UB 5DJ8A 3UTPD 2VXQL 1CZ8H 4RGOH 3OKLA 4L3EB 1T0NB 5F7YC 1TQCB 1ZVSA 4G6JL 2VH5L 4LSPH 1JWMA 4H1LG 1R5WA 4QRSA 2C3HA 5EFIA 4RRPG 4UTAL 1F5WA 2D03L 5KSAC 4Z7UA 1T7VA 2E7BA 1AGEB 1U9KA 4AZ8A 1XH3A 4M1GH 3ARFB 4ZDHA 4LQFL 5KANG 3RWIB 2BVYA 1OD9A 4UQ3A 3ZE1E 5SX4H 4P9HL 3VDBA 3W81A 5TDNB 5LKNA 1K5NB 4MJIB 1T83A 3BP7A 4YXLH 2Z31D 3B8SA 4GG8B 5L6YH 5IQ7L 2BVTA 2QTEA 1OAUH 1MIML 4YUEL 5L2JA 2GSIB 2DI7A 5LG1A 1NAML 5ANME 3RVVD 4HF5L 1NBQA 4G6FD 5D96C 5BZWA 2BNRE 1G7QA 4UT6H 1U8PA 4LLVB 3S34H 3N1MC 2ZOLA 1C16A 2YK1L 1JHKL 3PHOB 3AU1B 3X14A 1JRHH 1OSZA 3EZJB 4IRZL 2B4CL 2VUYA 3D25B 2EKSB 5C2BL 4P46A 2HT3D 1AHWC 5DQJB 4QHMA 4EIZC 1I9EA 2E9IA 3W9DA 4DN4L 3T3PF 1F6LL 5FFLA 1U3JA 5BO1L 5CSBA 2EDOA 3PDOB 3FO9B 3MROB 1RIVH 3ALWA 2V9QA 1RZJL 4LBEB 4NQVA 5TQ2H 1L8JA 4P9HH 4ERSH 1QQDB 2A6DA 4P2YA 4AH2A 2XYCA 3SDXE 5I17B 4H0IA 1EEQA 3A67L 3RWJB 4D3CL 5CD3B 5FA4A 4R8WH 1TNMA 2ADJB 5HYQA 4XCCL 3ZE0F 4XNXL 5FF6B 1IGIH 1KJ2L 4U3XA 3UXFA 3T0EC 4WI6A 2XWBA 3QULA 4XHJC 3TP4A 1TITA 3P3YA 4OGYH 4UT9L 4RFNB 1P84K 4ZAKC 5F9OL 1XIWB 3ZDZF 3PGCA 2WBJC 3PP3H 3MA9H 4M7JH 1YPZF 4OM0L 1G6RA 3JWOC 4MXQD 2VISA 2EICA 1YEFH 4ZAKA 1TZIA 4JDVB 3JV4B 2HMID 5CUSH 3O3BA 4WY7H 3IU4H 4ZPTB 1KTDB 5HHPA 5GJTH 2F5AH 4NZRL 5CZXD 1GPOL 3JUYA 5SWSE 3O3DB 2XT1B 4MNHB 3C8KA 3PNWB 3SKNA 1GOHA 4L5FH 4KI5D 2VL4A 2HKFH 3TIDA 1JZ3A 1OLLA 1G7HB 3TF7C 3K4DA 4YHPA 3NCBB 4B5EA 3O8XD 4PG9A 5JORA 3BQUD 2NY6C 3BPOC 3KYMA 4KMTH 5F9WB 4KK8C 2Q8BH 5F9OH 1OGTB 3QUYD 1I7RB 2B1HH 3WLWC 3MUJA 3R1GL 2B8OT 1EEZB 2ZJSL 4YDJB 2DQTL 2PO6D 2V6HA 5D6CA 3RHWK 4LCCA 5KVFH 3HC0B 3CSYA 3OKEB 1NBYB 2EC9T 3W0WE 2EZ0D 3MLVH 1GXEA 2VZUA 2BY1A 4WY7L 2XA8L 1XT5A 2L7JA 4KUZL 2XG5A 4LCCC 1XCTB 1ZT7B 1U8QA 2HYMA 3CLFH 2G5BA 5IMOB 5E2JA 1SMOA 3RVUC 4JREC 2LTQC 3H8NA 4MCYB 4X6DE 4P2RD 3GIZL 2CKBB 1HYRC 1OT1A 3RP1A 1IC5H 4WHTA 3BKMH 3S8WA 3CDGA 3O2DL 2APBA 3ZE2F 1AE6L 3IYLW 5EN2A 5IFJA 1JBJA 3OKKA 3TN0B 3RGVA 1YJDC 3VFPB 5HI4C 1AI1L 4PJBB 4MNQA 4NKIL 3I75A 1XCTA 5EO9B 1M7IB 1P1ZA 1IEBB 5I8EB 1JF1A 5C07D 4EDXA 5TE6H 2FGWH 2DM2A 2YD3A 1EH9A 4XVJL 4U1NB 5JHDB 1VPOH 2UUDH 1OQOA 3MRQA 5JR1H 2YS4A 3L3GB 4J6RH 1I7RA 2X4NA 3ZTJH 1X7QB 2FB4L 2VUOA 3EYUL 5I74C 4UI2A 4UB0L 1LD9A 1TVHA 3RJQB 4XP6L 4K7FB 4OLZH 1WICA 3KNBB 3K4ZA 1V7ML 4G6MH 2FZ3A 1CBVH 2ZUQC 1D6VL 5KVEL 2NXZD 1QSEA 4JO2H 5JDSA 1FNEB 3WE6B 3V5HA 4N5EC 3R4DA 1LEIA 3O3AA 1T4KB 5J56B 3MRJA 4RMVA 4HLJA 2GUOB 3ROOA 4K7PH 4X9BA 2IFGA 2QQKH 3MFGB 4XRCA 3VRJA 2QQLL 4NIKB 3GJFK 4WIQA 3ZSTA 4G59A 5IG7B 1FJ1A 1OTSD 2HFFB 3AMLA 4GRLA 1VPOL 3UBXG 2F19H 5CIPH 3RA7L 5I1IL 3NIGE 5IT2H 5FYJH 4V1DA 1UWGH 4XPFL 2DQCH 4NWUH 2GJ6B 4WEBH 4PGZA 4WU5B 2FEDC 3C08L 1WCBB 4FXGB 5TFSL 5SWZB 4LGSB 1OT2A 3TH3T 3LPGA 5E24E 3EOAB 2FBOJ 3QDGD 3V7AE 3BN9C 2H9GB 3O41A 4XNYH 1BIIA 1J8HA 4JPIA 3MYZA 3BZEB 1NLDL 2R4RL 2J3SA 2EDYA 2P5WA 4ZTPH 4HPOL 2FGWL 4MMZC 3RUGA 1RUQL 3WIHA 3CC5A 3GGWB 2P5EB 4YO0A 3SDDB 2Y36L 4KKBC 2NY5L 2LTQB 4XCEB 4JREB 3U36A 5IB4B 4RFEA 4OCXL 3BAEL 1HDMA 1GRWA 1MJ8L 2DQJH 2XV6B 3LRSB 4FG6D 3WIHL 3QDJD 4PRPD 3S3JA 4LDEB 5H94A 1K4DB 5CLTA 1F8TH 5MI0B 4DGIH 5K9KB 2R56L 1BVLB 2G75B 4WW2F 5D7SH 1HZHH 1IEAA 4IJ3B 3T0ED 4Y16B 4C54A 1CWVA 1KJ2A 2IALB 2JB6B 4FFVC 3JVGA 3FB5A 2FIRT 2VZTA 2YD2A 1DN0A 3GBMH 3V6OC 4IMLB 5IWLA 5CEZL 2JIXA 4R4ND 1MLCB 1I9JL 1E4XH 2XKSA 4PJXA 1BZ7A 2HT2D 4YBQD 5EO0B 4DVBB 1CDJA 3IAQA 3U30B 5EORL 3U4BL 2CDEB 2JJTC 3LEXB 15C8L 1CGWA 1FGVL 1WBXB 5TDNA 4Z5RB 4JRYA 5CZVL 4MD0B 4AT6A 2ADIB 1UWGL 4Z77B 5DWUL 3VXMD 1E27A 2H2PC 1BX2A 3ZLQC 2EXYD 5IBLC 4QXWA 4HIXH 3UTQB 3MV9D 3VDCA 3WIHH 3LKRA 4DQOH 5D72L 1FGNH 3D69A 2MFNA 5E8NA 5EUOE 5J8OA 4NJ9H 4ENED 1DZBA 1S9WA 2YD5A 2VC2L 5IKCA 5E1HB 2AEQH 2H6PB 3BE1L 4NQEA 3OJMB 3BJLA 5DJ8B 3FQTB 4R97B 1CDYA 5J12C 5D93B 3VXUD 1YEJH 1YEIH 5F72S 3W2DL 5EUOF 5CILL 5DHYB 3PDGA 3VXOA 2VLRB 1N8ZB 4J8RA 2V2TA 4PBWD 4R0LB 3Q5TA 5CBEB 4J4PA 2DQJL 4GH7B 4M61A 4HH9B 1A7NH 3VCLB 4OI7A 1CD8A 3C60D 4J4PC 1AGCB 5JW4Q 3ET9F 4JCMA 4Q9BA 4NJAH 5E8EB 3OSKA 2NY2B 4PG2C 3SO5A 5IEKB 1CG9B 1P7HL 3NZHL 5C9JA 1BOYA 5DTFA 4O2FB 1LE5B 1T6VN 3ZKMC 3BP6B 3ME0A 3L5JA 1XR9B 5EU4B 1RFDH 2IPTH 2X42A 1JV5A 3FHQA 1CLZL 1NGYB 2YBRA 3ARPA 2FWOB 4NCC1 4IDJL 5TGBB 3WCYA 3WMSA 4I2XB 5LBSH 4C83A 2NXYB 4ELMA 5I1DA 4L9LC 4AY0A 5FM5O 3Q5OA 4OFYD 2NTFB 5GSRB 5L0QC 1TZGL 4G5ZL 1KJVB 4QHUB 5EU7E 5L88H 2AXFA 4PGDB 2D3VA 3HE6A 5HI3D 4ONGH 1RQ5A 1MJJA 5DK2B 1UM4L 5JOFA 4XNMB 3MCKB 4PRIA 1ZEAL 5DF0A 4JN1H 4L4VD 1BLNB 3O2VL 1CQYA 3GZKA 1N5AB 3WSQL 4KZDL 3FB8B 4OIIH 1WBZA 4K3JH 1LVEA 1KCUL 1ZK9A 3ARFC 4PRAB 1JZ2A 3GMOB 1VEOA 1BPVA 2VKXA 3QUKB 1E4XI 2IMNA 3OHXA 4LVOC 3UTTE 5HHVL 5KSAD 5HHNA 5HHNB 1H15B 3DMMB 2DL2A 1ZOXA 1LE9A 5DT1H 4PJ7A 3U6RB 3JTTB 3AC0A 3UTTD 2D9CA 5IVNA 4Z7OF 1Y6MR 3WNKA 4CL7A 1CTNA 1N5AA 1WIUA 3VFTB 2AKRA 12E8L 3GSNA 2EE2A 3AXLB 4MB3A 2A83A 2WK2A 1YEEL 3MOAH 5DK2A 5L0QB 2YPLE 1JPSH 3QNZB 5GZNC 1G6RL 1MHPL 3DO7A 1FZJB 4LMQI 1TPXB 2IADB 3LKQB 2XTJB 1OOAA 1NFIA 1CE6B 4PS4L 4RIRB 3TCLA 1ZEAH 3WKNA 4ENEC 1RSFA 4GRWE 2DICA 4ELMB 1ONQB 1HNFA 4LEOA 4ZQKB 1YY9C 3QNXA 3LAFA 4E0RA 2FJGB 2Y9RT 1X5AA 1S7VB 1Q9KB 3TNMA 4QRRD 2V17H 5ACLA 4Z0XB 4TPRL 4P4KA 4W68A 2QHRH 5FECB 3C09C 3NIFE 3HNVL 1XGRA 4NN5B 3KXFE 3HR5B 3V5DA 1FH5L 1CCZA 1V5JA 4MZ3A 4XHJD 1H3GA 4ODVH 4HK0B 4KHTL 1CFBA 2DQFA 1MY7A 3X3GL 3MR9A 2DWDA 4YBHA 3CX5K 1DBMH 1GYAA 4NQSB 5EZOH 2B4CC 3FN3A 3RZCD 4CDHA 4X4MA 1S7SA 4MJ2A 4K71C 2GAZB 2LU4A 1LO0H 4X8XA 3SCMD 3X13B 4UOW0 5EA0H 5JQ6H 1DANT 5E6IB 5CIPB 1A4JA 2DQGH 4HC1H 2B39A 4Z8FL 3AAZA 5C0FB 5C2BH 2AQ2A 4HZAA 1B6DA 5EU6E 5I18L 2CO6B 5CINL 2QR0A 5EU3A 3RDTA 3O6LL 3UC0L 1T04A 3HN3A 3FQTA 5FUOL 1NUFA 3MRCB 1JJUA 2VKWA 1GSMA 4WGVB 1XZ0A 3HI6H 1FG9C 5EB9A 7FABL 2ZNWA 4ZUUA 5JA9A 4MNQD 4B7IA 4HF5H 1HHHA 5DDHB 2BY0A 4JM4H 4NQXA 1I7UA 1S9XB 3U48A 4JDTH 3K1DA 4LVNC 2GJZB 3STZA 3D85A 1FNGB 3BEWB 3HTLX 3KYOA 2SEBA 4KRPB 2O5XH 3CZFB 2V2XA 5DGRA 1K85A 3VI3F 3TFKD 4QRPE 5FOBB 3QA3B 2CLVA 3RWEB 3VI4F 1P7KA 5SX4I 5F7MC 2NQCA 2ESVB 4CVZA 4HW6A 2HT4C 3SN6N 1L4IA 4HEME 5TH2B 3U7WL 2P42B 4O58H 3DGGA 1FYTB 4M6ML 4POYA 1G7JA 4IMLA 3RTQD 3V5KB 4KXZH 3HZVB 4N0CC 2VQTA 4LVHB 3BHBA 3S35H 2NY3C 3IDXH 2BNRB 4ZFGL 4JFYB 4Y1AE 2AI0L 1IEAB 4YDLB 1NBVL 3RY6C 3X3GH 4C56A 1RZFH 4XGZA 4LCIH 2EXWC 3TYFA 2BOCB 4JM2A 1Z9MA 3LRSA 4ELME 1IC7H 1AP2A 5B39B 3NZ8B 4D9RD 1SEBA 3ARGA 4OQTH 4NZDA 4JB9L 4Q0XL 2R1WA 3ERYA 1MCQA 2X4TB 3QCVL 4K3DH 1Q9WB 4S2SB 3X12B 3SJVD 4M93C 3TVMD 4JKPL 1INQA 2HRPL 2R1XB 2VDMH 4QOKD 2IJ0C 1U42A 3QFDB 4OZHA 1F90L 4M7LT 2ED9A 1MNUL 2P24A 4ZODA 2F74B 5AYQA 3ARBD 4YC2C 4OFDA 3RIFK 3BDYH 3EOAA 2DQEH 2YWYA 1HQRB 2BVQA 4ZXBB 3INUH 1IKNC 1XGPA 4KI5E 4S1RL 3DX8A 3D5OF 3EGSA 5F9DC 2D7OA 5HGDA 5A2KH 3MLZL 1MVUB 2WW8A 5D5ME 4ZFZA 4X6FA 4X6CF 4ZMAT 2B5IB 1WVZA 2GJ6A 3CVHL 3QFDA 3V0WH 1ZVYA 3EYSH 1UJ3A 5I15L 4HKZA 5EIVA 1RUPL 5JLZA 4GRLB 3EIFA 5JHLL 1QEWB 1I9RH 2WUBL 1OPGL 4OF3A 3UP1A 4ZNEE 4N0YH 1JI2A 1LO2H 2X4OB 1NFKA 4PJEB 3JXAA 1KB9J 5F1IB 5E8DH 5HGHB 5D5MF 2VWEC 2P5EE 4L29B 3T2NL 5IOPA 4O02H 4RZCA 4H5SA 3QHZL 4PJFE 4R2GC 4L4TA 1C5DA 3GI9L 1P4LA 2BOCA 1U8LA 4JM2B 1A6ZA 5IV2B 4YXKL 3EO1A 1L0QA 4JFDB 1ZHBB 4Q9QH 4I9WE 3V95A 3BZFA 1J0ZA 4GAGL 5HHXL 3MODL 1F4WL 3CLFL 5C86A 5C92A 4A6YB 1ZA6B 4R4FL 3L3OB 1RUMH 3FT4B 3PGFH 3T0XA 3B9AA 4LLWB 1FYTA 5HVHB 3S5LB 1FFQA 3CX2A 1UXWA 2R23A 5TH2A 3C2AL 3W39B 5CSGA 5DK3A 4MDIA 2ESVA 3LIZL 3H9HA 4R6UA 5AAWA 4L8CA 2BDNL 4M6NH 1BJ1H 3HAEA 5ID0A 2APXA 3C60C 4YHLL 4KJWC 2Q86A 2NYYD 3AFLA 5IQ7H 1HIML 4UQ2B 4I3GA 1I1YA 3S37H 3VFPA 3UJTL 5C0CA 5IEHB 4Y5XA 1KLUA 2LU3A 4WFHD 4HCRA 2A0LC 5B3JF 4OLWL 4LCYB 2R39A 3BDXA 3PHSA 2XACC 1HEZB 1J0HA 4KJPC 3TLRA 1MH5A 3KPQA 4P59L 3QQ3A 3I3EA 5ITFA 2VZOA 4XH2A 4S1DC 4G9FD 1S9VA 2E6QA 3K2UL 2VAJA 3D9AH 3OMZA 2FX9H 3QJFA 2IEPA 1VFAA 1IM3A 4QY8A 1BJ8A 1MCSA 3UPRB 1RZIA 4M5ZL 4G9FE 4Y4HB 4ZOEA 3ILPA 4U6TA 1A0QH 3P40A 4N8CH 2CRIA 1P7QB 4JFOB 1D6VH 3FZUD 2AAVA 1NCCH 1WGOA 5C0ND 3T2PA 2XN9B 4EJ1C 5F9WC 2EXYC 3DVIA 5IBLD 3MGAA 4WHDA 1S9VB 4QRTA 2X4QA 2NY6D 4YX2H 1KV3A 4X5LA 2AEPL 2VDNL 3H0TB 2Q20A 2X44D 4RWYH 4YHYB 5JNYA 1HHJB 3ILQD 2VJXA 5C8JA 4GG6E 3ARGD 3GSOB 1A5FL 3QDMB 3OR6B 1HHGB 3T1FB 5D1XA 3TJHD 5E99L 4QXGH 4PP2B 1RUML 1F4YH 4U0RB 3BSZL 2EYRA 5C0AB 1R3IL 5EO1A 2G60L 1GZQA 3C8KB 3PNWA 3SKNB 3E6FA 2AXGA 5GGTL 4DVRH 3N06B 5FKAA 1MFEL 2MQCA 1KSRA 2R56H 4H1LH 3STBA 2DLHA 2FJHA 2BVPB 3FQXA 4J2XA 1EZVX 1B3JA 3Q0HA 4JR9L 3LKNB 1BEYH 1MHHB 1Z9SA 4UNUA 1EAJA 5LGKA 4ZAKB 5LVEA 2DAVA 3SKUD 3L3OA 5IGXH 5CZKA 4NGHL 2XN9E 2Y36H 5C0BD 1HOCA 5EO1B 1JVKA 2UYLA 4HV8A 2HVJA 5CGMA 1B9ZA 1SY6L 2IMMA 3DXAA 15C8H 3T1FA 1OAQH 1C5DB 1SBSL 5BRZA 3QDMA 1QRKA 5IOPB 1ORQB 1KYOJ 5BOZG 2ED8A 5F3HA 3HG1E 3I50L 3O45A 4P3CL 3OXRA 3L3DA 4Y4FB 2UZXB 2X4QB 1A6PA 4JN2B 1B90A 4JPWH 4K07A 5IBTH 1N4XH 4Y19A 1KB5H 5CP3A 5TE6L 5HGGS 1T20A 1FIEA 3ARVA 5C0IA 4BA8A 1MAKA 2A6IA 3VRLF 1XGYH 2K9UA 3QEGH 2Q76A 3T3PE 5JPMA 2OR8A 3U4BH 1BLNA 4C58B 3MO1A 1XF4A 1XGPB 3F62A 4KJQD 5EPMB 1HQRA 3CJJA 2R29H 2BVOB 4HBQA 4X99B 4KJYA 3QQ3B 5EU5A 1CDUA 3WN5C 1JGUL 4Q9RH 2AXFB 4QHKJ 1A2YA 1HEZA 1JGEB 1BZ9B 5JHLH 1K2DB 3SE3C 4I0PC 3ARFD 3L5XL 1JZ6A 1KACB 3QIUC 3GJFB 1J7VR 3GHBL 2FR4B 1CBVL 4XXDA 5F6HJ 4FABH 3Q6FB 4YK4C 2E27H 2UV3A 2F5BL 4D94A 3BRGC 3MYJB 4FTVB 3RVUD 3WIIH 2O5YH 2FATH 5FYLL 3JUZA 3SPVA 4JANA 3T0AA 2O26U 5GGRB 3HAEG 3BP7B 3QHTC 4JVPA 4EUPG 3QXTA 2IPKB 2BHYA 4GAJH 4XZUB 4QRRA 4ONHA 3OPZH 3FO1A 4KROC 2G9HB 2APVA 1ODAA 1RFDL 2CIKA 2IPTL 1R0AH 3ARFA 1UWXK 3EDJA 3CVHB 3DSNA 1DE4B 5J6HB 4NOFA 3WNMA 2MCPL 2XNAA 3WXWL 2DS4A 4RBPK 1Q0YH 1J18A 4QHNB 2WP3T 5C0AE 5HHOD 3DOSA 1S7WA 5DHVH 4OFVA 5CFHA 4GUPB 1GC1H 2I07A 1RAMA 1GAFH 2X1OA 1DN2A 3Q48A 1J0KA 5HDQL 3HE6C 3PJSB 5HPMB 4Y4KA 2C3VA 4L8BA 4ONFH 3NCJH 1HCFX 4M1CC 1P7KB 3BH9B 2F5BH 4OM1L 4PD4K 1WFOA 3V52L 3WNPA 4PJEA 3RWGA 2FBJL 2P45B 4F58L 2Z35B 2GJZA 1A7OL 4EQ2A 3OAZK 2PYFB 3N1PC 3PL6B 1S9WB 3OB0K 4NO2B 3TZVC 2CH8A 4GMTL 5JOPE 1IKFL 4IOIB 1H5BA 4PYGA 1CDHA 1NUNB 5F1OB 4I48B 5FYJE 3MCG1 1N59B 1NCWH 4MVBA 1WZMA 2WBJD 4OIAA 2F53B 3GRWA 2NX5D 2DYPB 1QKZL 3ARDB 5DJAA 2QR0B 1EO8L 1MQKL 1JF6A 5H37H 2WANA 5CEZH 4LDLB 5D2LE 3LS4L 2VLJA 4KK8D 5C0FA 3DPBA 4I3SL 2I9TB 5FOJA 2HFGH 1CICC 3BKCH 4GFTB 3ZTJG 5EORH 3KR3H 5DD1H 4EN3A 3AS2A 4K23L 2Q3ZA 4Z7VB 4IRJA 5C7XL 5JZ7D 4YLQT 1FYTE 1DN0B 2UWEA 3DECA 3MR9B 2IALA 4Y16A 4HZLB 5ADOL 4CMHB 1Y0LA 1TMCB 4C56E 5DJZA 2JCCF 2W60A 4FFYH 4ZD3H 3B6SA 3MJ9L 5FCSH 1RZ8B 5DMGC 5KTEH 5JW4N 1YPZA 5D1QC 3BRDA 1JWSA 2FB4H 2ITDA 3AREC 1B4RA 5DJ6A 2BCKB 3OAZH 5F8QC 2A1WL 3MLRH 3EYOB 1ND0A 4NJ9L 3DBXA 3VGDA 4PLOB 3B9KC 3QUYB 1KGCE 4EDWH 2GEEA 4JEGB 1S9YB 4PJ7F 4HIXL 3SDCB 1KUMA 3TNMB 4JR9H 1PQZA 3Q6GL 3LEVL 1S7VA 1LO4H 2P5EA 2NNAB 1YMMD 4PD4J 3QNXB 4P0DA 2CLZB 1KCVH 1I7TA 4GKSA 4N0CD 1PZUB 1I9JH 1D5XA 2NW3B 4QRQA 3RNQA 2YSSA 3QFJD 3VFUA 1X5GA 2WSKA 4PJ9C 1NFIB 3UBXI 5FOBA 1RIHL 2IADA 3LKQA 2H9GA 35C8H 4UINL 1KGCD 2VDKH 3PWJA 5FM5M 1Q94A 5F93C 2SEBB 2YD7A 1FVEA 1RI8A 1XGQB 1M05B 3ZDYF 4WGWB 3RRQA 4FXGA 1NCWL 1A7QL 1YECL 3QISA 5T3ZH 3V4UL 4GKOA 4PBVC 1NGWB 1RJZA 3IFNH 1FORL 5GS3A 3WS6A 4JPWL 3DJ9A 4H25A 1F4XL 1NGZB 2R2BB 2PCPB 3H3PH 3TT1L 1Y6NR 4RAUB 4XRCB 5C07B 3VRJB 4KKNA 1AO7E 1ZV5A 1NFDA 2NPLX 3RY6A 2EDNA 4RQQB 2X7LA 3B2UD 5C7XH 4JRWA 5IROA 4FQXC 4WW1B 4CUCA 5CEXB 4NZUH 2VABB 3QZWG 5HYJE 4R26L 2FZ3B 3OKDA 4NCC2 1UWXH 3P0YH 5GHWH 5IVZB 3P9MB 3FCTA 1KTKE 4RSVA 4Q6IB 5KBNC 5JZ7C 1MI5E 1U8MA 1E4WH 2H8PA 3BOVA 4FABL 2AGJH 4G8GE 4IRSC 4PV9A 4F15C 4HPYL 2X4NB 4TVPH 5B21A 3WSQH 3S36H 5TGBA 4JPKH 1BQHG 1IARB 2IAMB 4M8QB 4G80A 4Y5YC 1I1AA 2Q87A 4U7MA 3CVIL 1S8DB 3LPWA 3V4VH 4DAGL 1JF1B 1ZWIB 1Q9KA 4GMSH 1G7IA 5I1HH 1R3JA 4PTTA 3BGFC 3FQUA 2R0KL 4TOYH 2C3XA 3ES6B 1I4FB 4MJ6A 2HG5A 3HI5L 4XPHL 5IFJB 1JHTA 1IC1A 5DRWA 3GUTA 4K3GA 1KJMB 5T1LA 1WEJL 1FL3B 3QDGB 4X9FA 2EO9A 4KV5E 1C8PA 1WF5A 1FDLL 5L6YL 4EQ3A 4MD5A 1KN2L 2VLRA 1MIMH 1MI5B 1IL1A 1R3LA 4OQTA 3TBTA 2X2YA 2YC1B 2B0SH 4TTGA 1KT2A 1BD2B 4XVUC 3QCUH 4Z7WA 3OKMA 1QFWM 5EBWB 3IVKB 4JFQA 4PJ7B 3U6RA 4G43A 3DV4A 1FPTL 2DI9A 3HNSH 4JO3H 4YPGB 4OLXH 5MEQB 5IKCB 5TE4H 2KQNA 2RBLA 4X9IA 1J1OL 4HFUH 3NACH 2QHRL 2JCCE 2WZPD 3MBEA 3WFEL 3KPTA 1FVDB 1CR9H 2FO4B 3UTQA 4HKBA 5HI4D 4OI9A 4ZTOH 4PRIB 3CZJA 4RFOL 5D1ZC 4ZUTB 4XNZB 2J1KA 4LSRL 4Z7VF 5INDA 2JJUA 1EAPA 3BIAX 3NFNB 5ICZB 3NGBB 2EXWD 4MB5A 4ODSL 3HUJE 1MCPH 1FO0H 3EDDA 1ROWA 3MJ7A 4ORGB 5DEFB 1I1AD 1IAKB 1NGXB 1BZ7B 2BFVL 2BSTA 3SOBL 5LWYH 4Z7VE 2VISB 2YMXH 5CJXA 2UVEA 3UC0H 3IKCB 1FFRA 2PKDA 2MHAB 2OXHA 4XPBH 3T1WA 3BP6A 1W72H 1YNTB 4PJ8C 3RL1A 1C5BH 3GHEL 2XWJA 4MAYA 5C0JB 4AIOA 4DKDC 2DMKA 1A6UL 43CAB 3Q5YA 5ISZD 3PWNA 1EV2E 4TSAL 3IAPA 4U6YA 1S7QB 5HGAB 3ZMRA 2FJFB 2IH3B 2VLKB 3FOLA 2OI9C 4U3CA 3U36B 5FA4B 4JM2F 4LCUA 3ZKNC 4OZGF 1A9BA 1PG7L 4YO0B 3SDDA 1J05A 5TF1H 5I6XC 1KLGA 1FFPB 3QCUL 3TO2A 3SDAB 4FFZL 2MJWA 4UV4L 3VXUB 2CXGA 4WFFD 4Q97A 4LIQL 4PJXE 1EHLL 2A73A 4LOUD 3VH8A 4QTHA 5FGBC 2FJFA 3PDDA 5D71L 3JV6B 3PWPD 3EDFA 5E9DD 3MLXH 4UNVA 1YEGL 3WD5L 1N2RA 4AEIL 2HFEB 2FSEB 2GTWA 4EUPH 5A40E 1B4JL 3MRGB 1RURL 5I16A 3T4AB 2E7LA 2EDKA 1HE7A 5C0DA 1IJ9A 3PIQA 4LLUB 3AU1A 3PHOA 3LKRB 1JFMA 3P30H 5MEND 1EBPA 3L1OH 2BSTB 3C2SA 5I8OL 1CF8H 1JYNA 1I85C 5D1QD 1J86A 3MRJB 1NAMH 3VJ6A 4G8IB 4HKXA 1WAAF 5ICZA 3IXTA 2EH8L 3GIVB 4WI4A 5SWZE 1P9MA 3RY4A 4Z7QE 3BPNC 3P73A 3QZWB 5DUBA 1JGDA 4EVNA 2UY7A 3TM6A 1QSEB 3QO0B 1R3IH 3ARZA 2NXYD 2VZ1A 1JPST 4H26B 2EYSB 1P9MC 1G84A 5TQ0L 4HIEB 3GI8H 1RZJH 5CZXC 1MNUH 3BP4A 4BELD 5DURD 5JOPD 1CGVA 1T22A 4LLUA 1NDMB 4HLZG 3B5GA 3TYGH 4WHYH 3B8YA 4ZOAA 1CXHA 3RTQA 4PJ8D 5H94B 3VXNA 5D70H 3IFOA 4I77L 4A6YL 3LMJL 3MUY1 5D2NC 4IS6B 3LN4A 5FV2A 2ZSWA 4JG0L 5I8EA 4EDXB 5I8OH 3VWJB 1IC7L 4RA3A 5E00A 5CEZD 3WJLC 2YC1A 3I75B 3D6GA 3QXDA 4BK5A 4YBLC 2IC2A 5K9JH 1FFPA 3MSPA 3WHXB 1RUPH 4OM0H 1A9BB 2P5WB 1QRNA 5I18H 5IMLA 4HWZA 3NABL 1B4JH 2I26N 5DRWB 4WFGD 3CPLB 1S7QA 4P2RA 2CKBA 1QLEL 1EVTC 3TA3A 4RNRB 4OF8A 4PP1D 3HE6D 5HYSB 2C1PA 5HHME 2V7HA 1Q72H 1LNUB 4OIBA 3SE4A 3DRQB 3BDYL 2MKLC 1ZT7A 5SV3A 1SY6H 4KK5D 2V5YA 1BF2A 5EULV 4V1DB 1HI6B 3SE4C 3QYCA 2I24N 3OWEA 3FTGB 3WN5A 1KPUB 4P5KA 4X5XA 3RWDA 2X4SA 1JGUH 4Q9RL 3OF6D 5I1JH 4WFHE 2X4RA 3ROOB 1Q0XH 1A1OA 4Q9CA 4WI9A 2AV1B 4NN7B 1EAPB 3NFNA 2BXYA 2NW2A 2VDOH 3ULUH 5JORB 1RHHA 5DK0A 2OCFD 1DQLH 4Q6IA 3RZWA 1AGFA 4TSCL 5D8JH 1JPTH 4ZUTA 5ID1B 5I1GL 2CMRL 4FNLH 5DRXA 1HHIA 1JPGB 2NR6C 2YRZA 2OYPA 3VMNA 1QLEH 5CEXA 2ZJSH 1DVFD 5J06A 2G5RA 2XXCB 1O0VA 5F70A 3WYRA 4MJIE 4NN6B 3SCMB 1AO7A 3HMWH 1QD0A 1N5YH 3U2SB 1A1OB 4RGMC 3HA0A 3EYVA 1H0DB 1E6OH 1IGJB 1T5XA 1SBBA 4BSJA 3O3BB 4GLRI 1IE5A 3HG1B 2V5SA 3IXAB 5MEQA 2P48B 2WAHA 4MMXC 4CVXA 3WXVH 4JFQB 2W9EL 1JNNL 5E70A 4ODWA 4DK6A 4G7YL 5BW7C 1IEBA 5CJQL 5IB2A 1XIWA 3I9GL 2OQJA 3TWCH 5JIIA 4ELMF 5D7LB 1VADA 1MI5A 1T3FA 4YGVA 3F7VA 1UA6L 1I3GH 1J5OH 3D18B 5IVOA 5I8KH 3PV7A 3OKKB 4RWYL 1MFBH 3BKYL 4PJFF 5H2BB 3CPLA 1CICA 5FYLD 3PABB 1RUAH 5T3XE 3EOTL 4JAMA 1JHTB 4WRLA 4LMQE 5E2UL 3I02A 3K8LA 4KHXL 4QRQB 4XWGL 2NW3A 2J6EA 4S1SH 5DD5H 3IU3A 4PJ5D 4XVJH 4AH2B 2HH0H 1CFNA 2J4WL 1ZS8B 4MA3B 1KG0A 3NAAL 4XC3L 2HT2C 3DUSB 3L9RB 4UB0H 3ZYOA 1XGTA 2ESVD 4YE4L 5IJKA 1JCKA 3HS0A 4KZEL 2XRAH 4PJIB 4FQ1L 2A6JB 4J3UA 3EYOA 3PV6A 3EOYG 3V9FA 5DLMH 3O9WD 5E8DL 3NCMA 3B9KA 4WNQA 3V0VA 4DTGH 5DVNA 4MDJA 5CJQH 2BNRD 3W11C 1Y0LB 2ZUUA 4IIQA 3T0EA 4TULH 3H7BB 4EN3C 2CMRH 1P2CA 3G5ZA 4MA8H 2PO6C 5EOCH 4UILL 2BK8A 2X9YA 3QBTB 4LLVA 1N64L 4CN1A 2DKMA 4U0QB 1OAZL 4OCSL 4OGAC 3P4OB 2GSIA 4G6KL 5FIEA 3QZWA 4U1GC 5EOTA 2I9TA 3HB3D 5EU6B 1TJHH 1A64A 1AXSB 3GIVA 1EO7A 4NFDA 5DA0B 3WHE1 3S36X 1M71A 1M7DA 3ILQC 3D0VB 1UM5L 1IGYA 2QBWA 3KWWA 5I1EH 1BREA 4UQ3B 5IT2L 2CK0H 4KDTC 3ARXA 1H8NA 4Q7DA 4ALAL 2PCPA 4QOKB 4XP6H 3VE0A 4WVRA 3BT2L 1N59A 4ZYKB 4H1LA 5C0NC 1CLOL 4YHLH 3QUMB 4JFFD 1CE1L 3MACL 4LF3B 1DFBH 5KVDH 4L3EA 1X4ZA 3ULUD 2XWBB 3QULB 3OKLB 1D9KA 1Q94B 4G8GD 2D4FA 4X83A 3RWGB 1G9MH 3NCEB 3U9UB 4CAGA 4S1SL 3JV6A 1LP9F 2EE6A 3HE7C 4ORZC 1HYSC 1XGUA 1FZMB 3GSQB 4GRLD 3MFFB 2DLFH 1ADQL 4BZ1L 3BN9D 4LPVA 5CD3A 5ELIA 1JHLL 4AL8H 4Y4KB 4JFFE 3VXUA 5GS0C 4LSQH 4M4PA 5GIRB 5GRUL 3WJJC 1JPFA 1R5VB 4KU1A 1FORH 5KOMC 3C6LB 3WS6C 4GUPA 4OV5A 2ADGB 3G6AA 5L8KB 5E6ZA 2M26A 4HK3N 1S7WB 1CU4L 2IQ9H 3R1GH 1S9YA 4RMSA 1FLTX 1SJHA 3GB7A 4GOSA 2NY4B 4U6YB 1BAFH 4YDIH 2EKJA 1TETH 3O2VH 4EI5C 1HSBA 3AROA 1H5BC 4MAYB 1DBBH 3EYQD 2WV3A 4AYFA 1S5IL 3D25A 2W60B 3OJ2C 5DC0A 3SGJC 2NZ9C 2H1PH 2OXGA 4PJ5E 1S78D 1FC1A 1EZVY 2R29L 2X6MA 4NO0B 3SDXA 3CFJB 1LO5A 3SPVB 1HH9B 5J1TC 1JTTA 3M45A 5I2IB 3BAEH 4XNQA 2YPVH 4AMKL 1G7QB 1FAIH 4FZ8L 4WDIB 3Q6FA 2J6EH 5DJCA 4DVRL 5I2IA 4NP4H 1AR1D 1NJ9B 3NOIA 1UM4H 4LSQL 3CFJA 4HUXB 5FYKL 3HCVA 3ARDA 1XR8A 4OI8A 1CDCA 4K94L 4QF1A 5GSVA 4LDOB 2K1MA 1U2CA 3IDNB 5IW6A 4GMSL 2EIDA 3OJDA 4NZJA 3FN0H 4JKMA 1KPVA 2O5ZH 1BBDH 2DDQH 1H5BB 5IMKA 3FO0L 3PF2A 1DP0A 1M4KA 2ICWA 5DHVA 2J5LB 1ZVSB 4XP9L 3OL2A 3C6LA 3UZEA 3WIFA 7CGTA 5F9JB 5FYJU 3OGCA 4Y4HD 4PRHE 1T1ZB 3BEVB 4Y19E 2DQCL 4NWUL 4NKDB 1NAKL 5DWUH 2IG2H 2OTWB 1NC4D 1A02N 1B0RB 1A6WH 2BSED 3QDGE 4OF5A 4KY1H 4JVUA 5IJVA 5K9OB 1EBAA 2F54E 1CXFA 4K9EL 4G8EB 3MLTB 5CEYB 5GPRA 1BD2E 3IDGB 5T1LB 2HFGL 1DL7H 3SKJL 3MOBH 1MRFL 3GUTB 4GT7A 5E1AB 5HHOA 4WU7B 4KHXH 4XWGH 5L2KE 3KYAA 5EIIB 4FXKA 4HFWA 5BV7H 2BZDA 2CIIB 3LQZA 3NFSH 4FA8A 2MWCA 4LLYA 4MQ7A 5DUML 3KHQA 2GYSA 4XCYB 2DDQL 1EGJL 4IDJH 5IB1B 4YFEA 3ZKQD 2WWMC 5A16B 3F58H 1E4KC 4BKLB 2P1YA 4LSUH 5EU6A 5D7IF 4NRZB 4GS7C 3G6JA 1P4BH 3P4OA 3LS4H 4TVSa 2IG2L 3MYJA 3AM8A 3IT8D 3WUWG 4MA8L 3SKMA 3FB6A 3OR6A 35C8L 1S7UA 3LEYL 1HHJA 2FH6A 5C8JB 1EUUA 2V9RA 3G5ZB 3KPRA 1FL5B 1OAYL 1RHFA 5KSBA 4M00A 4KJYB 5EU5B 2GSGA 3VH8G 1QVOA 4EN3D 3QUZB 4G42A 5H8DA 5DFTA 1RJCA 2QLVB 3Q1SH 1KENH 1KFAL 2XN9A 2YN5A 4LPUA 3L7FB 1HINL 1C5BL 4NRXB 1NDGA 2IAND 4JCLA 2NX5A 4PLKC 1U3HD 3BZDA 4M48H 4WCYH 2JJSA 3AS0A 4XBEL 3NFPA 1VSCA 4WEMB 1VFAB 1G6RH 1MHPH 3NCJL 3VGFA 5GRJL 4CN6A 6FABL 2PTUA 4OJFH 3C9NB 4F9PC 4ODBD 2V2WA 5M95B 1TZHB 2VXSH 5D1XC 2F58L 1I8LC 1RJZB 2VH5H 4P3DA 4XC1L 4K94C 3SKJH 3LY6A 2CUMA 4AEHH 5KSVA 4F9PA 3MV11 2ZNXA 1UYWH 1C5CH 2R4SL 1ITBB 1QA9A 4U1JB 3VXUE 1LO3L 4H88H 5DI8B 1TDQA 3QDAA 4YGVB 2WINA 4F2MA 4UQ2A 3DXAD 2Q86B 1ADQH 5LAXB 4U49A 3FRUA 2DQIH 2DM4A 3HAEB 3GBNL 3LSOB 4LHUD 5ID0B 4O2CB 2BC4A 1MCLA 2PXYD 1LHZA 5EZJA 1WZLA 4KKCD 1ZLWK 3QXAB 3L95B 1I7TB 4GKSB 3HG1A 4F80A 4MX7A 2XZQH 3OG6B 1CK0H 4QRRE 4XB7A 4WW2C 3KYKH 4JDZA 5FKAB 4XCNB 3VG9C 2EYTA 3TBWB 1I85A 1CL7L 2C4XA 5E95B 1R3HB 2BCKA 2OL3B 3AUVA 1JHKH 4ONOA 1KTRL 3SJVE 2ID5A 4OTXH 1ZHBA 4R7NB 1HXYB 1GIGH 3NH7L 2XWTA 5I1CL 3QEQB 2M2DA 2OM5A 3A6OA 5EBLA 5L7XH 5ADOH 3P0YL 1NANH 1SYVA 4J1UA 3TT3L 3KPSE 5JNYB 4KVNL 4JJ5B 5KS9E 1ZLWH 4UT9H 1TNNA 4FQHB 1LP9A 5T1KD 5C0GB 3EZ8A 4V3EB 4XVTL 3BISA 2Q7NA 2VXUH 4WTWA 1R3KB 1KPUA 3QUMH 1FV1A 2RCSL 5FYKU 4L8SA 4ZSOE 1XCQB 4ONGL 1F58H 4P9HC 2ICES 4HG4K 3ILPB 4ZFZB 4RCAA 2R2EB 1CICD 1BFVL 4WO4C 2EEAA 3QT2A 1OL0A 2GT9B 1T1WA 1MH5B 3KPQB 1IGTB 3NIGF 4YFDB 4IBLT 4HBCH 2FHBA 1U91A 3R06A 3VXMA 4NNYA 4UOJA 3DX6A 4NO2A 3FMGL 4ODTH 2P8LA 3EO9H 5F7EL 2HJFA 2XOTA 1TQBC 5AZ2L 4G5ZH 2Z4QA 5BZDB 4G6AC 1NC2A 4HHAA 2Z31B 2Y5TB 3RWCB 3TA3C 3TZVD 1UH4A 3P4NB 1BF8A 5HHXH 3DYPA 1FO0L 5DVMA 5D70L 4K9EH 3FB7B 3H9HB 4IDLA 1FVCB 2E5EA 5ECJE 5CP7B 3VGBA 4F8QA 4XP1L 3VWJC 5HDBE 4AEFA 3VXNB 5F7HA 2YD4A 5FDWA 4KC3B 3VG9B 2W38A 2Y6SC 4WW2B 5C0CE 3C87A 2EE3A 1MWAL 3MC0A 2BNUA 3W0WA 1G7PB 3LKPA 2GCYB 2CKBL 1BBJA 2XTJE 1L9MA 4D8PB 1CLYH 2P47B 3WFEH 1DE4A 4MLSA 2VLLA 2ZCLH 3G6JE 2A9NL 4PJCF 4M6NL 2VZ3A 2A74A 4GXVL 3JVGC 4MAUH 5FDWB 3TESA 1FNLA 5DS8B 3QPXH 5CP7A 3RX7A 4PGEB 3FT2B 4FQJL 4KV5F 4L4TD 4KMLB 4HPYH 1F4HA 2YKLH 5GGRA 4NHUE 3NN8A 1FNSH 5I1GH 4TUJB 3FKUS 3RWCA 2DD8L 2VN4A 3BPNB 5HI5D 4ODVL 3VD4A 1TENA 4TRPH 4GW5A 4LIQH 4PUBH 2FLRT 4PS4H 3O8XB 4XXDB 3V4VL 1ZHNB 1FE8H 2R8SH 4NNYB 3ZKXC 1DBJH 1EPFA 4G8GA 2NZ9D 1LQVA 4KKAD 1GHFL 4JZOB 3NVQA 3C5ZA 3BKJL 3FONA 3MRHB 1ZE3C 4LLDA 3BKML 3KXFA 4OUUA 4ZUWB 5GJSL 1EXUB 2HFEA 1XIWD 5GGTH 3WDHA 2CJUL 4UDUB 1QO3A 2P7TA 1NCBH 2AXHA 5DD3L 4BUHA 4M48L 4WCYL 4P2QB 4M62L 1ZGLP 1YPZE 2A73B 1ACYH 4CADB 3QUZC 4IOSD 1EX0A 2DJSA 4KJPD 7FABH 3GMNB 4IRJC 3AAZB 2MSPA 2JELH 5BMFH 1I8KB 1YMHA 3VGAB 4OZHF 2W65B 3RDTC 1UT9A 5C0GA 4XP1H 5IIEB 4K2UH 2R69L 3OXRB 4P2OA 1EUTA 1BVKB 2AJSH 4PRIE 1X5LA 5B39A 3PWNB 2D7NA 4U6HA 4LCWA 3RBSA 3P4MB 1F11A 4TUOA 3RA7H 5TDPA 1FRGL 5D7KD 3TYFB 4AQOA 4KI5C 2WWMD 5IJKC 4Y5VA 4XGZB 1QSVA 3V5DB 3I9GH 4WHCA 2X9WA 2HWZH 1KXQE 1OAKH 4DGVL 1V7MH 4DW2L 4OD2A 3WEXB 4MS8A 3OZ9L 3VXQB 2UZIL 2KUTA 2H2PD 2CR3A 3I2CH 3UO1L 1A47A 3QUXD 2H26A 2QL1A 3TJHC 1IAKA 1NGXA 4OLUH 4GW4A 3DGGB 2E7CA 4KKLC 4OLWH 4PRHD 3REVB 2DIJA 4CVZB 5CUSL 5JW5A 1V3LA 1DQDL 4NYLB 4WUUA 1AD9A 4MQXD 3SO3B 2EIZA 4M7ZB 4FXLA 1FIGL 3P4LA 2DF3A 3FRUB 3M17A 3JWDL 3CZFA 5F7DB 3DO7B 2NY0C 4XXCC 3GNMH 4Z76B 1BHGA 2CRYA 4NQUA 2AJSL 4WUKL 4UTAH 2XQBL 1N0XL 3KPNA 3GSUB 2R0LH 3O9WA 3D1MC 5FUCE 5D1ZB 4HWBA 3T04D 3MA7B 2IFFL 2VDRH 3WIIL 4I0KA 4F7CA 4WWKC 3RL2B 4N0UE 3MJ8B 2HRPH 2VDML 4BFGA 1F58L 1J11A 3DVGB 5DQDH 5EBWA 3IVKA 1RZKC 2VXVH 1W0VA 3OR7B 4PREA 3RGVC 5DMIH 4PRAA 4M8VA 1PEZA 1EHNA 4UIMB 4XPAH 2ZG2A 4NRXA 5F97E 1WBZB 1A3LH 3B5TA 1IM3B 4QY8B 5SWZD 1H8OA 3QCTH 1J8HD 3PG2A 3LZFH 4M3KB 4RMUA 2VDPH 3MRFB 3FZUC 4S1QL 2G2RB 5DSCB 4HLZH 4DK3A 3K81A 3GO1H 2GAZA 2LVCA 2FYYB 4HUWA 1EA9C 1CIUA 3CSPA 4MNGE 5GRVK 3QEUB 3VGEA 4KK9C 4OCLC 2H32A 1GZPA 2W07A 4ZFFB 2ATKB 2DLTA 4X6BA 5DJ2B 1G7IB 2VDRL 2FWOA 3CDYA 1ZWIA 2YBRB 1UB5B 1DCLA 3KYNB 1JV5B 1VCAA 4S1RH 2GY7B 4NPYA 2D4DA 3OKOA 3A67H 2MCPH 2NYYC 4MSWB 1LE5A 1SBSH 4X6BB 4N5EA 1YEJL 1VERA 4BZ1H 2GHWB 4LEOB 2VO5A 2IAMC 4XMPL 3F5WB 3LN5A 3JZ7A 2WBWB 4X7SL 5E1AA 1WWBX 3VD3A 2OJZL 2FYYA 3O6FC 4IRSB 3BZFB 2AJUL 3EUUA 4EZMA 5M94B 4XPGL 1BQHA 4G8EA 1UJTA 2GITB 1N8ZA 4I4WA 4J8RB 5CHNA 2VLKD 3N1FC 2AKRB 4CJ1A 3SQOL 3TBYB 1U3YA 4Y1AD 4NC1C 3ULUC 1CVRA 1I1FB 4GAGH 4NBYB 2VXVL 4YH6A 3ZDZE 3SDDD 4XAKE 5E08L 5DRZA 5T5NG 4Q74A 1NUDA 2Y5EA 4GRMB 5F9JA 3QIWC 2QQKL 4EKXA 1UJ3B 2HKFL 4ETYA 4S1QH 5E9DB 5CD5C 2OX5A 1EJOH 3CSGA 4LSTH 5D1ZA 4NM4H 3P9LA 4YNYA 1EFXD 3IDNA 1JZ4A 5F88A 1E27B 4EI5D 2PYEB 1A6WL 3SGKC 1ZGLB 2Y06L 25C8H 4HQQH 4ZTPL 1G9NC 4Z5RA 3BO8B 4OZFB 4DTGL 1Q9LA 1INQB 5JW5B 4QEGA 5FYLH 1DL7L 5IR1B 4KI1A 5FYKD 3BH8A 4QCIB 3EJYC 3FO0H 5FUZL 4RA0C 3V6OA 3RIAF 3FQNA 3LH2L 4XNQB 3T65A 1IGML 2JK5B 1K6QL 1O5DT 3N50A 4OQ1A 3QHFH 5C9KA 3E3QE 5E4EC 5F21B 2VSDA 3WFCH 4YE4H 1ITCA 1PFCA 3QG7L 1JNLL 2EC8A 4X7EC 1Z5LB 5DJ6B 3G6DH 5B3JE 1UCTA 5K9KA