1K5PA

Hydrolytic haloalkane dehalogenase linb from sphingomonas paucimobilis ut26 at 1.8a resolution
Total Genus 107
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
107
sequence length
295
structure length
295
Chain Sequence
SLGAKPFGEKKFIEIKGRRMAYIDEGTGDPILFQHGNPTSSYLWRNIMPHCAGLGRLIACDLIGMGDSDKLDPSGPERYAYAEHRDYLDALWEALDLGDRVVLVVHDWGSALGFDWARRHRERVQGIAYMEAIAMPIEWADFPEQDRDLFQAFRSQAGEELVLQDNVFVEQVLPGLILRPLSEAEMAAYREPFLAAGEARRPTLSWPRQIPIAGTPADVVAIARDYAGWLSESPIPKLFINAEPGALTTGRMRDFCRTWPNQTEITVAGAHFIQEDSPDEIGAAIAAFVRRLRPA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Haloalkane dehalogenase LinB from Sphingomonas paucimobilis UT26: X-ray crystallographic studies of dehalogenation of brominated substrates
pubmed doi rcsb
source organism Sphingomonas paucimobilis
molecule tags Hydrolase
molecule keywords 1,3,4,6-tetrachloro-1,4-cyclohexadiene hydrolase
total genus 107
structure length 295
sequence length 295
ec nomenclature ec 3.8.1.5: Haloalkane dehalogenase.
pdb deposition date 2001-10-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00561 Abhydrolase_1 alpha/beta hydrolase fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1k5pA00
4MXDA 5ALMA 3WK4A 1TCCA 1THTA 5JASA 2VT7A 1E66A 1EDDA 5C8XA 2QJRA 3H18A 2O2IA 3HI4A 2XMBA 2WUDA 5DYWA 4HXFB 1GGVA 2XE4A 2PUJA 2WIFA 4AO7A 4FLMA 4J3JA 1K6EA 1CVLA 1UXOA 3ICVA 2XUGA 4Y2PA 1R9NA 2UZ0A 3K2IA 1C7JA 1N8SA 5AICA 1X2EA 2B4KA 2PVSA 4PNZA 4AO8A 5ALGA 4GHWA 4WJLA 1CLEA 3C6ZA 1XLUA 3CN9A 4FFVA 3RKSA 3M82A 3ZLUA 4KEAA 1A8UA 1ORVA 3H2KA 4A5SA 2CBGA 3FWHA 4OU4A 1H23A 4JUIA 4QDXA 5A7HA 1H22A 4CI9A 1GQSA 3W2TA 3M81A 3C6XA 5LLSA 3M3DA 3LLCA 2OG1A 3DKRA 4RE5A 5LZ4A 2QUAA 2ZYRA 4Z49A 2PM8A 4QZVA 3LP5A 1N5MA 1CUYA 3B5EA 4U2GA 4B9EA 1MX1A 1MX5A 4JNCA 4B84A 5AK3A 2WHPA 1WB4A 2PSDA 1XZHA 4J0CA 1MO2A 2Q0XA 1GT6A 5BV7A 3K6KA 4FBMA 2ZJ6A 5CXXA 2FJ0A 2G5PA 1DWPA 3ZI7A 5BWBA 4EHBA 3QPAA 4WDRA 4NVRA 5CH5A 5JARA 4FTWA 1H2XA 3FLAA 3PUIA 2ZJ7A 5JD4A 1CEXA 4W1QA 5AM0A 1OXMA 1O6FA 1IZ7A 1CUXA 2WFLB 1R4ZA 3STTA 1EDBA 1Y7IA 4QDOA 1AC5A 1FFCA 5DYTA 1TCAA 3RK4A 1YB7A 1XRPA 4KACA 4MEBA 4PF1A 2Z8ZA 5FV4A 3WZMA 1QIKA 3NGMA 4DMFA 4KRXA 2QRUA 5D6OA 4AMZA 2P8SA 4Q3LA 3DDUA 2R8BA 2GBCA 4DIUA 1MAHA 4BDTA 1JI3A 3F67A 3F8SA 5LZ8A 4WCVA 3C8DA 4EY8A 2H9YA 4P92A 3BWXA 1KEZA 1XRQA 1IUNA 3E1GA 5LZ7A 3D0KA 5A71A 3R3WA 3DJYA 4B80A 3DYVA 4UBIA 5HF8A 4QDZA 2B9VA 4ZRDA 1UOPA 1WHTA 3L1HA 4DNFA 1QO9A 5AI8A 1BE0A 2V98A 1LPNA 5LZ2A 5ALJA 5E4TA 5CT5A 1YCDA 4C4XA 1CUUA 1J06A 1J2EA 2GYVA 5AKJA 3V1MA 3GBSA 2ZYHA 2Z8XA 1EVQA 3M83A 1ZD4A 2BUBA 3S8YA 1XZCA 2VJDA 1AGYA 3KXPA 2HM7A 1DWQA 3X3HA 3FNBA 1AURA 1SOMA 3G0IA 3QMVA 1P0QA 1UOOA 3C43A 5FXMA 1DWOA 4QLOA 4IH4A 5AO9A 1B41A 4AX4A 1LPPA 4X6UA 1K5PA 4K2AA 3ZLTA 1ACLA 2OQIA 4BATA 3WA6A 3HEAA 1BEEA 1A88A 2IITA 5JAUA 4P08A 4B83A 3FVRA 5AOAA 3RARA 4LYEA 3PFCA 4WFKA 1IMJA 2CZQA 1LBTA 1XKTA 3WIOA 1QFMA 3V1LA 5AI9A 5CBKA 4B9AA 1ZI6A 3WI7A 2FUKA 3UMJA 4BCCA 1DU4A 1MT3A 1QIGA 4X92A 5AI5A 5H3HA 2JF0A 1XZKA 4Y7DA 2B20A 3QYJA 1SCQA 3IDAA 5JAOA 1NX9A 3AFIA 2BJHA 2HU7A 3FSGA 3WL6A 5E2IA 4BCDA 3VJLA 3WJ1A 2G5TA 2Y6VA 1N5RA 2YYSA 5FOQA 1JMKC 4P9NA 2ONCA 4UFOA 3QMMA 4LYDA 3H2GA 1XZIA 2DQYA 4IHAA 3ANSA 2WU4A 1E89A 2QS9A 1SCIA 3H1BA 4Y2YA 1P0PA 5AM2A 1CUHA 5K3AA 1IUOA 3NUZA 4GBGA 2OCGA 3WYNA 2PKYX 4H7EA 3V1NA 2WJ3A 1CRLA 1R50A 2QXTA 3D59A 3BJMA 2RAUA 2NW6A 3PUHA 3NOXA 1MU0A 2I3ZA 4BP9A 2QM0A 3STUA 3E3AA 4BRSA 4FNGA 4MYSA 5LIPA 4QA9A 1MTZA 3W06A 2QMQA 3H2IA 5BWCA 1GKLA 1WPRA 3STXA 1CUJA 2RI6A 3ESBA 5KBYA 5HFAA 2QR5A 1GPLA 1R88A 3TRDA 3IUJA 1JKMA 1FFAA 3U1TA 5A62A 1BROA 3D5EA 5T4HA 1Y37A 4Q3OA 5AI0A 2XUOA 3WIBA 5EHZA 3HXKA 5C8ZA 2WM2A 3I2HA 5FPQA 1P0MA 4B81A 2OCIA 5AKEA 3CN7A 3IUQA 4W1RA 4X94A 3ZWQA 4W63A 1QO7A 3AZQA 4ZV9A 2GBIA 5DNUA 4FDMA 1EDEA 4RGYA 3W9UA 5T4EA 2R11A 1CUEA 4BZZA 4BBZA 2QJWA 4HAIA 3FOBA 2HU5A 3QM1A 1CUAA 3H1AA 4GEGA 3DOIA 4MWSA 1ACJA 5EI5A 5HF5A 4B82A 5ISMA 2WIDA 4BDSA 3ICWA 1ZD2P 2WIJA 1CUCA 4BP8A 1THGA 3D4LA 5CH8A 4ZREA 4FLEA 3BJRA 1AMNA 1ZI9A 1XZJA 4F21A 2HADA 4EZIA 2XUFA 5AM3A 3EQ9A 4CG3A 3G9ZA 1HDEA 4X6YA 5HFNA 5ALLA 3WKBA 3KOOA 4WY5A 1WCYA 4N8SA 2C58A 1H2YA 3FYTA 4QDUA 2ZYIA 3I28A 4AB1A 1DX4A 2GBFA 4TGLA 1QIMA 4PW0A 5CH3A 1E5TA 2QXUA 3AZPA 5SYNA 2XQJA 1UK7A 4KE8A 5AKIA 1EH5A 3KDAA 4J0GA 2W22A 1YAJA 1AKNA 3V1KA 5AJHA 3R41A 4ZGBA 6YASA 5AKZA 4MEAA 1IZ8A 4JYPA 3Q0TA 3NWOA 5DYYA 2JGEA 5AKLA 1RYYA 4DMKA 1ZJ5A 2ZJFA 3C70A 2H7XA 5FKJA 1BN7A 3F97A 1UZAA 1BCSA 1F8UA 1ZIYA 4Q05A 3HABA 1QIDA 4UHDA 3STVA 3OC0A 4C87A 2XUPA 5K5EA 1HPLA 3OURA 1R9MA 5JAPA 5FPPA 2HDWA 3F9CA 3QPCA 1W1IA 4FLFA 4E11A 1XRRA 2VF2A 4UHBA 3HRHA 3PDCA 2O2GA 4DSZA 1W6RA 1MN6A 2JEZA 1GPNA 1QOZA 2OLEA 3ZPXA 3I1IA 1N1MA 4JYMA 2WIKA 4X71A 2XUKA 2QUBA 2H7YA 1QE3A 2G4LA 5AOBA 4BAUA 2V96A 1UK9A 1ZI8A 3IURA 4HXGA 4X85A 1DT5A 5D7BA 1TCBA 3ZV7A 2HA2A 2XUHA 3WWEA 4M0EA 4OB8A 4MJ3A 2YXPX 4Y9SA 5JZBA 3O4IA 3VJKA 3VVMA 2OQVA 1BU8A 3H19A 4QEKA 3SC2A 2O7VA 3O4GA 4DTCA 4Y2XA 1E8MA 1XRMA 3QITA 2BCEA 3R3YA 5ALIA 4DYHA 4ZXFA 3AJAA 1XZAA 1CUWA 2WLSA 4H35A 1R1DA 1XZEA 3G8YA 2WTMA 3I2FA 1LPMA 2PPLA 4W1PA 4A23A 1PV1A 3UUEA 2XUJA 3VXKA 3STWA 3FLBA 1BEZA 2WHQA 5IVHA 2HHAA 2HIHA 2PUHA 4MQMA 5BOVA 4G9EA 4LIPD 4H77A 3H17A 4OD0A 2RONA 4QLAA 3G0DA 4EUSA 5A7FA 3BIWA 1K8QA 4UBLA 4YASA 4IO0A 4CG2A 1VXOA 1Q0RA 4CCWA 1DQZA 2J4FA 3I2GA 4J03A 3O9VA 1EXWA 1USWA 2CEKA 3DYIA 4BAGA 4BTVA 2XQIA 1KU6A 1G42A 5EIEA 4QE3A 1ZD3A 2I03A 3A2LA 3HC7A 3PI6A 1MNAA 2RHTA 1AUOA 4Y2QA 4F5ZA 4PSDA 2AJLI 4X3CA 4YK7A 1LPOA 4UHEA 4YX9A 4KE9A 4Y2UA 3HSSA 2OGTA 4O08A 3VDXA 3H2JA 1YA4A 4H7KA 5HQ3A 5AIBA 2PSFA 3EQ7A 5JATA 2LIPA 4C6HA 4OYLA 1CV2A 4UHFA 4LXGA 3D7RA 1LGYA 3R3ZA 2QTBA 3HLKA 2HA6A 4Q82A 4S0XA 2J3DA 3O0DA 4CCYA 4H0CA 4DM7A 5D3KA 4I3FA 5AH0A 2WKWA 1GXSA 3PF9A 4PV7A 1AZWA 4AN1A 2BFNA 2CMFA 3FCYA 4H7DA 5AKXA 2XI4A 3A2MA 3WK8A 3IUNA 5LZ9A 5ALOA 4L9AA 1U65A 1QIIA 3WL8A 1MPXA 3I2JA 1XQYA 4DNPA 3I6YA 3G9UA 3C5VA 3FCXA 1TRHA 1QONA 2YH2A 1SC9A 3IBTA 5KREA 4ZI5A 1MNQA 1EX9A 1S8OA 2X8BA 4UFNA 4UBOA 5AI4A 4EB0A 3DL4A 4J0DA 5ALYA 4DMCA 2VT6A 4NZZA 1A7UA 5JZ9A 2VJBA 1WPXA 1YS1X 1XFDA 4L72A 2JGKA 1XRNA 4G4GA 5ALQA 5C7YA 4X97A 5CRIA 5AK4A 1Q84A 2WFMA 3EQ8A 2JGJA 4N5HX 5CURA 3DEAA 4BE9A 2HA7A 2X5XA 1QIHA 1DX6A 3G9XA 3R0VA 3QPDA 1UKCA 3F96A 1XROA 1TQHA 1QGED 5CT9A 3C87A 3W05A 5DTIA 1PJAA 1W75A 1LBSA 3S2ZA 5CT8A 5ALNA 3EF3A 4UUQA 4ARAA 1YB6A 1UFOA 1XZLA 4J0KA 1BS9A 1Z68A 3T4UA 4P93A 4UBJA 5AK6A 2BGRA 4KE7A 5AP9A 4Q3KA 3MUNA 4F60A 2VJAA 2JIDA 2XLBA 2XMRA 3A70A 4OUKX 3DQZA 4UFPA 1LZKA 4AXBA 3D2CA 1OCEA 4NMWA 3OG9A 1YAHA 2XUDA 2XMQA 4AO6A 3H2HA 3QBJA 2DSNA 4G5XA 2EDCA 1EB9A 5AKGA 1B6GA 4ETWA 5JD5A 4E14A 3WKEA 1K63A 3CCCA 4WY8A 2XUIA 1ZICA 1Q0ZA 3U0VA 4X93A 4KJXA 1E8DA 4V2IA 1UK8A 1ORWA 4AZ3A 4K6KA 3IB3A 4GLBA 5EHQA 2CUTA 1GPKA 4KAFA 3I1YA 3O4JA 4OB7A 5C8VA 2IIVA 3QZUA 3WZLA 1VE7A 5D3ZA 1AQLA 4X00A 5EIHA 4BYMA 4EY6A 2VATA 4FFWA 1PFQA 4X7BA 2DHDA 4FNMA 5AHXA 1KU0A 4Q34A 1MJ5A 1CUDA 1JU4A 3BDIA 1DTEA 3PF8A 5A2GA 4H7HA 2ES4A 2HFJA 4DNOA 2WJ6A 2HA4A 4CFSA 3I2IA 2X76A 3GROA 5HQ3B 5DJ5A 3VKFA 1JU3A 4YPVA 5SYMA 1CUZA 3ESCA 4GDMA 3JW8A 1ETHA 3ED1A 1M33A 3EBLA 4INZA 4I4CA 5ALXA 1VA5A 4WFJA 1P0IA 2BUCA 4BAZA 1VE6A 2IX9A 2HRQA 2XQGA 3A6ZA 3FBWA 4LXIA 3WK9A 4H7IA 1FFBA 4CCYB 2ZVDA 5HCUA 2BUAA 1A8QA 2B61A 3PICA 2XB6A 4X6XA 1U8EA 2ACKA 3IUMA 2J3QA 5AI6A 2DFPA 3RLIA 4CIAA 4JEIA 4ARBA 2WG2A 1QIEA 3BE8A 4EY5A 1WB5A 3D3NA 4FKBA 4RE6A 1C7IA 2XUAA 1G4HA 1UK6A 3EIOA 4OCZA 1YSCA 1ZGBA 2AJBA 5JD6A 4G8BA 3WQHA 1UWCA 1WM1A 4B0OA 2DR0A 4KR0A 3TEJA 3ANTA 3WKAA 2VSQA 5CT6A 5ALFA 5DLPA 4L0CA 3H0CA 3C45A 4HVTA 2HU8A 3LCRA 2ZSHA 2GYUA 3WK7A 2WG0A 2WILA 4G4JA 5LZ5A 3GELA 4U2CA 4E46A 3B12A 4Y2VA 2C0PA 1XQWA 2V9ZA 3DLTA 5ALDA 2AJ8A 5JADA 2V97A 4BZWA 1O6GA 2DHCA 1WHSA 5AM4A 3JWEA 5I7UA 1HBJA 3QMWA 4OPMA 4J0JA 1DQYA 3E4DA 3KSRA 3WWOA 4U2BA 4D9JA 3DCNA 1TIBA 2K2QB 5FUMA 1U4NA 1CPYA 1GKKA 3IVMA 4BE4A 4BTLA 2YASA 2XQFA 2BKLA 2Y2VA 4XVCA 4B0PA 3O9MA 5EHXA 1CUGA 5I9IA 1F0NA 3SK0A 1ZGCA 5K3BA 4Y2TA 4A16A 1DINA 4Y2JA 5DWDA 2C4HA 2C5GA 2HRRA 5T4BA 5KWIA 2C5FA 3WLAA 1XZDA 1XLWA 2AJDA 5FDFA 2BAGA 2CB9A 2PSJA 2HA3A 5CT4A 5AKYA 4GW3A 3WWPA 3WWCA 1VOTA 2OGSA 3QVMA 3WKDA 3H04A 4K6GA 1R3DA 1E8NA 2VEOA 3N0TA 4KRYA 4EY7A 5AOCA 2WJ4A 5CMLA 1CUIA 3UUFA 1QIJA 4BVJA 4KE6A 2EDAA 4Y2RA 5LP1A 3Q8WA 1L7QA 4DLNA 4MQLA 4MYDA 1FSSA 5HK8A 5K3FB 4LKOA 5ALUA 4GWLA 2CKMA 1FFDA 3FYUC 1T2NA 4GI1A 3P2MA 2XUQA 2VQ6A 2WU3A 1ZOIA 5DNVA 3DS8A 4G8DA 1X2BA 5ALRA 3C6YA 4K6HA 1XQXA 3HZOA 3IIIA 2JGMA 5ALEA 1GZ7A 1D07A 4HS9A 1X70A 1HLGA 3JYHA 4N8DA 1EA5A 1YS2X 1G5FA 2AXEA 3WA7A 5AM5A 2DHEA 2XLCA 5FRDA 1K4YA 5IVDA 3A2NA 2HA0A 3WMRA 2O2HA 3WWDA 4AZ0A 3DKKA 2WG1A 4IH9A 5T4FA 5JAHA 5IH7A 4XX1A 3WL5A 2FJPA 4XWGA 3FVTA 5EIAA 4OB6A 2WUFA 3AUKA 1JJIA 5HF6A 2Z3ZA 5JALA 4GECA 3FAKA 2OCLA 4HRYA 4DNQA 3LIIA 3I6ZA 4MWTA 1UKAA 4OSEA 2WUGA 4PSCA 1ZIXA 1HKHA 2XMCA 4B7ZA 1MAAA 2WHPB 3GFFA 4FBLA 2ORYA 4UBKA 3AIMA 5E4YA 1W52X 5EFZA 1XRLA 1C4XA 1CUVA 5AKHA 4RNCA 2W6CX 1CQZA 1WB6A 4Q1VA 3FLEA 5AM1A 1EINA 1J07A 1HQDA 2AJCA 4DSAA 3WL7A 2GZSA 1VXRA 1YR2A 4ZWNA 2J4CA 2JGLA 2GZRA 4HXEB 1Y7HA 1NU6A 3STYA 2ZSIA 1VZ2A 1LZLA 2Y1KA 5AK5A 3I2KA 1IUPA 2VAXA 4J0HA 4J7AA 2ZYSA 2D5LA 1WOMA 2FX5A 2Y2UA 3WYDA 3PE6A 2XMDA 3DD5A 3LIPA 2GYWA 3ESAA 2WFLA 2QZPA 2PX6A 4WDQA 4B6GA 3C8HA 4NS4A 2OGZA 4E15A 5HF9A 5C81A 3AINA 5CTAA 4OYYA 1XZBA 4ROTA 1XZGA 1VJ5A 3KWJA 5AIAA 3V9AA 4AMYA 1EVEA 1SCKA 4G8CA 3W9BA 5ALWA 5F4ZA 2WFZA 5JZSA 1ODTC 3FSGD 4UHCA 1EK2A 3WJ2A 5AKKA 4K5QA 5HK9A 4KAJA 1E3QA 5ALPA 2PU7A 3GA7A 3R40A 1CR6A 1I6WA 4PSUA 4G4IA 1L7RA 1TAHA 1TK3A 5ALVA 1SFRA 2JEYA 1LPAB 5DNWA 3ZLVA 3DNMA 4AQDA 1BCRA 5LKAA 4UBMA 4FMPA 2WIGA 1JJFA 5ESRA 1DT3A 1QIFA 2GBGA 4GXNA 1RP1A 2EEPA 3IA2A 1W4LA 2XMGA 3PFBA 3VJMA 2CJPA 1XQVA 1BRTA 1CIJA 3BF8A 4JH0A 4Y2SA 5EGNA 3AZOA 2H7CA 3FYUB 5KWJA 3GZJA 2C7BA 2G63A 3T52A 3WK6A 2XMSA 4L3WA 3ILSA 4N8EA 4C89A 4UBNA 1JFRA 1YASA 4J0IA 5IVKA 4XJVA 1LLFA 3MUOA 2VTVA 5DTJA 3L1IA 4X91A 4FOLA 1LPBB 5FP0A 3KD2A 2XMZA 2O7RA 5K3FA 2HL6A 3G0GA 3BF7A 4TPKA 3HYSA 2JGFA 3F98A 1JMYA 3AIOA 1VKHA 3OM8A 3MGAA 5K3CA 2DCMA 4C01A 1ZJ4A 4FWBA 4PQEA 5JIBA 4UPDA 2JBWA 1W76A 4FHZA 4G1FA 3O4HA 3SX4A 1ODSA 2JGIA 2QKYA 2HFKA 1MX9A 5JYCA 1T4MA 4X95A 1FJ2A 2WSLA 4H7JA 5A6VA 4N5IX 1BN6A 4EY4A 2XQKA 3SWWA 4HRXA 4QNNA 1J1IA 3IULA 1UOQA 4BVLA 4RPCA 2RIPA 4DMHA 3K9BA 1IVYA 1G66A 4CIBA 4QWWA 5HZGA 2Z5GA 5ALZA 1QJ4A 2VAVA 1A8SA 4EA6A 2H1IA 4W1SA 1CUBA 1VZ3A 3E0XA 3YASA 5FLKA 2PU5A 1RWQA 3HACA 1XKLA 1CQWA 4M0FA 1AX9A 2PBLA 4G9GA 3MVEA 1U2EA 5I8PA 5E4JA 4XIIA 5YASA 5J3JA 4WFIA 3W04A 3R3UA 4BRZA 1EI9A 1QFSA 3OTQA 3C5WP 1LNSA 5LYYA 1H2WA 1ZD5A 3TJMA 5LKRA 4TVKA 5K3EA 4DGQA 2QOEA 3G0BA 1EB8A 3CCBA 4LXHA 5ALSA 5JANA 4QDTA 2Y6UA 4U2EA 2RHWA 5IVIA 2E3JA 3G0CA 3B3QA 2WHRA 2OAGA 3OOSA 5IKXA 4AN0A 3WKCA 1CUSA 2OAEA 4B85A 2D0DA 2RGUA 3D2AA 4BB0A 2PL5A 3BL8A 2VJCA 2OXEA 3VVLA 1LPSA 2HA5A 4C88A 5CXUA 3KWFA 2XDWA 3QH4A 1ISPA 4LHEA 4EBBA 1FFEA 3TGLA 3AILA 1YA8A 3ESDA 3WK5A 1OILA 4HZGA 5HKBA 4CG1A 4IH1A 4IQ4A 3HJUA 3C6BA 4U2DA 4C4ZA 4H18A 3R3XA 2Z3WA 5EHNA 3BXPA 4KYVA 1UT6A 2WQZA 4UHHA 1QZ3A 1NU8A 2QT9A 4I19A 3RM3A 1EK1A 3G9TA 3DL7A 2QVBA 2PSHA 4F0JA 4PO3X 3DOHA 2OPHA 4BC0A 3L1JA 5K3DA 5HKAA 3VISA 4M0MA 1HL7A 2WTNA 2VA9A 1F0PA 3D2BA 3CXUA 3BDVA 5ALTA 1XLVA 2I3DA 2PSEA 2C0QA 2ECFA 3O95A 5ALHA 1L7AA 2XT0A 1XZFA 3I6MA 3R3VA 3V48A 1XZMA 1EHYA 5A7GA 2BGNA 3BIXA 3G02A 4U2FA 5ALKA 4HTAA 2OCKA 1QLWA 1JJBA 4BC1A 4BCBA 1JT2A 2ACEA 4ITVA 4KAAA 1QTRA 4C4YA 1VA4A 3LS2A 3OPMA 4X90A 3FYUA 5CW2A 1CFJA 3GUUA 3N2ZB 4OU5A 2ROQA 4ZV7A 2I78A 1ODCA 2WUEA 3G7NA 4BVKA 1UKBA 1Q83A 4W9RA 3AIKA 1H2ZA 4QWMA 1QTIA 7YASA 1TKRA 1VLQA 1GQRA 2DQZA 1CUFA 4H7FA 1F6WA
chains in the Genus database with same CATH superfamily
2IEZA 4OJMX 4X64B 3OFSA 1NW3A 1DDGA 1QCDA 1VYVA 2WLTA 5I7AA 4FGZA 4TMZA 1TL7C 3W34A 1QP8A 5GM2A 4MUIA 4WSOA 2YHBA 2J5QA 3S40A 2QHXA 4GE0A 3NVDA 4YIKA 1RRKA 2CNOA 4DCOA 4KZPA 4EAAA 3KOWA 1RJFA 1J5XA 4PTZA 3C24A 1J42A 3V5NA 3OU6A 4HAXA 4DA6A 1ZMOA 1YJAA 1AU9A 1X1TA 2GSWA 1DDOA 4L5BA 5DSXA 4M0LA 5H59A 2CXQA 2AZTA 2DWUA 4FCVA 4G0OA 3WQBA 1Q92A 1VL6A 2Y0BA 1R5OA 2PEZA 2PV7A 3DWIA 1CETA 2QR2A 1NVEA 3IQEA 3NGLA 3NXKA 2FW8A 4NU0A 3LVFO 2XGJA 4Q19A 4HHEA 1SG9A 3C4JA 1XMOB 4I66A 4LWZA 3RPEA 2WIFA 3HVKA 4CEJB 3ZVKA 3OZRA 1D2MA 2PXHA 3PB3A 1K6EA 5J2TF 1A82A 3T3HA 4BNFA 1HLFA 1UXOA 5AJYA 5BRJA 1JEYA 1U2DC 2XUGA 2W6OA 1CY1A 1HNZB 4G0NA 4DLWA 3E81A 1UXGA 4YCLA 1NW5A 1X2EA 3L0BA 3LI2A 2FPRA 2PVSA 2MTBA 1OLXA 3KHSA 4LAFA 1NG1A 3L0OA 4XPIB 5L4LA 5TV2A 5G4KB 2O3RA 1I6KA 2FWIA 4LCJA 2C5LA 1JIQA 3FFBA 3L4EA 1PJZA 1CNEA 3QVVA 4Q48A 1JKJA 1VRVA 5L8VA 3C16C 1N3LA 2L69A 1W0JD 3H5AA 2CNLA 4UUPA 4YAEA 3E03A 3IEVA 1VMAA 3IKJA 2BEKA 1Y0BA 1EGQA 1L5LA 4JBHA 3NVMB 4FVTA 1WDKA 4I7EA 3O2SB 2IUEA 1ZNYA 3S27A 4A5SA 2CBGA 2WJJA 4AG5A 4RMGA 1T36B 4WNYA 2IVZA 5BR4A 3LDUA 5EMMA 1ESDA 1YD7A 1ISJA 4EW2A 3AJ9A 2OZVA 2P2GA 1JVNA 5B6IA 4GLOA 1H22A 1KOLA 3W2TA 3WNZA 3A10A 5B64A 3C6XA 5LLSA 2OG1A 2VHQA 3LC7O 1CQIB 1O6ZA 1P4JA 2G7MC 4FEYA 4HEA1 4N6GA 3WX0A 1V8OA 1RTKA 2VVTA 2V6JA 3M5PA 3E35A 1HI9A 4ZKEA 3RHTA 4C4SA 5A4DA 1WV1A 3DKRA 1QG6A 4JAVC 2F7SA 4OLFA 2ZYRA 3G5TA 4FFMA 3O91A 4UVEA 2VXBA 4YJDA 4QZVA 1FMLA 4K3VA 1YZYA 2KYRA 3NU1A 3SXUB 1G2QA 3LTNC 4ESOA 2XTZA 4XFJA 1MX5A 4F45A 5EAIA 3PR3A 4B84A 1RPNA 4NU5A 2QPAA 2RG7A 4DB4A 3CUYA 3OQ6A 3VZCA 2OCXA 4GL2A 5FNVB 2H52A 2YHIB 4TTTS 1YR8A 2JS7A 5D51S 2PSDA 2OWEA 3AB7A 3FPGA 4J0CA 4KPGA 4EI2A 5CK4A 3SBXA 1M72A 4XYEA 5IWAB 2ZWOA 1A9XA 3ZDYB 1E1RD 2QYTA 2HCTA 2Q0XA 2FW0A 5ECDA 5FWYB 4CT4B 5BV7A 3K6KA 3G1WA 2QE6A 4TQ9A 2P9CA 4FBMA 4AWXA 4Z53A 621PA 2DPGA 3LBYA 5LCXA 5EKXA 3EA5A 2HT6A 2I9KA 4K0KB 2G9RA 2PZJA 1A97A 1NP6A 3FTPA 1DTWB 1Y80A 3PUJA 1U0EA 4UE6A 4ZTUB 4XCXA 4LQDA 4LY0A 1O8BA 4A8PA 1USVA 4FOPA 4BO4A 1M2HA 1G98A 3RLFA 1QRRA 1ZCJA 4IGKA 2D7DA 5ECWA 2P2ZA 4FCCA 3H5NA 3FLAA 3K0FA 1BGWA 2I6FA 2HHJA 2CK3A 2ZJ7A 1R0SA 3AHDA 2EXXA 2J67A 3B8HA 1B1AA 3L40A 2HLDD 1LSSA 1K98A 2BMVA 3H11B 5AM0A 3SP1A 5IJZA 4WHMA 2O5EA 3BFVA 2OCYC 3QI2A 3RHZA 1C7FA 5CYGA 2G83A 1OXMA 3AUTA 1KDTA 1QFJA 1X9GA 4QKQA 2V54A 1KSGA 1NXQA 2ZTLA 2KB0A 4JBXA 1T9BA 1B16A 4RTRA 2ZPAA 4OM8A 3BB3A 5C37A 1PWEA 4QAQA 4FZVA 3D9QX 3ELYA 1Y7IA 5GJWC 6LDHA 4W5WA 4HT3B 4BY9E 2WPDA 4PAOA 2J0SA 2OD2A 1GAWA 3EQ2A 2WKSA 1L2TA 3RK4A 1XVVA 3KS9A 3WISA 1M2VB 1SK8A 4LQCA 4KACA 1OZAA 5FWAA 1ZSVA 1RQ2A 4PANA 1Y4SA 4YDSA 4CM1A 1U0JA 2R751 5KTMA 4JJIA 2WHYA 2HI0A 5C34B 4EHJA 4EY3A 5FV4A 4A26A 4LJ6A 1T1GA 1UZNA 3IDFA 3DG9A 4EHKA 4L2IB 3HPQA 5K0SA 3BMOB 3QJ5A 4DMFA 1K66A 2AOWA 3WYAA 3QBTA 1N9GB 1W35A 2Z56A 4YYEA 1KAOA 2OD7A 4BX9A 4YRNA 1NG9A 1O57A 5A5EA 3EZ9A 1M76A 2AN1A 1T5OA 3EZ6A 5D6OA 2Q1SA 1DTSA 1NW6A 1RBZA 3WMWA 4L8VA 2R8BA 3W78A 4LZJA 5BNIA 2GYYA 3QLJA 1FW8A 1WULS 1G8HA 1NVKA 5AQEA 3MJRA 2BFOA 4CLRB 4ETMA 1V3TA 4W5RA 3R7FA 1W48A 5BYAA 1SCUA 1JI3A 3F8SA 3FNHA 2FN7A 1ZSNA 2FCRA 2DAPA 2QGFA 3OU7A 2L42A 2B30A 4GMHA 3SSNA 4DZTA 2PTHA 2OC9A 4WXEA 1ICEA 5H7XA 3EXFA 4QYTA 4OQPA 2QN7A 3SR0A 4E33A 1R0CA 2YYYA 4OSPA 3Q8LA 4E5MA 2VLBA 3X1JA 1MVNA 1G7CA 1KEZA 1XRQA 3VZBA 1WXGA 3ZCPA 1FX0B 5LP6C 4ZYLA 5CX1A 2QTHA 5JAMA 5E95A 3MTEA 3E1GA 4F3NA 1A7JA 2ZB7A 4PTYA 2Y4NA 3D0KA 4GP9A 1NN0A 2HZ7A 1X7YA 2HSJA 5AR1A 3PL1A 4KFCA 1CF2O 4V39A 3JTMA 3PPWA 2IWRA 2UV8A 3D02A 2D4AA 3LSTA 4TLBA 1ZY2A 4TSFD 1WHTA 4EYGA 3NHKA 3W6PA 1P62B 1LNZA 1MDBA 4RACA 2BFFB 4TVBA 3O74A 4XB6B 1NYLA 4I1YA 1PK9A 3ABOB 3GC6A 4KAXA 4ENTA 1BE0A 1AVTA 2G82A 4XD7A 1UBHS 3V1TC 1JHZA 6NULA 2V98A 3FW1A 10MHA 1DRVA 1YDGA 2GXAA 1BVYF 1JLLB 3Q85A 5EJ9A 3UPUA 1UBUS 2DFNA 3N58A 3G5UA 3M6XA 1YTLA 1YOBA 1ZA1A 3I34X 3NX4A 3NWJA 4ISBA 1OE0A 3O1HB 3DMTC 4V1CB 1NFQA 2HXYA 2CD9A 5ENDA 3V1MA 4M1SA 4DL9A 2Q41A 2EWWA 2M32A 4PZYA 4D02A 4PG4A 5GIPE 1CXZA 3OMWA 1H6BA 3GBSA 4WI1A 5CB4B 2CLFB 2Z8XA 5FHRA 1EVQA 3M83A 4H59A 5I3ZA 1N1GA 4D74A 1QYCA 4R05A 3ORRA 4W9NC 2QI9F 1SBIA 2Z8YA 5LA6F 4DY4A 3L84A 3SY8A 4ZZ2A 1YR6A 3IPLA 3U80A 3BWYA 3A04A 3CRW1 2HM7A 3EHEA 3LC2O 1KO5A 1JILA 3A1CA 3WGHA 3EVEA 3F6YA 3OZXA 3RSHA 2VDWB 2WWVD 3MCVA 4GLJA 7GPBA 1R27A 1AURA 3WO0A 2GWHA 1YL7A 2PZBA 3QMVA 4NG4A 1DC6A 1HV8A 3AF4A 1QYVA 2YZ2A 3LFUA 3TSCA 3O3NB 4YT5A 1DWOA 3LU1A 4I9NA 3V8QA 5LIPA 1X94A 2EHDA 3IODA 1UINA 5I51A 4MKGA 3PXDA 3S2EA 3NM5A 2RBGA 2WT9A 2ALJA 1GXSB 1JE0A 1ARZA 1LK0A 3BK1A 4NDNE 3FH0A 3WLJA 4YMVA 1K5PA 5C52B 2ZRIA 4IQ0A 2I7VA 1CY8A 1QUFA 1H94A 4NWIA 4E1AA 3ROMA 3V32A 1SKAA 4B76A 2KQUA 4BATA 4FZ5A 5JJ5A 5IX8A 3B5JA 3EJWA 1N5LA 3PNSA 1WNFA 4QU9A 4YI5A 1PR2A 1T3GA 1UC4B 1UFKA 2F2TA 4JBGA 3EY4A 5JQWA 4UVDA 3U5TA 5LOVB 3WA6A 2QSJA 5LSAA 1RYEA 2IITA 2XZDA 3NWPA 3ZCRA 3EH2A 4YRPA 4BFVA 5JAUA 1MAWA 3VZPA 3NM6B 2QRVA 4FONA 4PCAA 4L0MA 3ZE9A 4IMJB 2XWSA 4UM8B 2ENUA 2JLVA 2EJCA 4C4RA 4QUDA 3G2HA 3BH7A 1QNFA 1A2QA 1IWPB 4LYEA 4BQSA 4EABA 2RDMA 1QGOA 4WFKA 4UNIA 4DDKA 1BGXT 1LBTA 1IXYA 1HA3A 3TX6A 1UWVA 5FLYA 1EE2A 1QFMA 4OK6A 4JUFA 4RJJA 5G4KA 2QRHA 3IOEA 4IFIA 3HJNA 4LE1A 5KJFA 1D9XA 2C29D 3DWEX 1K2WA 3IP6A 4QUIA 4ZAGA 3WI7A 4UFPA 1S0UA 4JY7A 4NR0A 4QSMA 1DU4A 1L5OA 1QV6A 3U62A 5LU9A 2JF0A 1XZKA 3B1WA 1XJ0A 2R1UA 4TXHA 4ZRMA 2BBWA 4ER0A 4V02A 4FB4A 3CX3A 4P4NA 1RRPA 4Q3NA 4D79A 1LWOA 1OXTA 2P1RA 3IDQA 3F9RA 3OZEA 1Z0AA 3C8MA 2V0CA 3D7SA 1M0WA 3N8HA 4IO1A 4Z8XA 5MN4A 1E3SA 2BJHA 3F1LA 3H3JA 5KJ6A 2A4MA 3ZQKA 4ZVSA 4QO8A 1OREA 3TMKA 1X77A 2J9ZB 3LXUX 4OYRA 3L7MA 3GMIA 1E0AA 4H2DA 2ZXEA 3KQHA 2JJ1D 4MB6A 4PGFA 1U8XX 2CBZA 2Q3DA 4HFMA 1CDZA 3F1KA 1KRXA 2UUOA 3C3XA 4EW1A 3G6KA 1OGJA 3ZNQA 4D5EA 2Z2JA 2OM2A 5HCIA 1A4XA 3GMDA 3WHKA 5K8CA 2RK4A 4JLDA 5AKEA 4P2BA 3EPHA 1KAQA 4KFRA 5HDQA 3SXUA 4AP5A 3ZHTA 3ADCA 2AZMA 4BO2A 1ZJ6A 221PA 4DCMA 1TU4A 4YJGB 3CRQA 4ZPXA 5JVDB 3PIRA 4M1EA 4DV0B 4MV3A 5HZHA 3A4IA 3ANSA 4NFLA 1G6HA 1L1QA 2FSHA 2VDKB 1Z35A 1GEGA 4F93B 1EG2A 4YRSA 4CETA 2QMHA 4FD2A 1LLDA 3NHPA 1LS6A 1G60A 2AOXA 4O4HB 4C05A 5KUTA 1RCUA 3WLKX 1PL0A 3G1UA 1GPJA 2PUGA 1MXHA 5EJEA 3RUEA 1I3OA 1NSYA 2B6NA 4IZ6A 1T1RA 4HZIA 1DFHA 4XM1A 2CDBA 2J5KA 3JRNA 3L79A 2OBNA 1B3RA 5AM2A 1QC5A 4IOKA 1CUHA 1QUEA 1T2CA 2M6RA 3A6LA 2FUEA 4NY1A 4GOMD 4Y6GB 3DVRX 2IIPA 3GLRA 3PDJA 4BBAA 8OHMA 1U7WA 3F73A 2WNSA 1UAAA 2YINC 4U3JA 1G1AA 1K7FB 2R6JA 4WN3A 4C76A 1Z6YA 3UHJA 2OHGA 2YJTD 4MR9B 4UUMA 3WG9A 1A4IA 2HB6A 2WJ3A 1M8PA 1R4MB 3MXTA 4K03A 4MKXA 5AWFC 3WNCA 1OT5A 2IA5A 5FUWA 5G1PA 2C4UA 5AJXA 1Q1GA 4NH4A 3M2PA 3JWJA 1G8SA 5HP4A 1T5SA 3EGVA 4HQRA 1MU0A 4M86A 3SVLA 3OX4A 5J4VA 1MGOA 4U02A 1PL6A 1G63A 1WG8A 3NAMA 4TMYA 1IRIA 3U0BA 1HFKA 1RVV1 3TLAA 1A2OA 3U17A 1G9XA 3DOJA 4ZYZA 4AJIA 1UKYA 1U3TA 1VI2A 3E3AA 3STUA 1VQ1A 1WZIA 2O6HA 3GLIA 3L1VA 4MGIR 3B48A 3HS3A 1OYWA 2Z83A 2QMQA 4ARCA 4AKEA 3OBIA 2ZWAA 3WQRA 3STHA 5BWCA 3K96A 3R5HA 4KBYA 3EA4A 2JCGA 2PDAA 5BXYA 4ZZ0A 5M7EA 3QJGA 2JJMA 2Q6TA 3U4QB 4DWOA 2AD1A 1ZGJA 3LY8A 4P82A 5KBYA 3RRMA 3KALA 4N7RA 3ASVA 1NF8A 5SV2A 5KQGA 1R88A 2ZB8A 5LQRA 2A59A 2X5JO 3NKFA 3TTSA 1ECBA 3N5CA 1HO3A 3GMSA 5HX7A 5IM5A 5LLTA 3U1TA 5A62A 1QDUA 3AFHA 2A5FA 4HR7A 1VMKA 4AKHA 4LXYA 3IEMA 2C88A 4IG9A 2A58A 4RGVA 3H7AA 4EFMA 4B3MB 4ODIA 3VGPA 2ZYAA 3HXKA 1NVDA 3OZDA 4FS3A 1QP4A 3DGFC 3D7NA 1ZGGA 3GFSA 1NX6A 1P0MA 3GV0A 3LYUA 5EEGA 3L8EA 4YRJA 5L3VA 5KQSA 4MUKA 1UJ5A 4MW5A 2I2DA 2P2YA 4O2BF 4UU0A 2HUPA 4BX8A 4MPPA 2OBFA 3OZCA 1J1UA 2YZKA 3K6RA 5J47A 1MEOA 1XPJA 4AJHA 1TXGA 3FDZA 4RGYA 2B4RO 3N05A 4B6PA 2GMWA 3CLTD 4IYJA 4ZOLA 4ZC1A 1T4CB 2JAXA 4QYWA 1ZJYA 1PDOA 1RLUA 4ZAYA 1CUEA 1PCXA 3EZLA 3SZOA 5BUSA 5BORA 1SBQA 3EXFB 2QJWA 3RU7A 1HMYA 1I2MA 3E2PA 4MUFA 5E6SB 2JFQA 5BO5A 3RKUA 2X0JA 1TAGA 2HU5A 1M2OB 1PYGA 2VYCA 2YQ5A 5J1TB 3ZE8A 4RTJA 2P41A 3F0TA 1X8XA 5CNJA 4JLMA 2Y67A 2E2WA 1FSZA 1XJQA 2AFRA 3LYLA 5T3UA 1R5NA 4GEGA 4O5AA 1XLTC 3G1TA 4L5JA 4MWSA 1D0SA 5I7SA 4DKJA 1N78A 4IV0A 5JPIA 1X7YB 1TT5A 3I9FA 2CJWB 1XCPA 1MO3A 2H1CA 3UH0A 1XA4A 4B82A 1YL5A 2BOVA 5GIOE 1WPQA 4ARIA 3AOEC 4YJ3B 1XTIA 3ICWA 3NTUA 3DZDA 4J76A 2OHJA 2WIJA 1NUPA 2PKWA 3C1UA 4GVLA 5B3AA 4ARSA 1CUCA 4ZVRA 3P9ZA 4GR4A 4BP8A 3TVDA 4JV5B 4D6XA 4ME6A 5F77A 1THGA 3VZDA 5B1DA 2XYHA 1RQNA 2QZ4A 3SNKA 1Z39A 3BJRA 3HXPA 4F21A 3TIFA 4PZCA 3ZKWA 5HKKD 4JODA 4B87A 4PGMA 2LR0A 3DL2A 4RO0A 3RC7A 1FDUA 1E0DA 4TM8A 1UPBA 1VLMA 3EQ9A 1JLHA 3MBKA 4EMUA 1GLVA 4S1VA 4KI0A 3F3KA 4P31A 1KDYA 1TUGA 1RFGE 3OZFA 4H7PA 4GE3A 3NHUA 2PBFA 3LHFA 4P0PB 1M67A 4QRDA 1KY3A 1HDEA 4NATA 1NR5A 3CF2A 4ID3A 4B2LA 3OA0A 3NW9A 4L9RA 3OEHD 2GBLA 3NUQA 3QUSA 3TNJA 3HP4A 2YZMA 3M3HA 4PEVA 2O59A 1JEQA 2EJBA 1ISSA 1T35A 1MIOB 2EV9A 1SIOA 1XO1A 1NQ5A 1XNJA 3R5XA 4IWYA 2RGWA 4LGYA 2P2SA 3SX0A 4DOMA 4ZJZA 3TECE 1GAEO 4I36A 2ZYIA 4RYDA 1H9BA 3ROXA 4FKMA 1DEKA 3BS4A 1CW2B 2WYWA 3WFIA 3RVQA 2WP8J 4TGLA 4KK3A 4NEHB 2O23A 3WGKA 1DOAA 2GPYA 2PEYA 4CN8A 1X8KA 4ATNA 4JN6B 2XKJE 2GRAA 4GRIA 1I1OA 4DXDA 4YBRA 3PCTA 1Z8HA 3PJGA 2HREA 3CZPA 4L8YA 4KE8A 2JJ8A 5ES4B 1JR3D 4XWTA 1RLTA 1H0SA 3NWBA 4EQ6A 2VDUE 3FE2A 5J5AA 1KTIA 1ONSA 1S8AA 4DCCA 3RIGA 2OAP1 2P1ZA 2R7LA 4ZGBA 1Y1SA 4Z51A 5BR7A 1P4AA 6YASA 1QYXA 2BKAA 4MRAA 4OGLA 2CHEA 5C4MA 2PANA 4TZ6A 4TLEA 2OEPA 2ZYTX 2PGAA 3FBGA 4WH0A 3HA2A 3CSDA 3N59A 1NMYA 2ZXUA 2ZXFA 3V46A 2ZM6B 4R8RA 4DG5A 1ZJ5A 4LF5B 1AXGA 2ZJFA 4RLHA 3ZHXA 5M5BA 1MXFA 3MD9A 5BYBA 3EMDA 3PXUA 4L16A 4TTVA 4DIBA 5THXA 4L28A 2FRVA 2WSIA 1R3UA 1Y5LA 4D6YA 4DN6A 4B8ZA 3O8RA 1BCSA 3DZJA 3KQKA 2PXAA 5HZKA 1POXA 1W1WA 1ZIYA 3DZFA 1I1NA 4I50B 3TTWA 2H1WA 4CT5A 1XTUA 3KLPX 3THWA 3AVUA 4ZVNA 2F43B 3HABA 2FOIA 4YT8A 4GGPA 1BFUA 1CDOA 2LRHA 2MSDB 2F4VB 2ZSEA 4C87A 2OC4A 2VOEA 5DTMA 4FIZA 2XUPA 4AKGA 3T1OA 1EEXB 3N76A 4DV6B 1B8PA 4YO8A 1DV2A 1L5ZA 1PKXA 4OAPA 3OURA 1DG1G 1V9CA 3FKJA 3KPJA 2Q3FA 2YOHA 2GETA 3V4ZA 2RCNA 4WK6A 1N9ZA 3KB1A 4PG7A 1RJWA 4B33A 1II8A 4RMNA 4OLBA 4EW6A 4DBLC 1NI4B 4X1YA 1ABBA 3H2BA 2AXQA 2Q6KA 3LHIA 1NJ2A 1UBRS 3HDGA 1IZZA 3B9RA 2ISQA 3D8TA 4FLFA 3ABSB 4A91A 5FLEX 3IMCA 4NE7A 2VF2A 3MWDB 1FNDA 1ZXLA 3H1PA 2I2WA 1EE9A 3HRHA 3FPFA 5KNBH 3EDYA 4UQLA 4NZMA 5KJ1A 2B4TO 2R6GA 2IOHA 1HDZA 1V71A 2YOFA 5JVDF 2UAGA 1VMIA 3G59A 3B8EA 3LHKA 3CVJA 3OCYA 4GOND 4TT8A 1NT4A 1W6RA 5EXPA 4DLSA 3ZUPA 3TLXA 4RVSA 4DJEC 3NH9A 3EEOA 4QUGA 1YA6A 1GNRA 1NUTA 1L4EA 2QVGA 3JQ9A 4PG6A 4FHDA 4AYTA 4QULA 5EIBC 5KCZA 1NN1A 1YOVB 2ZJ2A 2QBYB 3DDCA 2R87A 1XMPA 4HLQB 1WCIB 3A6HA 4R9UC 1CJBA 1L5MA 3HN7A 1E2BA 2ZTMA 3BTUA 2HY7A 4D9EA 2XCOA 2ZVJA 1L7XA 2GPAA 4MEJA 2QRNA 4NULA 1SRQA 1KK3A 3P0FA 4AQ7A 1A95A 4FT2A 2ZI6A 3UICA 1TC2A 4FS8A 1QE3A 1O58A 1QHHA 1WAMA 3JQ8B 2C9BA 3RGGA 1QH8B 5EXEA 4HQNA 4F7WA 2W6IA 5JG7A 4ZHQF 4E2FA 1QVZA 4QELA 2OHIA 1C9DB 1DBVO 3RAPR 3HJHA 3VMFA 2NO4A 4CU2A 3INGA 4ZK2A 4G5YA 5EE9A 2YL2A 3IQDB 2WV7A 3CJQA 4TL7A 1DT5A 4JOCA 4UUBA 4DTIA 2IPAB 3ZV7A 3NHZA 2H0QA 5LA6A 5BV8A 5FA6A 4YTEA 4M0EA 1RXCA 5BXQC 2TMGA 3OQOA 4ZVMA 3RYHA 3GGOA 1U7OA 4RY9A 2D8AA 5HPYB 3IELA 4A6XA 3AXSA 2B25A 5CVVA 3O4IA 1GSHA 5H0IA 4QASA 4OXIA 4RULA 2OQVA 1BU8A 2PS0A 3H19A 5HEKA 4IVNA 3SXPA 1SHZA 1E7YA 3CPHA 3JSXA 4QEKA 3F2VA 4DILA 3SC2A 2AI3A 1T6ZA 2BHLA 1AN9A 3WYBA 4R5HA 2B35A 4C0JA 3HO6A 4Y9RA 2WSYB 2HW8A 1OXUA 1U81A 2IPOA 1P1IA 4OJTA 2R7MA 1M6WA 4WQMA 3M9WA 1KWGA 5JJIA 1LQ2A 2ZWVA 5ALIA 2NVUB 3V8RA 4DYHA 1L8QA 1JIIA 1G1MA 1TMKA 2HYDA 2PRYA 1TVCA 2FR1A 3DUWA 2JCYA 4H35A 3GY0A 1GARA 4M1ZA 1R1DA 1PNQA 3G8YA 2WTMA 4WPGA 4Y3UA 1VJTA 3NBFA 4MCAA 1W1UA 2Y8EA 2QX4A 2GPJA 4YBZA 3QUQA 2ZAMA 4KDRA 5L51A 2F3UA 1P7CA 2CXXA 4P4UA 4PBRA 3LX5A 1XD9A 2X9NA 4OMCA 1PGNA 1HFWA 2FEKA 3CU5A 3STWA 1YQGA 2O1XA 3JR7A 1PT6A 5JBNA 5IVHA 2ZFUA 2A6PA 3ROQA 1PX0A 1XZQA 2IXEA 1WKCA 2XDAA 5BOVA 4KX3A 2FYTA 3S7ZA 4JXXA 1RZRA 1JJAA 4TMVA 4LIPD 1OD6A 4OQXA 5AVOA 3SIPA 3WLLA 4YRZA 3CO0S 1ST2A 3EUAA 1FQJA 3K0AB 7ABPA 1X1EA 2Q3LA 4MGEA 1WQ1R 4PR3A 5TQ0B 5ER9A 1K3TA 3E8XA 4PAQA 2YWDA 5BMVA 2JBAB 3QVJA 1SVOA 3ZE0B 4C7OA 4U5QA 1CYEA 3DDZX 1I4WA 1BMFD 1TJ5A 2FN8A 2X6RA 3KSDO 4GL4A 1ESEA 4MCJA 2QMUA 1FRFS 3LCVB 5FI3A 4KXMA 3COWA 3AESB 2J31A 2AC2A 1YVPA 2XNKA 2PJDA 3HJGA 1DG3A 2Q5HA 3L8ZA 3BTVA 3VYWA 4CG2A 4CUKA 4I6JA 4KDEA 2QUHA 4MQ6A 4MIKA 1Q14A 1LTKA 4EP1A 2H31A 3VYUB 1AKYA 3HK2A 2QRKA 3L18A 4B32A 2A3NA 2JLBA 1Q0RA 4HNUA 2XNHA 1RS0A 5EYPA 1RQRA 2CGEA 3N7AA 1TVEA 2IQIA 2J4FA 1K5DA 2IL1A 2J1LA 3BIOA 5IBRA 1KVUA 1NY6A 1QORA 3P9CA 3AI3A 3CX4A 1SC1A 4LEIA 4PO1A 5ERGB 3R76A 1NF3A 3RCBA 4NECA 2XE7A 2OE2A 2G09A 2MYTA 2FPPB 5IN5A 1ECFA 2QL6A 2IX3A 4FWTA 1AXRA 1YONA 3ECSA 3NBQA 3A05A 3IDSA 1QRSA 2CEKA 2E4YA 3DYIA 3FFWA 4RK1A 4OM7A 4UNRA 5CFNA 3BXEA 1KU6A 2F64A 4ZEXA 3X44A 1SGWA 4TWJA 1ENZA 5CDHA 4CEHA 1DQSA 3SG0A 5EIEA 1ZEMA 4RHUA 1HDIA 1O1YA 3MJSA 1W0KD 3LDFA 3OTIA 4JK3A 2X23A 3JAWA 4GZ5A 3PI6A 5IK2D 1AUQA 1IJEA 1E1MA 2GX6A 3ASUA 3QF7A 2WJGA 4Q39A 3ZKWB 2ODWA 1AUOA 4FYWA 5B4TA 1ZUIA 4RCVA 4W8HA 4D43A 1M0SA 2P9QA 3FSRA 1JU9A 3PV0A 4R9SA 1XWWA 1TQ2A 2VLIA 3CZMA 4UHEA 1RCTE 4KQ1A 4TOIA 2RJ3A 1D6SA 4IXMA 1S3SA 4ND8B 4H6XA 2E37A 2JG3A 1MEEA 3TLMA 3R0JA 5FIUA 3QVSA 4MV0A 2IP1A 3M1AA 2P4EA 5BUCA 4I4NA 4DDWA 2BMDA 4NDAA 4YUVA 1SUEA 1X1SA 2E5WA 4KQGA 3QUCA 4UTVA 1DBIA 5E7IA 3ZWAA 5FOSA 2ADMA 3H1GA 4BFUA 1FTGA 4YVFA 4YAKA 1WVIA 1Z6QA 5FPHA 1V5FA 4ISCA 4ALIA 1DJQA 4QBIA 5L3SB 3W1WA 2ANCA 2AEMA 3DPSA 4GOLD 1I6MA 1LGYA 4A6DA 4B3DA 2C4MA 2QTBA 3GLFB 5FWXB 1GRQA 5TR9A 3FXAA 4JGIA 3VKVA 1NVUQ 2O1EA 4Q82A 4RANA 3BREA 1I2BA 1YDWA 2AWOA 1W94A 2CFCA 2ZDQA 4JBWA 4OQLA 1X74A 4RJKA 5H4GA 2ZUUA 2HLHA 1U0GA 2QVZX 5IW8A 2F1HA 1UQUA 1SOAA 1K7XB 3L8YA 4ZVVA 3W8DA 1BQEA 2UZ4A 4WXRA 4CCYA 5JFGA 4EQ6B 1E3WB 1GFIA 4H0CA 3HM2A 3KR2A 1OROA 4KNVA 3UCEA 3I8SA 2XZTA 3RV3A 3JD4A 1A4RA 3WLPA 5BSUA 2H18A 3TI7A 4P0TA 2BFNA 2OFPA 1TYBE 5AKXA 3RWOA 1TD1A 2XI4A 4Q3AA 2FG5A 2XEXA 2WVHA 3HBFA 3L6RA 2CLLB 2A88A 3NPAA 2VRCD 5DI3A 2IU0A 3WRXA 3ZZ0A 3PR2B 3T0IA 2RJNA 4G1CA 4WMLA 3RG8A 3QUBA 3G2NA 4NCHA 3GGSA 4DQVA 2YZNA 4L9AA 3LL4A 4WLOA 2PMDA 1QGUA 3AVPA 1QIIA 1IG0A 2CFSA 2GD2A 4GYKA 3KWLA 3DAYA 1MPXA 3SS9X 5F12A 4BX2A 4XOIA 3O8QB 3H9BA 1ONBA 3I58A 4HLNA 2OXCA 3I2JA 4OSOA 1BCSB 4QUBA 3PWTA 4F4FA 1M8KA 1T8UA 5AVQA 3K9CA 4WOBA 5EJGA 1X86B 3IRUA 1NXOA 3A9SA 4HFNA 4BMYA 4EA7A 3ZWKA 1IBMB 4MVJE 1LTQA 2WICA 1W88A 4RKWA 1MC5A 3C5VA 1NQAO 3T5PA 3UAYA 2NSLA 3SN6A 5FPKA 2AS0A 2C7GA 1YB4A 1G7SA 3R5SA 5IH3A 4JX8A 2IXDA 2I9PA 2W2TA 3IBTA 1FMJA 1TKBA 1K5GA 2V7EA 5IFKA 1L3BA 1EBUA 3DCJA 1WCXA 1KYVA 4Q6BA 4ZI5A 1R0KA 1M8GA 3GJZA 4UD6A 1ZM4A 1MNQA 4A6PA 4AIRA 1NXTA 2I65A 5IYZA 1Z5NA 1KKLA 5KVVA 3KG2A 4UFNA 4UBOA 2R6FA 1H65A 2A0XA 4NOJA 3V9PA 2Z08A 1JQEA 2YBEA 4LVCA 4PCLA 1PU2A 4GKAA 5AI4A 4EB0A 2BDUA 4HH1A 3AUAA 2ATEA 3UH1A 1EHIA 3H5TA 4NZZA 3OJFA 4GQIA 4DKXA 5H82A 4PNPA 4HUTA 5C32A 3MMPA 4O3FA 3KVRA 1GZ3A 4I4IA 4QYSA 3ENWA 3RUPA 3FTEA 4C4OA 1C0LA 4HLDA 1QHNA 1Q11A 3TL3A 2XB9A 2BZSA 3Q6MA 4Y1EA 1JXOA 4GMGA 1OAOA 3OESA 2DTEA 3SKYA 1NVFA 2XVMA 3BYZA 4L72A 2JGKA 1T9GR 2W2NA 1T0HB 1XXHB 1EGVB 2NZVG 2Q3EA 2WMYA 1WETA 3KWMA 1WCIA 2CYCA 1NXXA 2ZRMA 3L7DA 4HAOA 2X8JB 1T9HA 3OFJA 4X97A 1A71A 4II2A 4K9MA 5AK4A 3SE0A 3WL3A 2BWJA 2X0DA 1TF2A 6REQA 2O07A 1ADBA 4Q47A 1QO0D 2GJ9A 1GG2A 3VR1A 2XCIA 4JASB 4N5HX 2C94A 4DUGA 4LK3A 5CURA 1Z5ZA 3OETA 3V55A 3HKCB 2O3TA 5L6LB 3RAEC 4YAFA 4MVXA 2D2EA 2HA7A 4MV8A 3BERA 4BNTA 3JVDA 4URVR 2O4CA 1DC5A 1L4UA 1Z2NX 3UATA 5AVVA 4RHEA 5LLDA 4XEUA 4Z54A 1N3IA 2FE4A 3FB4A 5DT2A 1TQHA 4B4WA 1JLSA 4Q9JA 1ELOA 3KSAC 5HJ2A 1NOKA 3EEBA 1I4OA 1OIWA 1U2ZA 5EJAA 4B6EA 5HKKA 3A1FA 2ZRQA 3PYLA 16PKA 1MQ9A 1NC3A 3JQAD 2FW7A 2HTEA 1PJAA 4JLOA 1T5TA 5DTIA 3SHWA 1OWPA 4JENA 2OXRA 1N32B 5DI9A 4MZXA 4ZO4A 2OV6A 2LXNA 4OV6B 4RPIA 3GRUA 5ALNA 4EVQA 1AQIA 2PYIA 3IAEA 4HEA6 1TVKB 2IGBA 2ORIA 3EF3A 3AONB 4UUQA 2Q27A 3SQOA 5HR5A 1O96A 1BS1A 3IBSA 3ETEA 4ZQHA 1YB6A 1UFOA 2JIBA 4J0KA 1VBMA 2BGUA 4LMPA 4R6WA 4U9IS 3HY3A 3GJQA 4KKXB 4B3SB 1T13A 3HB1A 4N82A 4XQ9A 5FR1A 2VEDA 3QIAA 3T4UA 2Q1TA 3NFYA 4JP1A 5JQGA 2BW0A 1P45A 1PUXA 4L9SA 4LG1A 2OM6A 4LX0A 3U81A 3PNLA 2JJQA 3K7EA 2JGAA 1X9IA 3QXGA 5F9MA 1W96A 3OM0A 2XJ4A 2NWQA 2R5WA 5AP9A 3FSEA 4Q3KA 3LUKA 3MUNA 1VTKA 3TFWA 2WC1A 1GSOA 4MDHA 3DO8A 2VJAA 4TRRA 2DY1A 2XMRA 1OUMA 4P53A 5ICFA 1LCIA 3WLHA 4GC9A 3LWBA 4L4ZA 1JIVA 4TXMA 3X1YA 2LTAA 1KK0A 3OJEA 2O2EA 2H4JA 3DQZA 4GR9A 4YIHA 1NSFA 4ZT2A 3L4SO 2Y93A 4IBOA 1XF9A 4AS3A 3OKCA 3LUPA 4RIIA 1VBKA 2W2XA 3PVSA 1W4CA 2XAAA 1VFPA 2XUDA 1RYBA 3PJEA 4O2BA 4PVCA 4QYXA 4RMIA 3A11A 2X7JA 5EN4A 3ZGOA 4BWGA 3THXA 2O2DA 5TIIA 1FOEB 1AOXA 3BJEA 3HU5A 2DM6A 2VJOA 3QBJA 4MS3A 1YE8A 2EDCA 1EB9A 4NCXA 5E1BA 5REQB 5AKGA 1T5DX 3O21A 4W9MC 1PSDA 3AL0C 2VPWA 1K68A 4WFQA 1PDVA 3T1VA 4BJ6A 3COJA 1BDIA 1U1IA 4AKIA 2VNHA 3VR0A 3NIFB 2EKZA 5TQ0A 2VJNA 5COBA 1R8YA 2JBAA 5T6MA 5IT9A 4AY3A 2VP0A 1N4DA 1T0IA 3DB1A 1E3LA 1EKXA 4LHXA 5LBUA 2ZWIA 4U9UA 4DLAA 4P4SB 1SKMA 4KJXA 3CUWA 3VNSA 4OHCA 3AESA 2VA8A 13PKA 2GHIA 1NWCA 2AIRA 3ONVA 3TDMA 3L8HA 3MCWA 4K6KA 4ZQIA 1BWPA 3AY0A 4AQYB 1JYFA 1Q2UA 2A0WA 4HGPA 3IP7A 4KLCA 5EHQA 3ZHZA 3I5MA 5J1SB 1ZR4A 3DPIA 1I1QB 3FF1A 4JLBA 3BGIA 1NURA 2CUTA 3JQAB 4BJ3A 3F4BA 3N2EA 3ETNA 4MWEA 4R98A 2QTZA 4KH0A 3UWMA 4DDVA 1SD1A 3A9CA 2HIMA 3O4JA 5C8VA 5EJ6A 4IIXA 4KB5A 3VQTA 1YVEI 1Y5IA 2IE0A 3H1EA 2LE0A 2TMKA 1A69A 4M89A 1NOJA 2ECKA 2J3MA 3C2QA 4HAVA 2P67A 3L7LA 1J24A 1NC1A 3UMGA 8LDHA 4P98A 4YMGA 1ZLYA 2MT9A 4BYMA 1N2HA 1L1RA 3W79A 2P40A 4MWBA 4HH4A 4YACA 5FH9A 4LMBA 1GT91 4ND7A 3THYB 3LQ1A 2MSCB 1JA9A 4NU6A 1IHDA 4LJ4A 4NHOA 4BVBA 1N7HA 4Q9DA 3JX9A 4MYRA 1H2BA 4MI1A 1V7QA 2GAOA 1XL0A 3AXTA 4QQRA 5EQFA 3R8CA 1OLOA 5AHXA 2J9RA 2FN9A 1KU0A 2W6ID 2BIFA 4IV8A 2VF7A 2YHSA 3VNAA 2YR0A 4KLZA 4IJUA 1A5AB 1IVNA 1I2DA 4H7HA 1Q12A 1V16A 2HFJA 4XX0B 4U7PB 3S2GA 2ZUFA 1B23P 2PNFA 4IWXA 3N8DA 3P4XA 3CUUA 3CZ5A 4R2XA 1NVAA 5CVUA 4JSYA 5KAMA 3EB9A 4UU7A 4ZA2A 4CFSA 1H3FA 1F4LA 3GROA 5HQ3B 3IAS1 3QEMB 3AR7A 3WE7A 4K9QA 1QHIA 4OP1A 5DJ5A 3RS7A 1B0UA 1WXEA 3BB1A 3M6WA 1PLKA 1P44A 4GRDA 4JYCA 4LGCA 4OBBA 3BCHA 5EJ8A 5C1DA 2QAGC 2JIZA 3EBLA 4MUNA 1SAYA 3KUUA 5JU6A 4LRUA 1DHTA 5A9SB 5JMTA 1IB6A 1YR7A 1ZJZA 2YV5A 4JEUA 3J80A 2QNIA 4EKEA 4WFJA 4OHVA 2INGX 1OGIA 1P5ZB 2A4KA 1E0KA 1P0IA 1R66A 1YBAA 3CNOA 3H16A 4JYBA 3ADBA 4NZYA 2YWJA 5DK4A 5AVYA 3IPXA 2R0QC 1TZ2A 1A77A 1G8KA 4WZAA 1D6MA 2C00A 1BH6A 3G8BA 3HBJA 1KYIA 3PQ3A 4R3WA 4XUCA 1KOGA 3TOXA 3OOYA 3FUVA 4DHEA 4KPEC 5HCUA 4ZGWA 1VCNA 3DE6X 1BD4A 1NI5A 1UODA 1BC5A 3TUZC 4C4AA 1AGXA 2E6UX 1SQGA 2B61A 3PICA 2P8JA 1KSFX 3GT3A 3GVIA 3RR2A 3HDHA 1JF8A 1FU8A 2G5CA 4LBZA 5EKDA 4BKUA 4JB8A 4GXQA 2QQEA 2QLMA 3CLRD 4EENA 1TADA 1JSCA 4DZZA 4A36A 1BDMA 3EXG2 1T5IA 1NF9A 1JGTA 2W93A 1SUDA 3EVZA 4QM6A 1E60A 1ES9A 1NUSA 1XUOA 2RB5A 5EHGA 2Y1LA 3JAKA 3R5TA 4DR6B 1D4FA 4RA6A 4ARBA 1QGUB 4ICIA 3GLFE 2O3QA 4UTXA 3HB7A 5CPBA 3X43A 3GFBA 5BV1A 1A9SA 1IQPA 1TJYA 2QLJA 4UMFA 1LVGA 2PYDA 1IUKA 3QENA 4RE6A 3S70A 2GPTA 2PR7A 1U0SY 2XUAA 3DE1X 1WDTA 1TQ6A 1KNQA 3TBKA 1QANA 3KOZA 3PU6A 4IJVA 4ZEMA 1W88B 2FQWA 1WWKA 3ZQUA 2DZDA 4LQLA 3M4JA 4BB6A 4MUXA 4GM4A 3FR8A 3KEFA 3KSZO 1YFLA 1FS4A 5JD6A 2D5AA 4E7OA 3CNNA 1MJHA 4U9HS 1JEEA 1Q7RA 3UJHA 2PYZA 1SWVA 3QOFA 1JUDA 3ND6A 4LVNA 3ZVRA 1A4UA 1Q95A 2Z2KA 5L3ZA 3UHAA 1UBLS 1XTBA 1DXHA 1UC5B 4LDNA 4A2CA 4AJEA 2IDKA 3LQ4A 5IU6A 1I14A 2NV0A 2VSQA 4YXWA 2C4VA 2IHUA 2E82A 4BV8A 3K1TA 4D44A 2G76A 2FH5B 2OFWA 2VIIA 3OIDA 4OI0A 2KE5A 4L0CA 1CKEA 4N3BA 3H0CA 2GEUA 2JRLA 4HVTA 2O8DA 1N2OA 2LVBA 3E9RA 1S4QA 3IEIA 3OH8A 5HM6A 1RYNA 4LY9A 1TEHA 4PZUA 1JQDA 4KODA 2JIZD 4JEMA 3WK7A 2J3IA 3CEMA 2EQBA 3KAJA 2FPXA 2C9MA 3S28A 5JHHB 3BGOS 1EYZA 5TE9A 4EHNA 4U2CA 1NV8A 2EFGA 2QD4A 3BTSA 121PA 1XD2B 2VPQA 2GKSA 1QE0A 2C0PA 3B6MA 4CZ2A 4L57A 1AO0A 1ABEA 5ALDA 1NF2A 1L5HA 4BZWA 2I22A 4H6WA 3OKFA 1WHSA 3OSUA 5AM4A 1IY0A 4L3OA 3DNPA 1KRHA 5JDCC 3FPSA 2I1VB 1KZYC 1F8YA 1XHFA 2D06A 4OPMA 3ORYA 2IVFA 3S1LA 4B4VA 1DQYA 4TKVA 3MGKA 1Z4QA 5KTRA 2MINB 3ELBA 3KSRA 4XKJA 3QVWA 4PYNA 2WTEA 1OBVA 2FEMA 1Y7LA 2Z9CA 3O8BA 4FNOA 5ESXA 1UXHA 2AWNA 3UM9A 1N7JA 3OY7A 4IRUB 2H1VA 3TDKA 1ADGA 3GJXC 5FEUA 1OH5A 1NVVQ 3ZHCA 1FXWA 3PHJA 4M9RA 2ZOSA 4P7GA 1E5QA 3IVMA 2YZGA 3VSBA 1JTVA 3H5RA 4UPVA 4BTLA 2YASA 5CFZA 2BGWA 4W99A 3TRJA 1J2JA 3FRIA 3V33A 5CFRA 3DLHA 1T8YA 1LDNA 2Y2VA 3OPYI 1NNUA 3GG2A 2H1OA 3OLXA 1JH8A 1V43A 3FHLA 3IV6A 2RMKA 3O9MA 4PICA 4JD5A 4UTRA 1RAFA 3ABZA 3MIIA 3NIBA 1BE6A 4BFTA 4EHHA 2YWHA 4RJTA 1M8FA 3BMCA 4AY5A 1HT2E 1Z25A 3NCTA 4LBVA 3INTA 1QHFA 3CUSA 3I23A 4Y2TA 4D26A 5BSTA 4D9KA 3V7NA 2C5GA 3LT5A 4FJ2A 2HRRA 5IAAA 3GWGA 1CT9A 4TTQA 1IWOA 2KS6A 1GADO 2Y9PB 3FZGA 4HWPA 4NONA 5CA1B 2C5FA 4GSLA 4CUJA 2GN1A 3OT1A 1XZDA 1OXVA 3UGKA 4BJHB 2P4QA 4D9NA 5FDFA 2ZI9A 1DV1A 2BAGA 1DIOB 4GI3A 3A1WA 5BW8A 1SKYB 2PSJA 5IG2A 1RXSA 2ZWMA 3E1KA 4H31A 4CTOA 3FKQA 1DC8A 1ZBDA 1I5RA 4M55A 4N47A 2HA3A 2XE8A 1ZMRA 1FDSA 4GIBA 4MS1B 3KQUA 4D8VA 4EG5A 3DV9A 1RE1A 4MYHA 3E9MA 3VTFA 4BVFA 5AKYA 2IV7A 4LGVA 1VB5A 1WMSA 2BGIA 1P18A 2D5IA 2FOLA 3WOHA 3WWPA 3KBOA 4EBFA 4HWRA 4TMTA 3WVNA 3SQXA 3EGDA 4M7RA 3T41A 1P19A 2ZIVB 1RHRA 3ND9A 3QXXA 2F55A 2NQTA 3A6PC 5KVCA 3N0TA 4EY7A 5AOCA 1W5SA 3QOYA 4EGJA 1WD7A 3TSOA 5CGZA 3A4VA 1E62A 3LYAA 2W2MA 4MLDA 4BVJA 4LZAA 3KT0A 3HVUA 2M6KA 4CLEA 1JKIA 4Y2RA 3DUFA 4A82A 4WBNB 1ISHA 2OZPA 2Y1CA 4RIGA 2NUAB 4G56A 4MAAA 4OQEA 4Z1MA 3VOSA 3OU2A 3QVLA 1HYBA 4HTFA 2FX2A 1GQQA 1OWMA 5HK8A 3ZD6A 2JLAA 4AP9A 3KB8A 3QRWA 3AO0B 1FTWA 4IQ8A 4Z3DA 2DX7A 1K3UB 1P5RA 1Z36A 4GZ3A 2NO1A 1JFTA 2VDPB 4EJSC 1FFDA 5DGXA 4PINA 2RC6A 3JCZA 1JV2B 4GI1A 1YR9A 4ZOBA 2GPNA 5D01A 5I7WA 2R7AA 1Z82A 1NKTA 3HWSA 4FZJA 3SC3A 1SUPA 1MABB 2EJUA 2TS1A 3DS8A 3LQYA 2VYQA 4MB2A 2PFKA 4TRJA 4XGIA 1X2BA 4TLAA 4KQXA 3RRZA 2F3SA 4QQKA 3D1JA 3RVPA 1GUAA 3LW7A 1BNCA 1QVWA 2Q9BA 2FV8A 2V4UA 2X1LA 3HZOA 4NYJR 4XWAA 5H1YA 5IBQA 3U61B 3ETJA 4EG4A 1BQ4A 2I34A 4OVKA 2VJQA 3BE5A 4GWGA 4IMPA 3RBXA 3I5XA 2CLEB 2NT4A 1RIIA 1CWUA 3GN1A 3RRBA 1P73A 3ME5A 3PC7A 3HJTA 1HLGA 5J4HA 2C97A 1NASA 4N8DA 4KIFA 1U8ZA 5LXTA 1EA5A 2H5EA 3CURA 5JBQA 1M6EX 2AXEA 2QN9A 3CZ4A 3OLVA 4JR2A 4WN9A 5AVXA 5HMLA 2UZ1A 4B40A 2XLCA 2FR8A 4JT8A 2QD1A 3VNUA 4XASA 4DQKA 2UU9B 3RRXA 4CLHA 3E3LA 3A1NA 2OYRA 1P5HA 3N2IA 3I4FA 2G9VA 1Y1QA 3A2NA 2HA0A 4A1OA 2PR2A 2QAIA 3UAZA 1X7HA 4MPDA 4YRIA 2HCBA 4YJ2F 3R0QA 3RFVA 1RACA 4K40A 1M1NA 3M33A 2O2HA 1SVUA 3FMOB 2GF9A 2RGEA 1AKTA 3DKKA 4IH9A 4DUGD 5T67A 3QTLA 3PE4A 5T4FA 1ZD1A 5IH7A 1MOZA 1Y81A 1E4EA 4OA8A 3M6FA 1NDHA 2AT1A 5F1PA 4CLOB 1APBA 5IT0A 1HNXB 1KZ4A 1V1MB 3EVDA 4WZBE 1V16B 4OB6A 1SVKA 4X45A 5U1PA 2C03A 2AZXA 1OXKB 2QIOA 2HV9A 1FL9A 1UZUA 2WABA 3PD1A 3W5UA 3KTDA 5G53C 2WUFA 3Q10A 1YQQA 3DT9A 1JJIA 3LPMA 3GZ4A 4ZTBA 2CK3D 2NNLD 2Z3ZA 4BGVA 1JQLB 1JMVA 1IVSA 3ILXA 1CRQA 2BF7A 3O47A 4OXXA 2WTXA 4GECA 5CIWA 4ONEA 3KT3A 3ZGYA 4D56A 4AL4A 1T6YA 5HG0A 3WP1B 4JLVA 2I62A 3UT0A 1PDWA 3VSEA 1YQDA 3GH1A 3LIIA 2COKA 2EF1A 2A84A 1ZYUA 3IX7A 4MWTA 4C14A 3A31A 1P9LA 2A9JA 3B9PA 3FNQA 1LF0A 1THZA 2IBSA 1YQEA 2GESA 1ZIXA 2ZRNA 1AD2A 1BDJA 1B0AA 2FZVA 2HEGA 3JYOA 1GSAA 4KMSA 4QEDA 4RVFA 1GTZA 3AHHA 3TGWA 4BWYA 4YP1A 5C5EA 1PG5A 4ANFA 3KUCA 1UM8A 1PFVA 3BSFA 4FBLA 2ORYA 2BC9A 2V5AA 3FB1A 1W52X 1CP3A 4UBKA 5E4YA 2WOJA 3LUJA 4CL8A 1C4XA 4TYYA 3QKUA 4OREX 3PXBA 1Z26A 3TCXB 4ESEA 3UHPA 4KIJA 5FTLA 1YZVA 4RNCA 2RHHA 3B7GA 3QKRB 1Z6TA 4MW4A 3R74A 1CQZA 2G1UA 3X1XA 1UZMA 2F3PA 1A8IA 1KJIA 4COOA 4J9VA 3WFZA 3AJ8A 4MRNA 1NT2A 1Z4LA 1EINA 2ZBPA 3IQXA 1J07A 1GRRA 1HQDA 2JKYA 3M5DA 4RGBA 4DXHA 4UHKA 1DJOA 3GU3A 2XUZA 3DBRB 3QJYA 1YIDA 2DP4E 2WJWA 4ZC8A 1FJGB 4IIUA 1W59A 3EH1A 3HFSA 3WHPA 2GZSA 1VXRA 1FQWA 3FJYA 4ZWNA 4H6PA 5C53B 3P9NA 4M1QA 1Z5VA 3IHTA 1JDPA 4S24A 3STYA 1E1YA 3T3MB 1IY1A 1VKRA 3AEYA 2CLDX 4CFYA 2GN6A 1XJCA 3N8NA 2ONYA 4FSHA 1I4DD 2SHKA 4EW3A 4WV3A 4M6WA 1N4AA 2EIXA 4P7JA 1IIBA 3R3HA 2N75A 3PE6A 3W77A 4RS3A 4EKNB 2NU6A 2DUUA 2CNWD 2V7XA 3EZNA 1TO2E 4BZXA 3TNYA 1MO5A 2BVNA 2C9ZA 3H0KA 3Q8KA 1WXHA 3MIZA 4RF4A 1BX1A 1IBSA 2NIPA 1RT9A 2ZBGA 1J33A 3DT8A 5EJ7A 5KVAA 2Y99A 4B6GA 3RBAA 3D8BA 1KOFA 3R6TA 2D3TA 4HQ6A 3UT5A 3FMFA 4E15A 1F51E 1C30A 3X2EA 4EJSA 2HJ9A 2RH5A 1XZGA 2YC2C 3LUCA 1Q0SA 3G2OA 4QQNA 1F6BA 4NE9A 4HNAA 1G8FA 2XKKA 5E6RA 1GDHA 3KFVA 1BXZA 1CX9B 1DKMA 2H57A 2BFWA 1KO4A 1UJMA 4M7PA 4K1XA 1ZGZA 5IJXA 5AW9A 3VI3B 2OD9A 1Z4NA 3U4AA 3W9BA 2P2LA 1LTHR 1W34A 4M9ZA 3WNQA 2Y27A 4B43A 4BQQA 2P65A 2GZ2A 3LFHA 5F4ZA 3MFYA 1JG4A 3VH4A 2NVOA 4L4XA 2X4IA 5SZJA 5I7FA 1XK7A 4IGAA 3SQNA 5GADl 3GDHA 2E7ZA 2AW5A 2R1TA 1E1QA 2WVJA 4NYIR 3FYCA 5F21A 4EYKA 4IUDS 4KAJA 1V7ZA 4I3GA 2GK7A 2SCUA 3E18A 2GUGA 3K1ZA 4U8HA 3TSWA 2O9JA 2PH5A 1LDYA 2Q4EA 4IIYA 1Y3CE 2W6QA 3UENA 1USGA 3BZWA 3ILVA 1CR6A 5IASA 1KRWA 2KHZA 1SUCA 1KP2A 1CDDA 1H42A 3USCS 4CKZA 1M8JA 4PSUA 1Z5UA 5DTRA 4A0GA 1Q15A 3UMCA 1Y1RA 1Y6ZA 1SFRA 2V9CA 3Q3GE 2ERXA 1IHUA 1U7UA 3C5CA 2WF7A 3LSYA 1HTWA 4O4JF 1BEUB 1Z5PA 2HMYB 2IOFK 2WKPA 3E7PA 3QNWA 5F51A 1Z9BA 3WLFA 5LKAA 4RSRA 1S2OA 4FMPA 3SM3A 2ZGVA 3TQRA 3M1IA 1JJFA 4MQFA 5TEVA 3VR2A 4W6ZA 3CRMA 3FF4A 3HDTA 3T5GA 1EXVA 3VKHA 2GBGA 4ZFNA 1I4EB 1V47A 3KJHA 1C0IA 2V6MA 4PBTA 2BHSA 1RP1A 3DR3A 3JZDA 5EQTA 1KS9A 3VV2A 3LMKA 3FUXA 3HJFA 1RC0A 2CJPA 1XQVA 1Q7BA 4JH0A 1RJEA 3K9HA 2I54A 1J2RA 4YCAA 2W8ZA 4JC8A 4NZNA 1GP2A 1A5ZA 3DTNA 1N57A 2HCRA 3ZXYA 2IZ6A 2JC3A 4XYLA 2OP0A 1PW5A 4FFBB 2WMNB 2RKBA 3FYUB 2NU9A 5F7JA 2HWKA 1GTMA 3SIWA 1EA7A 1CQXA 3GZJA 1U28A 2C2KA 4RMHA 2G63A 1P5FA 1G21A 3CNHA 3OY2A 5AW6A 4DWVA 4AS2A 3EYWA 1D2RA 3AY6A 4L3WA 4MLPA 2JK1A 5C8YB 1T9ZA 1XEXA 2W58A 4U2KA 4MP3A 1JFRA 3KXLA 5HBRA 3ELDA 4RWEA 1B73A 2RHCA 1SCNE 3FGZA 3AR4A 2ECPA 1R2QA 4D4HA 5IJ0B 1AKMA 4XJVA 3R2JA 3FHJA 4YMLA 4RL4A 3DEYX 4C0HA 2J3LA 5DTJA 4S05A 1WU8A 3V34A 1SQ6A 2WKQA 3DZIA 1E3EA 2ENWA 2NLOA 4X91A 4FOLA 4JHXA 3ZHBA 3RRJA 4UEOA 2NPOA 4MVJP 5IEBA 4E5DA 3UGTA 5E7QA 2IYSA 1V3QE 2FPOA 4PHFA 2D74A 3UB4A 2HL6A 1X7WB 4M0KA 4BVEA 3LDAA 1W0KA 2IOFA 3G0GA 4GR5A 4IIHA 4BFYA 2W9XA 3BF7A 4M3NA 3HYSA 4PX5A 4WD3A 1OZGA 4LFBB 5JH7B 5D3MA 1VKHA 2H4WA 3IAM6 1U2PA 4QTZA 2A9RA 3IL2A 3QE2A 5K3CA 3INYA 3PXCX 1QXSA 2DCMA 3O8DA 5IDYA 3ULKA 4YPOA 2PE5A 3OPQA 2WZBA 2IUSA 5JIBA 4UPEA 1U63A 3KEGA 3RAGA 3D4BA 4F91B 2W2KB 3ET4A 1XYVA 2VPPA 4IVPA 1UEXC 1S02A 1YZQA 4HGNA 5IN4A 3BD8A 4EJMA 3H1TA 2VHYA 1C0EA 2VUTA 3KUDA 3A26A 1MX9A 4LE0A 4PRYA 4WESA 1T4MA 4E51A 4BO7A 4R9NA 3T9EA 1BX3A 2BHNA 4PFSA 5ITSA 4HDQB 1PFGA 1ZXBA 3JARA 4OHPA 4H7JA 4JR0A 3ZQ4A 4BEBA 1UMKA 4EECA 5A6VA 2BFCB 2WMDA 2JGNA 3T0FA 3DDHA 2QD3A 2Y1DA 3IERA 1UDBA 2R8EA 3CB2A 4D97A 5DXFA 5B1YA 4QNNA 1J1IA 1FDTA 1E6EA 1V1RB 4KXUA 1DIGA 1SVIA 2EFCB 2ZJ0A 3IOMA 3IULA 5DISB 4BVLA 1PJSA 2ODEA 3K05A 2WQ7A 2DYKA 4RFSA 1RM4A 4G5SA 3BN3A 3KKLA 3BTOA 2XWQA 4L1KA 3TIXB 3VVCA 1G66A 2J6BA 1MB0A 3E22A 1QTQA 3U2QA 4FN5A 7REQB 8MHTA 1PYOA 3OZSA 1U7HA 1TPZA 1WEHA 3AETA 1NBOA 2ZATA 4DE5A 2J9FA 1WU7A 4KIWA 5ALZA 3R44A 1PVOA 1O97D 3N75A 5AOVA 1GAQA 1ZWLA 4YUWA 4BLQA 5AVWA 1D03A 3E4CA 3CJTA 3EC7A 1Q2XA 1E2FA 2H1IA 1WXWA 5KTOA 4N54A 2J87A 2RI0A 3A1DA 1U9ZA 1F06A 3HCAA 3M6IA 4A92A 5ANRB 3TW4A 3FOFC 2PLFA 5EEHA 3SU8A 1AX9A 2IZ0A 2PBLA 1IATA 4G9GA 3BHJA 1JKXA 4R1OA 4CV0A 3PEWA 4EO7A 1FJXA 5J3JA 1B26A 1QSGA 2VJMB 3EG9B 4KRFA 2G70A 1O94A 4WFIA 3W04A 5T8KC 4L5IA 5DYNA 1C1HA 4M2LA 1QQTA 1EI9A 2ZJBA 1GA4A 3IKVA 1ESMA 1QFSA 1J8QA 2HBYA 1M6NA 4G0MA 4ZT6A 1HEUA 1E1RA 3B9BA 3G23A 4KQKA 3PPVA 3OPYB 1TQ8A 3H75A 5KHAA 4QJBA 1YK0A 2IUTA 1LNSA 2BBTA 3FMVA 3ZG6A 4P54A 3VDRA 1NBIA 4DLYA 2BELA 3OZVA 1QHXA 3G0BA 4IJKA 1DIAA 3B7WA 1PK7A 4I5GA 3BMNB 4IUCS 4QL3A 3W6OA 3WAGA 4I5FA 4QJ5A 4ZYTA 4U2EA 1Q6ZA 5CAEA 4Z4QA 2E3JA 4KMMA 3THOA 3H4VA 5IHPA 1KMQA 3GK3A 5CNIA 3HJCA 2JCBA 2UUAB 3TW0A 5C9ZA 1DOHA 3F5DA 1HOTA 3X1MA 3KKKA 4BBPA 5KTYA 3KT6A 5BNWA 2BTQB 3DBRA 3DKIA 4TUYB 3MMZA 1YZLA 2E89A 3I30X 3QBDA 3A1EA 2AF3C 3CGGA 3UXEA 1SIUA 3GVHA 1B6TA 2QMZA 3TOVA 1UBJS 1LDMA 4NEGA 3UFXB 1U28C 4MW6A 5TX7A 3UQYS 4Q1DA 1AQJA 1GNQA 2XZOA 2QLBA 3VO1A 4ZI7F 5CXUA 3KWFA 5DGIA 421PA 5MHTA 2XDWA 3CEJA 2FLWA 4CRWB 1T0UA 2NUBA 5LQUA 3T35A 1VSBA 1ISPA 3TCNA 4Z9XA 1E1CB 1IONA 2XX3A 4TXLA 3H2SA 3ZLJA 1UBTS 4LHEA 5I9LA 3T61A 1IN1A 3AY7A 2A1TR 5GZ3A 5DCLA 4KR3A 3FNEA 3TGLA 4ZICA 4REQB 2AFHB 4O4IB 2QN8A 1G16A 1ZAKA 1KPHA 3RSCA 3UWPA 1E5XA 5CPFA 4AP6A 2EATA 1DG9A 3WDSA 3VKGA 3HQ4O 3ESDA 3WK5A 4BNMA 2AZ4A 3AQIA 3F6RA 4JUDX 2JCSA 1ORHA 4Q00A 3LWNA 4XTRA 1D1TA 5LBIA 2B78A 1DBQA 3I1JA 1SXJA 1LFAA 2J30A 4AJKA 4C06A 2XOXA 3T34A 3OQBA 3FCSB 5JFOA 4EHIA 4WLNA 1NIPA 3HJUA 1NLYA 5BUZA 3PEVA 2P35A 4H18A 1AUPA 1ZL0A 2HJGA 3D64A 5CDSA 1J0CA 3Q6NA 3SR3A 4QVIA 2D1FA 3FJ1A 3LK6A 2W70A 2GD1O 4H9GA 4CIWA 2L17A 2ZBDA 5KCMA 1UZLA 4R2LA 4UHHA 5CLFA 4K1LA 4JI1B 3ONWA 4M49A 4RBNA 2ZSDA 3OF5A 4FN4A 5L6MB 1NNEA 2C98A 2ZQZA 2D59A 3M6UA 4IM7A 3PCRB 4DLRA 1C14A 2G28A 1MC1A 3PR1A 1WQ4A 3V2HA 2PSHA 4F0JA 2QUIA 2DBZA 3KELA 4QNRA 1XMIA 2AX4A 3IPYA 4FK8A 4H60A 5JCXA 1HUQA 2UZ3A 521PA 2YWEA 1J8DA 1F3OA 4BC0A 2NUPB 3OTGA 3PC2A 5K3DA 5HKAA 2IYOA 1FFXB 3A1TA 5I9BA 4O02B 3RVRA 1K88A 1XXLA 3WWZA 3UPTA 1QV7A 4RZ3A 4M0MA 1GKIA 3HBLA 1NBWB 3DMFA 4B45A 2IHJA 4D4KA 1F0PA 4H16A 2FR8C 4G65A 4Q66C 3H05A 1IJBA 3BDVA 3OKAA 1T2EA 2G08A 2J3JA 3QU9A 4UZEA 5ALTA 1XLVA 3T1NA 2REXB 4D0GA 1KJJA 3G2QA 3H4MA 5KTSA 4XIGS 2VRNA 2Q8PA 4ETIA 5KNBD 1O5TA 2FTKE 5ALHA 5F23A 5IAOA 2Z9DA 1L7AA 2XT0A 1VJRA 3CEPB 4F2PA 1O6CA 2XY4A 3AR2A 1AO3A 1M0EA 1X8JA 1XN1A 2RHRA 4DIEA 1XZFA 4ZOCA 3ZGZA 3J81A 2ZJ1A 3DR5A 5B1EA 4HDMB 5IANA 2FPUA 2XTMA 2WUWE 2EGGA 2FRDC 5CCXA 2DUNA 3IDZA 3OZTA 1ZM9A 2BGNA 2YJ6A 3K4QA 1GAXA 4D42A 5BQ3A 3SFTA 5T3YA 1X1CA 2PIDA 1FIUA 1QVAA 3EVCA 2QQGA 2IZOA 1MO4A 4Q9IA 5JO9A 4UOEA