1K5VA

Human acidic fibroblast growth factor. 141 amino acid form with amino terminal his tag with asn106 replaced by gly (n106g).
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
128
structure length
128
Chain Sequence
KPKLLYCSNGGHFLRILPDGTVDGTRDRSDQHIQLQLSAESVGEVYIKSTETGQYLAMDTDGLLYGSQTPNEECLFLERLEENHYNTYISKKHAEKGWFVGLKKNGSCKRGPRTHYGQKAILFLPLPV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Acidic fibroblast growth factor
publication title Alternative type I and I' turn conformations in the beta8/beta9 beta-hairpin of human acidic fibroblast growth factor.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hormone/growth factor
total genus 36
structure length 128
sequence length 128
chains with identical sequence B
ec nomenclature
pdb deposition date 2001-10-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00167 FGF Fibroblast growth factor
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.80.10.50 Mainly Beta Trefoil Trefoil (Acidic Fibroblast Growth Factor, subunit A) Trefoil (Acidic Fibroblast Growth Factor, subunit A) 1k5vA00
1M16A 1P63A 3RMXA 5F8SA 3B9UA 4LO1C 4Z9WB 2AFGA 3HN1A 1HWNB 4GAIA 6I1BA 2ZR1B 4J2KA 3R4UA 3UD8A 2P39A 1FWVA 5BXRA 2FFUA 3BAOA 2QYIB 3BADA 2KI4A 4I4PA 2Y9WC 2I1BA 1S0EA 5EHAA 4I2SA 3V0BA 4OWKA 1G9DA 4OWLA 1T4QA 3CA5A 3A22A 2VU9A 2HWMA 1DJSB 4ISRA 3NBEA 3RSJA 4PC4A 2D23A 4J23B 1HWMB 4QBVA 1BFBA 5DSSB 4I4RA 3HBWA 3IAGC 4J2SA 1YBIA 1V6XA 5BVPI 3LTQA 3AZWA 4ZKTB 1GGPB 4I1EA 2ERMA 3FJFA 4JRAA 1M2TB 4KC3A 2E4MA 3ZXGA 1EYLA 1JLYA 2BFHA 4I4UA 4XFSA 1BFFA 1BFCA 3WINC 3RTIB 2GO2A 1JTCA 2NZ9A 4ENDA 4KEIA 3WA1A 4I4SA 2NVHA 1HCDA 4IONA 2RSTA 3K1XA 3BRDA 3A07A 4QD2B 2R9KB 1BFGA 3FJKA 1EPWA 1SR4C 3NBNA 3SNVA 3CAHA 4TLPA 3FJCA 1EV2A 3RMYA 2D7IA 4D8HA 4IYBA 1RZOB 5DVHA 1DFCA 1G9BA 4H9WA 1L2HA 1W3AA 4D0TA 3AKIA 4J2YA 3O4OA 3P6JA 4LO0A 2KI6B 4IQPA 2IHOA 1I1EA 3HALA 3BX1C 4G9MA 3FJAA 3NBDA 1AXMA 3OGGA 3P53A 3CA4A 4ZFYB 2D20A 1S0CA 3HSMA 3O49A 4I6IA 3WO4A 3P6IA 4I4YA 41BIA 3D7WB 3FGMA 1YYNA 3S8KA 2HZ9A 3CQAA 1S0LA 3V79C 3ZC9A 4XFUA 1K5UA 3LLPA 4F34A 2K8RA 1K5VA 1OQLB 4G6MA 3O4AA 1N4KA 3WO3A 3C9ZA 4KBBA 4DCKC 1AVAC 1A8DA 1CE7B 3QYDA 4YOLA 2DRYA 2HW9A 1IOBA 4QD2C 2Y9XE 4LO3C 3OJVA 1RMLA 2MIBA 3UJ0A 1BASA 1TFMB 1Z0HA 2MC2A 4GP0A 1BLDA 2F2FC 4I0YA 1ISYA 1IHKA 2LIEA 1DZDA 2K4AB 2FFVA 2P23A 3A23A 3EF2A 3POKA 2D1ZA 3CRIA 4IY9A 4GOVA 5JLVA 4JQ0A 4ZOTA 3S8JA 1NUNA 1TOOA 4JAWA 2KLLA 2DREA 3FJHA 1ISWA 2BEBA 5BQUA 2K43A 9ILBA 3N7LA 3CRGA 1V6UA 3IM6A 3PG0A 4HJJA 3ILAA 5B2HA 2J3PA 3N7JA 4OEFA 3VWCA 4HR6C 4P6AA 4I4QA 4EEEB 4I7IA 1IILA 5BP5A 2D24A 2Z49A 1Z4SA 5BXTA 1XYFA 3OBTA 3W9TA 3PUBA 4P0JA 4QC4A 3F62B 1FQ9A 4JPZA 3OJMA 5FZUA 1ABRB 1JT3A 2Q3NB 4FVVA 8I1BA 1BARA 1WD3A 2WRYA 5FZZA 1HKNA 2WBCA 4EFRA 3AH1A 3V0AB 1YTOA 4JKQA 4QKSA 5D62A 1R8NA 5EC5A 31BIA 3FJBA 3VT1A 1JLXA 4KEJA 3E8LC 1FMZA 2YUGA 4G9NA 3VSZA 4I4XA 3VSFA 2NP0A 1AVXB 2BEAA 1NZKA 1FWUA 1FV2A 4FGFA 4OEGA 4Q9PA 1DLLA 3BTAA 3I2XA 4R6UB 3AZVA 4OWJA 1JY0A 4H04A 5BXPA 1AVUA 1R8OA 5DUYA 3O4BA 1ONKB 1T9FA 3OJ2A 3N7MA 1Q03A 3AJ6A 4KEKA 3H6SE 1JT7A 2VLCA 1CVSA 4EKXB 3CA6A 2ET2A 2VXTI 3H6RA 1SZ6B 3HOMA 1HWPB 4IHZA 3WMUA 4USPA 1MC9A 2Y9GA 1TTUA 4ZA3B 3BAHA 5F8YA 4QALA 3WO2A 7I1BA 3BRFA 3FUQA 3KMVA 3BAQA 1IT0A 1D0HA 2X2SA 2FO1A 1Q1UA 3CA1A 1FGAA 4LO1A 5FNWA 2LIQA 3AKHA 1BA7A 2VUAA 1S0DA 1DQGA 2ESUA 3BAGA 2GZBA 2NTDA 3BA7A 4L4HA 3CU1B 1IRAX 1FN0A 1JT4A 4OEEA 2UUSA 3IIRA 1FMMS 3I2AA 1QQKA 1F31A 1QQLA 3IM7A 4DENA 1G82A 3FJIA 4XFTA 1HIBA 4I4OA 3V0BB 1AVWB 2X2TA 4Q91A 2VXRA 1BLAA 1QXMA 3VUOA 3FFZA 4HA2A 4LO7B 2L5XA 3N7KA 3FJDA 4P0LA 1TWEA 2NM1A 2XOAA 3VEQA 2DS0A 5D63A 4AN7B 1G9AA 3FJ9A 3FJ8A 3HMYA 3RTJB 4QBCA 3O44A 1Z2VA 4I96A 4ZBVB 4JP0A 1DQOA 2M49A 2Q9XA 4X3AA 1KNMA 3WINA 1IJTA 2F8XC 4ISQA 1S0BA 5BXSA 2D22A 1AF9A 3JRRA 3AJ5A 2AXMA 1ISZA 4LO2C 4IY8A 3F1RA 3AH2A 4G6JA 3MALA 4P0KA 3O4CA 1SR4A 1WBAA 5I1BA 2FGFA 1IRPA 2VSAA 2IWTB 5BOWA 1V6WA 3Q7YA 1EVTA 21BIA 1PC8B 3BB2A 2RQ9A 4DEPA 1ITBA 1E0OA 2FDBM 3FJJA 3ZC8A 1WD4A 4L4IA 4XKIA 1II4A 5F90A 1W3FA 5BQUC 4OW4A 2AAIB 1TP0A 1WBCA 3UJ4A 3NJ5A 4GP3A 4EB2B 3BAUA 1ISVA 4USOA 3FUOA 2KKIA 4QKRA 4LO7C 1RY7A 3MPPG 3A21A 5DZUA 5D61A 3PMEA 5BP5C 2KH2A 1TIEA 1XZZA 3VT0A 3CRHA 4X37A 3H6RB 1MD6A 1S0GA 3BRGC 4X38A 1I1BA 2E4MC 4ZFWB 1HWOB 4II0A 1ILR1 3T8SA 4EFQA 3O4DA 3AH4A 3O5WB 2ZQNA 4AN6A 4JKXB 4Z8SB 5HPZA 4J2XA 3V0AA 5JMCA 4QO3A 3H6QA 3I29B 3BAVA 3BA4A 1J0SA 1HCEA 2ZQOA 5EG6C 4IZXA 4GOYA 3N0KA 4I37A 1UPSA 1PUUB 2Z48A 4LO3A 3ZXDA 2VSEA 4WBCA 4ZGRB 4CJMA 1RG8A 4LO8B 4I4VA 4A7YA 1W3GA 1Q04A 5FZYA 3VT2A 3CA3A 2F2FA 4Q9GA 4G1RA 4I1BA 1YF8B 5F8WA 3UD7A 5G00A 1VCLA 2AQZA 5E24E 3WMVA 3QR5A 3CA0A 4I3NA 4D0ZA 3IM5A 4X39A 2HWAA 5GAQA 3UDAA 1TWMA 4ZLBB 1JT5A 3OGFA 2RG9B 1PWAA 4A7KA 3R4SA 4LO0C 1DZCA 4IZEA 1V6VA 3FJEA 2QN4A 3NBCA 4GAFA 4EFPA 5FNXA 1YXWA 4I8MA 2Y9FA 3BA5A 1DIWA 1S0FA 4OUJA 2MLLB 3Q7WA 1JQZA 3TC2A 2DRZA 4A7ZA 1AFCA 1FV3A 1PUMB 2D44A 3AKGA 3ZX7A 1G9CA 3O3QA 3Q7XA 3PHZA 1PZZA 2NYYA 1ISXA 3UD9A 4F83A 2D7RA 1DFQA 1XG6A 3JUTA 3OBRA 4ZFUB 3AKFA 1XHBA 4LO2A 2D43A
chains in the Genus database with same CATH superfamily
1M16A 1P63A 3RMXA 5F8SA 3B9UA 4LO1C 4Z9WB 2AFGA 3HN1A 1HWNB 4GAIA 6I1BA 2ZR1B 4J2KA 3R4UA 3UD8A 2P39A 1FWVA 5BXRA 2FFUA 3BAOA 2QYIB 3BADA 2KI4A 4I4PA 2Y9WC 2I1BA 1S0EA 5EHAA 4I2SA 3V0BA 4OWKA 1G9DA 4OWLA 1T4QA 3CA5A 3A22A 2VU9A 2HWMA 1DJSB 4ISRA 3NBEA 3RSJA 4PC4A 2D23A 4J23B 1HWMB 4QBVA 1BFBA 5DSSB 4I4RA 3HBWA 3IAGC 4J2SA 1YBIA 1V6XA 5BVPI 3LTQA 3AZWA 4ZKTB 1GGPB 4I1EA 2ERMA 3FJFA 4JRAA 1M2TB 4KC3A 2E4MA 3ZXGA 1EYLA 1JLYA 2BFHA 4I4UA 4XFSA 1BFFA 1BFCA 3WINC 3RTIB 2GO2A 1JTCA 2NZ9A 4ENDA 4KEIA 3WA1A 4I4SA 2NVHA 1HCDA 4IONA 2RSTA 3K1XA 3BRDA 3A07A 4QD2B 2R9KB 1BFGA 3FJKA 1EPWA 1SR4C 3NBNA 3SNVA 3CAHA 4TLPA 3FJCA 1EV2A 3RMYA 2D7IA 4D8HA 4IYBA 1RZOB 5DVHA 1DFCA 1G9BA 4H9WA 1L2HA 1W3AA 4D0TA 3AKIA 4J2YA 3O4OA 4MZHA 3P6JA 4LO0A 2KI6B 4IQPA 2IHOA 1I1EA 3HALA 3BX1C 4G9MA 3FJAA 3NBDA 1AXMA 3OGGA 3P53A 3CA4A 4ZFYB 2D20A 1S0CA 3HSMA 3O49A 4I6IA 3WO4A 3P6IA 4I4YA 41BIA 3D7WB 3FGMA 1YYNA 3S8KA 2HZ9A 3CQAA 1S0LA 3V79C 3ZC9A 4XFUA 1K5UA 3LLPA 4F34A 2K8RA 1K5VA 1OQLB 4G6MA 3O4AA 1N4KA 3WO3A 3C9ZA 4KBBA 4DCKC 1AVAC 1A8DA 1CE7B 3QYDA 4YOLA 2DRYA 2HW9A 1IOBA 4QD2C 2Y9XE 4LO3C 3OJVA 1RMLA 2MIBA 3UJ0A 1BASA 1TFMB 1Z0HA 2MC2A 4GP0A 1BLDA 2F2FC 4I0YA 1ISYA 1IHKA 2LIEA 1DZDA 2K4AB 2FFVA 2P23A 3A23A 3EF2A 3POKA 2D1ZA 3CRIA 4IY9A 4GOVA 5JLVA 4JQ0A 4ZOTA 3S8JA 1NUNA 1TOOA 4JAWA 2KLLA 2DREA 3FJHA 1ISWA 2BEBA 5BQUA 2K43A 9ILBA 3N7LA 3CRGA 1V6UA 3IM6A 3PG0A 4HJJA 3ILAA 5B2HA 2J3PA 3N7JA 4OEFA 3VWCA 4HR6C 4P6AA 4I4QA 4EEEB 4I7IA 1IILA 5BP5A 2D24A 2Z49A 1Z4SA 5BXTA 1XYFA 3OBTA 3W9TA 3PUBA 4P0JA 4QC4A 3F62B 1FQ9A 4JPZA 3OJMA 5FZUA 1ABRB 1JT3A 2Q3NB 4FVVA 8I1BA 1BARA 1WD3A 2WRYA 5FZZA 1HKNA 2WBCA 4EFRA 3AH1A 3V0AB 1YTOA 4JKQA 4QKSA 5D62A 1R8NA 5EC5A 31BIA 3FJBA 3VT1A 1JLXA 4KEJA 3E8LC 1FMZA 2YUGA 4G9NA 3VSZA 4I4XA 3VSFA 2NP0A 1AVXB 2BEAA 1NZKA 1FWUA 1FV2A 4FGFA 4OEGA 4Q9PA 1DLLA 3BTAA 3I2XA 4R6UB 4UY4A 3AZVA 4OWJA 1JY0A 4H04A 5BXPA 1AVUA 1R8OA 5DUYA 3O4BA 1ONKB 1T9FA 3OJ2A 3N7MA 1Q03A 3AJ6A 4KEKA 3H6SE 1JT7A 2VLCA 1CVSA 4EKXB 3CA6A 2ET2A 2VXTI 3H6RA 1SZ6B 3HOMA 1HWPB 4IHZA 3WMUA 4USPA 1MC9A 2Y9GA 1TTUA 4ZA3B 3BAHA 5F8YA 4QALA 3WO2A 7I1BA 3BRFA 3FUQA 3KMVA 3BAQA 1IT0A 1D0HA 2X2SA 2FO1A 1Q1UA 3CA1A 1FGAA 4LO1A 5FNWA 2LIQA 3AKHA 1BA7A 2VUAA 1S0DA 1DQGA 2ESUA 3BAGA 2GZBA 2NTDA 3BA7A 4L4HA 3CU1B 1IRAX 1FN0A 1JT4A 4OEEA 2UUSA 3IIRA 1FMMS 3I2AA 1QQKA 1F31A 1QQLA 3IM7A 4DENA 1G82A 3FJIA 4XFTA 1HIBA 4I4OA 3V0BB 1AVWB 2X2TA 4Q91A 4MZGB 2VXRA 1BLAA 1QXMA 3VUOA 3FFZA 4HA2A 4LO7B 2L5XA 3N7KA 3FJDA 4MZFB 4P0LA 1TWEA 2NM1A 2XOAA 3VEQA 2DS0A 5D63A 4AN7B 1G9AA 3FJ9A 3FJ8A 3HMYA 3RTJB 4QBCA 3O44A 1Z2VA 4I96A 4ZBVB 4JP0A 1DQOA 2M49A 2Q9XA 4X3AA 1KNMA 3WINA 1IJTA 2F8XC 4ISQA 1S0BA 5BXSA 2D22A 1AF9A 3JRRA 3AJ5A 2AXMA 1ISZA 4LO2C 4IY8A 3F1RA 3AH2A 4G6JA 3MALA 4P0KA 3O4CA 1SR4A 1WBAA 5I1BA 2FGFA 1IRPA 2VSAA 2IWTB 5BOWA 1V6WA 3Q7YA 1EVTA 21BIA 1PC8B 3BB2A 2RQ9A 4DEPA 1ITBA 1E0OA 2FDBM 3FJJA 3ZC8A 1WD4A 4L4IA 4XKIA 1II4A 5F90A 1W3FA 5BQUC 4OW4A 2AAIB 1TP0A 1WBCA 3UJ4A 3NJ5A 4GP3A 4EB2B 3BAUA 1ISVA 4USOA 3FUOA 2KKIA 4QKRA 4LO7C 1RY7A 3MPPG 3A21A 5DZUA 5D61A 3PMEA 5BP5C 2KH2A 1TIEA 1XZZA 3VT0A 3CRHA 4X37A 3H6RB 1MD6A 1S0GA 3BRGC 4X38A 1I1BA 2E4MC 4ZFWB 1HWOB 4II0A 1ILR1 4H75A 3T8SA 4EFQA 3O4DA 3AH4A 3O5WB 2ZQNA 4AN6A 4JKXB 4Z8SB 5HPZA 4J2XA 3V0AA 5JMCA 4QO3A 3H6QA 3I29B 3BAVA 3BA4A 2NS2A 1J0SA 1HCEA 2ZQOA 5EG6C 4IZXA 4GOYA 3N0KA 4I37A 1UPSA 1PUUB 2Z48A 4LO3A 3ZXDA 2VSEA 4WBCA 4ZGRB 4CJMA 1RG8A 4LO8B 4I4VA 4A7YA 1W3GA 1Q04A 5FZYA 3VT2A 3CA3A 2F2FA 4Q9GA 4G1RA 4I1BA 1YF8B 5F8WA 3UD7A 5G00A 1VCLA 2AQZA 5E24E 3WMVA 3QR5A 3CA0A 4I3NA 4D0ZA 3IM5A 4X39A 2HWAA 5GAQA 3UDAA 1TWMA 4ZLBB 1JT5A 3OGFA 2RG9B 1PWAA 4A7KA 3R4SA 4LO0C 1DZCA 4IZEA 1V6VA 3FJEA 2QN4A 3NBCA 4GAFA 4EFPA 5FNXA 1YXWA 4I8MA 2Y9FA 3BA5A 1DIWA 1S0FA 4OUJA 2MLLB 3Q7WA 1JQZA 3TC2A 2DRZA 4A7ZA 1AFCA 1FV3A 1PUMB 2D44A 3AKGA 3ZX7A 1G9CA 3O3QA 3Q7XA 3PHZA 1PZZA 2NYYA 1ISXA 3UD9A 4F83A 2D7RA 1DFQA 1XG6A 3JUTA 3OBRA 4ZFUB 3AKFA 1XHBA 4LO2A 2D43A
chains in the Genus database with same CATH topology
1M16A 1P63A 3RMXA 5F8SA 3B9UA 4LO1C 4Z9WB 2AFGA 3HN1A 1HWNB 4GAIA 6I1BA 2ZR1B 4J2KA 3R4UA 3UD8A 2P39A 1FWVA 5BXRA 2FFUA 3BAOA 2QYIB 3BADA 2KI4A 4I4PA 2Y9WC 2I1BA 1S0EA 5EHAA 4I2SA 3V0BA 4OWKA 1G9DA 4OWLA 1T4QA 3CA5A 3A22A 2VU9A 2HWMA 1DJSB 4ISRA 3NBEA 3RSJA 4PC4A 2D23A 4J23B 1HWMB 4QBVA 1BFBA 5DSSB 4I4RA 3HBWA 3IAGC 4J2SA 1YBIA 1V6XA 5BVPI 3LTQA 3AZWA 4ZKTB 1GGPB 4I1EA 2ERMA 3FJFA 4JRAA 1M2TB 4KC3A 2E4MA 3ZXGA 1EYLA 1JLYA 2BFHA 4I4UA 4XFSA 1BFFA 1BFCA 3WINC 3RTIB 2GO2A 1JTCA 2NZ9A 4ENDA 4KEIA 3WA1A 4I4SA 2NVHA 1HCDA 4IONA 2RSTA 3K1XA 3BRDA 3A07A 4QD2B 2R9KB 1BFGA 3FJKA 1EPWA 1SR4C 3NBNA 3SNVA 3CAHA 4TLPA 3FJCA 1EV2A 3RMYA 2D7IA 4D8HA 4IYBA 1RZOB 5DVHA 1DFCA 1G9BA 4H9WA 1L2HA 1W3AA 4D0TA 3AKIA 4J2YA 3O4OA 4MZHA 3P6JA 4LO0A 2KI6B 4IQPA 2IHOA 1I1EA 3HALA 3BX1C 4G9MA 3FJAA 3NBDA 1AXMA 3OGGA 3P53A 3CA4A 4ZFYB 2D20A 1S0CA 3HSMA 3O49A 4I6IA 3WO4A 3P6IA 4I4YA 41BIA 3D7WB 3FGMA 1YYNA 3S8KA 2HZ9A 3CQAA 1S0LA 3V79C 3ZC9A 4XFUA 1K5UA 3LLPA 4F34A 2K8RA 1K5VA 1OQLB 4G6MA 3O4AA 1N4KA 3WO3A 3C9ZA 4KBBA 4DCKC 1AVAC 1A8DA 1CE7B 3QYDA 4YOLA 2DRYA 2HW9A 1IOBA 4QD2C 2Y9XE 4LO3C 3OJVA 1RMLA 2MIBA 3UJ0A 1BASA 1TFMB 1Z0HA 2MC2A 4GP0A 1BLDA 2F2FC 4I0YA 1ISYA 1IHKA 2LIEA 1DZDA 2K4AB 2FFVA 2P23A 3A23A 3EF2A 3POKA 2D1ZA 3CRIA 4IY9A 4GOVA 5JLVA 4JQ0A 4ZOTA 3S8JA 1NUNA 1TOOA 4JAWA 2KLLA 2DREA 3FJHA 1ISWA 2BEBA 5BQUA 2K43A 9ILBA 3N7LA 3CRGA 1V6UA 3IM6A 3PG0A 4HJJA 3ILAA 5B2HA 2J3PA 3N7JA 4OEFA 3VWCA 4HR6C 4P6AA 4I4QA 4EEEB 4I7IA 1IILA 5BP5A 2D24A 2Z49A 1Z4SA 5BXTA 1XYFA 3OBTA 3W9TA 3PUBA 4P0JA 4QC4A 3F62B 1FQ9A 4JPZA 3OJMA 5FZUA 1ABRB 1JT3A 2Q3NB 4FVVA 8I1BA 1BARA 1WD3A 2WRYA 5FZZA 1HKNA 2WBCA 4EFRA 3AH1A 3V0AB 1YTOA 4JKQA 4QKSA 5D62A 1R8NA 5EC5A 31BIA 3FJBA 3VT1A 1JLXA 4KEJA 3E8LC 1FMZA 2YUGA 4G9NA 3VSZA 4I4XA 3VSFA 2NP0A 1AVXB 2BEAA 1NZKA 1FWUA 1FV2A 4FGFA 4OEGA 4Q9PA 1DLLA 3BTAA 3I2XA 4R6UB 4UY4A 3AZVA 4OWJA 1JY0A 4H04A 5BXPA 1AVUA 1R8OA 5DUYA 3O4BA 1ONKB 1T9FA 3OJ2A 3N7MA 1Q03A 3AJ6A 4KEKA 3H6SE 1JT7A 2VLCA 1CVSA 4EKXB 3CA6A 2ET2A 2VXTI 3H6RA 1SZ6B 3HOMA 1HWPB 4IHZA 3WMUA 4USPA 1MC9A 2Y9GA 1TTUA 4ZA3B 3BAHA 5F8YA 4QALA 3WO2A 7I1BA 3BRFA 3FUQA 3KMVA 3BAQA 1IT0A 1D0HA 2X2SA 2FO1A 1Q1UA 3CA1A 1FGAA 4LO1A 5FNWA 2LIQA 3AKHA 1BA7A 2VUAA 1S0DA 1DQGA 2ESUA 3BAGA 2GZBA 2NTDA 3BA7A 4L4HA 3CU1B 1IRAX 1FN0A 1JT4A 4OEEA 2UUSA 3IIRA 1FMMS 3I2AA 1QQKA 1F31A 1QQLA 3IM7A 4DENA 1G82A 3FJIA 4XFTA 1HIBA 4I4OA 3V0BB 1AVWB 2X2TA 4Q91A 4MZGB 2VXRA 1BLAA 1QXMA 3VUOA 3FFZA 4HA2A 4LO7B 2L5XA 3N7KA 3FJDA 4MZFB 4P0LA 1TWEA 2NM1A 2XOAA 3VEQA 2DS0A 5D63A 4AN7B 1G9AA 3FJ9A 3FJ8A 3HMYA 3RTJB 4QBCA 3O44A 1Z2VA 4I96A 4ZBVB 4JP0A 1DQOA 2M49A 2Q9XA 4X3AA 1KNMA 3WINA 1IJTA 2F8XC 4ISQA 1S0BA 5BXSA 2D22A 1AF9A 3JRRA 3AJ5A 2AXMA 1ISZA 4LO2C 4IY8A 3F1RA 3AH2A 4G6JA 3MALA 4P0KA 3O4CA 1SR4A 1WBAA 5I1BA 2FGFA 1IRPA 2VSAA 2IWTB 5BOWA 1V6WA 3Q7YA 1EVTA 21BIA 1PC8B 3BB2A 2RQ9A 4DEPA 1ITBA 1E0OA 2FDBM 3FJJA 3ZC8A 1WD4A 4L4IA 4XKIA 1II4A 5F90A 1W3FA 5BQUC 4OW4A 2AAIB 1TP0A 1WBCA 3UJ4A 3NJ5A 4GP3A 4EB2B 3BAUA 1ISVA 4USOA 3FUOA 2KKIA 4QKRA 4LO7C 1RY7A 3MPPG 3A21A 5DZUA 5D61A 3PMEA 5BP5C 2KH2A 1TIEA 1XZZA 3VT0A 3CRHA 4X37A 3H6RB 1MD6A 1S0GA 3BRGC 4X38A 1I1BA 2E4MC 4ZFWB 1HWOB 4II0A 1ILR1 4H75A 3T8SA 4EFQA 3O4DA 3AH4A 3O5WB 2ZQNA 4AN6A 4JKXB 4Z8SB 5HPZA 4J2XA 3V0AA 5JMCA 4QO3A 3H6QA 3I29B 3BAVA 3BA4A 2NS2A 1J0SA 1HCEA 2ZQOA 5EG6C 4IZXA 4GOYA 3N0KA 4I37A 1UPSA 1PUUB 2Z48A 4LO3A 3ZXDA 2VSEA 4WBCA 4ZGRB 4CJMA 1RG8A 4LO8B 4I4VA 4A7YA 1W3GA 1Q04A 5FZYA 3VT2A 3CA3A 2F2FA 4Q9GA 4G1RA 4I1BA 1YF8B 5F8WA 3UD7A 5G00A 1VCLA 2AQZA 5E24E 3WMVA 3QR5A 3CA0A 4I3NA 4D0ZA 3IM5A 4X39A 2HWAA 5GAQA 3UDAA 1TWMA 4ZLBB 1JT5A 3OGFA 2RG9B 1PWAA 4A7KA 3R4SA 4LO0C 1DZCA 4IZEA 1V6VA 3FJEA 2QN4A 3NBCA 4GAFA 4EFPA 5FNXA 1YXWA 4I8MA 2Y9FA 3BA5A 1DIWA 1S0FA 4OUJA 2MLLB 3Q7WA 1JQZA 3TC2A 2DRZA 4A7ZA 1AFCA 1FV3A 1PUMB 2D44A 3AKGA 3ZX7A 1G9CA 3O3QA 3Q7XA 3PHZA 1PZZA 2NYYA 1ISXA 3UD9A 4F83A 2D7RA 1DFQA 1XG6A 3JUTA 3OBRA 4ZFUB 3AKFA 1XHBA 4LO2A 2D43A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1M16 A;  1P63 A;  3RMX A;  5F8S A;  3B9U A;  4LO1 C;  4Z9W B;  2AFG A;  3HN1 A;  1HWN B;  4GAI A;  6I1B A;  2ZR1 B;  4J2K A;  3R4U A;  3UD8 A;  2P39 A;  1FWV A;  5BXR A;  2FFU A;  3BAO A;  2QYI B;  3BAD A;  2KI4 A;  4I4P A;  2Y9W C;  2I1B A;  1S0E A;  5EHA A;  4I2S A;  3V0B A;  4OWK A;  1G9D A;  4OWL A;  1T4Q A;  3CA5 A;  3A22 A;  2VU9 A;  2HWM A;  1DJS B;  4ISR A;  3NBE A;  3RSJ A;  4PC4 A;  2D23 A;  4J23 B;  1HWM B;  4QBV A;  1BFB A;  5DSS B;  4I4R A;  3HBW A;  3IAG C;  4J2S A;  1YBI A;  1V6X A;  5BVP I;  3LTQ A;  3AZW A;  4ZKT B;  1GGP B;  4I1E A;  2ERM A;  3FJF A;  4JRA A;  1M2T B;  4KC3 A;  2E4M A;  3ZXG A;  1EYL A;  1JLY A;  2BFH A;  4I4U A;  4XFS A;  1BFF A;  1BFC A;  3WIN C;  3RTI B;  2GO2 A;  1JTC A;  2NZ9 A;  4END A;  4KEI A;  3WA1 A;  4I4S A;  2NVH A;  1HCD A;  4ION A;  2RST A;  3K1X A;  3BRD A;  3A07 A;  4QD2 B;  2R9K B;  1BFG A;  3FJK A;  1EPW A;  1SR4 C;  3NBN A;  3SNV A;  3CAH A;  4TLP A;  3FJC A;  1EV2 A;  3RMY A;  2D7I A;  4D8H A;  4IYB A;  1RZO B;  5DVH A;  1DFC A;  1G9B A;  4H9W A;  1L2H A;  1W3A A;  4D0T A;  3AKI A;  4J2Y A;  3O4O A;  3P6J A;  4LO0 A;  2KI6 B;  4IQP A;  2IHO A;  1I1E A;  3HAL A;  3BX1 C;  4G9M A;  3FJA A;  3NBD A;  1AXM A;  3OGG A;  3P53 A;  3CA4 A;  4ZFY B;  2D20 A;  1S0C A;  3HSM A;  3O49 A;  4I6I A;  3WO4 A;  3P6I A;  4I4Y A;  41BI A;  3D7W B;  3FGM A;  1YYN A;  3S8K A;  2HZ9 A;  3CQA A;  1S0L A;  3V79 C;  3ZC9 A;  4XFU A;  1K5U A;  3LLP A;  4F34 A;  2K8R A;  1K5V A;  1OQL B;  4G6M A;  3O4A A;  1N4K A;  3WO3 A;  3C9Z A;  4KBB A;  4DCK C;  1AVA C;  1A8D A;  1CE7 B;  3QYD A;  4YOL A;  2DRY A;  2HW9 A;  1IOB A;  4QD2 C;  2Y9X E;  4LO3 C;  3OJV A;  1RML A;  2MIB A;  3UJ0 A;  1BAS A;  1TFM B;  1Z0H A;  2MC2 A;  4GP0 A;  1BLD A;  2F2F C;  4I0Y A;  1ISY A;  1IHK A;  2LIE A;  1DZD A;  2K4A B;  2FFV A;  2P23 A;  3A23 A;  3EF2 A;  3POK A;  2D1Z A;  3CRI A;  4IY9 A;  4GOV A;  5JLV A;  4JQ0 A;  4ZOT A;  3S8J A;  1NUN A;  1TOO A;  4JAW A;  2KLL A;  2DRE A;  3FJH A;  1ISW A;  2BEB A;  5BQU A;  2K43 A;  9ILB A;  3N7L A;  3CRG A;  1V6U A;  3IM6 A;  3PG0 A;  4HJJ A;  3ILA A;  5B2H A;  2J3P A;  3N7J A;  4OEF A;  3VWC A;  4HR6 C;  4P6A A;  4I4Q A;  4EEE B;  4I7I A;  1IIL A;  5BP5 A;  2D24 A;  2Z49 A;  1Z4S A;  5BXT A;  1XYF A;  3OBT A;  3W9T A;  3PUB A;  4P0J A;  4QC4 A;  3F62 B;  1FQ9 A;  4JPZ A;  3OJM A;  5FZU A;  1ABR B;  1JT3 A;  2Q3N B;  4FVV A;  8I1B A;  1BAR A;  1WD3 A;  2WRY A;  5FZZ A;  1HKN A;  2WBC A;  4EFR A;  3AH1 A;  3V0A B;  1YTO A;  4JKQ A;  4QKS A;  5D62 A;  1R8N A;  5EC5 A;  31BI A;  3FJB A;  3VT1 A;  1JLX A;  4KEJ A;  3E8L C;  1FMZ A;  2YUG A;  4G9N A;  3VSZ A;  4I4X A;  3VSF A;  2NP0 A;  1AVX B;  2BEA A;  1NZK A;  1FWU A;  1FV2 A;  4FGF A;  4OEG A;  4Q9P A;  1DLL A;  3BTA A;  3I2X A;  4R6U B;  3AZV A;  4OWJ A;  1JY0 A;  4H04 A;  5BXP A;  1AVU A;  1R8O A;  5DUY A;  3O4B A;  1ONK B;  1T9F A;  3OJ2 A;  3N7M A;  1Q03 A;  3AJ6 A;  4KEK A;  3H6S E;  1JT7 A;  2VLC A;  1CVS A;  4EKX B;  3CA6 A;  2ET2 A;  2VXT I;  3H6R A;  1SZ6 B;  3HOM A;  1HWP B;  4IHZ A;  3WMU A;  4USP A;  1MC9 A;  2Y9G A;  1TTU A;  4ZA3 B;  3BAH A;  5F8Y A;  4QAL A;  3WO2 A;  7I1B A;  3BRF A;  3FUQ A;  3KMV A;  3BAQ A;  1IT0 A;  1D0H A;  2X2S A;  2FO1 A;  1Q1U A;  3CA1 A;  1FGA A;  4LO1 A;  5FNW A;  2LIQ A;  3AKH A;  1BA7 A;  2VUA A;  1S0D A;  1DQG A;  2ESU A;  3BAG A;  2GZB A;  2NTD A;  3BA7 A;  4L4H A;  3CU1 B;  1IRA X;  1FN0 A;  1JT4 A;  4OEE A;  2UUS A;  3IIR A;  1FMM S;  3I2A A;  1QQK A;  1F31 A;  1QQL A;  3IM7 A;  4DEN A;  1G82 A;  3FJI A;  4XFT A;  1HIB A;  4I4O A;  3V0B B;  1AVW B;  2X2T A;  4Q91 A;  2VXR A;  1BLA A;  1QXM A;  3VUO A;  3FFZ A;  4HA2 A;  4LO7 B;  2L5X A;  3N7K A;  3FJD A;  4P0L A;  1TWE A;  2NM1 A;  2XOA A;  3VEQ A;  2DS0 A;  5D63 A;  4AN7 B;  1G9A A;  3FJ9 A;  3FJ8 A;  3HMY A;  3RTJ B;  4QBC A;  3O44 A;  1Z2V A;  4I96 A;  4ZBV B;  4JP0 A;  1DQO A;  2M49 A;  2Q9X A;  4X3A A;  1KNM A;  3WIN A;  1IJT A;  2F8X C;  4ISQ A;  1S0B A;  5BXS A;  2D22 A;  1AF9 A;  3JRR A;  3AJ5 A;  2AXM A;  1ISZ A;  4LO2 C;  4IY8 A;  3F1R A;  3AH2 A;  4G6J A;  3MAL A;  4P0K A;  3O4C A;  1SR4 A;  1WBA A;  5I1B A;  2FGF A;  1IRP A;  2VSA A;  2IWT B;  5BOW A;  1V6W A;  3Q7Y A;  1EVT A;  21BI A;  1PC8 B;  3BB2 A;  2RQ9 A;  4DEP A;  1ITB A;  1E0O A;  2FDB M;  3FJJ A;  3ZC8 A;  1WD4 A;  4L4I A;  4XKI A;  1II4 A;  5F90 A;  1W3F A;  5BQU C;  4OW4 A;  2AAI B;  1TP0 A;  1WBC A;  3UJ4 A;  3NJ5 A;  4GP3 A;  4EB2 B;  3BAU A;  1ISV A;  4USO A;  3FUO A;  2KKI A;  4QKR A;  4LO7 C;  1RY7 A;  3MPP G;  3A21 A;  5DZU A;  5D61 A;  3PME A;  5BP5 C;  2KH2 A;  1TIE A;  1XZZ A;  3VT0 A;  3CRH A;  4X37 A;  3H6R B;  1MD6 A;  1S0G A;  3BRG C;  4X38 A;  1I1B A;  2E4M C;  4ZFW B;  1HWO B;  4II0 A;  1ILR 1;  3T8S A;  4EFQ A;  3O4D A;  3AH4 A;  3O5W B;  2ZQN A;  4AN6 A;  4JKX B;  4Z8S B;  5HPZ A;  4J2X A;  3V0A A;  5JMC A;  4QO3 A;  3H6Q A;  3I29 B;  3BAV A;  3BA4 A;  1J0S A;  1HCE A;  2ZQO A;  5EG6 C;  4IZX A;  4GOY A;  3N0K A;  4I37 A;  1UPS A;  1PUU B;  2Z48 A;  4LO3 A;  3ZXD A;  2VSE A;  4WBC A;  4ZGR B;  4CJM A;  1RG8 A;  4LO8 B;  4I4V A;  4A7Y A;  1W3G A;  1Q04 A;  5FZY A;  3VT2 A;  3CA3 A;  2F2F A;  4Q9G A;  4G1R A;  4I1B A;  1YF8 B;  5F8W A;  3UD7 A;  5G00 A;  1VCL A;  2AQZ A;  5E24 E;  3WMV A;  3QR5 A;  3CA0 A;  4I3N A;  4D0Z A;  3IM5 A;  4X39 A;  2HWA A;  5GAQ A;  3UDA A;  1TWM A;  4ZLB B;  1JT5 A;  3OGF A;  2RG9 B;  1PWA A;  4A7K A;  3R4S A;  4LO0 C;  1DZC A;  4IZE A;  1V6V A;  3FJE A;  2QN4 A;  3NBC A;  4GAF A;  4EFP A;  5FNX A;  1YXW A;  4I8M A;  2Y9F A;  3BA5 A;  1DIW A;  1S0F A;  4OUJ A;  2MLL B;  3Q7W A;  1JQZ A;  3TC2 A;  2DRZ A;  4A7Z A;  1AFC A;  1FV3 A;  1PUM B;  2D44 A;  3AKG A;  3ZX7 A;  1G9C A;  3O3Q A;  3Q7X A;  3PHZ A;  1PZZ A;  2NYY A;  1ISX A;  3UD9 A;  4F83 A;  2D7R A;  1DFQ A;  1XG6 A;  3JUT A;  3OBR A;  4ZFU B;  3AKF A;  1XHB A;  4LO2 A;  2D43 A; 
#chains in the Genus database with same CATH topology
 1M16 A;  1P63 A;  3RMX A;  5F8S A;  3B9U A;  4LO1 C;  4Z9W B;  2AFG A;  3HN1 A;  1HWN B;  4GAI A;  6I1B A;  2ZR1 B;  4J2K A;  3R4U A;  3UD8 A;  2P39 A;  1FWV A;  5BXR A;  2FFU A;  3BAO A;  2QYI B;  3BAD A;  2KI4 A;  4I4P A;  2Y9W C;  2I1B A;  1S0E A;  5EHA A;  4I2S A;  3V0B A;  4OWK A;  1G9D A;  4OWL A;  1T4Q A;  3CA5 A;  3A22 A;  2VU9 A;  2HWM A;  1DJS B;  4ISR A;  3NBE A;  3RSJ A;  4PC4 A;  2D23 A;  4J23 B;  1HWM B;  4QBV A;  1BFB A;  5DSS B;  4I4R A;  3HBW A;  3IAG C;  4J2S A;  1YBI A;  1V6X A;  5BVP I;  3LTQ A;  3AZW A;  4ZKT B;  1GGP B;  4I1E A;  2ERM A;  3FJF A;  4JRA A;  1M2T B;  4KC3 A;  2E4M A;  3ZXG A;  1EYL A;  1JLY A;  2BFH A;  4I4U A;  4XFS A;  1BFF A;  1BFC A;  3WIN C;  3RTI B;  2GO2 A;  1JTC A;  2NZ9 A;  4END A;  4KEI A;  3WA1 A;  4I4S A;  2NVH A;  1HCD A;  4ION A;  2RST A;  3K1X A;  3BRD A;  3A07 A;  4QD2 B;  2R9K B;  1BFG A;  3FJK A;  1EPW A;  1SR4 C;  3NBN A;  3SNV A;  3CAH A;  4TLP A;  3FJC A;  1EV2 A;  3RMY A;  2D7I A;  4D8H A;  4IYB A;  1RZO B;  5DVH A;  1DFC A;  1G9B A;  4H9W A;  1L2H A;  1W3A A;  4D0T A;  3AKI A;  4J2Y A;  3O4O A;  4MZH A;  3P6J A;  4LO0 A;  2KI6 B;  4IQP A;  2IHO A;  1I1E A;  3HAL A;  3BX1 C;  4G9M A;  3FJA A;  3NBD A;  1AXM A;  3OGG A;  3P53 A;  3CA4 A;  4ZFY B;  2D20 A;  1S0C A;  3HSM A;  3O49 A;  4I6I A;  3WO4 A;  3P6I A;  4I4Y A;  41BI A;  3D7W B;  3FGM A;  1YYN A;  3S8K A;  2HZ9 A;  3CQA A;  1S0L A;  3V79 C;  3ZC9 A;  4XFU A;  1K5U A;  3LLP A;  4F34 A;  2K8R A;  1K5V A;  1OQL B;  4G6M A;  3O4A A;  1N4K A;  3WO3 A;  3C9Z A;  4KBB A;  4DCK C;  1AVA C;  1A8D A;  1CE7 B;  3QYD A;  4YOL A;  2DRY A;  2HW9 A;  1IOB A;  4QD2 C;  2Y9X E;  4LO3 C;  3OJV A;  1RML A;  2MIB A;  3UJ0 A;  1BAS A;  1TFM B;  1Z0H A;  2MC2 A;  4GP0 A;  1BLD A;  2F2F C;  4I0Y A;  1ISY A;  1IHK A;  2LIE A;  1DZD A;  2K4A B;  2FFV A;  2P23 A;  3A23 A;  3EF2 A;  3POK A;  2D1Z A;  3CRI A;  4IY9 A;  4GOV A;  5JLV A;  4JQ0 A;  4ZOT A;  3S8J A;  1NUN A;  1TOO A;  4JAW A;  2KLL A;  2DRE A;  3FJH A;  1ISW A;  2BEB A;  5BQU A;  2K43 A;  9ILB A;  3N7L A;  3CRG A;  1V6U A;  3IM6 A;  3PG0 A;  4HJJ A;  3ILA A;  5B2H A;  2J3P A;  3N7J A;  4OEF A;  3VWC A;  4HR6 C;  4P6A A;  4I4Q A;  4EEE B;  4I7I A;  1IIL A;  5BP5 A;  2D24 A;  2Z49 A;  1Z4S A;  5BXT A;  1XYF A;  3OBT A;  3W9T A;  3PUB A;  4P0J A;  4QC4 A;  3F62 B;  1FQ9 A;  4JPZ A;  3OJM A;  5FZU A;  1ABR B;  1JT3 A;  2Q3N B;  4FVV A;  8I1B A;  1BAR A;  1WD3 A;  2WRY A;  5FZZ A;  1HKN A;  2WBC A;  4EFR A;  3AH1 A;  3V0A B;  1YTO A;  4JKQ A;  4QKS A;  5D62 A;  1R8N A;  5EC5 A;  31BI A;  3FJB A;  3VT1 A;  1JLX A;  4KEJ A;  3E8L C;  1FMZ A;  2YUG A;  4G9N A;  3VSZ A;  4I4X A;  3VSF A;  2NP0 A;  1AVX B;  2BEA A;  1NZK A;  1FWU A;  1FV2 A;  4FGF A;  4OEG A;  4Q9P A;  1DLL A;  3BTA A;  3I2X A;  4R6U B;  4UY4 A;  3AZV A;  4OWJ A;  1JY0 A;  4H04 A;  5BXP A;  1AVU A;  1R8O A;  5DUY A;  3O4B A;  1ONK B;  1T9F A;  3OJ2 A;  3N7M A;  1Q03 A;  3AJ6 A;  4KEK A;  3H6S E;  1JT7 A;  2VLC A;  1CVS A;  4EKX B;  3CA6 A;  2ET2 A;  2VXT I;  3H6R A;  1SZ6 B;  3HOM A;  1HWP B;  4IHZ A;  3WMU A;  4USP A;  1MC9 A;  2Y9G A;  1TTU A;  4ZA3 B;  3BAH A;  5F8Y A;  4QAL A;  3WO2 A;  7I1B A;  3BRF A;  3FUQ A;  3KMV A;  3BAQ A;  1IT0 A;  1D0H A;  2X2S A;  2FO1 A;  1Q1U A;  3CA1 A;  1FGA A;  4LO1 A;  5FNW A;  2LIQ A;  3AKH A;  1BA7 A;  2VUA A;  1S0D A;  1DQG A;  2ESU A;  3BAG A;  2GZB A;  2NTD A;  3BA7 A;  4L4H A;  3CU1 B;  1IRA X;  1FN0 A;  1JT4 A;  4OEE A;  2UUS A;  3IIR A;  1FMM S;  3I2A A;  1QQK A;  1F31 A;  1QQL A;  3IM7 A;  4DEN A;  1G82 A;  3FJI A;  4XFT A;  1HIB A;  4I4O A;  3V0B B;  1AVW B;  2X2T A;  4Q91 A;  4MZG B;  2VXR A;  1BLA A;  1QXM A;  3VUO A;  3FFZ A;  4HA2 A;  4LO7 B;  2L5X A;  3N7K A;  3FJD A;  4MZF B;  4P0L A;  1TWE A;  2NM1 A;  2XOA A;  3VEQ A;  2DS0 A;  5D63 A;  4AN7 B;  1G9A A;  3FJ9 A;  3FJ8 A;  3HMY A;  3RTJ B;  4QBC A;  3O44 A;  1Z2V A;  4I96 A;  4ZBV B;  4JP0 A;  1DQO A;  2M49 A;  2Q9X A;  4X3A A;  1KNM A;  3WIN A;  1IJT A;  2F8X C;  4ISQ A;  1S0B A;  5BXS A;  2D22 A;  1AF9 A;  3JRR A;  3AJ5 A;  2AXM A;  1ISZ A;  4LO2 C;  4IY8 A;  3F1R A;  3AH2 A;  4G6J A;  3MAL A;  4P0K A;  3O4C A;  1SR4 A;  1WBA A;  5I1B A;  2FGF A;  1IRP A;  2VSA A;  2IWT B;  5BOW A;  1V6W A;  3Q7Y A;  1EVT A;  21BI A;  1PC8 B;  3BB2 A;  2RQ9 A;  4DEP A;  1ITB A;  1E0O A;  2FDB M;  3FJJ A;  3ZC8 A;  1WD4 A;  4L4I A;  4XKI A;  1II4 A;  5F90 A;  1W3F A;  5BQU C;  4OW4 A;  2AAI B;  1TP0 A;  1WBC A;  3UJ4 A;  3NJ5 A;  4GP3 A;  4EB2 B;  3BAU A;  1ISV A;  4USO A;  3FUO A;  2KKI A;  4QKR A;  4LO7 C;  1RY7 A;  3MPP G;  3A21 A;  5DZU A;  5D61 A;  3PME A;  5BP5 C;  2KH2 A;  1TIE A;  1XZZ A;  3VT0 A;  3CRH A;  4X37 A;  3H6R B;  1MD6 A;  1S0G A;  3BRG C;  4X38 A;  1I1B A;  2E4M C;  4ZFW B;  1HWO B;  4II0 A;  1ILR 1;  4H75 A;  3T8S A;  4EFQ A;  3O4D A;  3AH4 A;  3O5W B;  2ZQN A;  4AN6 A;  4JKX B;  4Z8S B;  5HPZ A;  4J2X A;  3V0A A;  5JMC A;  4QO3 A;  3H6Q A;  3I29 B;  3BAV A;  3BA4 A;  2NS2 A;  1J0S A;  1HCE A;  2ZQO A;  5EG6 C;  4IZX A;  4GOY A;  3N0K A;  4I37 A;  1UPS A;  1PUU B;  2Z48 A;  4LO3 A;  3ZXD A;  2VSE A;  4WBC A;  4ZGR B;  4CJM A;  1RG8 A;  4LO8 B;  4I4V A;  4A7Y A;  1W3G A;  1Q04 A;  5FZY A;  3VT2 A;  3CA3 A;  2F2F A;  4Q9G A;  4G1R A;  4I1B A;  1YF8 B;  5F8W A;  3UD7 A;  5G00 A;  1VCL A;  2AQZ A;  5E24 E;  3WMV A;  3QR5 A;  3CA0 A;  4I3N A;  4D0Z A;  3IM5 A;  4X39 A;  2HWA A;  5GAQ A;  3UDA A;  1TWM A;  4ZLB B;  1JT5 A;  3OGF A;  2RG9 B;  1PWA A;  4A7K A;  3R4S A;  4LO0 C;  1DZC A;  4IZE A;  1V6V A;  3FJE A;  2QN4 A;  3NBC A;  4GAF A;  4EFP A;  5FNX A;  1YXW A;  4I8M A;  2Y9F A;  3BA5 A;  1DIW A;  1S0F A;  4OUJ A;  2MLL B;  3Q7W A;  1JQZ A;  3TC2 A;  2DRZ A;  4A7Z A;  1AFC A;  1FV3 A;  1PUM B;  2D44 A;  3AKG A;  3ZX7 A;  1G9C A;  3O3Q A;  3Q7X A;  3PHZ A;  1PZZ A;  2NYY A;  1ISX A;  3UD9 A;  4F83 A;  2D7R A;  1DFQ A;  1XG6 A;  3JUT A;  3OBR A;  4ZFU B;  3AKF A;  1XHB A;  4LO2 A;  2D43 A; 
#chains in the Genus database with same CATH homology
 1M16 A;  1P63 A;  3RMX A;  5F8S A;  3B9U A;  4LO1 C;  4Z9W B;  2AFG A;  3HN1 A;  1HWN B;  4GAI A;  6I1B A;  2ZR1 B;  4J2K A;  3R4U A;  3UD8 A;  2P39 A;  1FWV A;  5BXR A;  2FFU A;  3BAO A;  2QYI B;  3BAD A;  2KI4 A;  4I4P A;  2Y9W C;  2I1B A;  1S0E A;  5EHA A;  4I2S A;  3V0B A;  4OWK A;  1G9D A;  4OWL A;  1T4Q A;  3CA5 A;  3A22 A;  2VU9 A;  2HWM A;  1DJS B;  4ISR A;  3NBE A;  3RSJ A;  4PC4 A;  2D23 A;  4J23 B;  1HWM B;  4QBV A;  1BFB A;  5DSS B;  4I4R A;  3HBW A;  3IAG C;  4J2S A;  1YBI A;  1V6X A;  5BVP I;  3LTQ A;  3AZW A;  4ZKT B;  1GGP B;  4I1E A;  2ERM A;  3FJF A;  4JRA A;  1M2T B;  4KC3 A;  2E4M A;  3ZXG A;  1EYL A;  1JLY A;  2BFH A;  4I4U A;  4XFS A;  1BFF A;  1BFC A;  3WIN C;  3RTI B;  2GO2 A;  1JTC A;  2NZ9 A;  4END A;  4KEI A;  3WA1 A;  4I4S A;  2NVH A;  1HCD A;  4ION A;  2RST A;  3K1X A;  3BRD A;  3A07 A;  4QD2 B;  2R9K B;  1BFG A;  3FJK A;  1EPW A;  1SR4 C;  3NBN A;  3SNV A;  3CAH A;  4TLP A;  3FJC A;  1EV2 A;  3RMY A;  2D7I A;  4D8H A;  4IYB A;  1RZO B;  5DVH A;  1DFC A;  1G9B A;  4H9W A;  1L2H A;  1W3A A;  4D0T A;  3AKI A;  4J2Y A;  3O4O A;  4MZH A;  3P6J A;  4LO0 A;  2KI6 B;  4IQP A;  2IHO A;  1I1E A;  3HAL A;  3BX1 C;  4G9M A;  3FJA A;  3NBD A;  1AXM A;  3OGG A;  3P53 A;  3CA4 A;  4ZFY B;  2D20 A;  1S0C A;  3HSM A;  3O49 A;  4I6I A;  3WO4 A;  3P6I A;  4I4Y A;  41BI A;  3D7W B;  3FGM A;  1YYN A;  3S8K A;  2HZ9 A;  3CQA A;  1S0L A;  3V79 C;  3ZC9 A;  4XFU A;  1K5U A;  3LLP A;  4F34 A;  2K8R A;  1K5V A;  1OQL B;  4G6M A;  3O4A A;  1N4K A;  3WO3 A;  3C9Z A;  4KBB A;  4DCK C;  1AVA C;  1A8D A;  1CE7 B;  3QYD A;  4YOL A;  2DRY A;  2HW9 A;  1IOB A;  4QD2 C;  2Y9X E;  4LO3 C;  3OJV A;  1RML A;  2MIB A;  3UJ0 A;  1BAS A;  1TFM B;  1Z0H A;  2MC2 A;  4GP0 A;  1BLD A;  2F2F C;  4I0Y A;  1ISY A;  1IHK A;  2LIE A;  1DZD A;  2K4A B;  2FFV A;  2P23 A;  3A23 A;  3EF2 A;  3POK A;  2D1Z A;  3CRI A;  4IY9 A;  4GOV A;  5JLV A;  4JQ0 A;  4ZOT A;  3S8J A;  1NUN A;  1TOO A;  4JAW A;  2KLL A;  2DRE A;  3FJH A;  1ISW A;  2BEB A;  5BQU A;  2K43 A;  9ILB A;  3N7L A;  3CRG A;  1V6U A;  3IM6 A;  3PG0 A;  4HJJ A;  3ILA A;  5B2H A;  2J3P A;  3N7J A;  4OEF A;  3VWC A;  4HR6 C;  4P6A A;  4I4Q A;  4EEE B;  4I7I A;  1IIL A;  5BP5 A;  2D24 A;  2Z49 A;  1Z4S A;  5BXT A;  1XYF A;  3OBT A;  3W9T A;  3PUB A;  4P0J A;  4QC4 A;  3F62 B;  1FQ9 A;  4JPZ A;  3OJM A;  5FZU A;  1ABR B;  1JT3 A;  2Q3N B;  4FVV A;  8I1B A;  1BAR A;  1WD3 A;  2WRY A;  5FZZ A;  1HKN A;  2WBC A;  4EFR A;  3AH1 A;  3V0A B;  1YTO A;  4JKQ A;  4QKS A;  5D62 A;  1R8N A;  5EC5 A;  31BI A;  3FJB A;  3VT1 A;  1JLX A;  4KEJ A;  3E8L C;  1FMZ A;  2YUG A;  4G9N A;  3VSZ A;  4I4X A;  3VSF A;  2NP0 A;  1AVX B;  2BEA A;  1NZK A;  1FWU A;  1FV2 A;  4FGF A;  4OEG A;  4Q9P A;  1DLL A;  3BTA A;  3I2X A;  4R6U B;  4UY4 A;  3AZV A;  4OWJ A;  1JY0 A;  4H04 A;  5BXP A;  1AVU A;  1R8O A;  5DUY A;  3O4B A;  1ONK B;  1T9F A;  3OJ2 A;  3N7M A;  1Q03 A;  3AJ6 A;  4KEK A;  3H6S E;  1JT7 A;  2VLC A;  1CVS A;  4EKX B;  3CA6 A;  2ET2 A;  2VXT I;  3H6R A;  1SZ6 B;  3HOM A;  1HWP B;  4IHZ A;  3WMU A;  4USP A;  1MC9 A;  2Y9G A;  1TTU A;  4ZA3 B;  3BAH A;  5F8Y A;  4QAL A;  3WO2 A;  7I1B A;  3BRF A;  3FUQ A;  3KMV A;  3BAQ A;  1IT0 A;  1D0H A;  2X2S A;  2FO1 A;  1Q1U A;  3CA1 A;  1FGA A;  4LO1 A;  5FNW A;  2LIQ A;  3AKH A;  1BA7 A;  2VUA A;  1S0D A;  1DQG A;  2ESU A;  3BAG A;  2GZB A;  2NTD A;  3BA7 A;  4L4H A;  3CU1 B;  1IRA X;  1FN0 A;  1JT4 A;  4OEE A;  2UUS A;  3IIR A;  1FMM S;  3I2A A;  1QQK A;  1F31 A;  1QQL A;  3IM7 A;  4DEN A;  1G82 A;  3FJI A;  4XFT A;  1HIB A;  4I4O A;  3V0B B;  1AVW B;  2X2T A;  4Q91 A;  4MZG B;  2VXR A;  1BLA A;  1QXM A;  3VUO A;  3FFZ A;  4HA2 A;  4LO7 B;  2L5X A;  3N7K A;  3FJD A;  4MZF B;  4P0L A;  1TWE A;  2NM1 A;  2XOA A;  3VEQ A;  2DS0 A;  5D63 A;  4AN7 B;  1G9A A;  3FJ9 A;  3FJ8 A;  3HMY A;  3RTJ B;  4QBC A;  3O44 A;  1Z2V A;  4I96 A;  4ZBV B;  4JP0 A;  1DQO A;  2M49 A;  2Q9X A;  4X3A A;  1KNM A;  3WIN A;  1IJT A;  2F8X C;  4ISQ A;  1S0B A;  5BXS A;  2D22 A;  1AF9 A;  3JRR A;  3AJ5 A;  2AXM A;  1ISZ A;  4LO2 C;  4IY8 A;  3F1R A;  3AH2 A;  4G6J A;  3MAL A;  4P0K A;  3O4C A;  1SR4 A;  1WBA A;  5I1B A;  2FGF A;  1IRP A;  2VSA A;  2IWT B;  5BOW A;  1V6W A;  3Q7Y A;  1EVT A;  21BI A;  1PC8 B;  3BB2 A;  2RQ9 A;  4DEP A;  1ITB A;  1E0O A;  2FDB M;  3FJJ A;  3ZC8 A;  1WD4 A;  4L4I A;  4XKI A;  1II4 A;  5F90 A;  1W3F A;  5BQU C;  4OW4 A;  2AAI B;  1TP0 A;  1WBC A;  3UJ4 A;  3NJ5 A;  4GP3 A;  4EB2 B;  3BAU A;  1ISV A;  4USO A;  3FUO A;  2KKI A;  4QKR A;  4LO7 C;  1RY7 A;  3MPP G;  3A21 A;  5DZU A;  5D61 A;  3PME A;  5BP5 C;  2KH2 A;  1TIE A;  1XZZ A;  3VT0 A;  3CRH A;  4X37 A;  3H6R B;  1MD6 A;  1S0G A;  3BRG C;  4X38 A;  1I1B A;  2E4M C;  4ZFW B;  1HWO B;  4II0 A;  1ILR 1;  4H75 A;  3T8S A;  4EFQ A;  3O4D A;  3AH4 A;  3O5W B;  2ZQN A;  4AN6 A;  4JKX B;  4Z8S B;  5HPZ A;  4J2X A;  3V0A A;  5JMC A;  4QO3 A;  3H6Q A;  3I29 B;  3BAV A;  3BA4 A;  2NS2 A;  1J0S A;  1HCE A;  2ZQO A;  5EG6 C;  4IZX A;  4GOY A;  3N0K A;  4I37 A;  1UPS A;  1PUU B;  2Z48 A;  4LO3 A;  3ZXD A;  2VSE A;  4WBC A;  4ZGR B;  4CJM A;  1RG8 A;  4LO8 B;  4I4V A;  4A7Y A;  1W3G A;  1Q04 A;  5FZY A;  3VT2 A;  3CA3 A;  2F2F A;  4Q9G A;  4G1R A;  4I1B A;  1YF8 B;  5F8W A;  3UD7 A;  5G00 A;  1VCL A;  2AQZ A;  5E24 E;  3WMV A;  3QR5 A;  3CA0 A;  4I3N A;  4D0Z A;  3IM5 A;  4X39 A;  2HWA A;  5GAQ A;  3UDA A;  1TWM A;  4ZLB B;  1JT5 A;  3OGF A;  2RG9 B;  1PWA A;  4A7K A;  3R4S A;  4LO0 C;  1DZC A;  4IZE A;  1V6V A;  3FJE A;  2QN4 A;  3NBC A;  4GAF A;  4EFP A;  5FNX A;  1YXW A;  4I8M A;  2Y9F A;  3BA5 A;  1DIW A;  1S0F A;  4OUJ A;  2MLL B;  3Q7W A;  1JQZ A;  3TC2 A;  2DRZ A;  4A7Z A;  1AFC A;  1FV3 A;  1PUM B;  2D44 A;  3AKG A;  3ZX7 A;  1G9C A;  3O3Q A;  3Q7X A;  3PHZ A;  1PZZ A;  2NYY A;  1ISX A;  3UD9 A;  4F83 A;  2D7R A;  1DFQ A;  1XG6 A;  3JUT A;  3OBR A;  4ZFU B;  3AKF A;  1XHB A;  4LO2 A;  2D43 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...