1K5WA

Three-dimensional structure of the synaptotagmin 1 c2b-domain: synaptotagmin 1 as a phospholipid binding machine
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
148
structure length
148
Chain Sequence
KLGDICFSLRYVPTAGKLTVVILEAKNLKKMDVGGLSDPYVKIHLMQNGKRLKKKKTTIKKNTLNPYYNESFSFEVPFEQIQKVQVVVTVLDYDKIGKNDAIGKVFVGYNSTGAELRHWSDMLANPRRPIAQWHTLQVEEEVDAMLAV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Three-dimensional structure of the synaptotagmin 1 C2B-domain: synaptotagmin 1 as a phospholipid binding machine.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Endocytosis/exocytosis
molecule keywords Synaptotagmin I
total genus 27
structure length 148
sequence length 148
ec nomenclature
pdb deposition date 2001-10-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00168 C2 C2 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.150 Mainly Beta Sandwich Immunoglobulin-like C2 domain 1k5wA00
3TWYA 3GPEA 2CJTA 2CM6A 1RSYA 3QAQA 1DJIA 3QK0A 4Y1SA 1WFMA 2KI6A 3F00A 2CJSA 1E90A 2QZQA 2RD0A 4ANXA 1GMIA 2FJUB 3B7YA 3P2BA 4WAFA 3NZSA 1DJHA 3HIZA 3RDJA 4FHJA 2DMHA 2FK9A 3QARA 4NP9A 1W16A 1DSYA 1DJGA 1WFJA 4KZCA 4NS0A 2CHZA 3NSJA 4FULA 4PS3A 3W57A 4QJ5B 2Z0UA 3W56A 3CSTA 2LHAA 5CCJA 2D8KA 4EZLA 1E8YA 4MJJA 3FBKA 3KWTA 1E7VA 4L2YA 2WXRA 4XZ4A 3SD5A 2ENQA 1UGKA 1CJYA 4BGDA 2B3RA 5H4ZA 2WXLA 2X38A 1K5WA 4Y1TA 4KITB 1DJXA 3L13A 2A4ZA 4FA6A 2K4AA 3M7FB 2WXKA 4G11A 4QJ3B 2V4LA 4AJWA 1HE8A 3L54A 4ICWA 4XX5A 2UZPA 3S2AA 3PYCA 4J6IA 1A25A 2Y3AA 3QJZA 1E8WA 4L1BA 3KWUA 2CHXA 3ML8A 2K45A 1DJYA 5CCHE 1V27A 2CHDA 1BCIA 2QZ5A 4KZ0A 4HLEA 4DNLA 4FLHA 2NQ3A 2Q0ZX 3DPDA 3FDWA 3IM1A 1TJMA 2WXGA 5G55A 2Q3XA 2YRBA 3F05A 3RPBA 4ANUA 1TJXA 4F91B 1DJWA 4L1LA 3F04A 4IHBA 1QATA 4IQHA 4ICXA 4FJZA 5EDSA 2WXMA 3L08A 3MJWA 3ENEA 4NPJA 2JQZA 3QR0A 5T8IA 3ML9A 4PS7A 4F1SA 4OVVA 4AOFA 4FHKA 2ENJA 3HN8A 3LJ3A 4WWOA 3PS6A 1DJZA 3OHMB 2WXIA 3N5AA 4DK5A 4FJYA 3DBSA 4ANWA 5JHAA 3APFA 1YRKA 3NZUA 2EP6A 3ZW3A 3L9BA 3TJPA 4HVBA 1RH8A 4LDCA 4A55A 5H4YA 5G2NA 3IBEA 2WXFA 3JZYA 4F93B 3L17A 1UOVA 3PREA 2WXOA 3QR1A 3L4CA 3PFQA 4EZKA 4L23A 4TUUA 2CHWA 4WWNA 4JPSA 3R7RA 4ANVA 3F01A 4LT7A 3ZIMA 1E8XA 1E7UA 3APCA 3TL5A 1E8ZA 1UOWA 4QJ4B 4WWPA 4FADA 4V11A 2R83A 4WEEA 4EZJA 1DQVA 3HHMA 2ZKMX 4PS8A 4LCVA 1W15A 4XE0A 3ZVVA 4F92B 4QAMB 2WXJA 2NSQA 4URKA 2A5UA 2N1TE 4GNKB 2ISDA 2NCEA 1QASA 2K8MA 4TV3A 4NPKA 1RLWA 2WXHA 3PRZA 3T8MA 5JHBA 3CSFA 3OAWA 3APDA 1BDYA 2BWQA 2YOAA 4GB9A 5KJ7E 1BYNA 2K3HA 4OVUA 2DMGA 2CM5A 4TS6A 3L16A 3R7QA 2WXPA 5CCGE 2WXQA 2WXNA 2ENPA 4BFRA
chains in the Genus database with same CATH superfamily
3NABL 4GRLB 2AITA 3QO0A 3BN9C 3WKPA 4YFDB 1SHSA 4O51A 5MEQB 5AKRA 4XTRC 1M2VB 1NWPA 2NY3D 2NY4D 4WV1C 1O6TA 2G9HA 3CVHA 5AALA 3QI9D 3L5XH 5A6LA 4JZNA 3O41B 2F53D 4FQHB 2GW5A 3VX0A 2QKIB 1KLFA 3OGCA 3QEQB 3SE8H 3I6GA 4GAGH 4OCRH 2HN7B 4PR5A 3VNZA 1KYDA 4AVIA 4PJAA 2WANA 3QE5A 1S5IH 1GIGL 4YHNA 1AY1L 5GZNA 2GTQA 2B3RA 3B9AA 2AZAA 1HEZA 1UJ3B 1E67A 2VJ0A 2ZTBA 4IRJC 5AOMA 1HXYB 5KAQG 3S8FB 3OL2A 1FLTX 2DWDB 2VW7A 4HLJA 2PABA 4F7TB 3X12B 3V5HB 4R96A 5EEYA 2RCSH 5DVPA 3RJDA 3F2LA 4CADB 1KJ3L 1JE6A 4WGKA 3MV7D 4BKLA 4CBZA 5EOQH 4BSVA 1WIPA 2B1AL 4JFOB 4PRIB 1SPDA 4X4MA 2JCCA 2R2HA 4OLZL 3V6FA 4FEMA 4JEGB 3BDYH 3BT2H 1TZ8A 3RKDC 1T5WA 2V0AA 3BD5A 1RJYB 4K55A 4MVBD 1NDMA 3MJ6A 1T2XA 3O3DB 4MXQC 4Y16B 4O4YH 5GRYA 3JWNC 1NBVL 4KZDL 4HJ0D 3BVNB 4IHBA 2YUZA 4ICXA 1Z3GL 3L3IA 3QXAA 2BP3A 4P5TD 5IB1B 1KN2H 3OKOB 2IH3B 5CN1A 4HKXA 2NY4C 1U58B 1BLIA 1NC4A 2FB4L 1R19A 4L8BA 1J1OH 3NTCL 3MX0B 4XMWA 5DRWA 1Q72L 3QUXA 1F58H 1CXEA 2HKFH 3GFUA 4AC4A 1JV2A 1P7QD 5BRZE 1H3PH 4G71B 1RUKH 4ZJ9A 4BH8B 4L29A 2BFGA 2Z8SA 2AK4E 3FULA 3QUGA 4U1MA 3E6HB 1FG9C 1KACB 2K9UA 1E5CA 4ZT1A 1ZY9A 1N70A 1A4BA 2X88A 3VE0B 3T0XA 2EDOA 2LR4A 1NEUA 2FQDA 4JE0A 4QUOA 2OX5A 3HEIB 4UTAA 1KTRL 3DDFA 4HS6A 4H0IA 2MEJB 2BIMA 1G9MC 5AW0B 3SODB 2IBZY 4HD5A 1ZIBA 3QEUA 4N26A 3SGDH 1KIRA 1GGCH 3OAWA 2OMVA 3LZRA 4XCEA 3DYPA 5SX5H 3T0VA 2JKSA 3RL2A 2X6AA 3CLFL 1LE9A 5H37G 3VSVA 5EO1B 1IAIH 4GMTH 4JO2H 1OF0A 4OFVA 1CC3A 2NR6C 5CCGE 3A0OA 3EO9L 2DKUA 1JPST 4ZOBA 3TYFA 4HIXH 3F58L 3K5SA 2VN7A 5KJ4A 2VDOH 5HHME 3EGXB 1CQYA 1Z0MA 4LE8A 4AEHH 5JPMA 3QDJD 3BZFA 2J6EH 3WELA 1W72L 3U0PB 2CDFA 1M53A 4GKNA 3VWKC 2ADYA 3SYPA 2WB1A 5KAQF 1D7DA 3VFUB 3NIDE 5A2LH 3JTTA 1PX3A 4WO4C 1NBVH 3DI2B 5BO0D 4FFTA 1ACYH 3HI5H 3QNYB 2YAQA 4HA1A 3VFWB 2ZXGA 2VLMD 2MPAL 3GXUB 4JKWA 2BVEA 3CU7A 1T5XB 2ZUXA 3NUKA 3IFLH 1S9YA 2YMOA 4ADIA 1CK0H 5H94A 1CWVA 4X6CE 3OZKA 3MNMA 2A0LD 4IMKA 4N2AA 2IH8A 4PJXB 1ECZA 4D3CH 2M26A 5T5NG 5H8DA 5KBMA 2C9AA 2FGZA 2E6PA 4N2BA 2CKBH 5DUPL 4PJCA 3MCYA 5BVJA 3RGVD 1AQMA 4B53A 5CN3A 5LBSH 3FQXB 3SPVB 2D7MA 2F15A 5DMJB 1ZLWK 5IESH 1Z9MA 2FX7H 2FD6H 2ZIDA 3IGFA 1FVCA 3EYOA 2J57A 1OSPH 4H0HB 2R1WB 4J3OD 5DHVB 2EC8A 12E8L 4JPKL 2BZ7A 3BSZA 4MSWA 4PCYA 5B21A 2W60B 3SB3A 5ERWB 5L4JA 3LRSA 4MQTB 4XCCL 2X1XR 3GBNL 5J13B 2DZEA 4XN1A 3PWVB 4YK4B 5ITBL 2CR3A 1CMOA 2QPEB 2VDOL 3ETBJ 2X3CA 3ABLB 4NGHL 3SGEH 2ZAGA 4Y5YB 2W0FA 2Z8WC 3C6LB 3WFHB 1BOYA 5J1TC 3TV8A 3PNRB 2AI0H 4G7VL 4L8DA 3EJTA 1QFUL 1NIEA 1W15A 3F7YA 4KKAC 2X40A 1NGYA 2DJ4A 1MZZA 3VH8A 5B3NA 1UXSB 3V0FA 4RBPK 1BZEA 4N0UB 2V3FA 4FFYA 3EGSA 4X6CF 5LN4A 2F53A 2JF1A 4HSQA 3P77A 1MQKL 3EYSH 1EERB 3QUZC 4DK6A 4FG0A 1I9RH 3EFOB 5F1NA 1S8DA 4QTIL 1CE6B 3QISA 4X6EA 2D7TH 2N01B 1U2CA 1CI3M 4N8PA 2H9GB 5D72L 1OP5K 4JRXE 3SPCA 4Y7MA 5I1KL 1C8QA 5SWSE 2F8XC 3SZKC 3WOVA 1W8NA 3WN6A 5BQ7B 4FP8H 4RA3A 3WJMB 3HNVL 4G8IB 4HC1L 4P4KA 3LY6A 4A2LA 1TUPA 1O6VA 3OG4B 1KIQA 1JDDA 4LQ1A 5JPMB 3FOLB 3DRTA 3GXIA 4L0ZA 4YXHH 3D0AA 4C59B 1ZA3B 2EEFA 1P9MC 3ZQ9A 3B2XA 3UO8B 3V7MA 1G0YR 2OK0L 4BSWA 3KGRA 3HR6A 3FS9A 1JS4A 4PTUB 4M1DH 1Z5YD 3MGOB 4WFEE 5K1VA 3G5ZB 5CCKH 2OZNA 1R9FA 5C0GA 4G5AA 1Z5LB 3ZY7A 4MNHA 1AO7A 4MRBA 4DQOH 5D4IA 4ZQKB 4BZ1H 3EBHA 1S9VA 4N2IA 3WJLA 4EF3A 3O3BB 1HKLH 2BVOB 2CMRH 3JUZA 5C92A 4KZ0A 1P4BH 3O9WC 2R1YA 5CD5C 4PGZA 1N5YH 1GKEA 1KT2A 4AYFA 4ZNEE 4ANUA 2JH2A 1EQWA 1OP5H 1KXQE 3BUPA 3UZVB 4QRTA 5B1CA 2WQUA 1QATA 1DL7L 2IXQB 4JY5L 5DD0L 4LCWB 1QQDA 5D1ZD 1PDKA 1BLNB 2HN7A 4PR5B 4QGYA 5E1IA 4U3SA 4YSDA 1EJ6A 1ZSDA 1W0VB 2NY6C 2WYTA 3D85B 3O6LH 3SDXF 1U93A 2CUHA 3AXIA 3ARQA 1U4EA 2E74C 3GPSA 4NKDB 4U6TA 5H4YA 3U2SA 3A4DA 3AU1A 1KLGA 3KPMA 4IMKC 2M83A 1I3UA 3OB0H 3Q0HA 2EYTA 4J23A 3PFQA 3EF7A 4X6DE 1FFTB 1BFOB 4TMPA 4YHLL 1A14L 5IR1A 4PM1A 2CCLA 4DP5X 3BH8A 3N1PC 1SJHA 4I7ZC 5M7QA 1AGFB 3POCA 2VDQH 4G2AA 5EIQA 3CH1A 4J12A 5BS0D 2E0PA 3FNKA 1UZ8B 3OJ2C 1V3KA 4MA1B 5CZRA 5CM1A 4Z0XB 1KB5H 5CR1A 3DVGB 5DZOA 1OGSA 1HIML 2VABA 3LKNB 4PJ7F 4LEXH 4H25B 1OSYA 5AW8B 4K3EL 3W11D 3FFCE 2CKBB 3KNBA 4PGDB 1D5IL 1YUKB 4F7KA 2CM6A 3Q5OA 4PJAB 1QNZH 3U9UB 3BWZA 3UOAB 1LE5A 2KPNA 1YYMH 4D9RD 2XX1A 3BN3B 1HHGB 3GXPA 3QO1A 5ICZB 1PFCA 5HYEA 4TSBH 3PAZA 2ZYIA 5FDYA 3H1ZA 2OI9C 3P0GB 3ARPA 1N64L 1KYOK 4DZBA 1PZ2A 1Z9LA 1FFRA 3CC5A 1S9XA 3MA7A 3OB0K 1LWHA 2D9CA 2ZCKH 3CFDB 4GSRA 2BSTA 5SX4H 1J05A 3QSKB 3VXOA 2RMNA 1G1YA 3B6SA 3N9GL 1QRNA 5ESVA 4HIEB 2PPFA 3UBXG 2H3NB 3QO1B 4BZ1L 2GSGB 4EDXA 2Z7WA 4MCNA 2FHCA 3IU3B 3L9YA 3ZZSA 1OTTC 2Z35B 4FLRA 4YSPA 1GL4B 3B2VL 2DIJA 2BHZA 2HCZX 4YFEA 1QEWB 4ZO8A 1BQHB 4MNQD 2MOVA 4LIQL 4LSTH 1E4XH 4M93C 4TSCL 2GJZB 5DJ8A 2XTJE 5E0QA 1OP3K 4OCWL 4M5ZL 3E80A 1OF2B 1URLA 2I9TB 2QPDB 1JTOA 3QZLA 2AEIT 3AACA 3K0WA 1G9EA 2FBJL 1NDTA 1WAAA 5IHUH 3W2DH 4YEEA 3V4PH 3MGTB 2NY1B 2BFVL 2ZSVB 2LU4A 3KJ4C 4MAYA 2FJGA 1CK0L 1IARB 1DJZA 2Y5TA 4YNYB 1CGUA 3DX1A 1KIPA 1XF3B 4AWJC 2D4FA 4F2FA 5DK0A 2V8LA 1PS3A 4N2OA 3PQYA 5CIPB 3VD5A 1NCHA 1QQDB 1URIA 4JFYB 3CZNA 2CHNA 4LLWA 1BBDH 1IQDA 1SQMA 4PRNA 4Z76A 5SWQB 2WXOA 1TCMA 4JPSA 2BY3A 2DN7A 1S8DB 1E2VA 3RTQA 2NXZB 4N3UA 1KPVB 4Q2ZB 4WHTB 5M94B 4HUWB 1NKOA 1PZ5B 4R4BB 4RQQA 3WIIL 3T3PB 2GJ6D 1GXEA 4WFHD 4D3CL 5J9PB 4PRIE 1D7FA 4MQXC 3UJIL 3L8QA 1YVLA 4UQEA 4QRRA 3X3FH 1XIWC 3X13B 5C0GB 3AY2A 4CSPA 4N0YL 2ZP8A 4P4RB 4ORZC 1ZS8A 1BD2D 4I9XA 4O9HH 3R1GL 2EVJA 1K9TA 1NKGA 4PV1C 1U91B 2NYYC 2W0FB 4Q6IC 3TPUA 5BS0E 1NCCH 1BQLL 1Q9WA 3KG5A 2AQ1A 2B4CL 4ZNCD 4XMUA 1JZ2A 4UT9H 1U95B 3J27A 4UDUB 4PWGA 4TVPE 2WBJD 3N06B 3WKYA 3RY6A 4PEEA 4F2ME 5BW7C 1SHWA 2XTJD 3GRGA 1UXWA 5D1QE 5EOQL 4AL8L 2YQ3A 3V0GA 4LLMB 4XHJC 3DURA 4KZCA 3VI4B 3MBEA 2EDWA 4LZKA 4RMBA 3UBFA 4U1IA 1RUPL 4X7DC 1P6WA 1AXSB 5I73B 5IBTH 3KWWB 3HLAB 3MLYL 4F33B 4XZ4A 3EYOB 3UTSE 1MCRA 4EI5B 2Q1EA 4YEFA 3RFZA 1CT8A 3PE9A 4NUJB 4JN1H 4AUUA 4EIUA 1FYTB 3L13A 3T65A 3KLSA 2XQ0A 4G7VH 4HHGA 3ILQD 4EN2A 2E56A 3AZUA 4S1DD 1USQA 5L2JB 4ZS7L 1TVBA 4MD0A 2Y36L 2GTWA 5I1LA 3EDEA 1E50A 2F54D 2WBXA 3MRHB 2OSXA 4G8GA 1FGNH 1YEGL 5HDQH 3ULVE 3FMGL 3IAGC 2HWZH 2Y24A 2XWBA 4DNLA 3E9TA 4AQ1B 2LU3A 3O4LB 4KRMB 1TDQA 5FYLH 1RIHL 2FTAA 4PJFF 3IAPA 4WNQB 2NSXA 4OIFA 4YHIA 5DD3H 2R4RL 1M7IA 4FQ2H 4C58B 3D12B 4MJ5B 4ABVA 3V5KA 4UDTA 3HUJE 3K4AA 1JRHI 1JN6A 3QFDB 3FQ2A 1ITBB 4FHKA 3IFPA 3S5YA 1HILB 2BSSA 3WFHA 5FGSA 2K8QA 4KO7A 1MNUL 3D2UD 1GYAA 1A0QH 5C0EB 3MGAA 3OAYH 4OQ1A 4M02A 2ZG1A 1YNLH 2QVMA 4NI3A 1VGKA 1JXFA 1HZLA 1FVCB 4UM9B 1FO0A 3WSQL 4J1UA 3L4YA 3SDCC 4LSUH 1BYPA 1I3GL 3LZQA 4J8RB 3MBWB 4YGVB 4XXWA 2OMWB 2YAHA 2F8OA 1BBJB 3ZGIA 2AEPL 3UC0H 4A68A 2D03L 3EYUH 4K3JH 1ORSB 3RURA 4M7LT 2XN9E 3V2AR 4OZIA 2P4AB 1CI5A 1FUNA 5DLMH 4ZDHA 2W5PA 1JBJA 1CDIA 1EGJA 1TU2A 2VSMB 3I75A 1JPSH 2BIPA 3MLZL 3VFRB 3BRGC 1E4KA 3NCJH 1LWJA 1YYLH 3HUJF 3VRJA 2YK1H 3VGDA 3NJNA 4A66A 1NFDF 2IO5A 2YAPA 1SXNA 3HNTH 1ZGLA 3NJKA 4O4YL 1WFMA 4WY7L 4JFXB 4CC0A 4LOVA 4ZUUA 4MJ4A 4KK6C 4HDIA 3B56A 5EPMA 4UTBH 5D2LB 3D50A 3BZFB 3H3BC 4JM2A 4UM8B 4B9IA 3O11A 1M71B 1WFOA 4LCCC 2IDCA 2W92A 5J5EA 2K6ZA 2MHAA 3NEOA 3FCBA 4M48L 3NZHH 4RAHA 1QLEB 2QKIC 4RMVA 4ZTPH 3WGUB 5F3BB 5IFAH 1ZGLP 3AXHA 4LEEA 3B9DA 3IDXH 3TGXA 1DN0A 2H32A 4OD1L 1CO1A 3MLUL 5HHOE 1PSKL 1AGDB 5IHWA 4G43A 4O2EA 3VXNB 2GBUA 1XDTT 3HMXL 1JRHH 4DUVA 4PY7B 3Q2VA 2CKBA 1EAQA 1SLWA 3ALWA 3VSQA 1PKQE 4NQDA 5IOPA 3MV8B 1MRFL 2VXQH 5CGTA 1YG9A 1KDIA 1QBAA 3U7YH 5EUOE 4ZFOA 5LXVA 1L7TL 3IXAB 5IB4A 2VQUA 3SDXA 4UQ3B 3SQOH 3QQ3B 4APQC 4PRBA 4Q0XH 4G6JH 4LPTA 2WKLA 3WS3A 1E4HA 2ED9A 4X4KA 3CFEA 3AS3A 2H1LM 4FJZA 2ATPA 2VN3A 3BEWB 3ARZA 2V9QA 1FNSH 1BYOA 3C5SB 1J8KA 1KPVA 1XGPA 3MJ9A 3NVQA 3QP3A 4WRLA 5D7KD 5L8JB 1OSZB 4ADGA 4L8SB 3W9DB 1KC5H 3HS0B 4A7GA 2R4SL 3PPSA 4AMKL 4YHML 5T1DH 4GO8A 2OKMA 2EC9T 3QUMH 1HCVA 1XF5B 3CHQA 3T0EE 1OCCB 3QQ9D 5F9AC 3GZKA 3VFOB 1ACXA 2HLAA 4BXVA 3D48R 2KDYA 2RACA 4FS0A 4MAYC 4M5ZH 2PTTB 2K3TA 4GSDH 4BZYA 1ZPUA 3JYBA 3LH8A 4PJGE 1XGPB 2FWUA 2QPUA 1P84J 5HI3D 3GMRB 1E5BA 2OQJA 1KYAA 5FR3A 2DJUA 4LO9A 4OKVA 4QMEA 4PJDA 1UB6B 4FXGA 4I3SH 2DW5A 3B3IB 4JRYE 4Q4EA 4BKLB 3HN5A 3I02B 5B4MD 4URKA 4UB0H 1JG9A 2HPTA 2ISDA 1CTMA 2HRGA 3FZUC 5EF0A 2IG2H 3GJFB 4Q6KA 3MACH 1JYVA 1T5WB 5IIEB 1E43A 1XL4A 1JGEB 3EYVB 3L5WB 3QIUD 3R19A 3FB8A 4PRAB 3ESVF 3BKJH 2AV7B 2J1KA 3HFFA 3OXRA 4P59H 4X7SH 5F93C 5C0IA 5BMFL 3SYAA 1G5AA 1DVFB 1TQWA 2VGLM 4IMLB 5CBEB 1QSVA 3HMXH 2J8UA 1BZ9B 3HAEB 4XXWC 4OM1H 3PLYA 1F11A 1OAKH 1MN4A 3CHOA 4NJ9L 1GJIA 4UZSA 2ETWA 3WEBA 1IVTA 2ED7A 4DEWA 2W94A 4R4NC 1RJZA 3IDXL 4QF1B 5LCVH 1CTNA 2QV4A 4PJ9C 3ULUL 3WEAA 2G0LA 4ORGA 4WIQA 5KSBF 5IJKC 2Z8VC 5I66B 4XT1C 2F9BT 3IN2A 1YJDC 1JPFB 5I1CH 5C0FA 4WHTA 4GIOA 2GEQA 4JFED 2OFQA 4AIZB 1QWNA 2GI0A 1DQMH 3TBCA 3IYLW 5IEKA 1IKFH 4ZTOL 3D0LB 3GTTA 4XAWH 1U41A 3GDBA 5HJ3B 3WNLA 3SOBH 3WLBB 4NN5B 4N5UA 3RNKA 5FECA 4J6RL 5IB2B 1Q1JL 2BH0A 3ULAB 4RFNB 1AH1A 4XNYL 3VI3A 1DLFL 1E30A 4NDMB 4LVOB 5DFTA 2ICCA 2VWEE 5I5IA 3WTYA 2IAND 4TLKA 2ED8A 5DD6B 3ZOAA 3VD1A 2JELL 2DI7A 3CZFA 3MDJA 1OPGH 3HE7C 3UEZA 1FG2B 2VL5A 3GXTA 1NPJA 1REIA 4FFZH 4XC1L 3WXVH 2WO4A 2K7QA 4JS7A 4Z7VE 5KSAC 4R7XA 4X80L 5JPNC 3DYOA 3APNA 4FERA 3DVIA 1SF3A 1BJMA 1MPAH 4I48B 1KC5L 3HG1D 3QIUB 4PB0H 2V5TA 5F6IB 2R69L 5C0BD 2GJ6E 2DM2A 1JK9B 4LKCA 5DLLA 2DLGA 1A6VL 1HZHL 3BP4B 2W9DH 4X9YA 3HRZB 4L5FE 4D9LL 1WE5A 4FQCL 3LIZH 3O4OC 4J1UB 3WU1A 3LNDA 4CW1B 1TFHA 5TH2A 3QXDA 3ROOA 2X7LA 4PPTA 2HT3C 4IGBA 5EBLB 4XCNB 5DMIL 3QR1A 1FZOA 1X4YA 3KPPA 3RGHA 1C8PA 3IDIB 3VM5A 1CFSA 1FVDA 1FDLL 3G08A 4YBLB 4FQLL 1DVSA 4CVWA 1F4WL 5J06A 5EU3B 2I5YL 1N7ML 3NCEB 4Q6IA 2GVYA 2G9KA 1WYJA 5AG8A 4XVUD 1EAPA 3PP4H 5F7EL 4WJG3 4Y4HC 4R6UA 2K8MA 3VTAA 4BH7B 1N7MH 3PHQA 2VC2B 5BVJB 4LOUC 4Q8BA 5AW3B 4H0LC 1ORQA 5CD5D 1R3IL 4NC1C 1T2QH 2UYLA 3FPYA 3ZE0B 4NQEA 1KCBA 1IBZA 4UQBA 4WI0B 4HWEH 2Y6TE 5L6YL 2AMUA 5IBLC 1YHPA 3THMH 5JXAL 4E9QA 1L7IL 5F9OH 2DM4A 3T2QA 3CZKA 2BY0A 4GAGL 5CF3A 1NJ9B 5GZND 3KPLA 3QRGH 3FT2A 4PVBA 4KQ3L 3BPNB 2QADB 5L6YH 4N4YB 4MJID 4XVTL 5DMGD 3QARA 3TS8A 2AERT 1HC1A 2ZNXA 3E8VA 5FM5M 3QYMA 1C5CH 1KN4H 2CBTA 2MPAH 3PIQA 4X7EC 4MMZA 3U30C 1H3WM 3CZSA 3BFQG 2Y07L 5IR1B 2OMYB 4LU5H 4EOWH 1MCDA 3I6KB 2FE0A 2XACC 3ESUF 3QVAA 4QYOB 1KENH 4K94C 3A6OA 1FNFA 4AW4A 3SBRA 1FCCA 2JIXB 4EI5D 1RLBA 3CDZA 3HW7A 1NAML 2BOCA 3PDGA 1J8SA 1XMWA 2IPKA 4TULL 3WNJA 4ZX3A 1A7PH 4OFDA 3QHZH 5CU5A 1UD6A 4GQZA 3SY6A 1HU8A 3FN3A 3QG7H 3MHZA 2BNUB 4XVUC 4G3YH 4YAQA 1CE1L 1H5BC 1MHEA 4X9BA 3V0EA 4UCFA 1J1PH 2RH0A 3HS0A 4FNSA 3U1SL 3V0VA 1DJYA 3BP5B 2X2UA 3QWOB 2JJSA 2BERA 2XQBH 4KNUA 3TFBA 3RX7A 1BLNA 4OCYH 5A43C 3SY0A 3VFPA 3BEWA 4HOZA 1NGPL 4J39A 3H9SE 5J9PA 1MCOL 3P73B 2IV8A 4QHUB 4JCWA 2EECA 4FQCH 2PYEB 4OGAC 1J1OL 3VE0A 2CPUA 3GT6A 5IBLD 3DJSA 4FI7A 1XT5A 5EUKB 1Z66A 4OVVA 4G8GB 2XPGB 5GZNC 3QQDB 3K8KA 4PJEA 4FQIH 2NT0A 1J0IA 2Q7AA 4ADJA 3PL6D 5JW4Q 2VITB 2I07B 1IFHH 4P2YA 1AMXA 5AVXB 5FYJE 1M7UA 3MU3A 4HWNA 5D7SL 1IBYA 5DK0B 3L3DA 3ARYA 3FAWA 3HMWH 1KJVB 3E2HC 2Q10A 1IKNA 1Q72H 5EZOL 4XN2A 1WHOA 2P46B 4XOAA 2WK2A 5C9JA 5D96B 3GKWH 2C1PA 2F5BH 3Q3GA 2FIRT 2FQFA 2O61A 4Z3EA 4XNMA 4OH2A 4UM8A 3WI9A 3HPLB 2H6PA 3LEXB 4M7LL 4TNVF 5DHEA 5F1OB 1WZMA 3MTXA 3H6AA 1A2YA 4LRIC 2HA1A 5IB5A 1XF2B 5BQ7A 3KXFD 4YIQA 1ZJAA 5IBTL 4LEOB 1YEEL 2B4CH 4KFMA 3ZMRA 1RI8A 5I9QB 1JYXA 3AQYA 4PVMA 5JQHC 4QKTA 1Q9LB 2TRYA 3ULUD 1MI5A 2B1HH 5I1IH 1X5LA 4F9PC 3LMJH 1UEYA 1ZT4A 4WAFA 3KD4A 8FABA 1KJ2H 5CWSA 4ZAKC 4QLWA 4FHJA 4N9OB 2CO7A 4AEHL 4CAGA 4UNVA 4PS3A 4KKLD 1UWYA 5DQDL 1L6PA 4PJDF 4IS6B 4PJ7B 5DJ2A 1KBPA 3WLWC 4U2YA 3RE0A 4ZFFA 4B9PA 3U6XA 3L7EA 2CUMA 3SCMC 3NP3A 1GMEA 1AVAA 4YAQB 1LO3H 1XF4B 1Z5HA 1R24A 4Z7WE 5D7JC 1A4KB 2DQIH 2XN9A 3AW5A 4Y1TA 5I8KL 5SWSA 3WFDL 3K3QA 4Y5VC 4BFGA 3TJEL 5KJRL 5KVGH 3T5WA 3OXSB 4U1NB 3NJVA 5EO9A 3CZLA 3RWGA 1BAFL 1CDGA 1R3HA 2NXZD 3U82B 2AC0A 3I9GH 3QCUL 1IMHC 3RAJL 1D6EA 3KWUA 3RIAK 3OPZL 2IQAB 1IIKA 3A6BH 1UFGA 3DPDA 2F7OA 4FOMA 4I1PA 1NINA 2HJFB 1C12B 2X10A 2DV6A 3W5MA 4ZZKA 1TLKA 2WD0A 2WQAA 1B2YA 2CMRL 4GEIA 2R0KL 1V05A 2VRKA 3ARGA 3HRZA 4IKLA 4QNPE 4QXGH 3FW6A 4ZMTA 3BH8B 3DETD 4I0PA 1BGXH 2WBJC 4BFEA 4GI8A 2EZ0C 1VENA 4P23A 1NAMA 2BRRH 4OZHB 5KVFE 5KN5A 4G42A 5E1AB 1EEZA 3O6FA 5I0WA 3ZYZA 4IRZL 5DRWB 3DHPA 1X3DA 2DQFB 5ESVB 1YMMB 1JNHA 4XRCB 3C6SB 4EKJA 4N6RB 3DTXB 3WIHA 3H9SA 4NP4L 2FGWH 5K9QI 4MDRA 5DZVA 3HA0A 3QT2A 3N3EA 5F1KC 1DZ0A 3TO4B 3L4WA 4S1DC 4ODTL 4JB9L 5IW3A 4PGCB 1U8NA 4X5LA 1XSKA 4GAJH 4WF7A 1XH3A 5D4JA 4W4OA 1PZAA 2ITCA 3RVWC 4X83A 4L8CB 3ZKXB 4JLRB 3T3ME 4AE0A 5I8CA 4JFEE 1UA7A 3IFNL 3PWUB 5DC4B 1G6RL 1P5UA 1JJUA 1KJ2A 4QI3A 4XNUL 3OKDB 5D7IF 5IGXH 2CK0L 4BV1A 1FHNA 5DO2D 2FNWA 1QBLH 3WE6A 5I76B 4OF3A 4MNHB 3D33A 3MYJB 3LOWA 4KROC 5AW7B 4A7SA 1AKJD 3BPOB 3COOA 1MUJB 3ILPA 2DKSA 4F3FA 4GBXA 4JFFE 1B0WA 2YAMA 1QYGL 4HKJB 4Z0XA 4RRPG 3PABA 1P4LB 5LGKA 5ISZB 2A6JA 5IVZA 3QPXL 4H8WL 1KTCA 1QR4A 2GY5A 2WQ8A 4AV5A 3SKMB 4BA0A 3QJHA 4ZUSA 4JG0H 1TNNA 4I1NB 5I16B 5D8JH 4AT6A 1SXBA 2VAAA 3CV5A 4XOBA 4NQVA 2GB2A 4FTVA 3T1FA 4L0YA 2RAMA 1F56A 1MFDL 4DCQB 4N2HA 2XQYA 4QR7A 2APWA 1CF1A 5DF0A 3VQLA 1RCYA 1RZ8B 4B0MM 3CFIC 4DVBA 3HFMH 3VQ1C 3RWIA 1OK8A 3C5ZD 4E68A 4XP9L 1ZIAA 2E7CA 3TYGH 1F4AA 3O6KH 4JDVA 4MJ6B 4Y4FC 3TASA 3T1FB 4HAGA 4K5MA 1PDKB 4JFDE 4HJEA 1DQQA 1I85C 1OT4A 1VGEL 4HJIA 1JFQL 4GRLC 1BZDA 3MJGX 3V4UL 2YARA 1IJ9A 4PWHA 1FNLA 4GOSA 3S37L 2BRRL 3FT3A 1M9SA 3B37A 4RFEB 2BS9A 4JVPA 4Y2LA 4WW2F 1ACZA 4MMXB 1OSEA 5F71A 1WA1X 1YAZA 1KFAH 5DEGB 4NQED 5HYQA 2QJDA 3EUUA 4X8JA 3ZLQC 1IQWH 1UADC 2QGCA 4FMFA 3MN8A 1DANT 4W4NA 3FU3A 4XI5D 3P11H 3CSBA 4WTZG 1WEJL 8PAZA 5ISZD 2DYRB 2DEXX 1YQVL 4FQXD 2VDKL 1WJ3A 2NZ9C 4YDIH 4HF5H 1U8PB 3F7RA 5IKCB 3O2DH 5ADPH 1NGPH 2RALA 2DL2A 4R0LB 1ZLUK 1U3HC 1WSST 5D2NA 4RIRB 3X3FL 3PGFL 4G6FB 4PTTA 1F41A 3U4BH 4HG4J 1TG8A 4GRWH 1CE1H 4NNXB 3BT0A 5BRQA 4PYHA 2CO4A 3G5YA 1ZTXL 2CIIA 1LK3H 1QP1A 1EXUB 3OBAA 1U33A 4GQ9L 1NEZA 1P6FA 3QQ4A 5F7UA 3SKOA 2AQRA 2R4RH 2VDNL 4DEUA 3WL9A 5AD0B 1UCBL 2DWEB 3F3HA 4U6YA 5D2LA 2ZD0A 3MXWL 2H3KA 1IAMA 1F5WA 2ESVA 2KPWA 1WBZB 1MJ8H 3NESA 2OMTB 1ID2A 3EAKA 1UH2A 1YNTA 4HIIA 1JGUL 4P0DA 1A0QL 4PJBF 4DKAA 3VMNA 1KWGA 2W07B 3ZR6A 3GHBL 1ACYL 3W57A 4JO1H 4QRRD 1XTLA 3TZVB 3RPKA 4P23B 2FCBA 1SZNA 3ES6B 3WSQH 3OZ9L 1CYGA 4K07A 2PWEA 1E8YA 4MJJA 3VMOA 2XXCB 2NZ9D 2IH1A 3MJ8B 3MBWA 1JHKH 3VX1A 3NJJA 4A04A 3IWVA 3B5TA 3C9NB 2ZP9A 3VXSA 4BFNA 2PR4H 2AJ3A 5GS1A 4ODWB 4YHOL 3GHPA 1TTUA 4BWUA 3IJYA 2PR4L 3ZDZB 4W6YB 4H20H 5I6OA 1ZHNB 4M9PA 4LVEA 2NRDA 2CHXA 1E5ZA 5E4OA 5DD3L 2BDNH 2W9EH 4LXFA 1BIIA 4G6AC 4PBDA 4KMLB 4CC1A 1RQ5A 4Y4HA 1F90H 2AP2A 2EXWD 4YHPB 1ICTA 1MAMH 2MIZA 3LCYA 5C0EA 2ARJQ 1FDLH 1WAAF 1RUMH 5CWSB 1A4KA 4L0PB 1C5DA 5DJCB 5D5MA 1CXLA 3MRIA 2CKBL 2VXUH 3NZ8A 3TBTA 1P1VA 5CJBA 3I3BA 3V0JA 4BWWA 1IEBB 2EEDA 3IMVA 3OPUA 3WXWL 2IAMC 2PYED 1B3JA 2FX7L 4IRSA 3GC3A 1E0OB 4PJ9D 4PBWD 3B4NA 3CG8A 5AVUB 2YRZA 2R2BB 4JQIL 1FV1B 3P4LA 1OT1A 2D7NA 3VFSB 5HHXH 3C09C 2A74C 2GG1A 5IB5B 1HVXA 4M8RA 2WZ0A 3ESMA 3AWGA 3TXAA 3CE1A 4OF7A 4I0PD 4KHTH 1C5BH 4M43H 4LAQH 2B5IB 3KPRB 4F2EA 1WZ1L 2DQGH 3FO1B 2OMXA 5I8OH 1SQ2N 4GP5B 1OK0A 2AFNA 3NGBC 4P06A 5DRZB 3FB5A 3U2IA 5JORA 1HHIA 4FCAA 1AE6H 4XPHH 4Q74A 3NIFF 1EV2E 3L3HB 4ZSOB 3L3DB 1QSEE 1FO0B 5HDOA 4TRPH 2WW8A 2Z93B 3KWWA 3ZTEA 1AQDA 4JO4H 4ZODA 2P24A 5LDSA 3BDYL 4FFZL 4KVCL 3QUYD 2F1EA 2ENPA 3VRIB 1X7QA 2P5WB 5K39B 2WTOA 3JWNH 4Z3HA 4P9HC 2MKWA 4Y88A 4Z3IA 4JO1L 2IALA 2ITDB 5LGHH 3ZE1B 5J13C 4MS8D 5E8PB 5E94A 3TJHC 5JDJA 1L6ZA 4JDZA 4W9DC 3FB7A 4PUBL 4RMRA 3NSJA 1KENL 1NCNA 3EZ8A 1B4TA 3NIFB 4PG2C 5E6RB 1TEYA 1TEGA 5TE6L 4DZ8A 4MJHA 1EZSA 4PJ9B 3S5LB 1J5OH 4P5MB 1WICA 2AXFA 5GRWA 5C0DA 5JW4N 3DNKA 5DSCA 3P73A 5J3HD 2XZQL 2XFXB 5DJDA 1V7ML 1WCQA 1GGIL 4KO6A 3PGCB 2QVIA 1NLBL 3VFVB 5ABDE 5F8RC 4Q6YA 4FQLH 5HYSB 5IROA 3MX0A 5DJXB 5T1KB 2ALAA 1HK6A 1S6NA 3S2AA 3RTQB 1UD5A 2VIRA 5FKAB 1C7SA 3F7LA 3BUIA 5F0JB 4JM2D 2VLKA 1AQKH 4LLAA 4BINA 4M1CD 4XN4A 5CCKL 2V2XB 2C1PB 1C16A 5B38A 3GMPA 5DK2B 3OMNB 2OTUA 2O6FA 4HMCA 2MNWA 4BM7A 2ZUUA 2IIJA 4CMHC 2NOYA 1ZVYA 3GRWH 4G1EB 2I9TA 4XN7A 3GLDA 3OR7B 3U1QA 3WFBH 3R4DA 3WO4C 4CU6A 1AFVH 3O2DA 3CFUA 4TTGA 3DPBB 4ZPTB 3LN4A 4TNEA 3QUML 4JREB 2R23B 1JI1A 4P5KA 3IBOA 3UO1H 4XAKD 1S78D 1QTYT 3TJHD 2PPAA 4XB8A 5GSVB 1DL7H 4FJYA 4AC2A 2C9RA 3II2A 4PN6A 4XPTH 3QQXA 4YSUA 1GGUA 5ITFB 1YNTB 3LKRA 1NFIB 1CCZA 1AO7D 1A14H 5E1HB 2D03H 2E8YA 1W0WA 4OLXL 4ODBD 3K2UL 1OQXA 5E03A 2ZJSL 3MRQA 3QW9A 3WMQA 5T1DL 1QEWA 4E5XA 5FKPA 5D1QA 3UAJD 2C1OB 2X12A 3V0AC 1CS6A 1WBYA 3UYPB 3GJEB 1NUNB 5D5ME 5J4MA 4L3CB 5A2BA 3SDAB 3IFNH 3K81A 3KYAA 1NZRA 1X7SA 1KLUB 1XFPA 3ECQA 5L0QC 2VW6A 2PXYC 2YUVA 1J05B 3BE1H 1K4DA 2VQTA 1OARL 3V55A 1OKEA 5EZIH 3H53A 3QIBC 3QJSB 3MRCB 2VDKB 4ORGB 4YMPA 1JHLH 4MXQD 4NHCL 3EO0A 3MJ8A 4Y89A 4HBCL 2UY6A 3KH4A 3HNVH 4JJHA 4OI9A 2VMCA 2E86A 4C4KO 1KB3A 4UBDD 4OV5B 4PG9A 1HH6B 5MEOB 3G5VB 1PLBA 3GSNL 2LLNA 4D7BA 1I7TB 3B9EA 3EXJA 2HKHL 2VR8A 2Z3FA 3CX2A 4HIIB 1DSFL 5F0MB 2GITB 3IJHA 4QJ5B 1QPXA 4NRYB 4S1SH 1IILE 4ZTOH 5KVGL 4MJIA 3ARBA 3NJIA 3ES6A 2QT6A 2DLHA 1VSCA 1GZHA 2EYRA 2V33A 4ES9A 4N5EC 2H0JA 1VFBB 3RIAF 3HMWL 1L9MA 4S1QL 1KTDB 1MCWW 4IBQA 2DWSA 3MLVH 4UAOC 4JQXC 4YXKH 3QZWB 3VI3E 4AV4A 4YSEA 2H2PD 3P4OB 4Z95L 1KCRH 2WLKA 4RETB 3PYCA 5DYFA 2DWEA 4U6YB 5DLML 3RVVC 1F6FB 3ARFC 3DGCR 3GMNB 4ONFH 3WFBL 1FFNB 1U92A 1EJOH 1FFQA 2XKUA 2K1MA 2R9HC 1U42A 2XBTA 2AGJL 3F84A 2N7AA 1Q9OB 4PWIA 4NQCB 3KJ6H 5AAPA 1L9TA 5IEKB 1AZBA 3EBGA 2JQAA 4KTDL 3L1GA 1QLRA 4RFOL 4ZX4A 4ZQKA 1T0MA 2FX9H 4R0LA 1ZRUA 5T1LA 3WO3B 4AG4L 4PQXA 3VFTA 3L48A 3BQUB 4NO2B 2UVFA 4PRHE 1TZAA 3KYMB 4XO5A 1AQHA 2PWHA 1KCUL 4K2UH 2WQVA 5I1DB 4QRFA 2WCGA 1R3LA 3C60B 4TKWA 2YSSA 2YZ8A 4IJTA 3L4CA 4F37K 1NCWL 4EN3B 3PY9A 4K94H 3MUZ1 2H6UA 3ZIMA 2QGEA 3S4SG 1EO8L 3CHPA 3QJRB 1YYCA 5HGAA 4FRWA 2KYIA 3HHSB 4KHXH 3RUGE 5I6XC 3IU4L 3D3VD 1EZLA 1EX0A 1KYUA 2QLYA 1J0YA 2M8XA 2PTTA 2RHEA 2N1TE 2D7OA 3QDGD 5JLZA 2W95A 1U8CA 2FATH 3RVVD 4OT1H 4EJ1C 5JIPA 2C9XA 4JZJA 2EIEA 1RIHH 5FECB 3IMBA 3MCKA 3CPLA 4XCFH 4PJHB 3SZ6A 1N9PA 4YDJA 2YEZB 1S7WB 1W0VA 3IMWA 4TLUA 1NBYA 4XVTH 3K4DA 2J88L 3OR6A 1ZTXE 3IVKA 1IGYB 3FUFA 3S3PA 2O93L 3PGCA 1HS6A 4J3OG 4DQAA 4B96A 4XP6L 1R17A 1H3VA 1LVEA 2R29A 1V3JA 1PJWA 3VD7A 5KYXB 4PJ5E 3G5XA 3MBXH 4N87A 1G9MH 1CLVA 4LPUA 4NS0A 3V4PA 3FTGA 4HCFA 4NJAH 2J12B 4U3HA 3PWPA 2O6PA 3SGJC 5JZ7D 1EIBA 5CN2A 2BHFA 3JVGC 2WPGA 2BINA 3LS5L 5IJVA 3M86A 3B2UD 5A6IA 4TNVK 2IBBA 2ARJA 3DGDA 4TVPD 3E0GA 3D25A 2ZCKL 4X7TB 4Y1AB 4FNLL 4W6XB 2WAQA 1PAZA 2Z1KA 4Z5RB 5HYJD 2VLJE 1UZ6F 1FLRL 4BKTC 1I1AC 4QGTA 1ZPLA 5DUJA 1MRDL 2ZX5A 3A21A 1EHAA 4RGOH 3CDGA 3HNSH 1A9EA 5FA3B 4KTEH 3O3EB 4NOFA 2OZ4H 2B3IA 4MSWB 3KLAA 3VG0H 4FG2A 4PJDB 5EZPA 4F58H 2MQ3A 3SJVB 3WNIA 1A7PL 4FLHA 1AGCB 3E6FA 3UYOD 1H6UA 3V4VH 1JVLA 3PV7A 4G8IA 3QPKA 1F3DJ 2J4WH 2GYSA 4M6ML 4PB9H 4P5TA 2J8UF 1QRKA 1ETZA 4UU9A 2B7DT 2GJ6B 2NY0B 4P9HH 1V5JA 1X5IA 1AR1D 3JQOB 1FFNA 4LARL 2PYFB 3DLQR 4S11A 4FFYL 4M93B 3HN8A 5TF0A 3WS6A 2HX9A 2JKJA 2W0LA 1Z3GH 3GHEL 2QDWA 1OSZA 4LCCA 5D2LE 3S88H 1RMFL 2XZCH 1BEYH 3KL5A 1A22B 1X6LA 2YMXH 5IW1B 5FYLE 2HFFA 2WVUA 3BISA 1NFIA 1KGCD 4OB5H 1DQDH 2I26N 2A9AA 4HK0B 4MWFA 3TBVB 2EACA 5FGRA 4WSKA 5DC2A 2X42A 4JFDD 5IG7B 4UQ2B 4HC1A 3U4EB 5CJQL 5GRJH 4PW4A 3OV6A 3DX8B 4TQ8A 5AB1A 2MSPA 3T4AA 5AZEH 3KPSE 4YBQC 3IDJB 2ZKMX 3K72A 3BQUD 4P9MH 3QUYA 4E36A 4WTXA 5JPNA 2A0LC 2F74A 2MNJB 4LOEA 3V4LA 5T3XD 4PJ8B 1GAFL 1UT2A 1JXDA 5GRJL 3C60D 5E4AA 3IPFA 1Z9OA 4AY0A 4UF7C 4W9HC 2EDEA 2FECL 2WUBL 1XMEB 1D7CA 1IGML 2YRLA 3X1BA 1U0QA 2VDOB 5MENA 1EUUA 3L1EA 1ZHNA 3P69A 4RAUA 5DUMH 1BVOA 4HCIA 5GGTL 1NMAH 3O45A 1FJ1A 3M8OL 3NA9H 2ZCZA 5D7EA 3VA2C 1J0JA 4IDJL 4J27A 5GS0C 5C08E 3QJVB 4E9WA 4CMMA 4NAJA 5KYWA 4X5WB 1CGYA 3FTXA 3PP3K 1E40A 4NB7A 3R8BB 1GGTA 3K71B 1CBVH 4WTZA 4OLUL 1JN6B 1E5UI 3QFDA 4GMSL 2FO4A 2Y06L 4PRPB 3BGMA 4YDIL 1AG0A 1RUPH 4N1HB 3UTTB 4FQXB 3CBKB 3HNSL 5HI4C 8FABB 1C7TA 2VISA 3C87A 2C7UA 4S0HA 2PR9A 4HEMA 2V4LA 5E2WL 5DZJA 5KW9L 1A6WL 3ARBC 2DQUH 1ADQA 5B8CC 1XCQB 4FP8L 3UTSD 5EC1A 1AXSA 3SDYH 4XNUH 1TT6A 1UM5H 4YDLB 3ZRFC 1T7ZA 2WTPA 1GW6A 2EIBA 4WUKL 4EEEA 3W11C 3IJ8A 3TBWB 4RMUA 1XF3A 4WFGE 2WLZA 3L08A 3HZVA 3WY2A 2R4SH 4DP2X 3T3MB 1OZTG 2CGRH 3AREC 4MBOA 2OMXB 3OTTA 3VXSD 4DESA 5T5FA 1TQCB 3I50H 5BOZG 1WIUA 2VDMH 3BAXA 4HFUL 4YHZH 5E2JA 3DBSA 2NY5H 3G9VA 1E42A 1AI1L 4BYHA 3L7FB 4KAQL 15C8H 5FUOL 2VRQA 2XWDA 3KPLB 3K74B 1NLDL 2DWDA 4OU3A 2FVNA 4POYA 1T21B 3VD0A 1TTCA 2WVVB 4PJGA 5ID0A 1FNEB 3WUWG 3W0WD 4WFFE 4R4FH 1HHJB 3H4FA 2VITA 2NW3A 5JNYB 3RFRA 1E8ZA 1PZDA 4WW2B 5C3LD 4DN3H 4WWKC 5ITBH 5G4MA 4V2CB 1NMCC 4ELMA 3JV0A 2QKIA 3OGCB 4R2GC 1U3HB 4QAMB 4ZW7A 1RP9A 4AVKA 1JZ8A 3FYIB 4TVPH 5IVXE 1V10A 3RVTD 5D6CB 1EHLH 4ZX6A 2IGFL 2LLLA 4W9EC 4HXBL 1XD1A 4HJGB 1FVEA 1BA9A 4OVUA 3GSNB 1NBYB 1NCAH 5J12C 4DUWA 1Q9KB 3EO1B 2DQHH 4UWQB 3MRLB 3HBQA 1FVDB 1RFDL 1QHQA 2OMYA 1YEEH 4U1LB 3HI1B 4AIXA 2UV3A 4CU8A 4PRNB 1Y0LA 5SWQA 3L3OB 3RWIB 3SBQA 5KW9H 4HIQA 4RFOH 4IGBB 1CBVL 1ZWIA 3MCLH 3F7VA 1VFBA 1D5IH 3FBQA 3WFCL 4QXUL 5CKAA 1LO3L 1SMDA 3QUXC 2RFXA 1T1XB 4JFWA 2ICEA 1EZUA 3MNWB 4PJIF 3SBPA 5DFVD 4BUGA 4BSVB 5EN2B 4PRHA 2X6VA 3NDZE 2VC2H 3LKQA 5KZCB 4MDJB 4YE0A 2YC1A 3ZHFA 2C3GA 3UG4A 4GUOA 5ID1B 5FYJL 2GK2A 5FYKL 4OZGF 2CDGB 2D7PA 1CZ8L 1C1EL 4N2GA 1MUJA 1IGJB 1SLUA 2P8MA 3S96B 4BK8A 3PWPD 1WC7A 2Y1ZA 3PFUA 4WWID 3JWDL 2AQNA 1DFBL 4K15A 4U6HB 1LO4L 4LSUL 3CHSA 4JFVA 2YD7A 1M3IA 2H3NA 4C54A 2HB0A 4XZUB 4OCSH 2XYCA 1IQDB 2UUDK 2ORBL 4FI6A 2IWGA 1EEUA 1H0DA 1A6UH 1UURA 3KLLA 1BAWA 2BY1A 4LSSL 3WNPA 2YWZA 2ZOOA 5HHPA 3PS6A 2LVEA 4N6RA 2XU9A 4XOCA 2AJYH 5C86A 3O3EA 4JL1A 1FAIL 4APQB 4EDWL 3PQYD 4WVRA 3MCG1 1A6TB 5ENWA 1EDYA 3D3VA 2Y1AA 5K93A 3KM1A 1I3RA 2PPEA 1ZLVH 4G42B 4JN1L 1A1MA 1NUDA 1Z3RA 4R84A 1G7LA 2VDQB 4KXDA 4U1GC 5HDWA 3KBFA 3LN4B 3ILQC 2WINA 5T5FL 1LK3L 3F5WB 5C0AA 1P7QA 2VJXA 1M2OA 5JOEA 2K4WA 3RWDB 2W07A 5CP7A 1YPZE 2PCXA 1OGAD 3MZGB 6CGTA 2OTUB 4HAFA 2X89A 1VZIA 1I3RB 1I1FA 4FXGB 1JTTA 1U8OB 5IB2A 5CINL 3FCGA 5SX4I 1MRFH 5T1LD 2CDEB 5F6IC 3QIWD 4HIEA 4O02L 2WXNA 3GRBA 4QHKI 3ULVF 4BFIA 2UUDH 5D7IE 1E9OB 4M7KL 2Y7QA 5GIRB 1LLAA 2HMID 4X6DB 1AGEB 1IAKB 4C47A 4ANXA 4JFHE 1GMIA 5I8OL 1EXUA 3QORD 2OSWA 1AZZC 2BSBA 3KYOB 4XXCA 4EE2A 4A38A 3D39A 4KVNH 1MQ8A 4MD5A 5IVXA 4L37B 1ZSDB 2VR3A 3GM8A 5ECJE 3KHOA 4ZFGH 2XA3A 2QR0B 2FL5B 3UYRL 2X4SA 3INOA 5GRVK 5CZVL 4LNRA 3V8OA 4FA8A 4D9RE 2QSCL 1FCGA 2ZWNA 3G6DL 4E0RB 5JW5B 4LPXA 4PLOB 2WUCL 1T0PB 1MCNA 5DHXB 5I1DA 5IB4B 1MCQA 4PTUA 3UTTD 2BDNL 2W9EL 1B9ZA 4QHLA 4XMLL 4ONGL 3FRUB 4F9LC 4OV6F 5HYJB 2MKLC 2AV7A 1XIWD 1SN2A 4L9DA 3NCJL 5F7AA 1FN4B 4XMLH 5KZCD 4ZS7H 3MQIA 5IQMA 2E47A 3NG5A 3QC5X 3QIBD 4EAEA 4JLRA 1AMYA 2VR4A 32C2B 4BHUA 3WTUA 1A66A 2BNQE 4NPYB 4OFKA 3BLBA 4MNGA 3D4GA 3IE4A 3BN9D 3MJWA 1KV7A 5GS1C 3IU4H 4GXVL 3LYRA 3HB3C 1EGJL 4G7QB 1T1YA 4AOFA 1K5NB 4U1LA 1J8HB 4OFIA 1AKPA 3WE1A 1UA3A 1GTNA 3OSKA 4GPVA 4U4IA 4Z77A 2XRAH 1THAA 3P3SA 3DOSA 1QPPA 1VDGA 1W0YT 2EO1A 2Z91B 4BQ9A 3BH4A 1MG2C 1Z9NA 4PD4K 1Q8MA 1FAKT 2MOGA 4JFQB 3QI9B 4MGXA 3VFNA 1MWAA 3KL0A 4F93B 1JIBA 1WFUA 1H3GA 4FGMA 4M56A 1MNUH 5DSCB 3UZVA 5FYLL 2BS71 3BAYA 4Q4IA 1U3HA 1UB5A 5HY9A 2VSKB 3QRBA 5F70A 3RY4A 3N1GC 4NO5B 1CICA 3RWJA 3QDMA 3RDTA 3GS4A 5IREA 4UIMA 4XODA 2H2PC 4PJXE 5CINH 3DYMA 1PZCA 2WLLA 2GJJA 1M9WA 1AD9B 4GS7C 3ZO0A 3TVMD 3BUTA 2FT6A 5DMYA 2ZYSA 1E28A 3SDAC 1R46A 4F8PA 4QXWA 4DT2A 4G1MA 4OZHF 3DK0A 1WRFA 2VZ1A 1G94A 2F8VA 1K3IA 1A7OH 1BFTA 5E9NA 1DQKA 4KX7A 1SY6A 4YK4C 2J25A 5HD8D 2DKMA 5I76A 3ZKND 3FO0H 5GGRY 3IJYB 3NJMA 2JIXA 3V4PL 2HRHA 3ARTA 3HB3D 5FOJA 1O9WA 5BUGA 5C0CD 5EBMB 3GUFA 3VXQB 4LESA 4ODSH 4G8FA 3SPVA 4W9JC 1IQWL 3O2VH 1ET8A 1D5MA 3M1BB 4P2RE 2NY6B 1XR8B 3HE6B 5INCA 1A8ZA 5EEUA 3D3VE 3ARRA 5CEYB 3HZMB 1E4WH 1EEQA 1RHHB 5EU6A 3MO1A 1JNJA 1I3VA 1E4JA 1SMAA 5D7IB 1IBHA 1OCOB 2AQ3A 5L88H 5SWZB 2HFFB 2QADC 2ADFH 2QQLL 3Q9QA 5T33H 4AQ1A 5MHSE 1BVZA 3CU1A 3LIZL 4LSVH 3SPIA 1CTOA 1G6RB 2FZ3B 2G2PA 5IF0B 1UZ6E 3FHAA 5IVNA 4JMNA 2UYLB 1F58L 4ZMLA 3KWXA 4HS3A 4HOMA 1X5GA 4OSUL 4TUKL 1KBGH 4R7NA 2X0UA 4YGVA 2WLIA 5KS9F 3AM8A 2V5SA 3PWJA 3L6FA 4OZHE 3W5NA 1CDYA 1EO7A 1PZUB 4NZTL 2NY5L 1VGKB 1PLGH 1YAIA 3FHEA 3MUHL 4OM0L 5DJ0B 3OB8A 4JMXA 4N2LA 5D2NB 5E70A 3JV5A 2X4PA 1GGBL 4YDVA 3E8UH 4MNQE 1P5UC 2UWEB 3LZNA 2E75C 1IM3A 2UZIH 2CBPA 4JY5H 1XIWA 3RIFF 1MNNA 2CNZA 2CO6B 4PSRA 1DVXA 3DKHA 3ZK0A 3BVDB 1EMTL 3JTSB 3F12A 3P9MA 5FM8A 3IJEA 5G2NA 3ME0A 5MI0B 4WO4D 2P5PA 3GZPA 5DD5L 2NZIA 3PWJB 2BZDA 3FRPG 3ASNB 1QI4A 5I71B 3U7AA 2GKIA 5HHQA 3KVDD 2BCMA 1QFOA 4QOKB 3RL2B 4V1DD 3JYCA 1NIAA 4HXBH 5IWLC 2G60H 1ZVNA 2IPUK 2XN0A 4PJXA 1IL1B 1NC2B 3CK0L 4E9LA 2Q2LA 4P2QA 4PJ6A 3APDA 1YJDH 3IGUA 1CLYL 4R7DA 1CICB 3RWJB 1JERA 3M8OH 1KGXA 5D96C 4JHAH 2RGSA 5FUCE 1OM9A 3ESPA 4MHHI 4IJ3B 5LAXB 3T8XA 4CGUB 1WA2X 4PJIA 4QRBA 3SD2A 5CEYA 1I8KB 1WWWX 5F7KC 1XX9C 4PJBE 1UUNA 1FIEA 1IAKA 5HJ3A 4MCZB 2J3SA 1UA6L 4QOKE 2HFGH 2DLTA 3B7YA 2DM7A 3ARWA 2NY1C 3FOMB 2ZUSA 1ZLEA 1UXWB 1SHXA 3S98A 1UM5L 1K5NA 4DFHA 1HWGB 3ARDB 5A2CA 4RIRA 1INDL 5HHOB 3TESA 4EI6B 4HWUA 1HXMA 3MACL 3M45A 5C9JB 1Z7JA 3TPUB 4NO3B 3PAVA 5KVGE 5KG9B 1A6WH 2WZ5A 2IOMA 4HQQL 2AK4A 4PIBA 1S7SA 3QDJE 3O6KL 4OUUA 4F7CB 4A1RA 2ZCLH 1BZ9A 3I50L 1MEXH 2PTUA 3TPKA 1X5ZA 1KNOA 4L4TD 5D2LF 3Q8EA 3SKJH 4XMKL 4AK1A 1LEIA 2FSEA 1QFPA 2FBOJ 5TD4A 3T6VA 4GG6F 1BAFH 5CZXC 1G7IA 4N2FA 1I8UA 3ZSTA 3MOBH 1BJ1J 1JPSL 3MLZH 4O2CB 2GT9B 2H6OA 4OLYH 1RIVH 4NQQA 3BD3A 3GBML 4OD2B 1AR2A 3BEVB 4FQ1L 4JDTH 2N0KA 5L2KD 1WVZA 1MFAL 15C8L 2DJSA 5FUOH 2OR7A 2RJMA 3NCYP 2AK4D 3NCCB 3IF1A 4GXUN 4JZOB 4Q6IB 1JPTH 3TNNA 3LX9A 3V6OE 2FLMA 3LS4L 4LVNB 1YZZA 5FAAA 2X3AA 3PAYA 2YXWA 3VJ6A 3ILDA 4X4YA 2FJHA 1YMMD 4NAMA 1GW0A 2PMZA 4M6OL 5MEQA 4X99B 2Q5BA 1BQUA 2BY2A 4GMSH 4L3EE 5CU9A 3GK8H 4Z6AT 4NPYA 3MODH 4YSRA 3O3DA 2WKGA 2MQCA 4Y16A 5I73C 5HI4D 1IKNC 4YR6A 1WFIA 2Y2TA 4EI5C 3BSZL 4JPQA 1IUZA 5ADOH 2K9FB 1HI6A 1MQKH 3EYSL 5CSZA 4UTBL 1IAOB 3UPCA 1DCEA 3Q7JA 3GJFH 1B0GB 1JXKA 4HGWB 3TP4A 5D5MF 4NP4H 2A6JB 2VQ1B 1HAWA 2PW1A 3LRHA 1RZFH 1QBBA 4JHAL 5CGYD 5IVZB 3L45A 3BAJA 4TV3A 2P5WE 3R0NA 2I5YH 5SX5K 5JXEA 2X6CA 4MDIA 2QQQA 3DHUA 3DMMB 3BXNB 4DP0X 5DMIH 1KPUA 4KRPC 4YE4H 3VA6A 3OKDA 1E3XA 2XV2A 3MBXL 2ENYA 3VI3B 5I1AA 1CFVL 1P69B 4Z9KB 3KDPB 1HN1A 4E9VA 4KUCF 5HDBF 2IFFH 3DROA 1DJHA 4NLHA 1CUOA 2ZWYA 4P3CH 4B3VA 5FDWA 5K9OB 3S88L 3UDWA 5T3XE 4XBPB 2HH0L 4JGMA 5ICXB 3GSVB 3Q8AA 5L7XH 2P47B 3H9SB 1OP4A 1R5VB 4M6NH 1OHZA 2HG5B 4G9FE 1VPOH 4M7ZB 1U8KA 3QWRD 2LGNA 3H9ZA 1QKZL 1SF5A 3BKML 3M6DA 4JRYA 4R8WL 5K9KB 4FTDA 3T6QC 2V9RA 3EJRA 2GTZB 1OVZA 2ZUQC 1NBZA 3UACA 5I1AB 2VM3A 2AJYL 4UT9L 2APTA 3D4CA 2ZG3A 3TNMA 5ID1A 4ZXBC 4JY6B 5I1GL 4YDKL 4R8WH 3N0PB 3VI3F 1I9IL 1ULVA 4L1SA 4P4KC 3TH4T 1LO5A 2V7NA 4K8RC 3BP6B 4TULH 5BS0B 4V33A 3L2LA 4KVCH 3HRPA 3LKRB 3MRMB 2WXGA 3HZKA 1L6XA 4IU3B 5H37A 3B5HA 2YA2A 4XVSL 2D9QB 3T4YA 4LU5L 4EOWL 4FCHA 4ODVH 1J88A 3MRBB 4PHZA 4OZIE 3EOTH 4LIQE 3QZPA 4DKEL 3L3GB 4Y4FB 5TPWL 1VADA 2ENJA 2UY6B 1ZKAA 2MRYA 5FKAA 5EU6D 1DQDL 1ECYA 3EGDA 5ESAB 2NDGA 1E5YA 2ICWB 2XG5B 1E4WL 4QCIA 5FB8B 4QD2E 1TJIH 3AAZB 3F6IA 1RZ8A 4P59L 4X7SL 2O5YL 3EH5B 4X8XA 5LDUA 3EF4A 5CLWA 1Z1WA 5INDA 4Y2OA 1CR9L 3VJ6B 1HCFX 2VDLH 2XPGA 2R1YB 3SO3B 3F7KA 1EBPA 3C5SA 1YDPB 3QNZB 3SE9L 1WBYB 3V5KB 5DJ6A 1OTTD 1HYRC 4JHUA 2HAZA 1YEJL 3VXSE 4ZOAA 1NMCB 2HTLC 3CTTA 1GZQB 1CD0A 4PCKA 5HDRA 4PHXA 7TAAA 5DUPH 4QT5A 1U2HA 4B5EA 1L0PA 4JHZA 2ZX7A 3GMLB 3ZDXB 2ZICA 3HKFA 4KMTL 3ZU8A 4FN0A 4CU7A 4KJYB 4F37F 4OJDH 3K71A 4X80H 1BHGA 3MLPA 5BZZA 3IJ7A 5J12B 3BFWA 2W38A 4O9HL 4OGAD 1OANA 4HCGA 1QVOB 4XP9H 1CDUA 2HH0H 3VD4A 3MV9E 2RD0A 3LN5A 2EZ0D 1XF2A 1PKQA 2ZX6A 1V7NL 1RUAH 1BQLH 4N2CA 4A2EA 1W8OA 3L7FA 4A6YH 1MIMH 4IGBC 3X1EA 1E27A 1RVFL 5FUZH 5BRPA 2WNXA 1O6SA 2D31B 5A2AA 1LEGA 4U6VH 5DHVA 3MUUA 3ARDA 5HHOA 2VDPB 5JHDE 4NQSB 1YY9D 1PG7W 4JDEB 4YN3A 4HOXA 5H4ZA 4M1GL 5F1NB 2OJEB 5G4OA 5DU7A 3ZDXF 1UWGH 1BFSA 1I9IH 3QUKA 3FFCA 5MEPB 5C6WH 3S36X 5EIIA 2YWYA 1E4XL 1RULH 3KM2A 3X3GL 3WAJA 2N7BA 3WHE0 1D5XB 3RB5A 3RX8A 3VD2A 2I07A 3P11L 3Q2CA 5AOKA 1U3YA 5BZWA 4FABH 2VXVL 4HWBH 3N85H 1UA6H 4IIQB 4CVZA 1UACL 1DEEA 5E08L 5EUKA 1RPKA 4AXWB 2R0WH 1XGTB 5DR5H 4BH7A 4Y5YA 1N18A 3ISYA 3MNVA 1HHJA 3K91A 4LCCB 4FFZA 2WIMA 3NN8A 2A38A 4G5ZH 3WHXA 5A7EA 4V1DE 4HLZG 4JHWL 3CCHB 1R4XA 1S46A 1E3FA 1U8HB 3V8CA 3BIKA 1L7IH 3PWLB 4DGVH 2F5AH 3HPJA 4ZAKD 3C6LA 4ZMNA 5E6IC 5F96L 1KEMH 1MELA 1YRKA 2G5BA 3L5XL 4JPIB 3ZYOA 3F6LA 1S3KL 2BW4A 1RP8A 5HPOA 4X6CB 1RH8A 1T2QL 2Z93A 1CXHA 1T20B 3TTYA 3I6SA 1FJ1B 4PBVC 4ODWA 4TVSa 5AENA 3S6CA 4PI0A 3QORA 2YA0A 2SODB 2Y6SD 1LGVA 4PWKA 4XN5A 5ECGA 3TBWA 1WTGT 4HHAA 4HUUB 1T4KB 3WFZA 2BVQA 5LQBH 2C9PA 3KPSB 4FFWD 3HC4L 1X7TA 1XGQB 5J56B 5MERA 4AZUA 2MHAB 1A3RL 5DJ2B 2YAEA 5TDOA 1JSYA 3D09A 2WWKO 4WHCA 3IMUA 3WD5H 1SEBB 4WJ5A 4MBRA 3HCVB 3FU7B 1IM9A 2FGWL 4Z7OF 4NN7C 4BZ2H 3FL7A 4NHCH 1KCLA 2YPLB 3OF6A 3UPRB 3MV11 5D72H 1I8IB 3HR5A 3IDJA 1KPRA 3FB6B 2Q2EB 3IT8D 3WS6C 3MROB 4A7QA 4EQ3A 3NPZB 4MMYB 3WO4B 1UB5B 1NCBH 2J5LC 4M5YH 3AY4A 1OQOA 3HC3H 4NQEB 5J6GA 3BE1L 5DDHB 3ARGC 1QA9B 2GTWB 5I1LB 2IWFA 3VRLE 1KGCE 1LQSR 2NX5B 3FFOA 3REWB 3EDJA 3CXDH 3OR6B 1ETZB 1S7QA 4PS4L 3FTVA 4UV4L 1AIZA 5KBDA 2NTFA 2IPUG 4OJEH 2Q86B 2DD8L 1CT8B 1SEBA 2FQGA 4M1GH 4Y4KD 3DX6B 3LMJL 4EXPX 4TUKH 4AJYV 3JTTB 1MCPH 3GSRB 3MLUH 4GI9A 1EWHA 3MXVH 4Z7OB 3I6LD 4XOEA 4OTXH 3WMSA 3QXAB 2HKHH 5I18H 4AI7A 4AVJA 1F3JA 3WKML 2NLJA 2WVTA 3HKZA 1VFMA 4LLDB 2GY7B 4IKIA 4XMKH 4FFWC 3VGEA 4ILDA 1TPXB 3DHJA 4IEFB 5A1AA 1T89A 4Z7OE 2Y7SA 1FGNL 1YEGH 3RP1A 4QJ3B 2HPOA 4X7TA 3A4AA 2VXQL 3GBNH 5E8NB 1OP9A 1Z32X 4L48A 1SN0A 3OLGA 1ETJA 4FHBD 3JVGA 1ZT7B 1Q9WB 3VXUA 3B83A 2CBMA 1Q4NX 4L1BA 1GAFH 4QRUB 2BHUA 2X4TB 4G8EB 2CXKA 2K45A 3WDHA 2YSSB 5L4MA 4Z7VA 2CJUL 2CRIA 3D18A 1A7BA 1MFEL 3OKMA 3ESOA 4IKJA 2MCG1 5I19H 4TNWK 1I8MB 2YD1A 4Y19E 3KYMA 1EK3A 2EDNA 4IOIB 4RSYA 1JDCA 3CH1B 1DVQA 4HJJL 2VDML 2HKAA 5CSZB 3ZKNC 4AL8C 5KOVC 2OX5B 1PF3A 4LHJB 5F89B 5A7BA 1H8LA 2JKLA 1GR7A 5EV7A 4RMWA 1YNKL 1QRND 4AXWA 4CRPA 5FGCB 3EJZD 5KSAA 4XBMA 2E9IA 5FA4A 2FWOA 1OAUL 4MD5B 1MHEB 4YFLF 2IH9A 2WAHA 3RGVB 1UM6H 4EBQH 3SPJA 4HJSA 5AEAA 1U3JA 1XGYL 5LQBL 3TT1L 1LDPH 1YYLL 4H88L 2WJ5A 2LABA 1A7NH 4QTIH 4QCIB 1JZIA 5AAWC 5JLZB 2HXAA 3FPXA 5BOPA 5LHDA 3LEVL 43CAB 2Y7QB 1VAHA 4IRZH 4EIGB 1NDMB 5E5MB 2A6KB 1I75A 4GXFA 2BNQD 3NOIA 4R26H 5DQ9B 3E3QC 5KSAB 4NQSA 4NT6A 1MLCB 3R18A 5KVFL 3CVDA 2ZSVA 3U36B 2IXQA 1NANI 3EOTL 2VJ8A 3FSWA 2ADGA 4DPRA 4ELMF 3FU0A 4FQQA 3BVNA 4EQ2A 1T0OA 2UX7A 2VKWA 5IB3B 4Q58C 3QQ3A 3K1KC 4YSCA 1RZKL 3NIGF 3RZCA 5E6IA 4GS7B 1IFRA 4FTVB 3S34H 1II4E 4JFDB 4K9EH 1H5BB 4X5PA 3ZGHA 1QVOA 1JMXA 5IM7B 3BPCB 4LDOB 1JPGA 2OV0A 3V0WH 1D6VL 2J7LA 5EBWB 1EGJH 3F64A 1T04A 4KJQD 3W0WE 4AEIH 1Z9SA 2A83B 1OAJA 4OLEA 5I1EL 2NLJB 3S2CA 2NXYC 1GZQA 2QPFA 1SN5A 4R3SB 2X9WA 3GMOA 5DFAA 2I25N 1XQ4A 3DRTB 3RUGF 1QNIA 5F9OL 5JIDA 3N40F 1T7YA 3GMNA 2OLDA 3G6DH 4KGJA 1KIQB 1NLDH 4KQ4H 2B59B 4XNBA 4U33A 5F1IB 3CFNA 2NTFB 4RGNE 5CEZE 4H7VA 1CYXA 1DJXA 3EH3B 3DROB 3FAXA 5D1QD 4ELME 3TO2B 2AHIA 5CJ8A 4G80A 1G7MA 2YBGA 1AACA 3SDDC 3FQ1A 5DYOB 1F6AB 2WQSA 3L9EA 3THML 1WITA 5LGYA 2ICWA 2QFPA 2XG5A 5JXAH 5CIPA 5B4MC 1BD2B 4NYLA 2V2TB 5C2BL 1UUSA 3II3A 1VADB 5KBPA 2ESVE 4QRPA 2KUTA 3VXME 3IRZA 5HGHA 2QVFB 4FG6C 1CICD 4ONFL 2MCPL 3F7YB 1AHWB 3NIDF 1HYSD 4JO3H 4TVUA 5SWZE 2BX5A 2VLRE 2XBDA 4IK6A 4K2UL 2VLJB 3BP6A 3C2AL 3A4FA 3L4TA 2R69A 4HMDA 3IJ9A 2NY1D 3LHAA 5EZLA 3V9FA 5FM5O 4AM0A 2ARWA 4PWFA 4QEGA 1TEFA 3BGAA 3STZA 2R0LH 3RNKB 1QBML 4X4YB 1D6VH 3GI8L 2KHAA 4J3XA 5C0CB 4DP7X 1MVUA 1J86A 3CFKA 2BSTB 5T1KA 4EZJA 3BI9X 4H26B 4G6MH 4N0YH 4N9GA 2TAAA 4ZBJA 2C26A 4PIRF 3KCPB 3V5DB 4XX1G 3SE4A 4YHYC 2QEJA 2R56L 4OD2A 3AROA 5CZXD 5KANG 3RI5F 4G6AD 1QUNB 3FSZA 3V52H 1MFUA 4AGNA 3FTWA 2X0VA 1UH4A 4K7FB 3R7QA 1MVYA 4LDLB 2NY0C 3C8HA 4M03A 2AZUA 4S1QH 1CICC 2ZONA 4GQ9H 5EN2A 2FQEA 4QKXB 3B43A 4F1ZA 3GTNA 2O72A 3DMMA 5D6DA 1XGZA 4JFDA 4KJPC 4YDKH 5C0RL 2A2QT 1F6LL 4Z0BH 4EIZC 4KI5D 5EC2A 2YO3A 4WJ5B 2CUIA 5C2BH 3L9RB 5IW6B 3O6LL 2WBJB 2XOTA 1XB6A 5EFIA 4JANA 1IKFL 1PAMA 4K8RH 3Q2NA 3BKMH 4O5LL 2JB6B 3QEHA 5BPPA 2PETA 5GQBA 3Q05A 4P46A 3BZEB 2FT8A 3MNWA 3UJTL 2ZUWA 1D6EB 3UIYA 2Z7UA 5HJGA 1A2YB 5JHLH 1C5CL 3WTTA 3LVTA 1XGUB 3GEWB 2EE2A 3PJNA 1SDDA 3GGWA 4HJGA 1ZWIB 3OGOE 5JHLA 4YXLL 4LGRB 4G6KH 4WCYH 2CR0A 2EVGA 5FFGA 2XWTA 3CAFA 1NOLA 5JOPD 3FUDA 4PG2A 1OAXH 1SVZA 2BOLA 5CGYC 4KK8C 3W38A 4PJ9A 1HSAA 2GIMA 5H2BB 4DKDC 1IEAB 1G4MA 4LOUD 3FH7A 4Z7UA 4TTDC 4JZOA 2R69H 1TFPA 3WNKA 5F89A 2R8SH 1MH5A 3IETB 3QQNA 5HYJE 1HQRB 1NCIA 1AD9A 3C2AH 4K3EH 5D70L 3VD3A 4AJVA 4BRJA 4E9SA 4G7SB 3ZO9A 4HIHB 2BP0B 1T21A 3PGFH 4PYGA 3QDMB 3RDTB 4WJKB 3ZDYF 1ZJBA 3GMMA 4QXTA 3FJTA 1MF2H 3ZDZF 4KKBC 2CSPA 5HHQB 4BH8A 4ATWA 1AP2A 1MCCA 2WY3B 4AMXA 1XR9B 3CFCL 4Y7OC 4LPCA 4S2SA 3SE6A 2P24B 4LLWB 4WDIB 4XN8A 4LEOA 1MAKA 4RX4D 4DKFH 1DEDA 1WV7T 1BV8A 1PNDA 1FZMA 3I9IA 3SE3A 2F58L 4ZMPA 4HQQH 4E9RA 4QHNB 4ANVA 1N4XH 1B88A 3D05A 3G04B 4RAUB 5J3HC 3HS9A 3QULB 4PWJA 4YVUA 1WS8A 3KR3H 3IMTA 2JXMA 3FOLA 5B8CB 1KXHA 5I15L 2ICWI 5L4IA 4BXSV 5L8LB 3CDZB 4IBUA 4NZUH 1NOFA 2DH2A 5TTRA 5CJXC 1WIOA 2DDQL 2BO0A 1TO4A 1OAUH 4M1CC 1MFEH 5I19L 3HC3L 3D08A 2DH3A 1TYJA 3GSXB 3I6LE 4LLUB 4HDIB 4KWUA 2J5WA 2EUWA 2R1XA 3EYQD 4RNRB 2R9HD 2KKQA 1FYTE 4WUUB 2YRPA 1BXUA 4HCRH 1Y7VA 3QQDA 3O0RH 7PCYA 3T0EA 4PLKD 2JKXA 1B6DA 2I7OA 4MB4A 3U6RA 4YSSA 1HL5A 4HKZB 2NR6A 5GZOD 2JJTC 5JW5A 1J11A 3KPOA 5D5MB 4P2QB 1U8JA 3O0RL 3QHTC 1U8KB 5EOCL 3VYPA 2FK9A 3RZCD 2V9UA 4NFDA 2G75A 1LD9B 5D7HA 3I3EA 5F7BA 5ETUB 4ZW5A 3M17A 1RZKH 2C3VA 1IC5L 4D8PA 4WWKB 4IOSA 4Z7WA 5DS8A 4XMPL 5DJZA 3KLDA 3VO0A 3KLHD 2Q8AL 1MF2L 4XPFH 2A4ZA 1UENA 3VXRE 4XPGL 1WT5A 5HVWA 1GHFL 5GGSB 3BPOC 3VUAA 4FNTA 4U4BA 3C2SA 2O5XH 4GY4A 5BRZA 3EFFB 1JXGA 5C0CE 4LK4A 3WFEH 1UVQA 2XIIA 1KDJA 2YQBA 5IQ9A 3UMNA 1BG9A 43C9B 3ZTNL 4HSAC 2B0SL 3ZDXE 2X4QA 2Z31B 3JTBA 1UZ8A 4XPAH 3OPZH 1X9RA 3RHWK 5GISL 3T0ED 4YHIB 2XG4A 3CWGA 5LGJA 4PLKC 2R29L 2NNAB 2QPSA 3A24A 4K23H 4RGNC 1NMAL 3MLVL 5DD6A 2YD2A 3U9WA 1A1MB 4L9LA 1BD2A 3ZE2F 3U4EA 4TUJB 4HETA 1YEDA 3MLSH 1YN7B 2EDMA 1FH5H 4X2UA 1TJHL 1JNNL 1EEYB 3H55A 2J73A 3HG5A 3QI9A 3BYYA 4ZD3H 4NI6A 3G5YB 1HWHB 4LFHG 2JB5H 4ALAH 5K9KA 1J5OL 1MWAH 4NYLB 3ZZLA 5C2UB 1N6QL 4G9DA 4QWWD 3DJZA 4XAKE 4HH9B 4P3DB 4J4PA 3MCKB 5IJDC 3SKOB 4KC3B 4D94A 1RPUA 1NUGA 5EIIG 3QEGL 1XH2A 4JW3A 3A23A 3CFKB 4Y9GA 5I1GH 1OAYH 2X9XA 4ZYKB 1JAEA 1I1AD 2QDVA 4GLRI 4PJ5B 5DMKA 4MFHA 5D9SA 3SQRA 4MMXC 3MUJA 1HNFA 4EKXA 3DVNB 3FN0L 5GHWL 1N0XL 3ARFD 4ONOA 1VCAA 4DN4H 4JPVH 4WI9A 4JKPL 4P5RA 3P02A 3W39A 4AT6B 3C08H 5LBSA 1WP6A 3CN0A 5CEXA 1O5PA 3S48A 4B7LA 1RY7B 3CVCA 1OWWA 4PS4H 3QJXA 1IE4A 4EN3A 1AXTL 2OJZH 2XBZA 4LSPL 3EHBD 2VZUA 4FFYH 1YMHB 1U8LA 1Y6MR 5FF6A 1EBAA 3D25B 1KIRB 2XPZA 3D4YA 3SE9H 4EMZA 4FLSA 2VXSL 3APMA 2Y69B 1E5AA 5CEXB 2G2RB 4O58H 3QZOA 3U7WL 2AS5M 2E8ZA 2LVCA 4NO5A 2D3LA 5BQDA 4QRPE 3JWOL 3SGEI 4ABUA 4W9GC 4NOBA 2KBGA 3CPLB 4P04A 2WN2A 3K6FA 4TQEH 1T66C 1H15A 3D30A 4JFFA 4QWWC 5EU4A 2G9HB 3VFOA 3JXAA 4TNWF 3M7FB 2I32A 3MRKB 4MAZA 4YBQD 3UAAA 3QUXB 3IVKB 2A74A 1IC7H 3K4ZA 1GY2A 4WFGD 4UQAA 3QO0B 2OS7A 2WM0A 4FQPA 5D4QA 2X0WA 2FWOB 2C9UA 4WI3A 4F8LA 2EKSB 1UXMA 5JXEC 3TT3L 3Q13A 4WU7A 5DHMC 3IF1B 3TNNB 3ZE1E 4APXA 2HRLA 2ZOLB 4CILA 2PLTA 1ZA6A 4ETQB 1IL1A 4KK9D 4NKQB 3RPBA 3WS3B 4FXKA 1P6AB 5C71A 1DUZA 1HHHB 5JHDD 3ARGD 2KLSA 3KGSA 4JO5A 3KW7A 4LSDA 3VMPA 4KO9A 2DQCL 4YHOH 2WINB 1AOZA 1L3WA 3K0YA 3ZBMA 1WZAA 2FDBP 1LO5B 2V7NB 3CSYA 1J5CA 1TCRB 1JF1B 1PJ9A 4E42B 3QZNA 2WVSA 2DQCH 2J21A 4ZMZA 2BVPA 1PEZA 2EIKB 5HHMB 1DE4A 4UQ3A 1UACH 1NFDE 4U1KA 3QJUB 5A3IC 1A5FH 1OB0A 4J5VA 4AM0Q 4GW5B 3B2MA 3ZE0F 1PZ3A 1XH3B 4FYQA 4KXCA 4WGVB 2AMGA 1KXQA 3FFCD 3B6SB 1ZT7A 5SWSD 2HJLB 1V8HA 4OKVB 2W65A 3CZEA 3GSVA 5HI5C 3DO4A 4MQSB 2CH8A 1E9PA 5E1GA 1QFWM 5CJQH 2VDNH 2VSDA 5J11C 3O6FC 4HIXL 3E38A 3T2LA 5KUKA 2YD4A 1LO4H 4IBZA 4U1GB 4KK9C 3QCVL 4OGZA 3OAUL 4RVBA 1X9LA 2HRPL 1KF9B 2HT4D 3G5WA 2PCFB 2C9QA 4N6QA 4OT1L 5GGUB 3ULVL 1CLZH 4N22A 1HL8A 2XDHA 4FI8A 4NXKA 5FA4B 1BF2A 5IMKB 1IT9H 3TBSB 5CBAB 1IC7L 2YFOA 4FFVD 4GSQA 1J5HA 2Q3AA 5GS2D 3WEOA 4DOHE 4Z7QE 2QZQA 2R0ZH 4JJ5B 1W6WA 2VLKE 3P2BA 3NRFA 1VPOL 4KY2A 3DSFL 3VG9C 1H6EA 3BMVA 3ZUNC 2WMPA 5K9QG 1PW3A 1YMHA 1LMKA 4RNRA 3EBAA 2Q7YA 5BZDB 2EEBA 1J7VR 2ZX8A 3OR7A 4HXAL 2BNRA 1N3NB 1WHPA 1CN4A 4NUGH 4AENB 4E41B 3TIDB 4HKBA 2R7EB 4G72B 1NCBL 4M5YL 5FCSH 1KULA 3TA3D 4UQ9A 1W8EA 1L0YA 2H7WA 5IV2B 1CD1A 1ZS2A 5T5FH 4WLCA 2W0PA 2LT9A 1OEZW 2OL3B 3L81A 4KTYA 4TVPL 2Z92A 3TO4D 4J8RA 3V4UH 3X1FA 1E6JL 3O6ML 3PWLA 2P45B 3V4VB 4X50A 4PB0L 1J0HA 1YSOA 2VDKH 3S35H 5ETUA 4TSAL 3VU1A 3GI9L 2Y4SA 3SJVE 2FLRT 1J9SA 3LQAH 4LBEA 4HMEA 4UMSA 2Z7YA 5EEXA 3MRFA 1MAJA 4OLZH 4AEFA 5ALBL 5JW4M 3L3JA 4OCNC 1Q0XH 1YY8A 3LTVA 2UZIL 4Y5VA 2ED6A 3QA3B 4FFVC 4EUPA 1HCYA 1DBAL 3NAAL 5K5YA 1YECH 2TSBA 2X4OA 4PJEF 3X14B 3IETA 3N42B 2BP8B 4GFTB 1BREA 2WLHA 1I8IA 3HR5B 3TH2T 4WI4A 1GY1A 4HWZA 1JK8A 3PL6B 4B41A 1B4JL 5FK9A 1MHCB 1NDGB 5L2KB 4JR9L 2Z91A 5ANMA 3BP5A 3QRLA 4HIPA 4TUUA 3SJVD 2JJTA 4OD1H 2YS4A 4KI5E 3HB3B 4LT7A 3VRIA 3TL5A 5F7HA 4NZUL 2O5ZL 1Q94A 4RMSA 1PNCA 4BD4A 1GTFA 1O6SB 2D31A 4FXKC 4JKKA 2CGRL 3P3RA 1S5HA 1R0AL 3GZQA 3QJFA 4DTGH 4R97C 1HDMA 1E6OH 2P80A 1FZMB 2V6HA 1BVNP 4X6CA 1OPGL 2EXWC 4AYGA 1N5YL 3FSVA 3VDBA 1FWXA 4F7MB 3VB8A 4GKZA 4OCWH 2GC4C 4NUPA 5JQ6L 3IDYB 3BKCL 1UQSB 4WK0B 1E4XI 4UV4H 1Q0YL 4D7PA 2DYPB 1F1GA 3O2VL 2H2SC 4ANKA 1UKSA 4LPYA 5D1ZC 5ICYB 4N90E 4UDTB 3FF8A 2J8HA 3AXLA 4B9CA 4FL4B 3P77B 3F6JA 3X17A 4Y5XB 1SFHA 1CFTB 4TXVB 4F57L 4FQXA 2XVGA 1KXVA 1JGIA 1EAJA 4IRSB 4MA7L 3SHSA 3HJ0A 4AQOA 4HCRA 2NXYB 4N20A 3ZKMC 4HGMA 1ASQA 2PWFA 5JO5B 1NKRA 4B95C 5B3JE 4IIQA 1OAZH 3T4AC 3CVHB 3HAEG 3TN0D 1HQRA 1FPTL 4PGBB 1DLHB 3ZL2A 2XZAL 3GLEA 2IPKB 3B8SA 1XGRA 4MD4A 1IGYA 4JB9H 4R4BA 1H9DA 3U0TA 3IJEB 3NSYA 1JGLH 3ZX1A 4ZMWA 3IGLA 4PJHA 3SDDB 5FO7A 4G6FD 4Y4KA 5DI8A 3OKOA 1RJLB 1EHKB 4XNQA 3JZ7A 2R0KH 4DW2H 5KVMC 4JJOA 4KUZH 1M7XA 1KCKA 2BNQB 3DURB 5EWIH 4X4ME 3QUYC 4ZMAT 1AQKL 3RPIA 1XSJA 3U7YL 3MYZA 4BUQA 3HHSA 4HT1L 3N91A 1X6NA 3WY1A 3STLB 5LXGL 2H2SD 3L4UA 1P4BL 4YHMH 4AMKH 5JHDB 1F97A 2P44B 3BRFA 3OM3B 3V79C 5EN3A 3SBWA 1A6ZA 2JB6A 3GB7A 1N6UA 4FTVD 3ZDZE 5TFSL 1QI5A 1NMBH 4OM0H 4NGHH 2ICEC 1OF2A 12E8H 2XY1A 4NHUA 4F7TA 2GTZA 1M7DB 4LAQL 5AZ2L 3BH9B 4YUEH 1ASPA 1FG2A 2VL5B 4GUPA 2IV9A 4IBLT 4IU2A 3QRFM 5AW9B 5DGRA 4UT6H 5HHMD 1S7UA 4N1CA 2X4OB 1ZLUH 5D2NC 1M42A 4GBXD 2EDQA 2JLLA 4H8VA 2AJSH 4JN2B 4UUJB 2ITEA