1K5WA

Three-dimensional structure of the synaptotagmin 1 c2b-domain: synaptotagmin 1 as a phospholipid binding machine
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
148
structure length
148
Chain Sequence
KLGDICFSLRYVPTAGKLTVVILEAKNLKKMDVGGLSDPYVKIHLMQNGKRLKKKKTTIKKNTLNPYYNESFSFEVPFEQIQKVQVVVTVLDYDKIGKNDAIGKVFVGYNSTGAELRHWSDMLANPRRPIAQWHTLQVEEEVDAMLAV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Synaptotagmin I
publication title Three-dimensional structure of the synaptotagmin 1 C2B-domain: synaptotagmin 1 as a phospholipid binding machine.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Endocytosis/exocytosis
total genus 27
structure length 148
sequence length 148
ec nomenclature
pdb deposition date 2001-10-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00168 C2 C2 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.150 Mainly Beta Sandwich Immunoglobulin-like C2 domain 1k5wA00
2WXKA 4L1BA 3PREA 3ZW3A 2WXPA 2N1TE 4GNKB 2WXIA 4PS3A 3QR0A 2CM5A 3RPBA 1DQVA 4QAMB 3SD5A 4HVBA 4BFRA 4F91B 4LDCA 1DJHA 5CCJA 2JQZA 3L9BA 3F04A 3F05A 5T8IA 4A55A 3S2AA 2KI6A 4WWOA 3R7RA 1E8ZA 1DSYA 4G11A 3IBEA 3B7YA 1QASA 3NZUA 3DPDA 4URKA 4MJJA 3L17A 4DK5A 4IHBA 1RLWA 2CJSA 4Y1SA 5CCHE 1TJXA 2D8KA 3QK0A 3APFA 4AOFA 3PFQA 1K5WA 4FHJA 2ENJA 1E7VA 3HHMA 3FBKA 1TJMA 4WWNA 4L2YA 4KZCA 2CHDA 4AJWA 5CCGE 3IM1A 3APDA 1YRKA 2DMGA 3ZIMA 4QJ4B 2WXMA 3JZYA 5G2NA 4FA6A 4JPSA 4V11A 2CJTA 2RD0A 4FADA 1A25A 5EDSA 3QR1A 2WXJA 3P2BA 2A5UA 2UZPA 1DJZA 2K4AA 4F93B 4XX5A 4NP9A 1UGKA 4QJ3B 2LHAA 1HE8A 1UOWA 4OVUA 1RH8A 4EZKA 1DJIA 3NSJA 2FJUB 3GPEA 3M7FB 4XZ4A 1W15A 1BYNA 2WXGA 4Y1TA 4ICXA 3L13A 4NPJA 2WXFA 1V27A 2WXHA 5JHBA 2CHXA 2WXOA 2NSQA 1CJYA 4KITB 4HLEA 2WXLA 4J6IA 2Q0ZX 3OAWA 3TL5A 4QJ5B 3L16A 3HIZA 3QARA 3KWTA 2CHWA 2Y3AA 4PS7A 1DJGA 2B3RA 3RDJA 3ZVVA 4ANUA 2K8MA 1QATA 2K45A 4OVVA 4IQHA 5JHAA 2V4LA 3QJZA 4PS8A 3W57A 3F01A 4LT7A 1UOVA 2ENPA 3OHMB 3TWYA 4XE0A 1DJYA 4GB9A 3HN8A 5G55A 3CSTA 4EZJA 2YOAA 1BDYA 2WXRA 4FJZA 4EZLA 1E8XA 4FLHA 2Q3XA 3ENEA 3ML9A 3PS6A 2Z0UA 2ZKMX 2R83A 3DBSA 3LJ3A 3PYCA 3F00A 2FK9A 2WXNA 3N5AA 5KJ7E 4ANVA 2ISDA 1E8YA 3FDWA 2K3HA 3CSFA 3L08A 1BCIA 4ICWA 3MJWA 4TS6A 4TV3A 3KWUA 1E8WA 3T8MA 1E7UA 4F1SA 4WAFA 3APCA 4NS0A 4KZ0A 2EP6A 3L54A 2X38A 2QZQA 4FULA 4L23A 2NQ3A 2NCEA 2CM6A 2ENQA 2CHZA 4BGDA 4TUUA 1E90A 1W16A 3QAQA 1RSYA 2WXQA 1DJWA 3TJPA 4L1LA 2BWQA 5H4ZA 3NZSA 3W56A 4FHKA 4WWPA 3R7QA 1WFJA 4DNLA 1DJXA 4LCVA 1WFMA 1GMIA 2YRBA 2QZ5A 3ML8A 4F92B 4NPKA 5H4YA 2A4ZA 3L4CA 4ANWA 4FJYA 3PRZA 4ANXA 4WEEA 2DMHA
chains in the Genus database with same CATH superfamily
1G9MC 2EDNA 4PS3A 3KPRA 2V2TB 3VYNA 5FDWA 3VU2A 2YA1A 1WWAX 3QIUD 3U1SH 4IRJB 4RWYH 1PVHA 1NDMA 5D7EA 3PL6C 5CLXA 1SXZA 4ENED 5I16B 3NPZB 2CDFB 3KLHD 1BQKA 1AZNA 4H0LC 1QBBA 1UT1A 2VITA 2VABB 4PV1C 1U8IA 1G5AA 1L9NA 2YAPA 4KK9D 3X1BA 5FYLE 4NXKA 1WUNT 5CR1A 1BQLH 1RU9L 3Q6FB 3QIBD 4U1SB 3FJTA 2O5XH 3SQOH 4QRRA 5GZOC 2J88L 2UWEA 5HHME 2AV7A 4IGBA 2WCSA 1J48A 4XP1L 3K4DA 4YO0A 1JD7A 5JHLH 3S2CA 2ID5A 4JDTH 2J6EL 1TT6A 2IALA 4PJHE 1OSEA 4ZOAA 3PL6D 2DWXA 3DARA 1WVZA 3QEUA 1E4XL 3FUFA 2HYMA 1JPSH 1G0YR 5AVQB 5AENA 3UAJC 1DQQB 3O6LH 4H0GA 3VRIB 1X3DA 2DQCL 1KACB 2F1AA 1U2YA 4ZAKA 3FTGA 2R29H 4U1HB 4I2XE 3TT3H 1BQ5A 2COQA 1PYWA 1PZ2A 2AK4B 2M8XA 4KRMB 3ULSB 5I19L 4CILA 3G5VA 5GZOD 3AM8A 5I76A 1X9LA 4W6WB 3TL5A 3F7LA 1HL8A 4NOBA 2QEJA 3FCSA 4IKNA 2W95A 2CHWA 2CMRL 3AU1A 5ESVA 1CB4A 1CD1B 4HMDA 4PJ7F 3MKGA 3HAEB 4XMLH 4XBEH 3UAJD 4K4KA 3AQDA 1XEDA 3SKMB 3VXPB 2UZYA 3F01A 1EX0A 3T4AA 4GBXC 1RUML 1HWGB 4I88A 4IBYA 3MACL 3I02A 2GSGA 3P4OB 4P23B 4DJMA 3I6LE 2XBZA 2ZKMX 3V9FA 4QRPB 3BPNC 4KI5D 1CICC 4TVSa 2WKOA 5C0AB 3NABL 1UM5H 3L08A 2VM9A 3MJWA 1ZS8A 2A7BA 4M6MH 1GZHA 2CJUH 4EEEA 3HHSA 1KBVA 1ODUA 4HFUH 4YBLC 1UA7A 5ENWB 5KS9B 2X09A 2A74B 5ISZD 4GBXD 2WUBH 4KK8C 2NOYA 4YEEA 1H19A 2HFEB 2AQSA 2W9LA 2JCCF 2OCJA 1UYWH 1XB3A 5FGBA 1CXLA 5D1QB 1RZIA 1CICD 1WZLA 1A4AA 3KJ4C 5KYWA 1X5HA 1GA2A 1PJWA 3MFFB 1RULH 5FGSA 1PSKH 5I23A 5E00A 4JG0L 2XQBL 1JNLL 4HZ1A 3V8CA 1GTNA 2WP3T 3A0OA 3AT9A 1JZ8A 1X6LA 4CSSA 4O58H 1DJHA 4KX7A 4NNXB 2ZAGA 3HW7A 2CCLA 1IBGL 1V10A 2PO6C 4KK8D 3RWHB 4IOIA 1ZE3C 3PDGA 5HYQB 1G6RA 3LIZL 3G6JE 5C09D 3ZUCA 4D3CL 3ULUC 1SXNA 1RZJC 1X7SA 1JHTB 3D3VA 3EAKA 4MNQA 4AE0A 2YXMA 2YN5A 2QQLL 4XXCA 4Z7NB 1EXUA 4JMNA 3OKOA 3S97C 4ODVL 5IQ9B 1KSRA 1MCCA 5A40E 1D5RA 4NB7A 1A4KB 1RVFL 1NCIA 2PO6D 3QG7L 4UAHA 1MIEL 5BV7L 3U0PA 3GPSA 1IQWH 4KZDH 3VXMA 1YY9C 1IX2A 3ULUD 1SGKA 5IM7B 1ET7A 1G9HA 3BAYA 1BZ7B 3QIUB 4NSKA 1BVKA 3D39E 1G43A 3HBGA 3U30B 1NCCL 3MJ8A 2WPGA 3V4VL 2V3EA 4HEPG 3OX8B 4B3VA 3RZCA 4N90E 1FH2A 3T8XB 2VAAA 2Y7LA 2GSIA 2QHRL 4Y9CA 2XPGB 3KEHA 4X4YB 1P4IH 3L5IA 3SO3C 3W2DH 3JWDH 4AG4L 3Q2WA 3WS6A 3BQUA 4DN3L 2AKRB 4Y7MA 3WFBL 5D9SB 3BPLB 4ANUA 5DUPH 4PG9A 1YY9D 3GS7A 3I6KA 3QIBB 3B1UA 4HBCH 2VKWA 2J5LB 4OVVA 1CD9B 3MLUH 1QEXA 1WT5C 4WW2F 2B39A 4OZHA 3SODB 2NRDA 4KPHL 2NLJA 4LSQL 1ZS2A 3IAGC 3PL6B 2ERJB 2DPKA 2X2HA 3IMUA 4JFEB 1YMHB 1MEXH 1IVLA 2YJQA 3ESMA 2XWTA 4OZFH 4LB8A 1BOYA 2W9DL 1AYRA 3LMJL 4GP8B 3W38A 3BZEA 4L1SA 2V33A 1SDAB 1UWFA 3DURB 4JGNA 5EORL 3QDGE 4N2OA 4W6XB 1YY8A 1ZA3A 4LEBA 1YPZE 3DUSB 4RQQA 4QRFA 5DZJA 4Z3HA 4K73A 5AW7B 3PGFL 3OGCA 3FQ4A 4FCHA 1TFHA 5J13B 4AVJA 4QHUA 1RP8A 1UQSA 5HDLA 3UCRA 3RY6A 1O6SB 5JPMA 2ZCLL 4PS4H 1I7UA 4P06A 5EU5A 4BKLA 1JXFA 5I17A 4XN8A 5JDSB 3HZKA 5KSUA 3JT0A 1U30A 4X4XB 2IANA 3QUKA 4ZFZB 2VDLH 3HB3D 3D4CA 3TVMC 1J1PL 1KFGA 4KRPC 1S3KH 4DPCX 3N50A 1KXVA 5I82A 5K9KA 1HL5A 4HJ0C 5IB1A 5C6TL 4HJJH 1QSZA 4L0YA 3ETSA 2CWRA 5T1DH 3P9WB 4P49A 3V5KB 5I1GL 1JUFA 2X89D 4JDEA 5L88H 1WS7A 2DLHA 5E24E 5ERWB 4Z7VB 2A77L 1EFQA 4WSJA 4PGJA 4BH7A 3GSWB 1GYUA 1NEUA 3NIDF 1HAUA 2DDQL 2EE6A 4CW1B 1K8IA 2J8UF 5ISZB 1FYTA 1DO5A 1XCWA 3WU1A 2ESVD 1MRCL 5DRZA 3V6OE 1JZ2A 1AI1H 3IEAA 5E1HB 4JY5H 2E27L 1IAKB 3TVMD 1K4CA 1YEDA 3WTSA 5DJ2A 2FQDA 3RNKB 4HJ0D 4WI9A 1AS7A 4PGZA 4M3KB 2RFXB 4WFFE 3UYRH 1S7XA 3OKMA 3MLVL 1S7VB 2VMFA 3ASWA 4HOXA 3QXWA 3EJZC 2KLSA 4M48L 1O9WA 5IQOA 4NHCH 2GTZA 4MD5A 3QDJD 1KN2L 5JA8B 1W0VB 4ZQKA 2VXQA 3GPEA 4N68A 1J9SA 5TF0A 3QFJA 1I8KA 1XAKA 3LPWA 4Y1TA 4W9EC 1M2VB 4U6VH 1A14L 1QBLH 1RZFL 5C09B 1UCTA 5HSFA 2DKMA 4NZRL 1SNRA 5I1JH 1WEJL 4JFDE 1U3HB 2PPEA 3TBYA 3ZE1F 4ZW7A 1FZMA 1JN6A 3KZ8A 1NICA 1A7OL 2HN7B 5F89A 3CSBA 4XN5A 2NNRA 2Y7NA 4EOWH 4R4BB 2EO7A 4F57L 1F90H 1LO3H 2WY3B 4OIIL 5T5FA 2ENPA 5ACMA 1P5VB 3HZYA 4YPGB 3PPSA 1BXUA 1JZ5A 1U8KB 4NDMB 3FRPB 4HCRH 1N19A 3FTXA 5FYJE 2AJXL 4JQIL 5GJTL 4GI9A 4MDJB 2GKIA 3K2UL 4ZXBB 3ZZLA 2DRUA 1G7HB 2BZCA 3ECWA 3BAXA 3IXAA 3T08A 4YHPA 1Z9LA 1ZEAH 1Q9KA 1N7MH 4MCZB 2DS4A 2W07B 1MAML 3QHFL 4EIZC 2XWXA 5TE4H 1JYVA 5J1SC 2BHZA 2X4OB 3CVDA 2BP0B 4XT1C 3C2AL 2WINA 4PLKC 1CDIA 1MUJB 2VE6B 4KHTH 4PR5B 1TTUA 1N4XL 2IXQB 1CZ8H 1G7LB 3H9SD 4GW4B 1P7HL 4MMYB 1YNTA 5HD8D 2V9RA 4K3HA 1Y0LA 3SDYH 5CHNB 4YC2C 2FWLB 1CDUA 5FOBA 4E9QA 4HUCA 3LXBA 4MWFA 3QWRD 4L1BA 4ES9A 4CN1A 1IKNC 3GIZH 5EO9B 3BGAA 3QW9A 1FFTB 2B5IB 2ZNXA 1LD9B 2J1KA 2DWTA 4NN5C 3F6LA 2HTKC 3PV7A 5EC2A 4N28A 2JJTA 2YMXH 3NCXA 3N85H 4IIZA 4N8VG 4OCYL 4XCEA 4EIBA 4NQSB 1D5XA 1AKPA 3H1ZA 2JIXD 3HI5L 3BP4A 3RGVA 4NZUH 4FFZL 4AOFA 5DJ8B 1B4LA 1TITA 4Y5XB 3B7SA 1MAJA 3MN8A 3NAAH 3ARRA 4AL8C 1MOEA 3TFKC 4BDVA 1ADQL 2W91A 3ZRFC 3WTXA 4MJ6B 3QDME 4K5MA 3HB3B 1CG9A 3Q2LA 4Z78A 2VR9A 1P1ZA 3QZPA 1FF5A 1KT2A 3RIAK 4ZO8A 2ED9A 2D7TL 1QOKA 1WAAE 2ZAIA 1MI5A 3A4EA 1TVDA 1XTLA 4LIQL 1BAFL 4LSVL 1MNNA 3BE1L 2E86A 5IMKB 2GJPA 4E9WA 1R4XA 4JFWA 3J2PA 4N1CA 4AC4A 5JXAL 3FKUS 1FCGA 5BVJB 4S0SD 4FZ8H 1UB5A 2A1WL 3TFKD 1OHQA 4KNSA 1A6ZB 2ESVB 4HXAL 3MODL 4MA3A 4XMKH 3ETBJ 1HL9A 3Q7JA 2EECA 5ESQB 2CUAA 2FX9H 5TDOA 3LOWA 5F7LB 3EJRA 3STLA 2AXFB 4A2HA 1ILSA 3RBGA 1AHMA 5T3ZD 2VN5A 3P0YL 4MNGB 1IZJA 2X4SB 1WTLA 4M62H 3H3BC 5H35B 2XPZA 4I1RA 3WUWG 1NCAH 2AXJA 4PRBB 3KGUA 1HKLH 1QSFD 2NY5L 3CV5A 4UIKH 3VXUA 3QDJB 4BFGA 1TQCB 1A3ZA 4V2BA 1UXWB 3HUJB 4J3OH 2ZKWA 3K7UA 4YFEA 2HLAB 4LCWE 2K3HA 4KJWD 4XCYB 1UWGH 4FQCL 3IJ9A 2E9WA 4BXSV 3NH7H 3MGTA 2AEQL 4XNXH 4QGYA 5IB2A 4Y88A 5AKTA 4ATTA 1IQDA 2E56A 3NACH 4B9FA 1SDDB 4K71B 5EO0B 5DUBB 5IGXL 3OKLB 5ICZA 1MCWW 1RERA 4HOMA 4IJ3B 4EUPG 4PY8J 2D03L 4M8UA 4NZJA 4P59H 5GS0H 4HKXA 3IMVA 3UDWC 5BRZB 5SWSE 4JKWA 3HPJB 2XTLA 4FHBD 3R1GL 1ZIAA 2VAJA 3O3BB 1TVHB 4AH2B 2OW7A 3RJDA 5KN5A 2HVJA 5EOQL 1H5BC 3O45A 6CGTA 2FB4H 3CC5B 3H85A 2QQQA 3V6FA 1HE7A 4ELDA 5CJOH 5SX4I 3ZL4L 5EULV 3MRRA 3IMTA 4AENA 4XTRC 3DIFB 4D9LH 3KLAA 1BVOA 3D85A 4R5TA 3LKRB 3REWB 1VCBC 1B3JA 3QXVA 4GT7A 2IFFL 4JDTL 2BNUB 3RYMA 5J8OA 5FM5O 4N87A 1FNEA 2MRYA 1JPSL 1QVOB 2B1AH 3H9SB 3QA3B 5H37A 1NH6A 5KJRL 4HLJA 4MSWB 3KR3H 1JTOA 3DHUA 3WFZA 4AV4A 1E4HA 4I3SL 2A9BA 5EBWA 2VDNH 1NUNB 4QR7A 2PYFB 3CVHB 4FE9A 1O0VA 3EH1A 4G42B 5F8QC 5C0NC 3Q5OA 4X4KA 4NP9A 1UGKA 3BESR 5GGTH 5TD4A 4JPWH 3EHBC 5IMLB 3EOAA 3ZDYE 2CBPA 2OR9L 3OR6A 1O7SA 3QXAA 5CUSL 3CCHA 3I3DA 3UG4A 2F53E 3PIQA 1ZT1A 3B2UC 4XBEL 2CG9X 2OMTA 5E8EA 2JIXB 5IJBC 2C34A 1NLDL 5KZCB 4NQED 3BVWA 1QUPA 1ASOA 1NWPA 4JG1H 4OUUB 1QUNA 5CINH 1ZLVK 1H8OA 4GI6A 2WGNB 5C0ND 3WEBA 5E1AB 5C9JB 1N6QH 3V10A 4KHXH 3MLYL 5AYQA 1Z9PA 1XBDA 2B1HH 3L3GA 5F7YC 4EIGB 4N2HA 2C9UA 5AOIA 1TU2B 4F8QA 3Q2CA 4W68A 2VH5H 3BUDA 3M8OL 3U83A 4AEEA 1SJHA 1XGTA 1AG0A 2CE6A 5DK0A 3TCTA 3Q8AA 4S1SL 1OCWH 5IHLB 2WWKO 3B2UD 2CJUL 4ORGB 2ZX9A 1SHWA 4F8OA 4H7VA 1AD9B 5ICYA 3PXLA 2I9LA 1MZYA 5C0EB 2WUBL 3LIUA 1BXXA 2MCPH 1QQDB 1RSFA 3K2IA 4FDWA 3KBFA 1XF2A 2A9DA 4KY2A 2BZDA 2OMWA 4WRLA 2ADGB 4ZMWA 1CFMA 4OQ1A 4FC3E 5DEJA 4MA8L 1JDDA 3WNPA 4HZAA 4JKMA 5DQ9B 1RULL 1PSKL 3AG1B 4GAAA 3A67L 2WLZA 4N0RA 1TTGA 1OB1A 1LP9E 1INEH 3BZ5A 1FORL 4R96B 5GJSH 4L0ZA 4WZ9A 2Q1EA 3G5XA 1QSFB 4JY6A 3D0VA 1FL3B 3D05A 4NI3A 1LILA 2G3MA 1L9QA 4GW1B 4R90H 4CN4A 3RB7A 5IEHB 3U79A 3RURA 1E4WL 1QFWM 3LKPB 1TZGH 4PJ9A 3FNKA 2B77A 5IMOB 1V3JA 5A7EA 1KPUA 5DK3A 1FNGB 3HVNA 1E5BA 2GK0B 1FL5B 2H4EA 3HKZA 2VLLB 3CIQA 1IQWL 2UUDH 3D50A 1EZVX 3FBKA 4XGZB 3BWSA 2YOCA 1JWUB 2IBZY 3IM1A 3H4HA 3CN3A 5E2UL 5E0FA 3SGEI 1F58L 1QFWI 3BRGC 4OFVA 3EBIA 3KD4A 4F20A 1KB5B 3FB6A 3VG0H 1I9JH 4BWUA 4RIRB 4DPRA 1VEMA 3AC0A 1OP5H 2H8PA 3CWGA 3JWOC 5JIQA 1RZPA 4ELKB 4ZUTB 5AOJA 3NSYA 2GABA 2NQCA 4PRIA 4DSYA 1OPGL 1N5AB 3OKNA 4S1RH 1DJSA 1AGFA 3L48A 3ZIYA 4HWBH 4RMRA 4YAQA 1PX8A 3WL9B 5I2IB 1NCDH 3C5SB 2D0GA 3MLUL 3MNZB 4QJ5B 1ET5A 3F7YB 4M9OA 5AEAA 1AH1A 2GT9A 3WAKA 2M1KA 4NZTH 3T0AA 3QNZA 1VPOH 1H5BB 3AMKA 3C2SA 3QUML 5JW4M 2XACC 4AWJC 2J21A 1VFAA 3X1FA 1QRNE 1JGLH 2WN3A 4QAWA 1QD0A 1SYVA 4LEXH 5AOLA 4OZGB 3PJSA 4TQIA 1MW0A 3GZOA 5D7KD 5ICXB 3KCWA 3V7AE 5CKAA 3IDIB 2LU7A 1A7BA 1ZLDA 2VYRE 1IBBA 4NQDD 2D7QA 2X7LB 2YPKA 4FI7A 4BQBA 1YZZA 2X4QB 4XWOC 4PS4L 4KBPA 1XCTB 5DT1L 2AK1H 4NQEB 5LGYA 2A0LC 2NQ3A 2VXUH 1AFVL 5C0BB 4KKAC 5B38G 1JZ7A 3KYOA 2AC0A 3BT2H 5F7NC 2VDLL 5CJBA 5K59E 4DP4X 5DMIH 3VSVA 2ITEA 2F1BA 2FDBP 2OR7A 2Y5QA 3GZPA 4LLUB 3RWEB 4JO1H 1L0QA 3QAZC 2AS5M 1TJGL 3QWNA 3G08B 4YBQC 3FQTA 1L0PA 4YK4C 2FGZA 5D7IF 1S5IL 5T1DL 4P9ML 5ITBH 3DVGB 5HDBF 2P49B 4A7GF 4G83A 3TYGH 2FATH 3RTQA 3TESA 1CQKA 1C7SA 1BJ1H 5ALCH 3VI4E 5HYFA 5L2JA 2N0KA 2NYYC 4G7YH 2A0LD 2Q7YA 3F64A 4KKAD 4NZ8A 3TEXA 3RUGA 4S0HA 3L3DB 4Y16A 1CC3A 1DUZA 1AYOA 1X7QB 1NBYA 4HIXH 4LPUA 4W9FC 5GGRA 3UTOA 4ZMQA 2W38A 1YNLH 1GOHA 4Z0XB 4NC1C 2MPAH 4XVTH 3K72A 4YBQD 3SJVA 2JF1A 3SGJC 1QPXA 3UYRL 5JPNC 3Q01A 5ETUA 2WBJA 2CJ3A 3QEHB 1K5WA 2NY2C 2QSTA 4NHCL 1KN4H 1HNYA 2CIKA 1U8QB 3QUZC 4JDZB 5CEZE 5KYNA 2NYYD 4YJZL 2Y36H 2JCWA 4NEHB 2EYTA 3KYNA 3FFCA 2EE3A 4MDRA 4Y9FA 2OQJA 5BW7C 2TRYA 2QMKA 3MRLA 5FHAL 1J87A 5I5MA 3WCYA 1OLZA 3PNRB 1MCRA 3WLBB 3OXSB 2Q2EB 3SDCC 2IWFA 5J6GA 1WF5A 2NY2D 2IV8A 3N42B 1XF5A 4JZJC 5I9QC 1OY3B 2KYIA 3MRQA 4DUXA 3LQMA 4U7KA 4AQ1A 5E5MA 2I27N 3WBDA 2H5UA 1HEHC 3PNWA 3QUZD 1U21A 1F90L 1LO3L 2XN0A 3H7BA 3DTXA 1SEBB 4PVMA 4CNIB 5F9OH 4NUQA 2AJZA 4DERA 1UXSB 2KBGA 5DGRA 3PAVA 1UJ3A 4XMWA 3JBG7 3BFOA 4LDOB 3CLFL 4P5TA 1NEZB 3D4ZA 3SDCD 2MOQA 3AXHA 4RRPA 2XICA 3RB5A 3NJFA 3ZE0E 4IMLA 4XNUL 1NAKL 1SJEB 4U1LA 1ZEAL 2J1WA 2PXYC 1F56A 1N7ML 5DWUL 1LE5B 2Q8AH 4TUKH 3R8BB 1J88A 5TE4L 3O11A 1KPVB 1UD8A 3IJ7A 2WHVA 3SY0A 5C0CD 3FQUB 3CQFA 1OL0A 3QISA 1AQKH 4BFJA 2J25A 2WO2B 1BCIA 4KAQL 1ORSA 4HC1L 1QW8A 3NJXA 4WAFA 4DQAA 1N8OE 5BS0D 4K5PA 1QPPA 2VJ0A 4RX4D 2ZX8A 4ABQA 4K7PL 2Z35A 4AGLA 2XN9A 3WLWC 2Z8VC 1M53A 1EZSA 1KEML 1JNNH 4M4RB 4IBWA 5IHUH 2AVFA 5I6XC 5EUKB 1XMWA 1OAUH 3DX6B 3A22A 5FECB 1GGTA 4L4TE 2LAGB 5E6IB 1SM3H 1INQB 3CU7A 3FCGA 2X9ZA 1T0MB 3U36A 1YEKL 1MRDL 2YO3A 2HTLC 3ATFA 1DYZA 4N2FA 1BVLB 4K2UL 1KIRB 4Z7UB 5FA4B 5GIRB 5LNGA 2MCG1 3GXMA 2BVQA 3BLBA 2A83A 2Z31A 3WKPA 4NQDB 4XBGA 4Q6IA 4AYFB 3TZVD 2OXGB 2Y22A 3O2WH 5C07E 5AVSB 3M7OA 1SHMA 3TBTB 1EJ6A 4Y19B 1QWNA 3CDYA 4PTUB 4L8CB 4URKA 1HJCA 5IVNA 1CBJA 3BLPX 4YHZH 4ZMZA 1MPAH 5HHOD 3O3AB 4S2SA 4PBDA 3FFDB 4A2MA 3OXRA 1S9YB 2I5YH 4RGOL 3W5MA 4MJ5B 4GG6E 5CEXB 5D6CA 1FN4A 1MG3C 2XZCH 1BW8A 4IBUA 1FGVH 4K55A 5J57B 4V11A 4MQ7A 1JV5A 3N44B 5EIIG 5HYJE 3V4PH 1BF2A 5CLYA 4CU6A 2F8OA 4Z7OB 1R3IL 3NZ8A 4RH4A 3GK8H 3NSJA 1EDQA 4XMKL 1BD2A 3HAEH 5KBDA 5E8DH 1PIGA 2APSA 1NBCA 1A6UH 3O4LA 1HSAB 1ID5I 2RHEA 4LXFA 3UTSD 3PJNA 3IDNA 2YN3A 3S88H 3NRQA 1MCPL 1NZRA 2AGJH 1IC1A 4FL4B 4LIQE 3SQRA 3UO1L 2JXMA 2XA3A 1U33A 4H25A 3CN2A 4NQVB 1HKLL 2NR6A 4OF5A 3FUJA 4K9EC 4ZW8A 5E5RB 2VQTA 3BUTA 3LHAA 4B60A 3EJQA 3QE5A 2WNKA 3FMGL 4X4ZA 3QQXA 4GKSA 1MAKA 3LTVA 1NDGB 2CKBL 3GO1H 2V9TA 4MMZC 2DM4A 1NFDF 3DOSA 4L3ED 3U6XA 3OR7A 1UWGL 3MCLL 3DIDA 3LH8A 1F00I 5D4IA 3T8VA 4XNXL 4RVBA 3UJTH 1OT2A 3ET9F 1R47A 3QPXL 4ANVA 4UOQA 3GXPA 3K1DA 3DRQB 5C7XL 3TS8A 3ZSSA 4XAWH 3MLPA 3BI9X 3JT2A 2BJMH 1E3FA 3S35X 1T1ZB 3EOTH 3QUZB 4P59L 3B43A 4W9DC 5ID0A 4JRXE 1N9PA 5DJAB 5AQ0A 4UMGA 4PRHD 4KK6C 3VFRB 4QUOA 3ZKMC 1ZMYA 1KIQB 4NO5A 1S8DA 2IO5A 1AGCB 2O72A 1E5AA 3MX0A 4GMTL 4WO4D 5DD1H 4ALAC 2RGSA 2VLRD 3BD4A 2X6AA 3VWKA 1DVXA 5FB8A 3BISA 1BBJB 3NK3A 1AXSA 2NUPB 4XNMB 5B3JE 3V9EA 3D34A 3FUIA 3LQAL 1KG0A 3HOGA 2X2YA 4X98B 2NTFB 5ID1A 2ITFA 1T2JA 4JVWA 2APVA 1E8ZA 2E7HA 4Z95L 3OKDB 3VTAA 4F9LC 2B1AL 4FEMA 4JHWH 4KK6D 5BS0B 3ZKMD 4GRWB 3O0LA 1ML0A 1B0GB 4PJDA 4POZC 1F02I 4PUBL 4YPJA 3RY4A 1HI6A 2VDNL 3KPRD 3UBXG 3PFQA 3QRFM 2DM2A 4YVNA 2WK2A 3T65A 4IIQA 1PAZA 2D7OA 2X2UA 5D7JA 3IJYB 2WCPA 1EGJA 4CADA 2XC8A 2WUCL 1MFAL 1T0NB 5F93C 4Z3TA 1MJ8L 3Q0HA 4DHLA 1G9MH 2DQGL 4CU8A 1MCFA 2XZZA 3TZVB 4JW3A 4KQ0A 1GZPB 3RVVC 3T3PE 2HLEB 3GGWB 4QRRD 1PZ5B 1IIKA 3VFWA 4IGBD 4KHXL 3O3DB 3BIKA 3CFQA 4GG8A 1F42A 5FWRA 5HHOB 1DL7L 3LPPA 4YE4L 5KYYA 1HC1A 5D55A 1T7XA 1O5PA 5HP5A 4OLVL 4Y2OB 1KCLA 3LRGA 4FKKA 4AXWB 1OCWL 1MN4A 4W6YB 4ZAKD 3WKQA 3IFNH 3UAFA 3QJZA 2ATKA 2P1YA 4BSWA 2QVMA 5F96L 4UT6H 1MDTA 3KGRA 2G3XA 2DLTA 1BMGA 2F15A 2XKUA 3P11H 4OCLC 1FG2A 4HIQA 5L9DL 3U2SA 4AV5A 3JUYA 3HHRB 4V2CB 4Y4KB 2VISB 5EG6C 3UTSB 2YAOA 1FL6A 2VMCA 4MD0B 4DFIA 1KLFB 2W0FB 4O2FB 3ECUA 4MAZA 4XPBH 3PV6A 5GJSL 5GZNA 1RP9A 1XCQA 2YAQA 2R4SH 3MUJA 4A2DA 2P8LA 3FU9A 4OM0H 4RBPH 3K71B 4E5XB 4KMLB 4U33A 1DLFL 3QCUH 2FLBT 2JK5A 5DQJB 3NIFF 1EO8H 1OAQH 1ACYL 5I8EB 4R90L 3Q6GL 4J1UA 5JHDA 3MRMB 3PP3H 1IC5H 4L3EB 1E3XA 1TZGL 1YCSA 3BVDB 4LRIA 3RQ3A 5IOPA 3NA4A 4GNKB 4X0KB 5DJDB 3IPFA 1JYWA 3VQ2C 2PCFB 2BIOA 5JIKA 3TO4B 5I15H 4P05A 3GIVB 3E8UH 2HFFB 2JKLA 4P0DA 3QUXC 3S6CA 1EBPA 3S3BB 3JYBA 4FKEA 2WZPA 3BXNB 3RKPA 1ZVYA 4BZ2L 1QASA 2AJVH 5F1IA 1QX1A 5G4NA 2BVPB 2P26A 1XQ4A 4LU5L 4XXCC 3TXAA 5CCHE 2EIZB 3V52H 1GGCL 2BOBB 1JDAA 5EZLA 4PRHB 1MHPH 1BM3L 3DI3B 4K8RC 1A9BB 3BAIA 5EU7E 3HMXA 3GTVA 2Y6TE 1PIFA 2UXFA 4WO4B 2O93L 4S1RL 1L5GA 2V3DA 5G2NA 4MZRA 5F3BA 1IGIH 1BQUA 1FLTX 1I3GH 3QPQC 5CJXC 1MCOH 1Y1UA 2ZAHA 4M5ZH 1JK8B 1KBGH 2VDQB 5KVDH 3D3VD 3FB8B 4MNQD 1YEHL 3ILPB 5A2LH 4H1LB 1V27A 5JHMA 3MV7E 4TNEA 3RWIB 3VDAA 4GYBA 4HIIA 2FX7H 4F1ZA 1GKOA 4NZTL 3WS6C 1HZLA 1VPOL 3G9VA 4K8RD 1CFTB 1ZE3H 4J3VA 2R2CA 5T1KA 3ARYA 1QSEA 1ZHLA 4HPYH 2EZ0C 3OZLA 3VXMD 3ULUH 4WFED 3CFMA 3FT1A 4URTB 5DHVA 1Q0XL 3ABKB 4LEXL 5FDWB 4LLDA 2Y1YA 2BHUA 2B59A 5GRWA 1NDMB 1GPOH 1NFIA 4XMZA 3RZCD 4N0UA 1CIDA 4NGHL 3MXVH 1ZLSL 2IAAC 2G9HA 3VFPB 8FABA 3Q3GA 2WO4A 1PZCA 3D30A 1DDTA 1UA6H 2FE0A 2VXTH 3BQUD 4FJZA 2VITB 5KSBF 2YPVH 3CK0L 1FZKA 1U8IB 3ENEA 4IRZL 4BINA 4KUZL 3TT1H 1ETA1 2VXUL 1MCSA 3OKEA 3BT2L 1A4JB 2EZ0D 2WP3O 3PWPE 1Q1PA 1AY1L 4FXGC 3QNFA 2UWEB 4IGBB 4NNYA 2YHGA 2Z65C 4YO0B 1U8HB 2J8OA 2IALB 1PD6A 3BWAA 2B08A 3ULVF 4YX2L 3FN0H 1KV3A 5FS5A 3RY6C 5JPMC 1KFAH 5AB1A 3VGAC 3TYGL 2FATL 1D5ZB 2R23A 3IKKA 4ZAKB 3W56A 3R7QA 1VGEL 3DTUB 4KJYB 3MV9E 2Y07H 1T4WA 4KTYA 2CBOA 4G7YL 1M7DA 1QA9A 1WA2X 1RIVH 2A73B 2OA9A 4IMKA 1KXVC 2EIJB 3G5VB 2ZUWA 4YHKH 5IW1B 3FPYA 3IS1X 4DP5X 3OG6B 2WCGA 4JPIA 4E0RA 1PDKB 2IMNA 1I1FA 1OGSA 2ZWSA 3WIFA 1PKQE 3SBPA 2JQZA 1FIEA 3BJLA 5GGUA 1ZHBA 1A66A 4OI9A 2HLFC 2UZYB 1U58A 1KN4L 3T4AB 3OSKA 2P46B 1J1OH 2BIQA 4P2OB 1TQTA 2IAND 4IHBA 3I02B 4KVCH 4KKZA 4TNVF 4D7PA 1C08A 2ILLA 4G8EA 5D71H 1EHLH 3GSNH 3GDBA 4X5XB 1JG9A 2E9GA 1TJMA 1JJUA 4R3SB 4LLVA 3ZO0A 2QKIA 1KYFA 3K8MA 5D96B 3B9VA 2OCCB 4P5MB 4GRLC 2FBOJ 4X0NA 3HFMH 2E5EA 3MTRA 2EH7L 2MTPA 3HHSB 4ZT1A 5FYKL 5BCAA 2HLFD 3H9ZA 4M6NH 2CUHA 4OJFH 1FYTD 1MJUH 4NQCB 1Z3RA 5EOCH 5BOZG 2FWUA 4NNPL 3WFEH 2LFEA 1AO7A 5JQIB 3F84A 3Q8CA 4TRPL 1JHKH 3RIFK 1JVOA 3ZN6A 2ZP0T 5GSVA 3UADA 3ARXA 3JWNC 1H3UA 4WF7A 3RU8L 4X6CF 3WAJA 5EA0H 1RZIB 4WEBL 1OAZL 5CFHA 3NFSL 5KYWB 1DCEA 4FQ1H 1BLNA 5INDA 3R18A 1KELH 3GBNH 2F7QA 5E00B 4YHNA 1SOKA 3ES6A 2ZOUA 2IG2H 4ZOEA 3CZNA 4ZTEA 3R4DA 5PCYA 3L9YA 2NX5E 2Q8AL 4IOIB 3QFJD 4RNRA 3RDTC 2F74A 3CH1A 1UZ8A 1AQKL 5AOMA 2KQNA 1TQSA 1N12A 5DVPA 4HUVA 3VAEA 5FF6A 1INDL 3D3VB 4MNQB 3CLWA 4ATWA 3OHXA 2DM3A 1OCCB 1KLGB 1RUAH 2X53A 3B34A 2GC4C 1YC7A 4G8FA 3OKOB 1FAIH 3ZDZF 4APQA 1FO0A 3KPSE 4PRNA 1R3HA 1KGJA 4BRJA 4PJFE 5KBLA 1UG9A 5KUMA 3DX8A 1SM3L 4P46A 3UH8A 4BZ1A 2A99A 3U0PB 2RBLA 5AVTB 3QJXA 5HTSA 4AQ8A 2R0WL 1AE6L 4G5ZH 2BWQA 2VR7A 3MJ8B 5F9AC 2YAFA 3JTTA 5EFIA 2LR4A 4IDJH 4NUPA 1IT9H 3RZCB 1GRWA 2YWYA 1ETZA 4QEGA 2KZWA 3MRBA 2JCCB 1WAEA 4P5RA 3MJ9H 2WTOA 3BQUB 2ZX7A 3SKJH 4J2QA 5EBGA 4N4YB 1Y6MR 4WFGD 4YHZL 2OS7A 2H41A 4PG9B 3MRHA 1KCSH 2JE8A 1I1AB 4PBWD 4A6YB 4F2ME 5JOFB 4JFXA 1E2WA 1RHFA 3M86A 4FQIH 4QWWD 3IBEA 4OZHB 3WFHA 3PDOB 2NLJB 4QRSA 2E7MA 2P44B 2NY4B 2AF2A 5AVRB 4JFYA 3TCLA 43C9A 1O7DE 3KPMA 3L8QA 5K1VA 3QJSB 4OQTA 4R4NC 1K3IA 3AS3A 3DRTB 3V4PL 3BZEB 2ALAA 1YDPA 1WHOA 4EZMA 2PYEE 5AVZB 5AVXB 1JGDA 5I75C 2P5EA 1YY8B 3L3KA 1OT1A 1UOLA 1JPFB 4X9YA 3OGCB 3IRPX 2JH2A 4JANA 2LTQB 1RZ7L 2BVOA 3QZNA 4NN7B 1CVRA 2A6IA 4Z77A 5FYJU 3RGVD 4QHUB 5DUMH 1UQSB 4EI6A 2W0KA 2FIKA 4RGNB 1ZGLA 2Z4QA 3Q1SL 2V2WA 2GBTA 1I7UB 4JRYE 4P57A 1A47A 4R4ND 4Z7AA 4OW6A 1CL7H 4O00A 5EU5B 4BKLB 1PG7W 3B5TA 3HZKB 3QUKB 3G7TA 3OAWA 1EHNA 1XDTT 4I77L 4OB5L 3GZQA 2W80C 3IB4A 1AKJB 5K9KB 4JQVC 4XP5H 1R17A 1GGBH 2EJ1A 4M3JA 1U4FA 4M8QA 4UF7C 1JUFB 1MI5D 4JDEB 1JGUL 1PLBA 1OGAE 1RUQL 4XNZB 4BQCA 1YMMB 5D1XE 3VI3F 4APXA 3JUZA 5T5NG 3I3EA 4BH7B 3EXLA 4XAWL 4XNQB 1K8IB 1FYTB 2H1LM 3ARUA 5BO1H 4TLKA 3AS2A 5DRZB 4LCCB 4H40A 3O2DH 4U4IA 3GLEA 3UTTE 4JPKL 3S34H 4HK0B 1K4CB 1YEDB 2ZWKA 1WWCA 5T3ZH 5T5NF 1PNDA 3NA9H 5BJTA 4N0CC 1PX4A 4G1EB 1S7XB 3F8UB 1JDCA 3B1TA 3ILQC 3VW3L 3RX7A 4L23A 5DD1L 3VXUD 2GTZB 4MD5B 4RMWA 4GO9A 3P73A 4ZQKB 4IHOA 5CMAA 5I5JA 5AWNH 5GHWL 5E2WH 1JF6A 3QFJB 1I8KB 3ZZ1A 4DNLA 1WFMA 2EE9A 3EDKA 1BOGA 4HCGA 2YRBA 4PJ5B 1V7NH 1HZHH 5SWZB 3QGVA 4DGVH 4QHNA 4Y89A 4OR1A 5H2BA 1CR9H 1IGCH 1N6VA 2VQ1B 3N91A 4MQSB 1JN6B 3DUHA 5GRVL 3BSZA 3MTXA 3ILQD 3MV8A 3AY4A 4L5FH 4HUNB 4FEIA 5FKPA 4U1JA 5MEPA 3R7RA 1OAXH 3IAQA 2Y7QA 3TJEL 1OE1A 1BMWA 2BY3A 2WIIA 4R7DB 4DZ8A 1F11A 1QFHA 1FH5H 4UTAA 1UM4H 3UPRA 1R33A 3J8F7 4ODSL 1KJ2L 3VE0A 3NIDB 3KS0J 4DKDC 5D5MA 3VDBA 1B9ZA 3IXAB 1LDSA 3GI8H 1DBJH 5IREA 3AXLA 1Q9KB 4RMSA 1N64L 3HE7A 2EEBA 3WD5L 4EIUA 3D85D 3C8DA 1UZGA 4AIXA 3UJJH 1SQ2N 5CU9A 5DURD 1NCHA 2WINB 1MW1A 1CDJA 3KL3A 3OMNB 3KXFA 4PRAB 4XO9A 4DESA 4V1DE 1YNTB 4Z7QB 3M1OA 4AIZA 1CJYA 4GMSH 5HGDA 1Y0LB 3Q1EA 4JFPA 3WN5A 5FOBB 1NGPL 2Q0ZX 2ODIA 2EKSA 2NXZC 5FX3A 3N40P 4H8HA 2CHNA 2MOGA 2OR8A 4KH9A 1Y7VA 4ZTOH 4J4PA 4UT6L 2XJKA 4NLHA 2ZOOA 4AGQA 3A21A 1MY5A 3P11L 3V6OC 5DMJB 4HS3B 2FQGA 3QC6X 3ZE1B 1RKRA 5EC2B 1AD0B 1Q1JL 2H3NA 4HIJB 4M7ZB 3KLSA 4U6XA 4G43B 3QUGA 4XCEB 1HKFA 4WUUB 4NWTL 1D5XB 3NGBC 1KCBA 2PW1A 3BZ4A 1T1WA 4O4YL 4ZMTA 4PJHF 2BZ7A 5G55A 3BP4B 1YAIA 4UOW1 5JMRA 2XU9A 3HEIB 4M1DL 4OTXH 3RGVB 4CBPA 1A22B 4TVPD 3MBWA 5F9WC 2NXZD 1FHGA 4PJCE 3RZWA 2IBGA 4BDVB 1K9TA 1O5DT 4UT7H 1S5HA 1EO8L 1OAQL 2P43B 1BQSA 2R69A 1R3LA 2DWSA 4IKIA 4Y1AA 5H94A 4OLWH 2UUDK 1IC5L 3PHSA 4GFTB 5IESH 3TJPA 3SYCA 2QR0A 4IS6A 1MI5B 1SY6H 4J39A 3LH2L 3VJ6A 2AJYH 2VZ3A 1W8EA 1LWHA 2MEJB 5F7FA 1COBA 5FUZL 4R26H 1OP5K 3ECBA 3HC4L 1UB5B 4XCCL 5LVEA 1EFXA 1EERB 4HEME 4MA3B 3S3DB 5KVFH 2NW3A 4MJHA 1EK3A 1YO4A 4BK8A 1DQVA 3E0GA 1CGYA 3VFOA 5ACZB 5TDOB 3UGUA 3V52L 1FLRH 4HCRA 3STLB 3VXSA 2D0HA 3H56A 3T3ME 3GFUA 4L3CA 2EO1A 1K2DB 3FCBA 2OCFD 5E7BA 1VEOA 4LPXA 2B14A 5I18L 1MCOL 3QWOA 3IE4A 3QXDA 1GJUA 2HKHH 2YPLB 3HHMA 1KBGL 1MCQA 2QPUA 4AM0A 5KBMA 5A6MA 2IDTA 2A9NH 4BFOA 1IFHH 1KCVH 1UACH 4BIKA 4PJ9D 4LCIH 2XWCA 2VR6A 4PPTA 1OF0A 3TNNA 2PTUA 1M56B 5IB2B 3QIWA 2AABL 3MROA 4IJTA 3T04D 1RH8A 5A43C 3QWQB 3AWGA 4P4KA 2LW3A 2DLGA 4HZLA 4HPYL 3CLEH 5C08A 3ULUL 5ICZB 3NJLA 1RZJL 2ZXCA 4YZFE 4HIPA 5FIEA 3B8SA 4O2CB 3OWEA 4QXTA 2J12B 4HKXB 2ZUUA 3B2VH 15C8H 3GHEL 4PJIB 4IW4C 3G6JF 3QQ4A 3DGDA 2Y0SA 1VAHA 2R0ZH 4PBXA 5KN5B 4GKLA 2HVJB 3MXVL 3SE9H 1OSPH 3O45B 1WQVT 3RNQA 2VXTL 1UA6L 4PRID 4WTZA 2ZCKH 3TH3T 3CN4A 3H2PA 3TT1L 5E08L 5CCKH 3WXWH 3MRRB 4F2FA 4AENB 3KLAB 5IB5A 2P52A 3D85B 3FB5A 4AGNA 1HHHB 1XV8A 4OLXL 5L4IA 2F7IA 3QRBA 4M7JH 4ERSL 6PCYA 1U41A 1FNEB 2HFGH 4P2CG 5HVGB 3JWOH 1GC1H 3FO0L 3FN0L 3OKKB 3ZKNC 2XTJE 2Z1PA 5ALBL 4GEJA 4B7LA 3P69A 2UV3A 3EYSL 3UMNA 4ECNA 4MB4A 4JVUA 5FGCE 5ABZA 5BVPH 2Y9RT 2Y06H 1M05A 1NCUA 5GGSA 3EOAB 5DO2C 4EI5A 3VTMA 4YBHA 1QFUH 3OR6B 4PJEE 4AUJA 1WFJA 3QXAB 4GAFB 2Q86A 1SN0A 4R97B 3PIQB 2JQAA 4BFIA 1ZT1B 2VRQA 3IMWA 1KXHA 1QG3A 5H4YA 3RTQC 3ZKND 2OMTB 4PJXE 4W70A 4NO0A 1DQJA 2FJGB 4HLZG 5E8EB 3GNMH 2N1TE 4GLRH 3HR5A 2Y4SA 2NXZB 3KLQA 1OE3A 2B16A 1S78C 2J4WH 2MJWA 4YWGL 3WO3B 1LHZA 4WI3A 4NJAH 2ITDA 2X3AA 3GSNL 3I2CL 3L3GB 5JIDA 4LFHD 5E56A 2J55A 2X88A 2ZKHH 3L5HA 2DWDA 1SJHB 2RB8A 1LK3L 1HEZA 5DK0B 2WBJC 3QB7C 1YPZF 2NY7H 5I74B 4MAYB 3WIIH 3RTQD 4N2BA 4PG2C 3NGBB 5TFSL 1FBIH 2OP4L 4QOKE 5ICYB 4R7XA 2BERA 1MLBB 2I9LB 3VM7A 1MJUL 4WWKC 4FNQA 4NLAA 4X7EC 2WC7A 1S78D 3D25A 1EWHA 1YYMH 4J5VA 4GKNB 1XF2B 1JHKL 2NQDA 4Y16D 3F58H 5EU4A 1FI8C 2OMWB 3SJVD 3KDPB 1YEWA 2Z64C 2WKLA 2HT4C 1X9UA 3MR9B 4UWQB 2WBJD 1EANA 1KELL 2FJUB 2W0LA 1KCRL 3GBNL 3U4AA 5JDJA 5KWYC 5FDYA 4PSRA 2Z7ZA 3FU6A 4TSAH 4MQXC 1ZWIA 1REIA 3GHBL 3K8KA 1ZSDB 3NRPA 5A2JH 4AX3A 4HW6A 3FSAA 1CI3M 2EYSA 3G5XB 3FFCD 1UJ3C 4JY6B 1F0LA 3C09C 3D0VB 4XBPA 3P40A 2R59A 3GTTA 4P5TC 5GISH 4A7SA 4UINH 1FNLA 1YN7A 2HT4D 1RUAL 2VR5A 3AQZA 4IU2A 3P30L 4JR9H 2IGFH 4LT7A 4PJ9B 3ZTEA 4F33A 5D2LE 3BVVA 4NAJA 4RWHA 4PV9A 2GC7C 2DJSA 3VH8A 4MQXD 3ZHKA 3LS4H 2I32A 4WFHE 4C83B 1NGYA 4M5YH 2G4EA 2BCMA 3QQDB 1MFDH 3HZMA 1LLAA 5LCVL 4KQ3L 4AKPA 4NRXB 3CTTA 3WNIA 4P5TD 4TS6A 3KWUA 4Q0XH 5DJXB 2FNWA 4M29A 3VACA 4WY7L 3FB6B 2XY1A 5I1KH 2XQYA 4ZMLA 2EEXA 2OX5B 4YH6A 3O2VL 2H8PB 2WLMA 5IW1A 3H0TA 5BO0D 1FZJA 4DGYH 2PWFA 1GAFL 1ZK9A 5DVOA 2ICCA 1D7BA 3UTQA 4PRIB 4GJTB 4J28A 4R7VA 4UB0L 3OKNB 3T0EA 2P7TB 2DLFH 4PJ7E 3O6KH 2X05A 3BFQG 1AGFB 3EYFB 4UMSA 3UROR 4G8AC 2EKJA 3S3PA 2R51A 4GRWH 4DIXA 1L9SA 3TYFA 2JB5L 3DSFH 4FQIL 4FI8A 3D8MA 1GZQB 1JYNA 2XN9D 1XBRA 4XAKE 2GT9B 2NXYB 2R1WA 3QNZB 4FI6A 2ZXWB 5HY9A 3CGTA 3RGBA 1HHIA 1LYQA 3U1QA 3B7YA 1CXKA 3BFWA 1KB9J 2E6QA 3DX9A 1SYVB 2DIAA 1D3CA 1QLRB 4JUTA 4JY4A 4BQ8A 3I9IA 5BUPA 1SVCP 4FXKC 1QSVA 2Z31D 4P48A 1RJYA 2VLME 4MS8C 1Z5HA 2YPKB 5C8JA 4HK3J 1EJFA 1JNHA 1KGYE 3I6GA 5D1ZC 3LVEA 1A1NB 1OTSC 1D5MB 2OW6A 2XJLA 2QJDA 3GJFB 2A4EA 2PNDA 3KYOB 4HQQH 1U93A 1UOWA 2O5YH 2GW5A 3TF7C 4DP0X 3X14B 2FBJH 4LBEA 4Q9QL 1L9OA 2N59A 4HXBH 3LPGA 1Z3GL 2EDHA 4ZFOA 2AQ2A 3ZPDA 1D5BA 2AMUA 1WFNA 5TQ0L 3A5VA 3FQTB 4UYPA 1UKTA 4HDIA 4MS8D 1R24B 2Q2LA 4ZUSA 5TQ2H 2OV0A 5ACLA 3CJJA 3MLSH 3V95A 4AL8L 2GBVA 5F7WC 2NR6C 1IZKA 5F7AA 4LHJB 3ZKQD 4FQXB 3BSHA 4QRPE 1EA9C 3TIDA 1O9ZA 1RK0A 2Y5EA 2Z93A 5BO1L 2Q7YB 1BD2D 5C0AE 3EDEA 2CLRB 2GIMA 2UZIL 4XB3A 2ZCZA 4H2AA 1NKRA 3HZ3A 3E9TA 3O4LD 4Y16B 1DUZB 1P4LA 2DEXX 3PFUA 3AREB 2VJ8A 4G6FB 5GGRB 4ZDHA 3SJVB 2GI0A 4L1DA 3HN8A 4U1IA 4WV1A 1DFXA 2JMRA 3L7EA 3IXTA 4C56A 3BPOB 5ETUB 2F54A 2YZ8A 3BX7C 3UIZA 4ZMPA 5GRYA 2NR6D 1TSHA 2CIKB 1J8KA 1TZIA 5DLMH 5HGHB 2NYZA 4GXVL 4MHHG 4YN3A 1X9RA 3OPUA 2F58H 5DMYA 1CXHA 5FO8A 2PP7A 2EYTB 3KYNB 1FIGH 3FFCB 3P0VH 3ARQA 4KUCF 1HZHL 2OQJB 3MRLB 4BA0A 2XX1A 3ZRSA 4YHIA 5L8KB 5D6DA 1CR9L 4UQAA 1MXGA 1PG7X 3N06B 3JYCA 4CC1A 2EDMA 1J8RA 2IFGA 3VWKC 4YSCA 1XF5B 4K9EH 1MFEH 2JWYA 5FPIA 4WEMB 4AQ1B 1XGQA 3O9WC 3PNWB 1ZOXA 3H7BB 4S10A 1AHWA 3DTXB 3UTPE 1XR8B 1OE2A 4U49A 2VWEE 2AJZB 2IH1A 4FS0A 4HVBA 4Z7NE 2QGBA 3U7YH 2MHAA 2K9UA 5HDBB 1AXIB 1UJ3B 1UM4L 2CGZA 3RUGF 3DC0A 4LP8A 1ZPUA 3RIAF 3U46A 1WTGT 5E94B 3K5RA 4JJ5B 1XSIA 4PAZA 1RLBA 3FQWA 3WO4C 2EIEA 1MHEB 1TTAA 3VWKD 4LAJH 4U1LB 1BQHG 1ZCRA 2NCMA 2VDQH 2WMPA 4OV6F 3WY4A 3O11B 2IQ9H 4IIQC 2OL3A 2F9BT 4TNFA 4WGKA 3SY0B 3UJJL 5T3XL 3DETC 4FP8H 1J5CA 3CFKA 5C2BH 3WSQL 1G4MA 4UI2A 4WDIB 4HOZA 5KVEH 3A6OA 1ORSB 5B7FA 4F9PC 4PY8I 4DP2X 3QHZH 4ZSOE 3H7LA 4ALAH 2Z35B 4I3RH 2OLDA 2XN9B 4S1QH 4AVIA 4WK4B 5JQ6L 2EDXA 2BY1A 1JZ4A 4Q4IA 4ZTOL 1EHAA 4RRPG 2QADC 3TH2T 3LKQA 4CVWA 1S9WB 4Q7DA 3U36B 5D7JD 5HGBB 4ABWA 3DETD 4BEIA 2KQMA 4MHHI 5IT2H 1KGCE 2VXSH 2UY6A 4LVNB 4RBPK 4YXKH 2A83B 2Z31B 4PRDA 4XBGB 4Q6IB 2XDHA 1MW2A 1NLBL 1EZLA 1CXFA 4JO2L 4DKEL 1NIDA 2H9GA 43CAA 4EN2A 2MWCA 3PP3K 2KERA 3BN9D 5CZRA 1OTTD 4AJ0A 1N67A 1UA3A 4M1GH 5AW6B 5JZ7C 4S2SB 2I26N 4LCWA 2XLLA 5FM8A 3OXRB 3FT2A 3ME0A 4NO2A 2HJFA 1E27A 4KKPA 3ZDYF 4OLWL 3NEOA 5KJ7E 2KL6A 1M7IA 1XF1A 5D6CB 1FN4B 4F5CA 1SBBA 3CMGA 4U4BA 5EWIL 4WNSA 1B6UA 4JK0D 1WIUA 4TNGA 3T4YA 3RAJH 2EP6A 1JV5B 4H8QA 2K6ZA 2JJWA 1Z5LA 4R26L 1E90A 3HVDA 1WWWX 3NZ8B 4KI5E 2YEZB 1BD2B 5JZ7D 1J5IA 4JN1H 3ZTNL 1MREH 1MWOA 1SEQH 4LRIC 3THML 3NJGA 4PJBA 1FLRL 3UERA 5ISZE 5JW4N 3LS5H 3L3JA 1ZKAA 2JXMB 2EVGA 5GZND 4MKMA 4ZS7L 5G5DA 4H25B 4XR8C 5I1HL 1GTFA 1JERA 5I6OA 3QVAA 3CXFA 5HYSG 1R0AL 2HKHL 1E6JH 1FE8L 4XZUB 5HHXH 2JELH 4GKSB 3GMOB 1PF3A 3IJ8A 3B3IA 5JHDD 2LVEA 5D7LA 2A9NL 3UACA 3OD3A 3OR7B 5DGQA 3P0GB 4LSSH 4LCIL 4PHZA 3UC2A 2H3KA 3EO9H 4WU7A 1IC4L 3JV6B 3GM8A 3MYJA 2V2TA 4PSPA 1NCOA 5D72H 3JV4A 5C09E 2NY3D 4OFPA 3S0PA 2WZPD 1PLGL 1L7IH 1HSBB 2G2RA 4RDBA 4AKOA 2GBUA 2J6EA 5KVDE 2QQNL 4JE4B 1KYDA 2IAMB 2R15A 1EMTL 4GAYA 5I16A 1I8IB 3N43B 2DMKA 3NP3A 4YHOL 1E4XI 5EF0A 5ID0B 5ADOH 2R0ZL 1RK1A 3SQBA 3X1GA 1AMXA 1D7FA 5LAPA 1DP0A 1S8DB 1G6RH 3MX0B 2EUZA 4WHYG 2CLZA 4X8GA 4H88L 5DYOA 1I7RA 3INUL 3SZKC 3EYUL 1F41A 4X5RA 8CGTA 5FB8B 5JMOC 3ULUE 2NNXA 1AXSB 3D9AH 1F3DH 4O2EB 4HUWB 4L2LA 3L4UA 1NIFA 3KBPA 2CDEB 4XB8A 1F6FB 1KG0B 3ZL1A 1HH9A 5I24A 1PGRB 1HQRA 5FAAA 3L1OL 4J3TA 5ID1B 3JWOL 2IH8A 1TQBC 1CPUA 4KY1H 5GGVY 3CX5J 4K8RH 1KENL 3H3PH 4KXBA 4Z23A 5GXBB 3G5ZA 1K5NA 4PJDB 2CR3A 5T1KD 1HI6B 1QSED 3ULSA 2CO4A 3LJ3A 3H53A 1C8QA 5B39G 4XC3L 4JFOA 1CLZH 5EDXA 1NC2A 4K3JL 5DA0B 2H6OA 5D7JB 4LGSB 5MERA 4XPFH 1NMAH 3D2TA 4KVNL 4CADB 2DQ6A 4ABVA 1OO2A 2FH6A 1L9TA 5GGQH 1WE5A 2BVEA 2R1YA 3L4YA 3N2JA 3N1FC 1WPCA 4IMKC 4BQ6A 2X5PA 4CVXB 3OQRA 3L4CA 4NCC2 4X6BB 4NWUL 3W9EA 1J0IA 2FL5A 5EBLA 3TA4D 4UTCA 4B9PA 5D2NA 2NDGA 3BH8A 4M5TA 5JIHA 1A7QH 5ENWA 5KS9A 4OCMC 1BZ9A 1FBIL 1MF2L 2WTPA 4X7CC 3DXAA 2ATKB 4W9KC 1WG3A 1NUFA 2A6KA 1U6AH 3R4RA 4MJJA 3GRWL 1T04B 3LIZA 1YYML 4PJ8C 4Y1SA 3U9UA 4ANKA 5D1QA 5TDNA 3I85A 4PJGA 3F58L 2FX8H 4HPOH 5BMFH 1PZUB 3P9LA 2AI0H 2QKIC 1KLUA 1KJVB 1U8JA 2FGWH 3U2SB 4L2YA 4B50A 5K59F 4AJWA 2X10A 1YNKH 2D4FA 3F3HA 5J6HB 3L1GA 1FL6B 4KXAA 2E9JA 1YUKB 3RWHA 3AZUA 4FQQB 1E42A 2ESVE 1CO1A 2F61A 3PV6B 5TPWL 1ORQA 1C5BH 1P7QB 2P8LB 4XPAH 5HGGS 4OZIE 2AITA 2A6DA 2APTA 4XMPH 3VI4F 1CDBA 3C5XA 1JTTA 1NFKA 2JK5B 3FCTB 5GISL 4U7MA 4YHLH 1JZGA 4MNGE 4J1UB 3V4VA 2X40A 1DQDL 1X5LA 2YD1A 2BIMA 3IDMB 4LK4A 3QCTL 1U42A 2IGFL 4M43L 4TULH 5IOPB 3QDJE 4Z7WE 2DQJH 1G1CA 4C4BA 2J7LA 3FOMA 1Q72H 3HUJE 1P4UA 2D3JA 4PJAA 3LD8C 1CYWA 3MOBH 5DMGC 1AO7D 5B7EA 5IM7A 2NY3B 2YSSA 4XNYL 3OVUB 2X0UA 4M5YL 3TIEB 1AQDB 2OKMA 1YECH 5FOJA 2FEEL 3ZYZA 4CUCA 4Q0XL 1L3WA 4WUKH 4B3EA 5EF2A 3T8XA 1BBDH 1AOZA 1J0YA 4MLSA 4X4MA 1BA9A 4X6FA 2JSFA 2VXVH 2XPGA 1WAPA 4PD4J 4HWEH 4X4YA 4APQC 4OM1H 2VXQH 3F00A 4FLSA 4NCC1 2AKRA 1GGIL 2MMXA 4OLZL 3TGXA 3UAEA 3P3TA 4P46C 2A6JA 5D9SA 3ZKSD 2BPBA 2JLLA 5DMGD 3TM6A 2YD2A 1RHHA 5F3BB 4AQ8C 2G2PA 1AZRA 2F08A 3JWNH 3U0TB 1KWKA 2DW5A 4K3GA 4GO8A 1RZKC 1XGYH 2O4EA 3RWGB 1ZLUH 4JFEA 3WFDH 1E6OL 3GUTB 4Z3IA 5IFAH 2DBJA 3EFOB 2V17L 3LCYA 2WJ7A 4HIIB 4APQD 4DAGH 5T5FH 3ARDB 5BZWA 4N2GA 1JD9A 4NO3B 1JWSB 1ZPLA 1BJMA 4PLJC 4P46D 1H15B 5F1SA 5T1KB 1J0ZA 1ZHLB 3MGAA 3ZE0F 2BIIA 5IHBA 3NTCH 3UC0H 1MFBL 3VVWA 3EJYC 5E95B 1E5CA 3H9SE 2ZIDA 4XP9H 1WIOA 1SMDA 3MAWA 3NJNA 2B59B 1NFIB 3K2KA 5DJZA 5HDQL 1GVIA 4N0UB 2IJ0C 4DK5A 2E7CA 1FVDA 4JCWA 1TQBB 3S36H 4WI5A 3R0NA 3Q3GB 3L45A 2XNAB 3GLZA 1GH7A 5MENA 4X4XA 4ZFZA 1IGJB 1FZKB 1P9MA 5F7HA 1QR1B 3OKEB 2O5YL 1MJJB 1P5UC 5J11B 1AJ7L 2DWYA 3EJYD 5AOZA 4ZK8A 4NNYB 1XGRB 3EDJA 5BRQA 2ODHA 3V5KA 3BWAB 4G5AA 5LGHH 3R0MA 3JV0A 4Z7VA 1KCUH 5IVXB 5EU6A 3IGUA 4OCXH 4OF0A 4AUUA 5LN8A 3NDYE 2ZONA 2R23B 3C9NA 2W65A 3MUZ1 3CXDH 1E40A 4UILH 3WGUB 1IAKA 1M7DB 5CN3A 2P5ED 3HCVA 3ARGC 3NFNB 4AITA 3AMLA 4PWEA 3X3GH 2RFXA 4JPIB 5JUEH 2X4NA 2CO1A 1I1FB 4QTFA 3HG1B 4DP1X 3WIFB 5AYUL 2ZOLB 3HBZA 3QORA 2ENYA 3LB6D 4E42B 5GGUB 1ZHBB 1I53A 1RI8A 2PABA 4GRMB 1IBDA 1ZJAA 2XVGA 4GG6F 1U58B 2MCMA 4ELMA 4OZ4A 5MHSD 1ZVSB 4Y7OC 3WEXA 1FZOB 2F58L 2E7LA 1VIWA 1R6VA 4G8EB 6FABL 4AM0Q 1U3HA 1FNAA 2FT8A 5A3ID 4LLVB 1D2PA 1X44A 4JQIA 1RUPH 5T3ZE 5KSBB 1HQ4A 2LV4A 3CFNA 4OKDA 4YHYC 5GGSY 4MX7A 5TTRA 4K9EL 2GG1A 1FYHB 2NNCA 3JWDC 3ZYJA 4YDKH 1IGML 2G5BA 1NBVH 1JXGA 1Z7JA 1PCSA 3CVIL 5F0MB 4B9JA 4XC1H 4UTBL 1AO7B 4NDMA 2R4RL 2XBTA 4DTGH 4GKOA 4UV4L 5IIEA 2H7WA 4J27A 4ZMXA 4ZXBA 3GXUB 4LEOA 4NPKA 5E9AA 1GOFA 2AJSH 1WH0A 4NBXB 1J0HA 3T09A 2IBZX 4YHNB 1CT8B 4X5QA 4D9RD 4UYQA 3P3SA 5FK9B 4L5FE 1Q94B 2ATAA 4RNRB 1HXYA 5DD3H 2VSCA 3CH1B 5IHZB 4PR5A 2ZCHH 3GEFA 4FP8L 1UZ8B 2IXQA 2QSVA 3GMPA 5C2BL 3EFDL 4GS7C 5KVEL 3HZVA 4H2CA 5FF6B 1SLUA 4FF9A 1DSFL 3QHZL 4PRPA 3OHXB 5CHNA 4HJUA 5D93C 2APXA 3C75A 4AI7A 4ALAL 2FJFB 3DO7A 4PB0H 4G8FB 3D1MC 3MV8D 4FFZA 2EDTA 4QF1A 1HCYA 1B2WH 5EO9A 4GUQA 3DJ9A 3HE7C 1FO0B 2VC2L 3ZIMA 4PRNB 3BD5A 4PB9H 4YGAB 1R3HB 3EGXA 1R5WA 5BUGA 5EUOE 4BKSC 1ADQA 3DX8B 3QZLA 4MAUH 3ASOB 2WD0A 4P46B 3QZWG 4PQXA 3P77B 3WTWA 1ERNA 1I1YA 2IOMA 4KDWA 4XN9A 3RHWK 3FN9A 4UU9A 5CJQL 3GMRB 2HKFL 5FUCE 4BZYA 5IT2L 5L0QC 3OAUL 5B3JF 1CGSL 5D70L 2BW5A 3L2MA 3JTTB 2BVUA 5EFIB 4DP6X 2WXOA 4ZS6D 2ATPA 4LCYA 4LSTH 3K4AA 4J4PC 3HE7D 4OZGE 3I9GL 4N25A 5I73C 2FECL 3VGDA 1SPDA 1FFQA 4Q56A 2APBA 2BWIA 4OIBA 2ADFL 2WM0A 4KWUA 1DCLA 3Q9QA 3MRHB 5KSAA 3DPBA 3KXFD 1EHKB 4NM4L 5H37H 2EVHA 4NIKB 3FQXB 1DVQA 4HX1B 3US0A 1RV6X 3WFHB 5C7ZA 4I0PB 3LDBB 3BDXA 4NQEE 4QHLA 5IMKA 4FTDA 5DU7A 1MVYA 2ARJB 4L0PB 3TCLB 4DPBX 2PCXA 4AK1A 4J4PD 3VD5A 1YJDH 1MHCA 2H1PL 2WB7A 3OPZL 3BKCL 4DOHB 1OOAA 1TZAA 1YDPB 2Y23A 1J8HA 1RUKL 1M6OA 2O6DA 1KIUB 4R2GC 1F6LL 5ESQA 3T3PF 3L3KB 4O02L 4DGIH 4NUGH 4X7FC 4X6DE 3E38A 5JXEA 3W39B 1SEQL 1J1XL 4RESB 2B0SH 2BVOB 1DANT 2A6IB 4TVPH 1SDYA 2ZP8A 3SDXA 5H35A 3LS5L 4EI6B 1KEGL 4QIRA 2ZG3A 1ZGLB 2R9HD 2Z4QB 3C8HA 2V2WB 4P57B 4KKCD 1UCBH 3QULA 3V0AC 4CC4A 3SDDA 4F58H 3F7PC 4FYSA 3T0XA 4XCYA 5MEQB 2Q9OA 3ARVA 1U91B 4Y1AD 4XXWA 1KTBA 4WGVB 2R39A 2J56A 1F4YH 4M8QB 1N0LA 3RJQB 3MDJA 1KYOJ 3TU6A 4DCQA 5DFAA 2AQNA 4U3CA 5B8CA 3RFZB 4APXB 5DUBA 2W92A 1IGYA 4ISVB 2DBLL 2QT6A 3UJIL 1IKOP 2CRIA 2DYRB 3ZU8A 3MNMA 3NQKA 3V5HB 3U4BL 3IU3A 5IWLA 1EFXD 5LQBH 1RL1A 5BRZA 3AB0C 1QLEB 2I24N 1EDYA 1E3ZA 4MA7L 4GT0A 4FQLH 5B1KA 3KE0A 3VXSD 2C7UA 4JPVH 2FSEA 2QV2A 1DBMH 3CC5A 3B2DC 2WXJA 2P5WA 4Y4HC 1G6RL 5TE7H 2ZT9C 4IBSA 4TL4A 4P4KC 5AD0A 5K93A 2QVKA 3V4LA 3P73B 4CN6A 1C5CH 4IHOB 1BEYH 3LKRA 5CMAB 3REWA 5I1CL 3FPXA 4HP5A 1JNJA 3VFMB 1BOGB 2AZUA 1PFOA 1GGYA 5EU3B 2DV6A 4N1HB 3QA3A 5CLWA 5H2BB 1MCEA 3NCCB 5HPMB 2YLHA 1F5WA 3ELAT 4DEPC 3QIWD 2PYFA 1LDPH 1NGWA 2K8MA 3CVHA 3FUKA 1KZQA 3LH9A 3MV8B 2ZNWA 3D4YA 4G42A 4P4KD 5C08D 1UADC 4JE0A 5JHAA 5MEPB 1QTSA 4U1JB 4UQ2B 3SGEH 5DC9B 2Y7QB 4BFBD 1BG9A 2X4PA 5F7EH 3B2PA 4LHUA 1SFDA 4YVUA 1P6WA 4XCFL 2ZSVB 4DZ8B 2VDPB 3GBML 2E75C 4GS7B 4KC3B 1ZGLP 3VE0B 5D5MB 3EOBA 4G82A 4OUUA 5K9JL 2ICES 4AZUA 1TEGA 3HS0A 5LB1A 3QRGH 5DLLA 3CVBA 5CNHA 4IBQA 5E1AA 3AXLB 4HPHA 5C9JA 1P53A 4UM8B 2M26A 2BWDA 2WOBA 1A7RH 4Z7UE 5D7KE 5AW5B 3TBSA 4EI5C 5FC9A 2CBQA 2AAAA 3SZ6A 2C1PA 3IDYC 4NQDE 1D5IH 2J8HA 1KDIA 4OZFG 5JOPD 5C0IA 3KXFB 4X9GA 2I69A 4EMZA 4E9XA 4HWZB 4AIZB 1XGPA 2VMJA 5HGDB 2V3FA 4QGTA 4JFPB 3WN5B 3D51A 4YSSA 4M9PA 3DYMA 2JFCA 3O8XA 4AQOA 5FCUL 2OBGA 3EIFA 4EI5D 1PG7H 4IBZA 1A64A 3F05A 5IROA 4J3OC 2H3NB 2FGWL 4U6XB 3IGFA 1E5YA 3PWLB 2PW1B 3GLDA 3KHOA 1T1WB 3EBHA 4G1MA 4NO0D 3GWJA 1MFUA 2VDMB 4LPWA 4C4UA 3SKNA 3VO0A 4Z7OE 1KIPA 3H42L 2A9ML 3BKML 1W72L 4X8JA 1QP1A 3MBWB 4D7BA 3UZVA 3S5LA 4F7PB 2VDKH 3SB3A 5J56B 3U2JA 1FL3A 2F7OA 5IVOA 3VXNA 3A47A 1EEZB 5IQ7L 4QT5A 4L8DA 4TL5A 5MP6H 1R34A 2OZ4L 4N2EA 1S5HB 2F5BH 5GS0C 5IEHA 4H8UA 1NCJA 3LKPA 3N1MC 2G75A 1R3LB 4GOSA 1J11A 3AU0A 1FNGA 3D87B 4QKTA 5L2KB 3ATDA 1MQKL 4IS6B 4PGBA 2X3BA 5C6PB 1V8HA 2Y7OA 2YAEA 4PYHA 3TN0A 5TF1H 2VLLA 3V5DB 2K1MA 4NJ9H 4Z6AT 3AS1A 3WGVB 3AG4B 5KW9H 1JWUA 3ECBB 3PP4H 2FJHA 5CFAA 1EFXB 1XSOA 4ZNEE 4M8VA 4NC1E 1KB5A 4BFFA 4ZMNA 4Y4FB 3MRDB 4JKLA 2BSRA 3BCDA 4B0MB 4AIEA 5ILTH 4ELKA 4ZUTA 2WW8A 2JJSA 4HWEL 1AAJA 2YGPA 2X70A 1N5AA 4D8PA 4L3CB 3QUMA 5C92A 4P2QA 3Q43A 3TBWA 1W8OA 4FN0A 3MA7A 5EEZA 1RPUA 3C5SA 2I60H 5HHMB 5JW5A 3MNZA 3QWOB 3QXDB 2FD6H 2VR4A 3WMQA 4TTGA 4QHMA 2YD8A 3N5AA 1XGYL 3BMWA 2N4IA 3F7YA 3FQ1A 1SYSA 1I9IL 3VVVA 3HR6A 3WE6A 4DAGL 4G8GA 3ESPA 3TNNB 3HE6C 3QIWB 1S7TA 5FYLL 3RRQA 3T0EC 2VW6A 4YGVB 4DQOL 4LASL 5C0CE 4JMXA 3UEZA 4K23L 5C08B 4RZKA 4HZLB 5C70A 2GAZB 1I8LA 3UC0L 3EXJA 1VZIA 1DFBH 2G9KA 2LFGA 3IDIA 2AEPL 5BS0E 1OSZB 4QXTB 4GRWE 4CDHA 2E7DA 4G7VH 2WQWA 2X7LA 2MTAA 4K94L 5DZ9A 1UD2A 3QQ4B 2ZUQC 4TUOA 4IKLA 5E6ZA 3U9WA 4DWHA 5F3FA 4JHBA 3S36L 3ROLA 3RNQB 2N7SA 5FYKU 5C0BA 4OCWH 3T0ED 2ICWJ 1TETH 2V8MA 5FO9B 3L3OA 1HDMA 3RIFF 3RWEA 5EZOH 4NQTA 3PAYA 4X42A 1XHHA 2A38A 4PJFF 5F6IC 4YNYA 2BSCA 4A2EA 2DM7A 5D7HA 5G4OA 3INOA 4JFZL 2O1AA 1NDTA 4LBAA 4ONGH 2VDRL 3KHQA 5J89A 2WYZA 2XG4A 3PABB 5HYEA 2VZOA 1XH0A 3CXDL 3K8LA 2LLNA 2YXWA 4DEWA 5KYXB 5E4OA 35C8H 4TUJB 4XX5A 5I0XA 5HI3D 3LVTA 4XPGH 1X7QA 4E9RA 1FFOB 4RETB 3TEYA 5B1JA 1QNZH 4N2CA 4Z0XA 5AFAA 5JUEL 4IOSA 4F15B 3IDYB 5JHBA 1D6EB 1U8CA 4NERA 2Q86B 3JTSA 3MLRH 4NQXB 3TCXA 2M2DA 2PUQT 3GSUA 1YUHA 5E2TH 3VD1A 3PGCB 4NO0B 5E03A 3IFLH 4JDZA 2PWHA 4R4FL 1X5XA 3G6DH 3OSVA 4LVHC 3REVB 3HS8A 2F68X 4EJ1C 3UTSE 3OXSA 2EC9U 3PJLA 4MA1C 5HGAA 1ES0A 4AC2A 5J5EA 4BFNA 1WFOA 2EQDA 2AQQA 2NY1C 3KJ6L 5SX5H 4EZJA 4Z1PA 3HNVH 4D9QD 4LSUH 4AMXA 2ZXQA 5DRWA 2Q3XA 4AJYV 1OD7A 4HETA 5EHFA 1X5GA 1H3PH 3UBGA 2ZUVA 3K0WA 5LBSA 2ISDA 1UXSA 1JPGA 4I18B 3D25B 4L3EE 4LRNL 5AAMC 1TFPA 1ANUA 1AS8A 5EU4B 2VT0A 5FYJD 4JM4H 5CILH 4HC1A 1VB9A 1JPEA 1BFSA 5F1NA 4C56D 2F54D 1DJWA 1RQ5A 1SJEA 2BY0A 5AAWA 4GUOA 4OF6A 3D0AA 5DD0H 1LE5A 4J3OG 2AQTA 1ZWIB 1IAII 1QI4A 1KPVA 4YDJB 2V5TA 1TJHL 1BPLB 1AIZA 2EYSB 2YFOA 4ZX3A 5E99H 1V3LA 2YKKA 1QNIA 5C0FA 1QYGL 1YEIL 4PRHE 3Q05A 4XBPB 5T8IA 4P04A 1YN7B 3MRFA 4J3OF 3VD4A 1NFAA 1NC4A 2VLRE 3C12A 2YR3A 4JFFE 5AL8A 2VR8A 4G11A 1H3WM 2XTJC 4R7NA 4F33B 3CFBA 1B2WL 5FECA 4NKIL 9CGTA 5E6IA 3VH8B 2XKSA 5CWSA 5E7FA 3NZHL 4Q8BA 4BCYA 1V54B 2BK8A 2DQFA 1XIWB 2V9UA 4N3UA 2QPSA 3D52A 1V7MH 1BVLA 3L1EA 4P9HH 1KULA 2BS9A 3HZMB 2Q8BH 3APDA 5KVEE 4GXFA 3NSCA 4N5EC 4Q6KA 1H9DA 3BZDA 2YLKA 2BDNH 1JK9B 4Y19A 3KPRE 3HRZC 1TR7A 3GMMA 4ODHH 1WDAA 1TTCA 1HOEA 4L8CA 1THCA 4HUUA 3UTQB 1N70A 1CE1L 1OF2A 1PFCA 3H54A 3O3AA 3DGCR 5JIIA 3FFDA 2P8PB 1S9YA 1GYWA 2TSBA 4O5LH 5IB4B 4N5ED 4NI6A 1OARH 3QR2A 1NJ9A 4FQ2L 4OT1H 2I9TB 1CWVA 3D06A 3HNSH 2R1WB 1CF8L 1MJ7L 1TKWA 4QRRE 2UWEE 4GAGL 5HY9B 3FW6A 3NSDA 3RIKA 1EXHA 1Z1WA 3OGOE 4QXUL 4AT6B 2EAEA 1W2KT 3UTTA 1EGJH 2IPTH 3CDCA 3DX9B 1HSAA 5KBPA 5LGKA 2CKBA 4JY4B 1U2HA 4KQ4L 3QUYA 2FEJA 1LNUB 2JI2A 2XBDA 2Z0UA 3WKNA 3TBCA 4TLSA 2Y24A 4YFLF 4N2MA 4TVPL 2H2PC 2ZXBA 3EF7A 4BHUI 4ZFFB 4BHUA 4NQVA 4J23A 3SCMA 3QO0B 1JNHB 1NOLA 1S2EA 1UVQA 3I6GB 3A4FA 2HVKA 3GC3A 3VRLE 4X6CE 4H8VA 2FHCA 3GSOA 2O61B 3KH4A 1NDGA 1U93B 1CU4H 1BHGA 4LCWD 2EILB 4LBEB 3FZUC 1FPTH 4ZFOB 3W5NA 1A6AA 3T0VA 2ZJSH 1A3RH 1JAEA 5B22A 3LRHA 4HDIB 2YKLH 2H2PD 3S37L 3WIAA 4ZUSB 2ZD0A 5J6SA 4ZMAT 5E6SB 3FTWA 3ZKXB 2MQ3A 2D7PA 4WO0A 5AVYB 3TIDB 1RK0B 2R8SL 2Z93B 4ZUVA 1T21A 5K9OA 4AYDC 4KMTH 3FZUD 1P4LB 4ZDHB 3VFRA 5C71A 2W9EH 2OSXA 1JFHA 4JPVL 2FH8A 4WV1B 1DBML 3MFGB 4G3YH 3IXTB 2DZEA 4QI3A 3SOBH 4C56B 2F54B 2ZQKA 3B2XA 4LNRA 4FFYL 3K5SA 4KZCA 2NUPA 1TZIB 4IRJC 3UPCA 4FA7B 3MRCB 1C5CL 1N5YL 3L1FA 4IOFD 5DJCA 4M02A 3U6RA 3BH4A 4HG4J 4L4VA 4FADA 5FO8B 1UOKA 5D7LD 4S0TD 5ITFA 3QS2A 5HI4C 3GI9H 1TZ8A 3OKDA 5J06A 2BINA 2MKWA 2X0WA 3BRFA 1QZNA 3APMA 4N26A 5CLTA 4EKJA 1B0GA 1WUZA 1S9KC 3ZRCC 2OJEA 4AEHH 1F6AA 3X3FH 1U8LA 3QQ9C 1NA8A 5I1IH 5E4IA 3CZKA 1EAPA 1H9VA 1XGQB 1OZTG 2FCBA 4KKRA 3T3MF 3D3VE 4MNQE 1DANU 2HT2C 1AHWB 2HX7A 5D8JH 4UZSA 2IH1B 1Z2KA 3C6LB 4R6UA 2MHAB 4K15A 4WNJA 1QBAA 2R0LL 4ZO6A 4LOUD 2HXAA 2VKXA 3U46B 3B9EA 4P07A 3HMXH 5BOJA 3V2AR 3CC1A 1P69B 5FUOH 4HULB 5JLZA 1BPVA 1SQMA 1GZPA 2NDFA 1KTJA 2QELA 3UTZA 1G1OA 3VXME 3WNNA 1PZ5A 3O6FA 4WFEE 3GZKA 3T2PA 1RJCA 3QQ9D 4HU2A 1SBSL 1C7TA 2QLVB 5CKGA 5KVGH 1KTCA 2OL3B 3QDMB 3UFIA 1O6VA 3CFKB 4Y2OA 1K72A 4K3EH 3FUEA 4N85A 4HKZB 3OB0H 4N0YL 4YZFF 5AALA 2EXYC 3P9MA 1JFQL 4AZ8A 3IGLA 5E6YA 2VMEA 2D7MA 4P23C 2G0KA 5DHVH 1F4HA 1PU0A 5AOKA 5GS3A 2P24A 2B2XL 1HYRC 3ZMEA 1AG6A 1HCVA 2J72A 1NC2D 4OZHE 3NCYS 4M61B 2VISA 4Y4KA 1OAKH 1S7WA 3OMZA 5EIVA 3VG9B 2HPOA 2UY6B 1HVXA 2H32B 1B4JH 4MD0A 3FU7B 2A74C 2WWOA 1KLFA 4PRDB 1TNNA 4O2FA 3WJJA 3G5YB 4N6RB 1IC7H 3TASA 1SJVA 1ACXA 1D9KA 2DEWX 3DVIA 43CAB 3K71A 4LQFH 2IMMA 2VDKL 5D1QC 3L17A 2BP3A 3UBFA 3G04A 5CS7A 4B9CA 4E9SA 5I8EA 4Z3JA 1CN4A 1JWMA 2F5BL 4LCWB 2HMIC 3MRMA 1VACB 4NO2B 2HJFB 5DJDA 1WZ1L 2PCFA 1A6WH 3TO4A 3DXAD 4NUMA 4PJEF 1UM6L 2WXMA 2IANE 3L7FB 4H8PA 4LPCA 3A6CL 1VERA 4CKQA 4ZW3A 1JZDC 2ICEB 3T4YB 5E1IA 4NJ9L 4HS6A 4PJXF 1Z5LB 2C9AA 4QJ3B 5D1QD 1XZWA 1BFOB 3PP4L 2BVPA 4DH2A 2A9CA 2VWEC 4XPHL 3FYIB 2EIZA 3CFUA 1S9XB 4PJBB 3VFGH 2K9FB 4FG6C 5J0BA 1FYTE 4WO4A 3L3JB 2GJJA 4NKMA 5E1GA 2J57A 4AMKH 5G5DB 3V0DA 1ZLUK 3UIYA 2R56H 2IGTA 2BH0A 3QIUC 1OANA 1JK8A 2HX8A 2L7JA 4HHWA 4IQHA 5EC1B 3U30C 4ESKA 3FB8A 4PW9A 2WLJA 3ILPA 3QDHA 4ENEC 3Q13A 3B3IB 2Z9TA 3NCJH 4H1LA 3KLHC 1U92A 5J9PA 3MJGX 1CBVL 1A6VL 1QEWA 1UC6A 1ZTMA 1T89A 4FYTA 2WNXA 5LDUA 5DDHB 4WU7B 3BPLC 3QFJE 4IRZA 2CGYA 4YS4A 3MYJB 3KYMB 5KJ4A 3QIBC 3MLZH 2J5LC 1ZAGA 2XCMC 3JV4B 3QH3B 4XO3A 1CQYA 4J7RA 4Z8FL 4O9HH 3K2MC 1YYLH 1SXSA 3JWNE 2G2RB 2AZAA 1JRHH 3A6BH 3EGSA 4HCFA 2ERJC 1U8PA 4TQEL 1II4E 1T83A 4JLRA 4GAYB 4MMXA 1Z0MA 2F53B 3MOAL 3VFPA 4ZD3H 2DL9A 4OJYA 1IO4C 1RK1B 4ONFL 3SQBB 2GTWA 4Y2DA 4JHAH 1SLWA 2ROXA 2EDOA 4HHAB 5DC4B 5IJKA 4NXSA 4X9IA 5F0LB 1MWAL 4YDIH 2CLZB 1A4JA 2IOOA 5DYOB 1I7RB 2HZHA 3TTYA 1F1GA 2XYBA 4HBQA 5D2LF 2GJ6A 4EI0A 3C6SA 1U8HA 1U3NA 4HH8A 2HB0A 5J13C 2H6UA 2VN6A 4HS8L 4M7LL 1HH9B 4JFED 4NIYE 1NL0H 1HQRB 4RMVA 3T9WA 1SHXA 3ZK0A 4WWOA 1FO0H 4H4NA 1D5ZA 2EADA 1CYXA 2K6WA 4Q14A 4KJYA 4NM8H 1XVSA 3G5ZB 4BZ1H 5F1OB 1IUZA 1K5NB 1P9MC 1VDGA 4FNRA 3G9AB 1I9RH 2HRLA 1OGTB 2XRAH 3LZFH 2A73A 3ECQA 1LWRA 1HH6B 4ZW5A 4M93C 2KC0A 35C8L 3P3RA 2L8AA 1F13A 3GRGA 1RZKH 4KI5C 5T33H 5A2IH 4R9HA 4Z7QE 1PDKA 1ZVHA 4JFOB 1NC2B 1JPTH 4R8WH 3IFOB 1F3RB 3UCQA 3JZYA 5IBUB 5MERB 2RD0A 5B7MA 4DW2L 3SBRA 5JYMA 2FLRT 4HF5L 2F8IA 3L2NA 3EOYG 5E2TL 2JQMA 5MEND 1LTXA 4P2OA 2R1YB 1LP9B 2OMVA 2WXGA 2KH2B 1MCDA 1CE6B 4I9WD 5GRJH 4ZMOA 3G6DL 4X5XA 2VDOL 1ACZA 2CO7B 3MA9H 3MSPA 4FXLA 4R3SA 4JGUA 3W9EB 4GUPA 2FL5B 4OLUH 4P5MA 5EBLB 5BPPA 4EN3A 3AGVA 3DMMB 1SMAA 4NPYA 4OQTH 5D2NB 3BH8B 3BDYL 5EU6D 1GYVA 4LSUL 3M07A 3WMPA 4NQCA 1BZ9B 3HAEG 4MTMA 4R0LB 3DXAB 4FERA 3DJRA 1P4BH 2C8NA 3DJTA 4FCAA 2E7LC 2A6KB 2EO9A 3CE1A 1GJIA 4GB9A 5E9DA 1E4KA 2PR4H 4KGLA 3U9UB 1N2RB 1U3HC 5TDNB 4KTDH 4PJGB 2R2EA 3P9LB 2OSWA 3DECA 2EE0A 1KLUB 1U8JB 5DA4A 1MI5E 1EZVY 4JB9L 4ZUUA 2ARWA 4XODA 3QORD 5GRZA 2NNAB 3QI9B 4J12A 1HYSC 2WZ6A 1Q8MA 3C60A 4OD2A 3LNEA 2F8XC 4BCXA 3L54A 1BFVH 3ARBB 1QABA 4I5BA 3RL2B 2G2NA 1DBBH 1ORQB 4TOYL 5KTEL 1KC5H 4XNDA 3PXHA 5BV7B 4JM2F 2A6DB 4ZXBC 2ADIA 1U3HD 4Q9RL 3FULA 3PG2A 3BC9A 1KLGA 4IM8A 2XT1B 5C3LD 3V4VB 1YN6A 5B39B 1CI5A 1P0SE 3B7UX 1UH3A 1HYSD 1GHFL 2N01B 3VXUE 4BJLA 5GGVH 5CGYC 4JAMB 3MU3A 2J1YA