1K68A

Crystal structure of the phosphorylated cyanobacterial phytochrome response regulator rcpa
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
140
structure length
139
Chain Sequence
AHKKIFLVEDNKADIRLIQEALANSTVPHEVVTVRDGMEAMAYLRQEGEYANASRPDLILLLNLPKKDGREVLAEIKSDPTLKRIPVVVLSTSINEDDIFHSYDLHVNCYITKSANLSQLFQIVKGIEEFWLSTATLPS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structures of two cyanobacterial response regulators in apo- and phosphorylated form reveal a novel dimerization motif of phytochrome-associated response regulators
pubmed doi rcsb
source organism Tolypothrix sp. pcc 7601
molecule tags Signaling protein
molecule keywords Phytochrome Response Regulator RcpA
total genus 46
structure length 139
sequence length 140
chains with identical sequence B
ec nomenclature
pdb deposition date 2001-10-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00072 Response_reg Response regulator receiver domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1k68A00
3LUFA 1F4VA 3JY6A 3OLXA 1Z16A 4HNQA 4RS3A 2L19A 4RZSA 5DGCA 3RQIA 5JNWA 1AB5A 3A0RB 4QYMA 3H5IA 4KRFA 2JBAB 2QVGA 4RK5A 1NXWA 3OM0A 1GUDA 4KVFA 4IMIB 4UHKA 5EWLB 1JDPA 3G85A 3HUUA 3K9CA 4NICA 4W5NA 4MQEA 2B4AA 1DRJA 3A3KA 5BRJA 2PUEA 2PUAA 4PICA 4XXHA 3H75A 4MRMB 4TLLB 3KCNA 3HK2A 3IPCA 3H5VA 3T38A 4RSMA 5CNKA 2L18A 2A9OA 2LIVA 3QEMB 1K66A 3RVKA 1TMYA 2J48A 1EHCA 3QEKA 4OG2A 3OO0A 5KC9A 4WT7A 4MAAA 4O1IA 1LBIA 1LK0A 1QO0D 2QVCA 5C5CA 5DTEA 3Q7RA 2GWRA 1A0OA 3H5TA 1TLFA 4S04A 2R47A 3HZHA 4RY0A 5BRAA 1JFTA 2R48A 3ROTA 1P2FA 1SXGA 4EYKA 5EWJB 1VPWA 5I4CA 2QXYA 3R0JA 1C4WA 1Z2EA 2DRIA 3BRQA 1BDHA 4PEVA 1Z25A 1D5WA 4QICA 9ABPA 4F12A 2FXIA 3QLVA 2FSPA 2R25B 3QELB 3DLBA 4G0XA 4YV7A 3GL9A 4KFCA 3CHYA 4M88A 1A2OA 1J56A 1ZDMA 3H5OA 2WY2D 1Z15A 3RVRA 2MSKA 3OMWA 4HYEA 2FN9A 1VKRA 3A10A 5ED4A 2W42A 3F6CA 1KMIY 5KQLA 3QELA 1MIHA 3O1JC 4FB4A 5C5EA 2P4UA 3IP5A 1BDIA 3B2NA 3IP7A 4JB0A 5JS1A 1UDRA 3RH0A 3EAFA 1ABFA 1ZESA 3Q41A 4W5RA 1ZH4A 1Z2DA 1NATA 1DBWA 3JPYA 1U8TA 3URMA 1JYFA 1F51E 2JRLA 4JASB 1EWKA 3DBIA 1YIOA 3FFWA 3GT7A 2MYPA 3O21A 3SAJA 5CNJA 3N0XA 1EWVA 4KPYA 5TE9A 5EWJA 5IUJC 1LJLA 1QNLA 2PL1A 1P6QA 2QR3A 4IRXA 4Z4GA 3TMYA 3HXMA 3KYJB 3RVJA 5CNMA 3NHZA 1JH9A 1ZH2A 5BQ3A 2RGYA 4TMYA 4Z4FA 3OM1A 4WZZA 2PL9A 4MR7B 4O1HA 5TPWA 2L2QA 3EODA 4MS4B 5B3JC 4QYWA 5FWYB 1W9HA 3I42A 3I09A 1MB3A 2IPLA 4G0QA 2WJAA 1KGSA 4RK6A 4G0OA 3JPWA 5BR1A 1M5TA 5IUNC 3HO1A 4Z99A 4N47A 4H3HB 2PMCA 1QPZA 4LE1A 3FMVA 2AYZA 3M6MD 1ISSA 3SM9A 1T34A 2FMIA 4ETIA 3OQOA 2PUGA 4N41A 2E4WA 4YWHA 4Z4CA 1CYEA 4ZPJA 4KZKA 3UKJA 2ZWMA 2LP4Y 1NXSA 4JAVC 4EGSA 3RVMA 4KQ9A 1QP7A 2XDYA 4ETMA 1NY5A 2WMYA 3VNBA 3HUTA 2RJOA 3DLHA 4MQFB 5KWSA 4MYRA 3H6GA 4LDAA 4L85A 5FBHA 1QO0A 4NCAA 4LZLA 1JHZA 4G0MA 3UK0A 2VUHB 2NUBA 2E4ZA 3OLVA 2PJUA 3O75A 2JCGA 4S05A 5FWXB 2F8SA 1PNRA 3KJXA 4N03A 1U2PA 1TM2A 4RDCA 4E7OA 1JLKA 4ZJPA 5ABPA 5TPZA 2E4VA 4N0QA 5EWLA 3MMNA 3C3KA 3MM4A 1VRVA 1DCFA 1A04A 1DC8A 3C97A 3M9WA 2CD7A 2FLWA 1MB0A 3JVIA 3RVSA 7ABPA 3NNSA 4TN5A 3KHTA 2X7XA 4MS3B 1ZGZA 1DRKA 5TPZD 1C0EA 2TMYA 1U04A 5E3JA 1JFSA 1QQBA 5JNUA 3CFYA 1I3CA 1RXIA 1M5UA 1WETA 1PUXA 3JTEA 3UUGA 2CHFA 1APBA 4RXTA 1URPA 2GKGA 4NV3A 3HDVA 3E61A 3Q15C 4XASA 1FFGA 4Q6WA 5FBKA 5JNVA 4HNSA 3FFTA 3Q7TA 2CHEA 2ID7A 3LTEA 4YS6A 2NT4A 5EWMA 2HQOA 3QLVC 4EYQA 4ML3A 3D8UA 2H0AA 4JOQA 4MLCA 3LUCA 2L17A 2FEPA 1QP4A 1ZGGA 3L6UA 3BREA 3KS9A 1KRXA 2KYRA 3O1IC 2QV0A 2QU7A 1XHFA 1JYEA 1YK0A 4OTZA 3ROFA 3TX6A 1EFAA 2FEWB 5IBQA 1E6LA 3FGZA 3I45A 3NBMA 4MR9B 4RY9A 4WUTA 5HM6A 1JWLA 6CHYA 5JNRA 4LE0A 5IEBA 1RNLA 4RXUA 3CRNA 3EQ2A 4G0ZA 2PUDA 4RY8A 4F11A 3SNKA 5PNTA 3H1GA 4N76A 2IOYA 4QPJC 3O2JA 3FFXA 3EULA 3C6QA 1BDJA 3JVDA 3CZ5A 2FQYA 3D02A 4MR9A 4OATA 1U2QA 4RK4A 3T6KA 1DP4A 4F3TA 3LOPA 1DBPA 3N0WA 1DBQA 3GYBA 5IULC 2F8TA 3QLTA 2JK1A 3LUAA 2AYXA 3SQNA 2MYTA 1NXVA 2GX6A 3CG0A 3HDGA 5TQ2A 4XLTA 2M1ZA 3OLZA 1SXHA 2YHAA 3KTOA 3CNBA 2JB9A 1USKA 3G1WA 4NQRA 5CHYA 4Z9BA 3RVPA 4EYGA 3OQNA 3O1HB 3QLUC 1XWWA 4MR7A 4RK1A 5T7BA 3BBLA 4MS4A 5B3JA 3H1EA 3EDCA 4EUKA 5FWYA 1PNTA 1PEAA 1SXIA 3HS3A 5IEJA 3N8IA 2PUCA 1HEYA 4GNRA 1D1QA 2MSWA 3ILYA 4B09A 2FVYA 2QZJA 5KC8A 4Z4EA 4Z9AA 1JFVA 3HCWA 3T95A 5KI6A 3LUGA 4Q7EA 4YP9A 2NZVG 1GUBA 5JNTA 4YR7A 2FTKE 1QMPA 1TJYA 2MYNA 2R4QA 3K4HA 4Y9TA 3S99A 2OQRA 3CG4A 1NTRA 3LMKA 4RV5A 1RZRA 4Z4IA 2VK2A 4IILA 1B00A 5DLEA 1TVMA 4XARA 1MVOA 1ZN2A 3IP6A 3H5LA 3SY8A 1VLZA 2FMKA 2LUOA 3LKVA 1JDNA 4Z0NA 5TQ0B 3F73A 2CWDA 3EQZA 1R8JA 4H60A 1KRWA 2YHBA 1U0SY 4W5QA 3N0RA 1SD5A 3RVQA 2FMHA 1DCMA 1YS7A 1P8AA 3KLNA 5IX8A 2A9PA 2A9RA 1OXKB 1GCGA 4EVRA 4KNYA 3LUDA 3NNDA 4W5OA 4GPAA 4RK0A 2FW0A 1CEYA 5HKOA 3LFTA 3RVNA 2WRZA 1NXTA 2E4YA 3NNNA 3Q9SA 1LBHA 3HVRA 2FMFA 3BILA 4KK4A 2HSGA 4YGXB 3HM9A 1L5YA 3LKBA 3TB6A 1EAYA 5CNIA 3QEMA 3DZDA 4IMJB 4G86A 5IC5A 1JF8A 2HQBA 2H3HA 2OENG 3MIZA 4Q6BA 4YCSA 4D6XA 1QP0A 1XHEA 2JVKA 1ZAYA 4DQDA 3C3MA 3LUKA 2WWVD 2A9QA 1PHRA 3CU5A 3NHMA 2FN8A 5TQ0A 3HV2A 1YS6A 4DN6A 3ILHA 1Z18A 3FDFA 4FE7A 2IPMA 4MQFA 4CBVA 4RU1A 4WWHA 3T8YA 5DCLA 2BGGA 1YTUA 1ZHHA 4MS1B 2Q5CA 1PEYA 3EJWA 3OLWA 4IF4A 4KMRA 4ZMRA 4RK7A 3N6VA 4L4UA 4RKRA 2V0NA 3DGEC 3TD9A 2PUFA 1BVHA 3P9YA 4KQCA 3F6PA 4P1ZA 3GBPA 2ZAYA 2GI4A 5EWMB 3VNAA 2IPNA 4EVSA 3RVOA 2FKAA 4ZMSA 1ZY2A 3HSYA 4NCBA 4JP1A 5DKFA 1CHNA 3O2SB 2IDMA 3IDOA 3BRSA 5F64A 3JS5A 4F06A 1BAPA 5TPWB 1JBEA 1GLGA 2E4UA 4HNRA 3QK7A 3HJFA 1JX6A 4TLMB 2FEKA 2QW1A 4LRQA 3LUHA 4MQEB 1P6UA 3CKMA 2FQWA 3DGFC 4DADA 2RDMA 5JNSA 2O20A 1FQWA 4D74A 4N0PA 1QKKA 4G0PA 4MRMA 4OBBA 3QX8A 3O74A 3QLUA 3OLYA 4RXMA 1YVUA 4H3KB 1USIA 1MAVA 2PKXA 4YO7A 3CZCA 4ZYLA 1RZRD 1ZVVA 2I6FA 2JVIA 4KV7A 4LX8A 1YMUA 5D2CA 4Z4HA 3MA0A 1Z13A 4WXMA 3GWGA 2PUBA 1OXBB 3IPAA 4P98A 1H9CA 3KKEA 1DC7A 4PE5B 2LBPA 3CS3A 2ID9A 4MR8A 4KREA 1BA2A 3Q7SA 5FWXA 3W9SA 3O2QB 3QX9A 3RVLA 3MQ4A 1LJUA 1Z12A 1D1PA 1NXPA 3OO1A 5JS2A 3H5WA 3KG2A 3HEBA 1DJMA 1FSPA 4KK3A 2HPHA 1L5ZA 1ABEA 1RXEA 3C3WA 3KLOA 4PYRA 4F8JA 1ISRA 2WJWA 3MF4A 1ZITA 4JA2A 5HSGA 3A0UA 2PLNA 1GCAA 4MS1A 4E7PA 4IGAA 3M9XA 3H6HA 1NXXA 2JBAA 2P9HA 5IUKC 1DG9A 3CLKA 4PZ0A 1Z17A 2IKSA 3MYYA 2VYCA 3TO5A 1E2BA 1AB6A 2JVJA 4EYOA 2IPAB 5KQPA 1USGA 1Y1LA 4G0YA 4LDZA 5T3YA 3OMXA 4YLEA 2HQRA 2RJNA 4UHJA 4W5TA 1RPJA 4MPTA 1IIBA 4MGEA 2FQXA 2MSLA 2NZUG 3N53A 4MR8B 5GOTA 3EGCA 3CTPA 2WB4A 4RKQA 2LPMA 4WXEA 1JL3A 2N9UA 2IYNA 1DZ3A 1NXOA 4XFKA 4MLDA 1M2EA 4RWEA 1QQAA 4MS3A 3OQMA 2PAFA 3LUJA 1Z26A 1E6MA 5TQ2B 1K68A 3H1FA 4D6YA 2HJ9A 4FE4A 2E4XA 5KQGA 2PE5A 3IP9A 3GA5A 1SRRA 3KYIB 1S8NA 6ABPA 3KSMA 4LE2A 1YMVA 3GRCA 3GV0A 3I5AA 4XAQA 4ETNA 4YRZA 2QSJA 4EY3A 8ABPA 2B1JA 1DCKA 5TQJA 4EVQA 2NT3A 3N75A 4OLBA 2M98A 3F7NA 3GBVA 2FLKA 1W25A 5GQSA 2GBPA 3L49A 1FFSA 2MYUA 4OLAA 4G97A 1E6KA 1YK1A 5HQJA 1M2FA 3SG0A 4JB2A 1EWTA 3E3MA 1D2AA 1FFWA 5KQMA 2VUIB 1D4ZA 4O5AA
chains in the Genus database with same CATH superfamily
2GBGA 3HBMA 1KEWA 4CT4B 3LUFA 2A7QA 3BHJA 3VR6A 2HHHB 4UVGA 2BM0A 1GEEA 1OA1A 5E2AA 1BZYA 3TRFA 1SBCA 1YB5A 3L05A 4LZZA 4A91A 4ZCIA 2UZAA 2D1SA 2AMVA 3RVBA 1Z8FA 3OSUA 4ZI7F 1UBKS 2W83A 4LYHA 3SIWA 4HDQB 3GJRA 4F8YA 3O8CA 1N2SA 3D2BA 1RQPA 3A3KA 1XXLA 2D1TA 1ZOLA 5KYKA 3UMYA 3BTOA 3P97A 4GQIA 4IWXA 5LYJF 3DOJA 4TGLA 4RSMA 4EHDA 3QBTA 1XR3A 5CA1F 4UAGA 2XT0A 4N39A 1I5OA 5B2FA 1HYGA 1YRLA 1SJ9A 2XIJA 4L6IA 4EG6A 2PX4A 3Q87B 1UK9A 1IATA 1DWPA 4P93A 2Q5IA 2GWRA 3BWYA 4RPGA 5DTEA 4F72A 1EWQA 2H7YA 4G81A 4O1MA 1KEEB 3HZHA 1ULUA 4LXHA 4PTZA 3QBVA 3ZVLA 3HUFA 3UW3A 2B20A 5J4LA 1H4VB 3NW9A 1COZA 2G5TA 5EJEA 1TZKA 1NT4A 1P5RA 2OOKA 1RRFA 1YC5A 2X9GA 2EC5A 4HHEA 3ZU6A 4EHAA 9ABPA 1PV4A 1STOA 4ZEVA 1OI2A 4PGMA 4QKQA 1VPDA 1FDRA 1JQLB 2Q6VA 2REBA 3DTVA 3L07A 4K7JA 4LN1A 4J0FA 1YS1X 1SELA 2K4MA 2Y0PA 4G9GA 4O63O 3R7FA 4M8SA 4RDXA 5ECYA 1HSZA 4BQOA 1UDAA 3VVMA 2Y1WA 1A4RA 3ODPA 4JBWA 3U7IA 4C4SA 4KH0A 4JI2B 1O03A 4BP1A 5AVQA 4INPA 3GLFA 5FKJA 2BZ0A 1F8FA 1QG4A 1ZEMA 3RS0A 1ICEA 4WK0B 1PYDA 1ND5A 1ZH0A 2DHRA 4XCXA 4IWYA 2G80A 2J0VA 3DZKA 4QA9A 1ACMA 2FZWA 1TQDA 2EW1A 2X0IA 4FFPA 4ZO8A 1YQWA 1HLGA 1MC8A 2ALJA 2VCEA 2JFQA 1C9DB 1EFCA 1MX9A 1QYWA 3FJOA 3QVTA 4Q4AB 4EECA 2IOFA 4AO8A 5KDOA 3N8NA 5HKKD 1W93A 1Y1PA 2LD4A 2XYQA 1TU4A 3KUKA 3MELA 5LR6A 3SZOA 2HC9A 4OUDB 3RIHA 2XCSB 2DFLA 2V7VA 4RMNA 3VU0A 3QUSA 1OWNA 1ISMA 4WZZA 4MR7B 5A2GA 3KSBC 2XA9A 3L5OA 4HSGA 3ZWPA 1C8LA 1FVOA 1XQ9A 3I09A 4WVLA 3RSQA 4KBGA 3RC9A 1MOSA 4HJXA 3PXDA 1I3KA 1XYGA 2XY4A 2ZT7A 1VFPA 1WNTA 1L1EA 3WIDA 2QE6A 4BB9A 2R6CA 1FXWA 2XTMA 3B1ZA 3M6MD 1KJQA 1T0JB 1YU6A 3IE0A 2HFJA 5D3KA 2QMOA 5FRDA 3RHSA 2ZS9A 4Q47A 2WMNB 1ZHOA 1GSIA 5HCUA 3DEYX 3TMKA 5T67A 3GGDA 2QTGA 4LC9A 4LPKA 2JA1A 3FUTA 1Q84A 1QP7A 4ZAFA 1DWQA 5CB4B 2BFCA 2GHIA 3N5KA 4LGVA 5G0TA 1X13A 4LHSA 4BMYA 5LN1A 2FK7A 4MQFB 3U3MA 2XB8A 1W4ZA 4RGVA 1IXRC 2ZJYA 1QX3A 1DIGA 1YZHA 1EBBA 1YD7A 2H1LA 2WUVA 2ZIZA 3H1PA 3PPIA 3PNLA 2R2GA 1I30A 1NBMA 2CW5A 1FDTA 1R50A 4WADA 2F8SA 3T0GA 1KMMA 2CLFB 3AO0B 2XUIA 2ZRBA 3THRA 5GINE 4NFLA 3QVLA 4P7FA 1W96A 2Q6KA 2IP4A 2X2FA 4N0QA 1S96A 4TROA 4Y7CA 4BNKA 4UNIA 3H2JA 3QJYA 4C0KA 4CMEA 1EP3B 3PWKA 2NZ8A 1SH7A 4XR9A 3C97A 4KNVA 2GXUA 2FW8A 3EGXB 3Q7PA 4F1JA 3IE1A 1JDTA 1U02A 2PV7A 2WKQA 4UQOA 3GBSA 3O26A 3RYCA 2EZTA 5BY2A 1CW2B 1G6HA 3JD0A 3KSDO 3LPDA 5AVYA 2TMYA 2VZEA 2WHPA 1NMZA 1JVBA 4ME6A 4QRHA 3ROPA 2RBKA 3O8DA 4JV5B 4XJVA 3UUGA 3W2FA 5LM3A 2GPNA 5K5EA 2VK4A 5JMWA 4WLNA 1FLAA 3RRFA 1URPA 2AH5A 3EFBA 3RTDA 4FEAA 2ECOA 1P7YA 5FBKA 1SULA 3E7FA 1MC4A 3DSRA 2VT2A 3IC5A 3L7IA 1DBVO 3Q3CA 4KXLA 4ZOCA 3NONA 4LOHA 4O2BA 1NNSA 1R74A 3QFCA 4EUHA 3R8FA 1XMOB 1L9XA 4L50A 4ML3A 3D8UA 1B41A 1OYYA 1QYIA 1CUHA 2G8LA 2R4TA 4JWKA 4WERA 1W46A 1MAHA 4G8BA 1VCMA 4MQBA 2CF5A 3IBCA 4IDQA 2X9VA 5AW2A 4QXMA 4LZJA 1JYEA 1YA8A 4EG8A 1IULA 1WNFA 2V8OA 3AG6A 4HYTA 2BM9A 5A04A 5CCEA 4MWOA 5EN4A 3R5FA 3RUFA 3COYA 3ICQB 1N25A 1QOPB 3F9CA 2I8CA 4FOPA 4EG4A 4KDCA 3DFKA 3SFZA 2XE7A 5AICA 1PZFA 3KK0A 3FVTA 4HGRA 4IDOA 1GQSA 4F11A 1EDZA 3DS8A 4I3HA 5IXSA 4JOBA 1UINA 4XM2A 1IUPA 5B3AA 2FQYA 4YCAA 4ZVRA 1FYFA 4DZRA 4DWVA 1BFUA 1KVSA 3AKEA 2VDKB 3GYBA 2V98A 4TWZA 1CJTC 5ICFA 3M6VA 2QJOA 4Y2GA 5JWHA 4DBLC 4C01A 4E5YA 4L95C 5J1TB 3CX3A 3EDMA 3UKOA 1SMKA 1SQ0A 3AUUA 1M1NB 3L0YA 4X1YB 1UBGA 3SJUA 1E1DA 4Q01A 4QULA 5JAQA 1XNJA 2IYRA 1VI6A 2RI1A 4Z9BA 4EYGA 3Q8XB 4KVAA 3FRJA 2ZB3A 3PTZA 4DIKA 2JDID 3ECAA 1HTBA 1E79D 1YNOA 5T4FA 3V34A 3C14C 2PGOA 5A5GA 1TYCA 3INNA 1HEYA 2O1WA 4HQ6A 4XGKA 1Z4KA 1Z2CA 3UK1A 3R76A 3ER6A 1XZKA 2JFVA 1SCBA 2H1WA 2W6OA 2WM8A 3L0ZA 5LJLA 5LIRA 2DKOA 4DLZA 1UXKA 3GN1A 2VLIA 4D25A 4ZO6A 3V5NA 1E7RA 5H3HA 3K6SB 4MITA 1XPOA 4V3CA 4R0VA 1PGNA 2PSEA 4TLDA 5JDIC 3K4HA 2VPTA 3EZ6A 3H99A 4LSMA 5HS6A 3WLPA 5KTKA 1NBMD 4F5ZA 1XJ5A 1XTUA 1IN1A 1H65A 4OU4A 1QR6A 3P71T 1AK1A 1J49A 2VUTA 2BKLA 3AJAA 1M54A 2H4FA 4BGDA 1GKYA 1BOOA 2C7GA 3QVWA 4PV7A 1MVOA 5HCIA 4F3CA 2JZCA 3PFHA 1FLNA 2VDJA 3MWEA 4B75A 4DJAA 1VJ1A 1PJQA 2FMKA 2WMOB 1U0EA 3N5CA 2QLFA 3TUIC 4C3ZA 3F73A 3K9FC 4HTFA 3MD0A 1AT1A 2J5QA 3ZKWA 1WB5A 1ZUNA 1RTTA 4WDRA 1UC8A 3LQQA 3L7JA 3R9XB 3N05A 2WTUA 4Y2QA 3IQEA 1J1IA 1VLVA 5KHOC 3K70D 1ZN7A 4MTLA 1XDZA 2HUPA 1BXGB 3TGPA 1G8HA 4PZEA 2CVFA 1YS7A 1UMBA 4Y6RA 2IEYA 1OT3A 4UOZA 2A9PA 3GP8A 4LYGA 4PZAA 3ZWAA 4REQA 4XIGS 3WLNA 2O8BA 2HEIA 1JXAA 3KRTA 4UAJA 3HYSA 2AN1A 4ZEXA 1GL6A 4U9UA 3FMIA 2ZYHA 4H17A 4LJYA 2XWJI 4BO5A 1WXEA 1NQ5A 4P82A 1THGA 1RC0A 5I5GA 3RAGA 1T29A 2DT8A 4LQCA 3WBKA 1HC7A 3EK2A 5DPMA 1V6AA 1XZQA 2HJGA 4KK4A 3WRWA 2VOJA 5MN5A 2P2GA 4CDMA 4NPHA 5JPDA 2QQEA 3O8OA 4R6WA 5CNIA 2V4UA 3T99A 4UUBA 3HJBA 1DKRA 1MCZA 3D7KA 4IWNA 1XU7A 3IQXA 3ZCTA 4HEA1 3BB4A 5ERYA 1LDNA 3UG7A 2JASA 4PX3A 5BN3B 4JBNA 1PHRA 4A92A 4HWKA 3PQEA 2H92A 1K7SN 2SHKA 2XVZA 3L7KA 5TJ9A 3FGOA 3FOFC 1E9AA 3D4BA 2HBZA 1Z18A 3MD9A 4HZGA 5TF4A 1S2MA 4B3RB 4GIBA 4J16A 1Y0BA 4MQFA 3TCNA 1OBHA 4Q19A 4CBVA 4ESVA 1NPDA 1T5HX 4RVOA 4WV3A 5DCLA 2OORA 2J07A 2Z1MA 1U4SA 1Y7TA 2MMGA 4LZOA 4M0FA 3ENQA 4LCBA 3NATA 3AW8A 3NDBB 1JW9B 5D7BA 3G2OA 5BR7A 4CDGA 4LDQA 3OJXA 3OOHA 1WULS 3KYDA 5HUQA 4JB3A 2LCIA 4QFDA 4UNQA 1KJWA 4KMRA 1EHYA 1P61B 1Y4AE 5J58A 1FLDA 5FWDA 1EUDB 1HKHA 2H65A 3DULA 1AKTA 1JDVA 2YZGA 3MJ4A 4HNGA 4NIMA 1A9SA 1RP7A 3H9CA 3LFHA 1DOAA 3MS2A 2C2MA 3ZW7A 4JP1A 4JUCA 2G9NA 3N7TA 1CEXA 1ZO8A 5TARA 3FJYA 3IJPA 1C3JA 4RPJA 3TEMA 2XPCA 1TO1E 3MQFA 5L3QA 1GLGA 3OCCA 1FU4A 1CXZA 1BNCA 3S7TA 4Q39A 2UYOA 2FWRA 3U7FB 3ZS9A 4JQZA 5CFRA 1P7CA 1AMUA 2QLBA 4B5LA 4G0PA 4BLVA 4P80A 1AGXA 1O94C 1ZN9A 1U2TA 2VHXA 2EQAA 5L53A 4AN1A 1P1IA 3ADKA 1EXDA 2Q5LA 4CTNA 3QTLA 2P9TA 1G8YA 4URWR 5EQFA 3J7AC 1D2MA 3IIEA 4QUIA 1B15A 5ENVA 3OEWA 3PI7A 1IJBA 4BP3A 3AY3A 2QX4A 2VP2A 3VO2A 3L8YA 5DGTA 1QORA 4HYQA 4HB4A 1X92A 2JIQA 4YAEA 4C6HA 4DL9A 4EARA 4EUEA 1KYQA 3QV2A 2QYHA 1FLVA 1HRDA 4PHTA 4AJPA 1B1CA 3ODGA 3THWB 4JQCA 4R1MA 5KTMA 3RSFA 2GZHA 1GNSA 4MYUA 2DETA 2J9YB 4OCZA 4B32A 4J8PA 3QPWA 3QU5A 5T4EA 1DJMA 1DU4A 3KJGA 3DMHA 2PTGA 3GCWA 5JBQA 2FSUA 3GLIE 3ADCA 1WUIS 1O95A 1RXEA 5HKKA 3AM1A 2WLSA 3HCAA 4B2IA 4CKCB 1MH9A 3RSOA 1NUAA 1CBUA 1J8FA 3CUSA 3QV1A 3S2ZA 2CJPA 4A0HA 4OQQA 5DRTA 3A6FA 4GYWA 3QMWA 4WSOA 3UC5A 3ZGZA 2HXYA 2JBAA 5HIAA 5LDDC 5IUKC 2PT5A 1DG9A 3TUZC 1PR4A 4MUHA 5JZMA 3PYMA 3MINA 3VPSA 2VYCA 2LCFA 3KJIA 4FX2A 3W2EA 4NXMB 4IS2A 1N2OA 4FDMA 4Z3KA 1G2OA 1P4RA 4OIFA 4NCHA 1Y5RA 3GEDA 3T3NA 1HE1C 2X0JA 1PT7A 2WI8A 3GJ7A 4WXPA 1H2BA 1X77A 2FDRA 2G6BA 2J9FA 4G3XA 4WLEA 4YRJA 5B53A 4IJUA 5FBZA 5C31A 3NV9A 4TRRA 2CMHA 4J16C 2ZROA 2JI6A 4E6EA 1X86B 4Z9FA 4H7KA 3N53A 2OCPA 5JS8A 1YBVA 3AJ9A 3SBEA 5AVUA 3V9PA 1T5SA 2HZ7A 3DYBA 4L9AA 3V4ZA 1DZ3A 4ZPXA 2QI9F 1LY1A 2PIAA 3TOZA 4TS3A 4JENA 4QASA 2PZAA 1R12A 3HLYA 3WYBA 1MNAA 3OCUA 2X0FA 3QYFA 4O2LA 2HJ9A 3GC6A 2DHCA 4LHZA 4MQMA 4O29A 1LSOA 3CSDA 1PJ4A 3RARA 4R83A 1Z28A 3H97A 3NHYA 3GZNA 3UN1A 5HIMA 6ABPA 4J7UA 3KSMA 4NF2A 3VHLB 1J4AA 1E64A 1SQGA 2YIMA 3VX4A 1T3HA 4Z7NB 3A26A 4F4DA 1Z45A 4EY3A 5EJ7A 1S2NA 2WFLB 4X1IB 5AKGA 2WAYA 1YFKA 2I80A 1T2EA 1WCYA 4GHWA 4NI5A 3TOSA 5K99A 1QC5A 2OV8A 2FLKA 3LLCA 5GQSA 1SOWA 2F67A 1U7UA 2C83A 1N78A 4A16A 3CR3C 4FBMA 2QZ9A 3CIFA 5F7XA 2YWDA 3V1YA 4B3XA 2EQBA 3JVVA 2Q3BA 3PRYA 3ILXA 4Y2PA 1YQDA 5U1PA 1HT2E 3AEKB 4K1XA 3EXFB 2IZ6A 3HCWA 3ZWYA 4HUJA 2NZ2A 4QDOA 3PGMA 3T1NA 6LDHA 3GPDG 4P0TA 2TMKA 4REOA 1F4VA 1SVSA 1WWKA 2PZMA 4YRFA 4ZYWA 3PCRB 2W4QA 4C2BA 1CZOA 4HVCA 1JZSA 4UZEA 4DLPA 2C54A 3KR1A 1UM9A 3S6JA 5BMVB 1Z36A 3I83A 3RYHA 4GP7A 3GP5A 2XWPA 5AI0A 2B4AA 4TMXA 1DRWA 2G9VA 3VHRA 4Q9AA 4PICA 4F5WA 4P22A 2PUEA 1X15A 3PA6A 2WPDA 4MRMB 3GEBA 2N3ZA 2CYCA 4J7XA 3CIOA 4N3AA 1QGDA 4WOPA 4BHTA 2EV9A 3GLIA 3HK2A 4D5GA 1GJRA 1RZRD 1ZVVA 1F6DA 1IHYA 3MT0A 1M66A 1Q22A 2GJSA 2GZRA 3D8RA 1GRVA 1ZVKA 4MPRA 4QBGB 2PWZA 3WY9A 4WX2B 3OX4A 3VA7A 2VRNA 2ZIXB 1VHTA 4ZJYA 1QCCA 2PWAA 2R47A 1ZM9A 1DAGA 2R751 4HNAA 4R16A 4EJ6A 3KTAA 4PO3X 4H1WA 4JI7B 2CFTA 3NIBA 4D46A 3L1VA 3U4AA 1AKEA 1M2VB 2C88A 4BNTA 3R0JA 3DNFA 1G60A 4HK4A 5KVQA 4X8MA 3UJAA 2FUNB 1Z07A 1RS0A 1R3UA 1USUA 2G0AA 1XTIA 3M82A 3Q1KA 1BHQ1 3QTBA 3SBOA 3VO8A 4O4HA 1EVQA 1K6JA 4XD2A 2QBYA 1IH8A 3UXMA 2F1JA 1J56A 2ODNA 3G7SA 4IYJA 4IOJA 1V6SA 2DYKA 4OXKA 2OB2A 1E9BA 1YL6A 3O7WA 3LSTA 1Q17A 5G0UA 5J1SB 5I8ZA 2ZU0C 3GLTA 4B6QA 1TZJA 3L4JA 3MOSA 4MDYA 4W8OA 2DFNA 3LOUA 1W8DA 3QXHA 3KQOA 2VP5A 3IP5A 3O3NB 3PFKA 1VE3A 2P5TB 3ZZTA 4ZGGA 1MO6A 3A27A 5BSWA 1ONPA 4P58A 1XNQB 3JU3A 1J8YF 1P4GA 4YDRA 3RT9A 1DBWA 3MCUA 4G67A 3KELA 4X84A 3KYCB 3MT8A 3SF8A 1WHTB 4R1OA 3E23A 3GUYA 3KETA 1FMTA 1Q44A 2GK4A 2O7NA 3SAJA 3T54A 4B48A 4DGSA 1DZIA 5TE9A 5KMGB 1X0VA 2B99A 3W5BA 2ZCJA 4N5MA 3R1IA 4TTAA 4BKQA 4I1IA 3E9YA 2JGEA 3QU4A 1CRQA 4EQZA 5JAIA 3NT2A 4EHLA 5LMZA 3OZGA 3GROA 3NOOA 4IVPA 4CDNA 4PFKA 3ES9A 5F9HA 3RI3A 3RSLA 2ZI3A 2ZBUA 1FC0A 4TMYA 4OQZA 2W6QA 3T5CA 3ZDAA 2I2CA 1RLOA 2I6GA 3EODA 3NXKA 4N7RA 4Q16A 4F2HA 1WUJS 2X5KO 3H3FA 2TRSB 3K5HA 3OSZA 2LCQA 3T0IA 2JD1A 5ADWA 4FHCA 4UE2A 3IEVA 1S5PA 2Q2NA 4Y2SA 1DB3A 3TZHA 3ISVA 3L1IA 3JPWA 2X76A 2I6XA 2VBFA 4PO1A 1JHRA 1P5HA 4D8TA 4DCMA 4DR1B 3LQFA 1T8WA 2C94A 4KXMA 3TFQA 3H13A 3K1JA 5IKXA 1JAXA 3WHLA 5KO2A 2ZRMA 3B36A 4YWHA 1CYEA 1IOVA 5F21A 1VYVA 5ALRA 4UTXA 4NS1A 3ENWA 5E0OA 3PUIA 3RVMA 1UWLA 2W2NA 4D4GA 4CWAA 4REQB 3S2GA 4KOEC 5ALSA 5J63A 2EQ5A 4DHEA 2PPLA 5FBHA 1Z3IX 4PLPA 1JEYA 2FPPA 2CLLB 5EIXA 1HTWA 2CVQA 3IT1A 4P7GA 5JATA 1NRXA 4RELA 3C15C 4IDGA 3O75A 4DSZA 2ORYA 1V1RB 2BUCA 2HU2A 3FBGA 4HLUA 2FLVA 4N03A 4OFBA 1OGIA 3CKKA 3DKVA 3BFKA 4RJIA 1E3EA 3HVKA 1JLKA 4ZZ2A 4J90A 1GNVA 2JF0A 5ABPA 4H27A 4K9DA 1FFXA 4TTQA 4A3SA 1YC2A 1EVYA 3FETA 4C30A 5JISA 3F4BA 3ZUPA 4R2XA 4C43A 4TZ0A 4COKA 4JBYA 3PR3A 3CRW1 2V4MA 4ERNA 1M6HA 4JJGA 3ZCSA 3NFRA 2L82A 3C7DB 3Q40A 4NZZA 3C5WP 1F0PA 3L8ZA 2O3RA 3WYCA 3FFAA 3TPCA 4ZXFA 1C0KA 2P6NA 3DDNA 3H0CA 1EXWA 3Q11A 1KHTA 1LTHR 4QOEA 1HV8A 4BEVA 2QKYA 4TWAA 5IJWA 3INGA 2RKOA 3C1AA 2PIDA 2ZBRA 1Z33A 3EAGA 2LDBA 1RXIA 2FFBA 3C98A 3JTEA 2NNLD 3T7KA 4C4XA 3HG7A 3LAWA 1L5LA 1H0SA 2AI3A 3USES 2RE8A 1RP1A 1HDIA 1SKMA 3AZOA 4FK8A 1COWA 5KVVA 3VYWA 4TZ6A 4QBKA 3NTRA 1Y4UA 3KEMA 2WHPB 5CAEB 1OBFO 1Y1QA 3U4QA 4MKGA 1XZFA 4XD7D 2L17A 1ZG3A 3DF7A 3PUHA 3BB3A 5CLIA 5L7YA 4J6EA 2A9FA 4MP3A 3EDQA 4JLOA 3N87A 3H6KA 1LSJA 4PZZA 1JIKA 1U3CA 3N8HA 3FSEA 3HY6A 4FC6A 4TKUA 4UFPA 1J5EB 4D9CA 3RJTA 2MOKA 3E8XA 1QO7A 3HZZA 4JSRA 3B3JA 5AW6A 1E2KA 5LQJA 2R8RA 3PC3A 4YRCA 4ZANA 2AW5A 2EF1A 1KPHA 4AUNA 1YQQA 4EFDA 2HDHA 3AFGA 3K0AA 2HNAA 2HSJA 1OT5A 2CVOA 4H77A 1JLLB 4ALNA 2X2EA 5F76A 1N7HA 2OPBA 2H18A 1PS9A 2VYQA 1V8BA 5ISMA 2IOYA 4UU8A 1UAYA 3AHEA 3GDWA 5IZCC 3CVWA 4DSOA 3EULA 5ED0A 4QWMA 1CJCA 1YQGA 1JEQA 4CEIB 4EPRA 2X4GA 5FPTA 1E63A 4I4CA 4NBSA 4MV8A 4A73A 4LBVA 3KQYA 2I87A 3SXUB 2CXSA 1SKBA 3RWOA 2AYXA 2VH2A 3F7TA 3HYCA 3R0QA 4KN6A 3B70A 4CQNA 1PJLA 4CM8A 2WBLC 2C9BA 4NEHB 4PFQA 3RW9A 2AN3A 4KAFA 5K1ZA 4GR9A 1KRHA 2HO5A 5AW9A 3K0HA 1WP4A 2NP6A 5AQEA 3WLJA 1RKXA 1KYZA 4ZFNA 4HFMA 5EKTA 5DNAA 4GDFA 1YBAA 1GIAA 3GIWA 3TJMA 3FNGA 4AD8A 1D7AA 5ALNA 1WP9A 4UVEA 1JJFA 1N6RA 4HF7A 4O5AA 4QGHA 4DR6B 2OGSA 1F0NA 1D9XA 1PT9A 1TAGA 2E82A 5DCUA 5AM1A 1AS0A 3UIEA 2F00A 1UJ5A 4ZKDA 1F4PA 1KIMA 4BNIA 2OD9A 3LBIA 3PG5A 4L28A 5C35A 4RVSA 3HZRA 4PLHA 1CQPA 2QZPA 3JRNA 3D0RA 5COBA 2AG6A 4DMRA 3H9UA 3MUNA 2JJ2D 1PL7A 4YMHA 2D5AA 1SCNE 1O6BA 1K3UB 1XF1A 4E30A 2RI6A 1QIEA 1OFUX 3G59A 5FQOA 3LMKA 1E7QA 2PQ0A 5JXIA 3LI2A 3LLVA 4QDTA 3EIWA 3NC0C 4QYIB 3DXFA 4S24A 3CZPA 3C6ZA 1DI0A 4ZVPA 5EZYB 2RGWA 2DY0A 1TYAE 1UPAA 1FS6A 1TXGA 4FZJA 1C1HA 1AO0A 2J5BA 1N33B 3DOIA 3OJWA 1LJ8A 2II6A 1KPIA 3TX2A 1NIJA 3CTMA 4L51A 1EUZA 4XJSA 4GLFA 1C1DA 1X7DA 2AA3A 3MPUA 5EIBD 5KJEA 5IJZA 1NVKA 1ORRA 1Y3IA 2YWRA 1KFEB 2VXYA 4WY2A 4ZQEA 1SVIA 3RVQA 5THXA 1CUVA 1WY7A 4AZ0B 3OC0A 1TVEA 3FTPA 3K0BA 4J0EA 4PLCA 1JE0A 1EH5A 2ODPA 4C20A 2ZS7A 4CQMD 4ETWA 1Y3DE 2RAPA 1PT5A 3SLGA 5DI3B 5DN6A 2WUFA 1GCGA 1NV9A 1ZI9A 3B3QA 3FRHA 4PBRA 2ARKA 3UJ3X 3KJHA 1SG0A 4ZYZA 3VC1A 3U56A 5LBTA 2ZB2A 1UJCA 2B1RA 3A1EA 2A5JA 5AVRA 2ZSJA 3FPAA 1IY0A 4NAVA 4EAQA 3ZXIA 1YDWA 4E4TA 4JZKA 1FFHA 3E15A 3VVLA 4QJ3A 2VRCD 5DM2A 2GSDA 1P0MA 3ZOZA 5A0VA 4RVHA 5IVDA 1NNEA 1PWEA 4LBZA 2J3MA 5A62A 1KWKA 3K31A 1E2JA 2I4IA 3TB6A 2FR8A 4IR7A 3EG5A 3PXEA 3ZV7A 2H1CA 4QFCA 1BX3A 5LA6F 1E0AA 2HCTA 4RO0A 2H3HA 2NUPA 3TTVA 3H0KA 3I9V1 3WGNA 4ZO7A 4YJHB 3IKLA 4NFSA 2AQIA 3B6EA 3EB9A 2Z3WA 5IZCA 3R4VA 1F38A 1WVMA 1KJYA 5BOVA 3HPRA 2P6RA 2HM7A 4XEHA 5K3AA 1X6VA 2JHGA 2FN8A 4ZI3A 5ILOA 3R0IA 4GMDA 4EJMA 3QIAA 1YS6A 2ZRHA 1G9TA 1YQXA 3DBLB 4H0FA 2DBQA 1IN5A 4MMXB 4UBMA 2JANA 5AKZA 2XKAA 1E2IA 4OYHA 1C41A 2O2HA 3M89A 3JSAA 4OQ4A 4COOA 1OH5A 2HN9A 2YJTD 2PXAA 4MS1B 5CGZA 3L8FA 2X14A 4RIEA 1OBVA 4LSWA 2LNDA 2X19A 1PJZA 4IF4A 5DP2A 3W2TA 1RQNA 3N6VA 3C5CA 4UE6A 1OV6A 4MA0A 2Y92A 1RRGA 3G2LA 1KMNA 3R3HA 4V03A 3GP3A 4RPCA 4HWPA 2I34A 3KDPA 5CVUA 4CV3A 1PLLA 1OX4B 4M54A 1HO3A 4RVNA 2Q7XA 4DEXA 3U4QB 3NOQA 1XZPA 5COAA 4XRGA 2O7SA 4JX9A 5DKFA 4LNUA 3AR9A 4IUDS 4R69A 2RG7A 4WIAA 5AHKA 4CODB 4BPRA 2PUJA 3LC0A 5HGXA 4CCWA 4YRTA 1PJSA 5DX1A 2AKEA 1LDBA 2AWNA 2YHIB 421PA 1RZVA 4N18A 3ZVRA 2WT4A 3BXOA 5IDVA 2G36A 1NUHA 2VFAA 3DAHA 4UUPA 2R79A 3SZUA 5DNVA 1QIKA 2JEYA 2R8EA 4LAFA 1OX5A 5ALQA 3RNOA 1QUEA 3ZGOA 4DABA 4NJMA 4UCQA 2OXTA 2FPOA 4LX8A 2Q9UA 4UM8B 3T7TA 3TL6A 2B9EA 4CR8A 4MVJF 5D7NA 3Q85A 2ANBA 3LGAA 1PG2A 2NU6A 4OQDA 4R31A 1OXBB 1M10A 4C6TB 4YMLA 2XCUA 3PRJA 3WVNA 4BLUA 4TLBA 3UXYA 2R2AA 3SX4A 3MBIA 3N0TA 4MINA 1JHUA 3P0RA 4PVCA 4R98A 5BV7A 1DJNA 1II8A 1MT0A 1IY1A 1NONA 1YI8A 2N42A 2Y1CA 4E5KA 2IXGA 2EBUA 1KY2A 4M9UA 3C5HA 5GY7A 3KHSA 1Y4DE 3T4PA 2IOQA 1TE2A 4AKTA 2ON6A 1Z12A 3GRPA 4Q7KA 5JS2A 1UBRS 1SXJD 1ZMTA 4JSYA 3UT5B 4CL0A 3P2IA 3PUZA 1JB1A 3G13A 3JD4A 1VJGA 4LJLA 3GDFA 3I58A 2JLYA 4JR0A 2HF9A 2H17A 3D1JA 1JR3E 1WDLA 4PYRA 4TYYA 1EVEA 2ETVA 4Y6PA 4BX3A 3W7VA 5BWBA 1QHGA 3A0UA 5KHLB 1TA4A 5AESA 5FYQA 1HDOA 3SC6A 3S2UA 4IS3A 4H7JA 4AJLA 1NW5A 2GOYA 1N8NA 1KMHB 2UUOA 4LSZA 2Q3EA 1Z17A 2P40A 4PRLA 3FIUA 4O4LF 5TEVA 4YQFA 1E3MA 1T4MA 1BC5A 2XB2A 3P0IA 3OTQA 3QXXA 5G40A 4QXQA 1H0RA 3RIGA 3MOGA 3DAOA 5EIOA 1R0ZA 1WEHA 1JG2A 4URYR 4TLCA 2OGTA 5IJ0A 2NQ2C 3IA2A 4K3VA 4Z9YA 2G83A 2Q3HA 2VNAA 4PPGA 3QXCA 3FDJA 4XX0B 4JMPA 4EHNA 4F9EA 5JS6A 2PYZA 5TVKA 3DEZA 1U8XX 2BMVA 2DHEA 3DNMA 5JI2E 2JZOA 1CUIA 5FFMA 3UATA 1VMDA 1A1VA 5BQPA 2OBBA 3CF4G 2A4KA 4OOEA 3FHOA 1O8BA 4NC9A 4NFHA 2OZKA 3AKYA 5JSHA 1VHWA 4GEGA 4MS3A 1KTVA 3K8ZA 3N9IA 1PR5A 4GQBA 4FI3F 4MP6A 3EPPA 5CEFA 1O97C 4R5HA 2C5AA 1FP4A 2P62A 1Q1BA 3A31A 1ZGCA 2OYCA 3L4BC 4HL6A 3ABOB 4M99A 2PH5A 1VBMA 1GRQA 2X4LA 3Q8LA 1U3WA 4K6GA 1NAIA 1HNNA 1NBAA 1WTCA 2DF8A 2YJ4A 1IZ7A 2ILTA 1OKKA 3G2NA 4Q00A 3X1JA 1QO9A 1HFKA 2XYRA 4BO1A 2RC5A 3LV8A 4EKIA 4JLKA 2C31A 4OHYA 4XIFA 1WBBA 1DMRA 3UK6A 1KS2A 1TDJA 3AL0C 3VAAA 1H2XA 1P45A 3FHCB 2Y66A 3M81A 2ZG6A 5HG0A 1JRLA 4QOHA 1MN6A 1CUZA 1N0WA 3F90A 1VZ3A 3KUXA 3SBXA 2DGDA 2XNCA 1YK1A 2B8JA 2Y1KA 3GJZA 4I4TB 4J91A 4LYEA 3T7AA 1EE2A 3NYRA 4C5AA 1AK9A 1M0EA 2YVLA 2FJUA 3G0OA 1JHVA 3Q0IA 4HT3B 2AOUB 1FTSA 2OCLA 2YVKA 3MB8A 3KQMA 1DPGA 1AURA 3PLAE 4ER6A 4CLXA 3SKYA 1AB5A 2DTXA 4EW3A 5L3VA 5E4TA 2ZBEA 2JBAB 2AOTB 2O8DA 1C9MA 1T1SA 1A5TA 2VR1A 1GARA 2X2OA 2C92A 3R6TA 4FU0A 1RWOA 1P29A 2CUKA 3PD0A 4KOAA 1DAKA 4U00A 4UPDA 5HIJA 1AGYA 2QR2A 3ZGLA 2GXAA 2K6GA 4W5NA 4ZYYA 1YR1A 4JSTA 3T4UA 5FTLA 5TIIA 3CBGA 4BZXA 2B1GA 4KIGA 5AI4A 3QOYA 5CLLA 2GHRA 3IEIA 4YUWA 1AG9A 1DAFA 5CNKA 1AX9A 2A9OA 3IRUA 3L7NA 5BURA 3Q3JB 3TVTA 2WFLA 1AKMA 4MV6A 1XEXB 3QUBA 5CGQB 4Z8XA 4BFTA 2IZ1A 2YJGA 5P21A 3FOCA 3W9YA 5K2MA 3RAEC 1MZPA 1TVCA 3C6XA 1XVTA 4FYYA 1N7IA 5JCJA 1XJQA 4WJZA 4IKOA 2VDWA 3AI2A 2AIRA 5J47A 3HXOA 2J85A 2V7QD 4PQFA 1A8QA 4Q37A 5BRNA 1TA9A 3ZU5A 5KVSA 5FCDA 2NV6A 2IHNA 3R5HA 5EIHA 1E3SA 2F1IA 2DQZA 1OASA 1JEQB 4O59O 3DLBA 4MJ7A 4OHBA 2FPKA 2AXQA 1IN6A 3CHYA 1FFYA 4EGQA 4HXGA 2GKSA 2R6GA 1SIOA 5HE9A 1OAOC 4KIFA 3RSZA 3I23A 2FFRA 3SJBA 1YTLA 3W4JA 4RA6B 4Q1CA 4NXNB 3F6CA 5BNWA 2BJWA 3AOEC 4GOOD 1WKBA 4UXIA 2MSEB 2C00A 5LP6F 4OHKA 1EUYA 4OHUA 4HBGA 1J0BA 3OEHA 3P9XA 5LZ7A 4B45A 5IFKA 3BMNA 2FV8A 4ZAZA 2QRGA 2H4XA 2WE8A 3FTCA 3GT4A 4FUTA 4E51A 2BFAA 3HMQA 4KE6A 4OHWA 5I4KA 4BGUA 1ONBA 3L4BA 5LZ9A 1I3MA 1E0DA 2PMBA 4RIGA 4BTEA 4D26A 3FW1A 1E3QA 2FN4A 1HEUA 1QPBA 5KNCH 2QRMA 2A7XA 3KIPA 5CK5A 1GD1O 3P45A 4TWBA 2AF4C 2GN9A 3ZWXA 1VSQA 4E5UA 1SD2A 2H1FA 3DB1A 3LKDA 4GMXA 4PYOA 4RZXA 2AHOA 4OLHA 5EP3A 3ZHBA 4E2WA 5AFSA 5CBPA 1SEVA 1U9IA 1V0JA 4KGZA 3JQPA 3QE2A 5CNMA 3NHRA 4G56A 1GPBA 3IODA 2W6PA 3NU1A 2CYBA 2P9EA 4RDIA 2GEBA 1X7YB 4FNAA 1A5SB 1X14A 2C8KA 4OLJA 4Z1MA 4GX5A 3TLGB 2IXBA 4DIEA 1GTSA 2P4HX 4FNGA 3KQPA 4CF4A 3FROA 3FMFA 3E0QA 1MB3A 4ZXPA 4QU8A 3A4VA 4JXXA 4ZVLA 2I8AA 5I45A 3HO1A 1M75A 3CXUA 3ND7A 4G4SP 1MQ8B 4ER3A 2F43B 1IN7A 1CT9A 3IXLA 2XV1A 2VOEA 4IJ5A 2E4WA 4I3GA 4LRXA 4N54A 4ERXA 1KZHA 1II0A 3VPFA 1O95D 5H4HA 1D7OA 2BTQB 3KPWA 2ZIUB 1T8UA 4ZQIA 4N6OA 1CZHA 1V9CA 2VAPA 1NW3A 3A2LA 2F3QA 1KKMA 1MABB 4S1VA 4WESB 4XH9B 3AF6A 3G0IA 3DLHA 4M55A 2QMYA 1G19A 2SECE 3JQ6A 3RC3A 4ADSG 4RABA 1SXJE 2ZE8A 4JKIA 5B6JA 4HNTA 1CRZA 3QPCA 3NWBA 4L72A 5ALOA 4A8JC 2DWCA 5AH0A 3VJRA 3R09A 1O9BA 2WPDD 5EJIA 3A6PC 2ID8A 3ONFA 4KIWA 1K8YB 1POWA 4C78A 4RDCA 2B2NA 4C22A 4FSXA 4FDVA 1U3VA 1GQFA 1MB2A 1N5LA 4LJ6A 4I55A 2NVUA 4TYQA 3OZXA 1FNCA 2QD2A 4WXRA 1M76A 8MHTA 1WIWA 4V2IA 4FIZA 1J8DA 3IAM6 4J4BA 3KQLA 1IM2A 3DKPA 3H9JA 1J07A 4GW3A 4PR3A 1DEKA 4WFIA 4FM9A 2XT6A 1U5BB 2X7XA 2XUAA 4AVYA 2DQKA 4GZ3A 2Q3JA 2Q1WA 1FYVA 1CUXA 1BS2A 4LF6B 3TQRA 1DT5A 1RMQA 1S8FA 1FFBA 1TX4B 1M83A 1UC9A 2XMRA 4D42A 4ZCTA 2BSAA 1JFSA 4YJ2F 2J0UB 2P6MA 3HB7A 3L8DA 5HQ3A 1H0HA 1HOTA 3USZA 3ASYA 2PMDA 2IEDA 3NHWA 5FV7A 4ND5A 3VM6A 2VF7A 3I61A 1I94B 2BELA 4OGFA 3PJRA 1M2HA 2EJBA 2CHEA 3LOQA 2PWBA 4BMNA 3K9WA 3TYXA 1YR6A 5B37A 5CLQA 1AGRA 1JP7A 1U5AA 2PO7A 4MHSA 1IDN1 4G1BA 4DLXA 1ZGGA 2CNDA 2YBEA 3HA2A 4UCWA 1HKUA 1JMKC 3FUUA 4F56A 1REQA 1PFYA 1ZZEA 3NC1C 3PPXA 1XEXA 1R0RE 5CT6A 1F9AA 1XXHA 4RQBA 1UKZA 2OM2A 3PWSA 3RNLA 4UOEA 2BGJA 4R71A 3VV2A 4U7WA 3ZY4A 1LPMA 2E2WA 2IHUA 1FP1D 3H4VA 4K1LA 1U98A 2J7PA 1FMCA 4B3DA 1E1KA 2R1TB 2WWFA 3KJFA 5CXXA 3WK7A 3DDHA 2CLDX 1ZIOA 3ACCA 4WY5A 5K0TA 4A9AA 2M1XA 2OFWA 3DB2A 1KI1A 2IYTA 2WU0A 3Q88A 4IQGA 4ZHSA 2H1IA 2JAOA 3EA4A 2OWEA 3N0WA 3ESZA 3OT1B 5T5QA 1L6RA 3SQNA 3LUAA 5FPKA 4X44A 2MYTA 3GDHA 4JITA 1ZUWA 4GWKA 2WYVA 4WOKA 1JYSA 4DM4A 3K0FB 3TECE 4HH4A 4V0ME 2NU7A 2X8LA 3NAGA 3GLRA 4IUBS 1YDHA 1GKLA 3HWWA 1W4LA 2IHZA 2JH9A 5T6MA 2WWRA 3ZLVA 4F84A 1JECA 3ICWA 2QN7A 4ZDWA 3EFHA 4I8DA 5LD2C 1ZRNA 2QEQA 3VR6D 4C89A 1PR0A 3RRYA 2WJ4A 1Q0UA 4I36A 4MO9A 4MKXA 4YMUA 2VDUE 4M2LA 3B9RA 4ZU6X 1TADA 4TKVA 1NP7A 4PLYA 4F92B 2I2FA 1WUHS 1WUYA 4Y0AA 5TSDA 4FYIA 3Q98A 3FDIA 2FDCA 2OZLB 2RGXA 3PGJA 3VU9B 2UU9B 4LYYA 2GB4A 1HZJA 1RI4A 5BWMA 1M7BA 1NM5C 1FMFA 1VHDA 1XLTC 1ZKMA 2H6EA 5GM1A 2WF9A 2MINB 1K8RA 3FWYA 1TFRA 3IHKA 1QV6A 2EIXA 4YLGA 3UHPA 2ISCA 5BV1A 4GGPA 5CEEA 1D07A 3P0FA 4OP3A 1GG5A 1GU1A 3HY4A 3PWZA 4B44A 2Q3MA 1TVMA 3D3WA 4NMXB 5KTYA 1GCIA 2R00A 2G7MC 3BWBA 1U2SA 3FPLA 4MB6A 3IHLA 4CM8B 1BEEA 2A2ZA 5G1PA 1GITA 1OA0A 3KT3A 4RSRA 3WDKA 3LNTA 3FTEA 3I6MA 1IHDA 3N07A 3UB4A 2G1JA 4HLUC 4LJ5A 1BHSA 3UOGA 1YIDA 3GELA 5ELLA 3PNSA 1AV7A 1E61A 1Q1ZA 4BQFA 1RQ2A 4X00A 2PWPA 5KU7A 3KUDA 4HD8A 2G25A 1KOLA 1CZRA 5JUWA 3TGWA 2YS6A 3L7AA 3TLZA 3FCAA 4JH0A 3UCFA 3WXMA 1JG7A 4MVJD 3EHEA 3ZTYA 2PKWA 3E8SA 1SUCA 5KS2A 3Q7QA 4UMEA 3FR7A 3O4HA 3RUEA 3TM4A 4EZBA 4RL4A 2GAJA 3G8CA 2YIVX 4EUNA 3GH1A 4KN8A 1D6SA 4RK0A 4XQ9A 4ZT7A 3I28A 4MVJM 2DLDA 3R5TA 3MRSA 3RVNA 1OPXA 2GEKA 2J41A 4A6XA 2HD4A 2BD0A 4Q9LA 3ADOA 10MHA 1S3FA 1G4HA 3O4VA 2WDPA 4NZMA 3AF5A 4YLYA 2O5CA 3FZYA 1T8RA 4FXPA 4MICA 1YVPA 3OM9A 4YBZA 5CM9C 1HETA 1OZGA 4NOMA 4DLVA 5JAUA 1WU8A 4MVJE 5KYXA 3UMGA 3CPEA 4RTSA 3H16A 4ZCSA 4EFKA 4RV4A 2DC1A 4Z9XA 1JV2B 2AQHA 4D6XA 1QGUB 3GFQA 3EOZA 2VBCA 4WLOA 3SMQA 2AXEA 3C3MA 4O4IA 2WWVD 2QN2A 3A1VA 5C4MA 1BWPA 3DWIA 5TQ0A 4LJ8A 1KZ7B 2LKDA 1ZUNB 1A7KA 4QTTB 3L02A 2JJ1D 3NH6A 3EOBI 4DQUA 1AUPA 1QZ3A 1VL2A 1R7RA 5T41A 2ZB4A 1T13A 2IWHA 2JW5A 4AY5A 1RACA 3BB1A 4PC6A 1NJSA 4W63A 4K9PA 3IB3A 4HGPA 4I08A 1ZHHA 3S0JA 5EG5A 5J4HA 1IE3A 3WFIA 2QTZA 3T3EA 3LK7A 4H15A 2RONA 2OCBA 1H8EA 1E32A 4CCSA 1SZCA 5CEJA 3RC7A 3KNZA 1RCFA 4Q7JB 2DJ5A 4M8LA 3ESBA 3D7MA 1LD3A 2Y27A 1B8UA 3OZAA 4Q1DA 5DIFA 1CQJA 3RVOA 5CIWA 5EIBC 2FKAA 4DJFC 3IELA 2I2BA 2IYWA 3BRSA 1C7IA 3DLPX 2C82A 3PICA 5DB4A 3KZVA 1GTG1 4DDWA 4RVCA 1JWAB 4UNSA 2HLDD 1C7ZA 2QW1A 1P2UA 1PFVA 3OFKA 2H9AA 1P39A 4MW9A 4ID3A 2HJVA 3LLUA 1PQWA 1QKKA 3AESA 4FOLA 4N0PA 4WXYB 1LSUA 3QX8A 4C87A 3MQ2A 3A4MA 4D9FA 2C7QA 5U4XA 5AJHA 4D9JA 1B6TA 1P1BA 4EG3A 1MW9X 4ZYLA 2R00C 4NL4H 2H29A 4MTCA 2RHBA 3M3HA 1G20E 4LRTB 1TRHA 3KOMA 3M6AA 3NQ41 2NXWA 3M70A 4Q02A 4D97A 2D5LA 5HKBA 3BPSA 1JAYA 2YQZA 3C74A 1ODLA 1OWMA 5A3JA 3CVOA 3BSWA 1C8KA 3Q3GE 1AKRA 4P53A 1T4BA 1QAOA 5FBQB 1EBUA 4JKYA 4S35A 5CMLA 3R40A 2CD9A 4OYRA 2BEVA 2G6TA 2Z2IA 2VUSA 4RLHA 1U8UA 3HU3A 4GBED 3F7MA 4ITRC 2IOHA 3DVRX 1Q74A 5E9JA 4JBXA 3KG2A 4C0SA 3FWHA 4R2LA 3OURA 2NOAA 3OU7A 1SU8A 4DT1B 4ZMBA 2JGKA 3PC2A 1ABEA 2Z6UA 5KOHB 5MN6A 1AA6A 4HFNA 4L6AA 2JH3A 3E9MA 4J7AA 3THSA 3F74A 2P1DA 1E4OA 3K6JA 2NU8A 4E1AA 1AS2A 3K9LA 4XWOA 4DV7B 1A8SA 3TXAA 1F8GA 4XUDA 1U2EA 4GGMX 1QH1A 2O1SA 1BKYA 5BW4A 1V1JA 4W8HA 1GGEA 2WF7A 2I4TA 3ZTTA 1SGWA 3BA6A 3ELUA 4KQJA 4UUMA 4B76A 2LIPA 4YRIA 5IBCA 5IJ9B 3M6LA 4EYOA 1OQAA 4TXJA 2O3UA 5I8WA 3SDZA 2DPYA 3OCYA 1NN3A 1N2GA 1FBNA 1KI9A 1HQYE 2BFOA 4UUAA 1GPMA 3DE0X 1VPVA 4JJAA 5J2UA 1HZZC 3NYQA 4NOKA 2I2DA 5JH7F 1RPJA 4DLWA 1HBJA 4ISCA 4LQDA 3FX2A 5AVXA 4PZCA 1KBQA 1D6NA 4BNVA 2FQXA 1EMDA 3B60A 2NZUG 5AOBA 4PBSA 1G1MA 2IF0A 1H5UA 3ITEA 2W98A 2B0JA 3KKQA 3AB7A 2WUDA 4I4IA 1B8PA 2CFSA 1GDHA 3EXAA 4L15A 1U9JA 4DCVA 2RFLA 4C76A 5EEHA 4PXYA 2AKYA 1KO8A 3E7WA 2XUPA 2GJAA 2WSMA 4GECA 3ZYCA 4OK5A 3ZJVA 2G9RA 3CF6R 3IDFA 1SBQA 1T0PA 2JAUA 1DTEA 3PFBA 3IVAA 1KI8A 2GNPA 4YQYA 3RIMA 5KQGA 4D9NA 5D00A 1G2PA 2PE5A 1GG2A 1NHWA 1ML4A 2RIRA 3DLCA 4HDAA 1XT6A 3OPXA 1AGNA 3JXEA 2TS1A 4RZIA 3T4XA 3ZCPA 4CMBA 3HJGA 1EFHA 4YASA 2V9ZA 1E18A 1LX6A 3INTA 1F48A 2CLEB 3S1AB 4DDTA 4AKGA 1UBNA 3K73O 4K9KA 2A1UA 3IB6A 1M1UA 3GT3A 3IEPA 3ZEIA 3DEHA 2UDPA 3NVMB 4IQ4A 2GLXA 1XFDA 1H2RS 3V4FA 3HBAA 4YJKA 4EPVA 1EYZA 1RLMA 2O06A 2MYUA 1CS0A 3H17A 4Y6QA 3GLSA 4ZVNA 5BNIA 3ANTA 2F55A 3QX3A 3AZQA 3LHDA 4WKOA 3ZQ6A 4BUZA 1MFZA 4DANA 1PN3A 2BKVA 3NRJA 3SG0A 3PL5A 1NNUA 3T34A 3E82A 1Y3AA 1Z3CA 4KXWA 5AXDA 4AECA 2HW8A 1XRRA 2VUIB 4IDCA 4YPVA 4PGGA 3H4TA 2BI4A 3IXMA 2RGBA 3PL1A 2CT8A 2IQ5A 5ARDA 5LJIA 2VH1A 2OR3A 2Y9PB 4FP9A 4LJ9A 4F60A 1P5ZB 4RK5A 5KCMA 1E9DA 1WVGA 5HF8A 3LIIA 5CITA 2WSSD 5K8IA 1T43A 2QNRA 2VL7A 2X22A 3D8HA 1RJ9A 1OU0A 3HYRA 1E2GA 5B6PA 4AQYB 5A1TA 1ZQ9A 3K15A 4MQEA 4B31A 3IDSA 5I9MA 5TEWA 5B2EA 3IVCA 4D92A 1TJ4A 1JSCA 1MBZA 3TLKA 2YMPA 4WI1A 5IDXA 4ZV7A 1YQ9A 1HWYA 1R3DA 3C8HA 3H9QA 5JJ5A 4BQSA 2EP5A 3F98A 3QVOA 1EHCA 3OPMA 2YYAA 2IX3A 5JR3A 1PTJA 5BXYA 2E89A 1JAIA 2V3CC 1CUUA 2VXOA 1RBQA 1UBJS 2QS9A 4KXUA 2IZ7A 4LOAA 2Y4NA 3Q7EA 3R77A 3I0NA 5FOVA 1ZJWA 2O3SA 1I1OA 5AI8A 1GGKA 3ZIAA 2P3OA 1G8MA 4V38A 4KR2A 1Z2EA 1CUCA 2QG6A 3IJEB 5LMUB 4BGIA 1C9JA 1WZCA 2AJLI 4YFYA 3QMVA 3KQKA 2QV7A 1DDGA 3HWX1 3R2JA 3JQAA 3QELB 4DKJA 2R6AA 3ZLUA 5AVSA 4KNWA 1MHPA 3DCIA 1N75A 1NMEA 2HU8A 2VK8A 2BTOA 1A5AB 1OYWA 2NTJA 3KD2A 2EBFX 3MJEA 3BWVA 1R27A 2V5UA 1PLKA 3NC4A 2BKAA 1XJWA 2IZZA 2Y77A 3D8TA 2X3UA 4HSEA 3A8TA 2I66A 4MWSA 4TRNA 5HF6A 4C3VA 1TTHA 1EDBA 3R3VA 1DNPA 5I7WA 4RHEA 5G02A 2OFXA 2XA1A 2ZUVA 3HUEA 4JJ8A 5I51A 4JI4B 1QQ5A 1BYUA 1VC2A 4IMPA 2GVDC 3GCXA 3RH0A 2P69A 1ABFA 3UANA 5AW4A 3X0DA 4B6SA 1K8XB 3GJXC 1QIFA 5HFJA 1FZTA 4M37A 3T1TA 2AZDA 3H19A 4ZVSA 3WQQA 4AJKA 2UUPA 4PYKA 2JRLA 5AOVA 4YP6A 5GZ1A 2C99A 1YF3A 4IIEA 1YIOA 4G5SA 3CKLA 2HYIC 1V9LA 5DNYB 4QAJA 1EWVA 4MVJH 4NU5A 1Z4LA 1F7VA 4QSMA 1NBOA 1NN5A 3IOEA 4R01A 5CD9A 3CUEF 4C1NA 3DLTA 1TEHA 3K92A 3NTUA 2IUFA 2K2QB 2WG2A 4AC9A 3LQ1A 3HXMA 5AM3A 2XQVA 3NGMA 1Y3FE 1M6NA 2H9IA 1A2KC 2BISA 1R6XA 4FD3A 1MAWA 1F5NA 3PF9A 1KYIA 4J4HA 3KBOA 3V46A 4AMUA 4EMTA 5FEUA 1KK1A 3OM1A 1E3IA 1M6VA 1CUSA 4N8SA 2PNJA 4AZWA 1QZXA 4MS4B 5H1YA 4ZZ1A 1T6YA 4MAFA 4UAUA 3EG9B 4DLBA 2PZKA 3OHMA 4BDSA 1FTNA 1Y6JA 3G2QA 3KPYA 4D4KA 2D3WA 4E22A 1S0UA 1W1IA 1H1TA 3BFJA 4I9UA 4DQVA 1E0JA 1YZNA 1Z6PA 5L3SB 2JFUA 1NVBA 3GFFA 4YAIA 3OQOA 1UJNA 4ETIA 7REQA 5BMVA 3NWJA 5G0VA 3TLXA 5I47A 2B8TA 3N2IA 5BW8A 5JQGF 1RD4A 1MG0A 1WCWA 1J8VA 2I7DA 3K09C 5HDQA 1C9NA 3BFVA 2R1VA 3D6NB 5CCBA 2OBYA 3C4JA 4MOWA 3KQHA 2Q99A 4MCJA 1ADJA 2SCUA 1UXJA 3HUTA 4M49A 5K03A 5H8WA 3TD6A 1TCUA 4ZO9A 3W04A 1NFQA 2HIGA 3ZY5A 3H6GA 3GH3A 4MGHA 4LZLA 1PTJC 1U0NA 2VHYA 1QANA 3HR7A 2NUBA 2Q2QA 1OLSA 2E4ZA 3NOXA 3Q8KA 3NWPA 4P4NA 5HTKA 5LQUA 4LIPD 2QUIA 2ZYWX 1P2VA 3VJLA 5IJ0B 4TUYA 4ALKA 1MABA 1SY7A 2H07A 2WSSA 3B6MA 3KEQA 3DQPA 4M0MA 4WESA 5DWVA 3QA3E 4PG4A 4S0ZA 1C1XB 1SVWA 2BUAA 3EA5A 3AXSA 2NYRA 4GZ5A 1K6IA 1RJ9B 1W6RA 1D6MA 3HBLA 1VRVA 2R65A 4BTVA 1V2GA 4D9HA 5BWLA 2PS3A 3SWWA 1PWYE 1U3FA 3GA7A 1QCDA 4IZIA 5JSZA 1PS8A 3ITKA 1YR2A 1J1UA 3B9PA 3NNSA 1HX7A 1GOTA 1LV8A 3ROXA 4FYMA 3D3KA 1TU0A 1DRKA 3NT4A 3C1UA 1YCGA 3K94A 3UWDA 2YWHA 2VBGA 4DUPA 1X39A 3K2IA 3VU8A 1IBKB 1XQ6A 5JNUA 4BN5A 5HTOA 1PUXA 3HCRA 5IKPA 2CJXA 6REQB 5BPFA 1JG4A 2QL9A 1ADYA 3D9QX 2JGNA 2IGTA 3WMXA 4RFLA 2D3TA 2ODQA 5KYXB 1Z7BA 1KZ9A 3NHKA 3ZHTA 2OVBA 5LQNA 4Q6WA 1PRYA 2WVGA 1ISIA 2XLCA 3RKUA 2VVTA 4PNPA 2XRYA 3LTEA 4II7A 1XNRB 4EFNA 5EWMA 1ST3A 5CYGA 4TOIA 1QKIA 3G0DA 1R5JA 4PG5A 5H9VA 4ARAA 2OOSA 3L04A 1AH2A 2I4OA 1TW2A 2F3UA 3MUFA 4Y9UA 5F5XA 1KJJA 3EVDA 4O4JA 3BTSA 2WAMA 1CNEA 1JG1A 4QEDA 4UBLA 4OTZA 2Q4BA 3SKXA 1XHFA 1F1JA 2Q5OA 3LBFA 5H81A 2PVSA 4P81A 2HJWA 3SYRA 5M29A 4PLVA 4ZOLA 2FUCA 5KX5B 4DVJA 2GBIA 1DV1A 1CQIB 4I9HA 4QECA 3TH5A 5BVGB 5CD1A 5JJLA 1G64A 1QYCA 4F97A 1G8SA 2XGJA 2WOJA 4P7KA 4ZI7A 1EFRD 1WS6A 3M83A 3O9VA 1DELA 3PFFA 4KIUA 3G17A 2QE7A 2XDAA 1W29A 4N76A 1E69A 3FCYA 2IUEA 4HH3C 4QBHA 1G8FA 5KSZA 2P27A 4TZTA 1Q11A 1CQIA 2KI5A 2LKCA 1U2QA 1D0SA 2WJ6A 3FMPB 3IEXA 2BFDB 3PHLA 1DBPA 5B30A 4XDGA 4UMVA 4KQ1A 2J8ZA 1B8NA 2AD1A 1UEIA 3KT8A 3QNMA 1NMQA 1EEHA 1P9RA 1VI2A 1W76A 1WPXA 2C0QA 2JRCA 3AJRA 1E9SA 1ARZA 2FK8A 2R66A 3E58A 2PBZA 1OFGA 1MOPA 3OLZA 1EBFA 2AOUA 2HK6A 5TVGA 1MO3A 1QHYA 5LKRA 4ZYVA 2AFVA 2BR4A 2PQ2A 2HU5A 3CNBA 3IAM1 3WWPA 3O8LA 3A14A 3THXA 1LQ2A 3PQ5A 2P9YA 4GAEA 3UFXB 3V8BA 2XQIA 2A14A 3MZ0A 5D84A 5DGIA 4MR7A 3U17A 4ARZA 5ICMA 2XYVA 1QUFA 2FGJA 5H0IA 3WGQA 3EGWA 4MUBA 4CL8A 2UVDA 2JIZA 4M83A 4L76A 1KO1A 1GTL1 4F5EA 1QMGA 1JJAA 1SB9A 1A9PA 1YI0A 2BFNA 4NDZA 4E5VA 2OC9A 2V59A 4FDUA 1OMOA 3V48A 4WCFB 3HABA 1W30A 4DIBA 4ZZ3A 3BJZA 2EL9A 1IZ8A 1V47A 2PAAA 3DCNA 1AZSC 1TO2E 1GV0A 4FJ1A 1NR7A 1R00A 3OPYB 3LNCA 4QUEA 1G291 4OX9Y 2VPQA 2GTIA 4BO4A 4C05A 5JCPA 3DLAA 4EIWA 5FTWA 3E48A 2MYNA 4KR6A 5DNWA 2J3LA 1HDGO 2C3MA 2ZJ5A 1LC3A 1MB4A 1NTRA 3EQ7A 1YASA 2BMWA 4O6VA 4QGFA 2VK2A 2YJ5A 4FYWA 5ECWA 1D03A 3HA3A 4MW2A 4Z5XA 2NSJA 2H4HA 3I76A 5LL6P 1YB7A 3VZBA 1TJNA 3DL7A 2GH1A 1N36B 3DPIA 2GEDA 2W2XA 1J9ZA 2J67A 1BQEA 2ENWA 4I6GA 4RLFA 1E92A 3WBJA 3ZDQA 5IDYA 821PA 3BBPA 2I4NA 3UEOA 3WRXA 2CWDA 1NI4A 4TPKA 2QLJA 4H60A 1TPYA 3TUJC 2BGNA 3D7LA 3N0RA 5KQRA 4QEZA 3AHIA 4EHJA 4RUKA 2EJWA 4ONEA 3BQMB 3P9KA 3ECCA 2VZ9A 1OXKB 3L7CA 3ICOA 5HR5A 1VE6A 1YA4A 2NTEA 1KI6B 4HMPA 3ABSB 2FW0A 4JT2A 3STUA 2KB0A 5FNZA 3UJ9A 3NVKI 4FMCF 1PCXA 1K0FA 2RC6A 5A7FA 2IP2A 2ZGVA 1O8CA 3QKTA 5SZJA 1GU0A 1CY4A 3MLEA 2AUMA 1W5FA 3N6XA 4IUYA 1XZDA 4DR3B 3G0CA 3K6KA 4RZ2A 3K2EA 3RT1A 1EAYA 1WZUA 2K2WA 3B6IA 3QVMA 5B1SA 1MOQA 1T2UA 3OZTA 4Q6BA 4ABTA 3EGOA 4Q7MB 2QRVA 5K3DA 1T2FA 1BWQA 2Q4OA 3F2VA 2Y1GA 1XHEA 2FXVA 1ZD9A 2Q4DA 3AF0A 2C98A 3TQQA 3USCS 3ZXSA 3DZBA 2BDUA 2I62A 3CU5A 4GM0A 3RAPR 1P33A 1XQWA 3GRKA 1FFAA 4OFZA 2XECA 4AYXA 3V1MA 2GN1A 4FQ7A 2O8CA 2AUNA 2FX3A 5IK2D 1GTMA 1OI7A 3HDYA 3CRMA 3D7SA 2QG9A 3ORSA 4XIJA 1RDFA 1DX4A 1Z73A 1ZJJA 1N6IA 1U7HA 3HB5X 1JZTA 1W19A 3KZ1E 3DONA 1E89A 3KP1A 4RLQA 3RJMA 1JFRA 3QXJA 5ES3A 3T5AA 2G63A 1UKAA 1FYDA 4LV6A 3HB9A 9LDTA 1LTKA 2ZJZA 1Z0SA 1BH6A 4QUJA 3PQFA 4E3WA 3O73A 2FMTA 4R2IA 2KJQA 5M3BA 4K88A 2ZT6A 2P77A 2ZIGA 3AF3A 2WJVA 5I9SA 5IAGA 3W9UA 2P8JA 1Y3CE 1RAEA 1O87A 4O08A 4HS4A 4EGAA 4ZMSA 1U1FA 5LQDA 1WSAA 3NBAA 3E53A 1BXRA 5AI9A 3V4VB 5F64A 3GRUA 1MENA 3JS5A 4LFAB 4BNGA 4CF6A 1GZ5A 1KR2A 4MH0R 2ZZNA 4TMWA 3QNWA 4O5OA 4JT8A 4LRWA 1UPBA 3CKMA 4L5YA 1C8VB 1TGYA 2XE4A 3CZQA 3FAZA 2O2SA 4JNCA 4INAA 3RT7A 2VAVA 4OBBA 1A96A 5HWSA 3E9ZA 2C2BA 5DVZA 2F43A 2ZI4A 3ORHA 4YBRA 2HLDA 4PQYA 4RXMA 3TLYA 3NTXA 1IUKA 4KFTA 3K9HA 5GV8A 3ER9A 1XAJA 1CTQA 2G8NA 5KDDA 2JHCA 2OQIA 2I6FA 6ADHA 5DO9A 1ESZA 4F7WA 4D8WA 4PPNA 3MA0A 2HPZA 5ESXA 2AUTA 3GWGA 1SCIA 3T1VA 1NLYA 1WG8A 3QKIA 1I33A 3V4OA 3WL6A 2V74B 1XZLA 4XFDA 4GMGA 1KJ9A 2JPDA 4ATNA 1O6ZA 1INLA 1NM5A 1JEEA 2HA6A 3UBMA 2W43A 4EB3A 1DBSA 4F5DA 1ZBQA 3PNYA 5HF5A 1QH0A 2A58A 1EE9A 521PA 1VMAA 1R6VA 5K8CA 4AG6A 1E1LA 4EB6A 1LJUA 1P7ZA 1SCAA 2WM9B 1D1PA 3MCWA 4MYDA 3SYNA 3BM5A 3EYAA 4CI0B 4DMMA 4FFSA 1KK2A 3PUWA 1XZJA 5CJJA 1SB8A 4YWJA 1XA0A 4CN9A 4DWJA 1H23A 5BSVA 2HPHA 2BE9A 3QH4A 4DNXA 1A8IA 4ENWA 1ZITA 4JA2A 4HWSA 3WYFA 2CDAA 3REGA 5LQMA 1Z35A 1C30A 1OXUA 4BZQA 4EMUA 1OPRA 2WWGA 3L8EA 4ASUD 5JVDF 5L7WA 1JWBB 4D79A 1MO2A 1QFXA 1BS1A 3AP2A 2YNMC 2ORIA 2I99A 4Q4JA 1VPTA 1JVSA 1Q1NA 3VAYA 3G8BA 5JIBA 3RUDA 4YRMA 2OSBA 3JZMA 3PIDA 5DX0A 1QQ7A 3GMSA 3H2HA 1FRQA 3D6MA 2EKDA 3D59A 4MV5A 5AVWA 3G0HA 1C5KA 2ZSKA 4LNUB 3T5PA 4OMDA 1EUCA 3VRHA 1YB2A 4LJRA 5AW8A 4Q66C 3BJIC 4PPQA 2M6LA 3BYZA 1EHIA 5JBNA 1DJPA 2WJHA 4Q9JA 4FEYA 4KYUA 2O59A 1L4BA 5BV2P 1ZINA 3D4LA 1NVVR 3QKRA 4RH3A 2YYSA 4RHFA 2IYNA 4ENVA 1MQ9A 3A36A 3WAGA 4Q4DA 1E94E 3JYLA 3S2FA 4CR6A 3KWMA 3SU8A 1CY0A 4MW6A 4EQ6A 3FCXA 2Q3LA 1N0HA 1U0GA 3E4DA 3QU7A 5CDUA 2H52A 2XCLA 3C41J 3DMGA 4MYSA 5SZIA 2QSUA 4MWGA 3PKIA 1YZUA 3RS3A 4DCSA 4GPD1 3KX2A 3F2IA 4QQFA 5H59A 1YDEA 4HI0E 4GXQA 2B92A 3EFOB 4TT3D 4NENA 4ZT3A 1WPRA 2B1IA 2CXTA 1UEXC 4IIJF 5AJVB 4FOSA 4MUGA 1FFCA 3BFPA 4KDRA 3T9CA 2HFKA 4UBNA 2O8EB 2M98A 3D2AA 2MSNA 5FUMA 2UZ1B 3WIVA 1DPFA 3DBVO 3T7DA 2WP8J 1MEOA 4H7DA 3CH4B 4KPEC 3FGPA 3SSMA 2ZAIA 4NSNA 3N2YA 1DSSG 1SXPA 4G97A 1KP3A 3SYTA 2E21A 1DXYA 1XTPA 2OD7A 1V41E 1M2FA 3C6YA 4M4SA 4R1UA 3NKLA 1D2AA 4BY9E 5A4JA 5I01A 2QJWA 1UAAA 1PKEA 3JY6A 1WB6A 4JIMA 2XWSA 1S3IA 2L19A 1I4EB 3FSJX 2PVPA 2W93A 3AL3A 1AF4A 4KFSA 4KXVA 4M8NE 2I3DA 3LDFA 4RW0A 4NBLA 1WXHA 1T1EA 5EHNA 1G42A 1TM5E 4I81A 1R6DA 2VXBA 1L0BA 3DUFA 3WLRA 3QYPA 4BV8A 3OMLA 1W6UA 2FB9A 2B7LA 2YCLA 3AYXB 2VAMA 4D3DA 2IE8A 1JFLA 2JAHA 1F2UB 4MLPA 1IY2A 3KCNA 3EZFA 1SCUB 4CHGA 3OM8A 3P26A 1Y42X 4RY2A 4ANFA 1BKSB 1D09A 3QEMB 1X8LA 1QP8A 1TMYA 2WIKA 4ZRNA 3VU9A 3WYAA 3UJCA 1VPLA 1XCPA 3ADPA 4ZD6A 4FSHA 2GPWA 1GYRA 2QYTA 2Q7DA 1FW6A 2FW9A 3VZSA 3DKKA 4BFUA 2IQIA 2EBWA 2M2IA 4FFBB 3TMAA 4RJLA 3HFJA 3UW1A 1QS0A 1ORVA 5BVGA 2PLWA 1PG5A 5FOXA 2P0AA 2GFHA 2BFEA 4KX3A 4TMKA 5EWJB 2ZWOA 3GD5A 2H7VA 1KY4A 2YW9A 4JQYA 4YC7A 4DLRA 1BDHA 1UP6A 5AM5A 3H2ZA 4F1WA 3UBTA 5HP4A 3AUXA 2F1OA 1DO2A 3UH0A 3HMKA 5TLSA 5BYAA 4G0XA 1OFIA 1IXKA 5K09A 4NYMQ 2HPAA 2WK1A 4OQEA 3QTTA 1SPBS 1G0OA 8ATCA 2EZ8A 3LW7A 1FS5A 5CFPA 1H8ED 1Y9JA 2GEVA 1TLLA 4QPDA 4CIXA 1KEUA 3UFBA 4GVXA 6REQA 1E2MA 2M6RA 1VXOA 2OLJA 3NBZC 3P7MA 2AHRA 3IP7A 4BFZA 3F71A 4OY3A 2F9LA 4PFSA 4X65B 5C8DA 2QQ0A 1T4DA 3FDZA 3OOYA 5A71A 3JWIA 3URMA 1QOZA 3CW2A 4RGYA 4S2UA 1ZC3A 1YGPA 3Q6MA 3T7SA 5KYTA 5ALPA 1A8HA 2RGNA 1NA5A 5L3RA 1DLIA 1X1CA 2H59A 2ZBVA 4OP1A 1BHJA 2HL6A 3C3YA 3Q0EA 1DUSA 4Q1VA 2HZBA 1C8BA 1QHHA 2ZJ1A 2WTEA 2AEFA 1BJKA 1P6QA 4E1BA 4FR0A 3LECA 3VR4H 3IOMA 1QGAA 2REQB 2GPAA 3E9DA 3V7NA 1DJOA 2GN4A 4F4UA 3WOVA 3PFNA 4CPDA 3AHFA 5LBIA 2BC9A 3IOCA 5I7AA 3RSGA 1HE3A 5IC6A 5BQ3A 1WOYA 3KQQA 2I2WA 3F8TA 4YMIA 4QYWA 3VSBA 1QGZA 2V7BA 4AYWA 2Z5GA 1AUVA 3UUFA 3CB2A 3NHLA 2X0KA 5KB3A 4B3BA 3OFND 4BMVA 4L3VA 4BRUA 1N1EA 4D4IA 1CIJA 2WKWA 3BTUA 1AZWA 4OQPA 5C7LO 1NKVA 2KWIA 4JKOA 3T52A 3DV0B 2AEEA 1OZAA 1U5BA 2AYZA 1I6LA 1TJ5A 2DPGA 2I4RA 2OP1A 2VATA 2ZRLA 3HN2A 4N41A 5ANRB 1G0NA 4JXJA 4ENQA 3H9GA 4ZPJA 1CFJA 1LH0A 2AK3A 3D4PA 2PDAA 3L40A 1MJ5A 4PYMA 9MHTA 4FQ8A 3FZEA 4ACBA 2V4ZA 3VNBA 1WPGA 1OZFA 2WKPA 3D8NA 1O4VA 2WSBA 3NYWA 3OC6A 2AZMA 4URUR 1FYEA 1QXSA 4LDAA 1VIAA 2QW8A 4L85A 5LSAA 1C4OA 1WDKA 1V3UA 2VUHB 4GX2A 1PVDA 5JBIA 2B3DA 2VWGA 3ZR4B 1CDDA 4PYNA 4I46A 3OPVA 4QGAA 1HT3A 1JPVA 3OA0A 3PKZA 4V02A 2W4MA 4RIIA 4J03A 1OI4A 3AL2A 4E5SA 1UQRA 1ZH6A 2E4VA 5ITZA 1QE0A 1T9AA 5KINB 1D0IA 4G5FA 3T7EA 5DEIA 5T6BA 2QE7D 1HG1A 2ZRAA 4JA0A 5KSPA 1QDEA 1RWWA 1KH1A 1SZPA 1DHRA 2AFIB 2A9KA 2VJYA 3PXUA 1J70A 3OWXA 2D2IA 3S55A 4JP2A 1SCQA 3M7IA 3OAAA 1EB8A 1SC9A 2QT9A 1JT2A 2C20A 3KB8A 5CVVA 4CFSA 1EX1A 1H4SA 1GFSA 1X1DA 5ITZB 2Y1XA 1NW8A 1G8GA 2B4YA 4KPUB 2I2AA 4JVOA 1R5BA 1CY2A 3VYRB 4QIHA 2V5VA 1GZSA 3KQVA 4TUYF 1I3CA 1WETA 4PSKA 4DC9A 1GA4A 1YRBA 2X58A 1Q1EA 1APBA 5ALMA 3DL2A 3LQYA 4KU4A 1CJMA 4MGZR 4BWVA 4Q4LA 2HYDA 3HRIA 3JV7A 1JXOA 1J9GA 1Q0PA 1S1MA 1J8MF 1PJ3A 3DLIA 3HNPA 4FGWA 3K9BA 4OV6B 4U5QA 4YS6A 1D4FA 2NT4A 4OSOA 1JXMA 5KYYA 3NEAA 2QVYX 2VPIA 2JLUA 1RIFA 3QWBA 1NW7A 4F8EA 2OKGA 3PUKA 3MJTA 4Q3DA 3KVRA 4R2WA 3L6UA 4F3YA 4WD3A 3W2HA 5KUTA 3UAVA 4OX9B 5EMMA 3DFFA 3G5TA 3I37X 1KAGA 2DCMA 2J7PD 3PC8A 3AP1A 3U7QB 1DJLA 5C32A 4U3JA 1P1CA 2A0KA 1EDDA 2RGEA 4MR9B 1CUBA 2FSFA 5JRZA 2P2YA 1AA9A 2X1HA 5LOVB 1C7FA 1JHXA 2GFQA 2GXQA 2VQDA 3COVA 4AX4A 5BSHA 1V95A 4L6CA 2PXXA 2QNIA 3U0VA 4ZEMA 3TR0A 3R7SA 1ZR2A 2EWVA 4CEJB 4B5KA 5CVCA 2ORWA 1VJ0A 3MG9A 5LOVF 3JYQA 5HJ2A 3GO4A 3QBJA 4KFUA 4L0DA 2QBYB 1W0KD 4WBXC 4CT0A 3CZMA 3D3WB 3URKA 1V2HE 3ENKA 4IHAA 1ZL2A 2C95A 4UHFA 5TQ2A 3G2KA 1QTQA 4JU9A 4BX0A 4HEQA 3VNSA 4D0SA 2X7JA 4JYBA 5D1NA 3U4HA 1P4SA 3KT0A 3L6DA 3MCTA 3WYDA 2JB9A 4Q18A 2GBLA 5I3ZA 2C7BA 1OV4A 4QDKA 4A6PA 1I5EA 1OR8A 3M1LA 1NFRA 3ABRB 4HADA 4TN1A 3W5DA 4C0AC 2AQ8A 3U48A 3AUTA 3BWMA 3LPMA 2V97A 4KQFA 3QUCA 4XB1A 3UB3A 4B6OA 5AO9A 3DDWA 1SUPA 4GP6A 1VRWA 4WCVA 1ZC4A 4WKBA 3JSXA 4ZOEA 1ELOA 3TIGA 4AUMA 2Q0QA 4HBZA 2MSWA 1SVLA 3D6FA 2WWIA 2PH7A 5EIAA 3OZIA 4HDSA 4QHYA 1SQSA 4B6GA 1N6OA 3P4XA 5A3QA 2V7EA