1K6QL

Crystal structure of antibody fab fragment d3
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
210
structure length
204
Chain Sequence
b'DIKMTQSPSSMSASLGESVTITCKASRDIKSYLSWYQQKPWKSPKTLIYYATSLADGVPSRFSGSGSGQDYSLTISSLESDDTATYYCLQHGESPFTFGSGTKLELKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATPIVKSFN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords immunoglobulin Fab D3, light chain
molecule tags Immune system
source organism Mus musculus
publication title The crystal structure of murine Fab D3 at 2.4 A resolution in comparison with the humanised Fab D3h44 (1.85A) provides structural insight into the humanisation process of the D3 anti-tissue factor antibody
rcsb
total genus 48
structure length 204
sequence length 210
ec nomenclature
pdb deposition date 2001-10-17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1k6qL02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1k6qL01
1IAII 4Y1AD 3AS2A 2EYSA 4GXUN 1YEFH 2P5WA 5FYJE 3VI4E 1UB6A 3TA3A 1TMCB 1U8LB 4FQLL 1DTUA 4Y5VA 1TTUA 1TZHB 4U6VH 3V79C 3ALXA 3N0PB 2ZPKL 1FZMA 4EJ1C 4NRXB 4Y4KD 2F54B 4H25A 4KC3B 2C7UB 4R9HA 5GS3A 5F1IB 4RGNB 4NDMB 3G5ZB 2NR6D 4YPGB 3RVVD 3MV8B 3KPPA 4JRYA 4W6XB 4RNRB 4RMUA 1HWGB 4YHOH 3GMQB 4MA3A 1TZHA 1S78C 1S7QA 3T2NL 4O9HH 4OLEA 1R3HA 3V6ZB 5HHQB 3X3GL 4LNRA 4RWHA 1RZGA 4E0RA 3ZHDA 4NDMA 2WNGA 3HFML 1S8DA 4KMTH 4TUKH 3U7WL 2W9EL 1O7SA 1NCWL 3N1GC 1AI1H 4U1GB 5EOTB 2VLME 3P0VH 5JUEL 4JLRA 1E4WH 1S9WB 3DVFA 5DJZA 5BV7C 4KFZC 5CJOL 4PYGA 4QXTA 1KSRA 3PF2A 5D1ZB 3DUHA 4LOUD 1B0RA 5CCKL 3BDBA 4YHIB 3SJVA 2JF1A 1FC1A 3A6CH 2CIKB 1CLYL 3T3MF 5B4MD 5C9KA 2VH5L 4O2FB 1WIPA 4FQPA 5DJZB 4KKLD 1RIUH 5LAXB 5EZJA 4M93C 1J05A 3D2UB 2H3NA 1HHGB 5DDHA 5CKAA 1ZHKA 1RIVL 3DLQR 1C7TA 4OUUA 5I9QB 5GRJH 2WBJD 4KZDL 1T20A 4JDVB 1H8SA 5E6IC 4Z0XB 2R1XA 4PJCE 5LAXA 3HMXL 4PJDA 1J05B 4ONGH 4P3DB 5DDHB 3IU4H 1TJGL 4LCIH 3U1SL 1ED3B 1ZANL 3MRNA 4Z76A 3GSVB 2PYFA 5D8JL 4NZJA 2ARWA 5E8OA 1MHCB 1FORH 3C60A 3QDGA 3FQNA 4OCMC 1IEHA 3BRFA 1UG9A 1ZLWK 1E27B 4KY1H 3EYUH 1JZ4A 2LVEA 3DIFB 4RAHA 2YXMA 5GRJL 4KROC 2FBJH 4P3DA 2XN9D 3QA3A 4OAWA 2XI9A 2BCKB 1F4XL 4X5XB 4WNQB 3LQAC 1QFWH 1D5BA 3VDCA 3IYLW 1OL0A 5FO9A 1BFVH 3MJ6A 1FGVL 5ANMB 4KV5E 3A6OA 4MNHA 5DRWB 4BQCA 5ICYB 5AUMB 4MD4A 1BOGB 4YXHL 1MIEH 5DMKA 4M03A 1X5AA 3QZWG 5DD3L 2OL3H 3ZHKA 4YDVA 4X5XA 2AXFB 5DTFA 3V5HB 5B39A 1A2YB 4PRIB 2AKRA 3CSYA 4U2YA 5TQ0L 1N6UA 1HHKB 2VZUA 3FQUA 3FB5B 2OJZL 4MNHB 1BD2E 4G9FE 2GJZA 2VL5B 1NDGB 1NL0L 3B83A 4CMHB 1E6JH 1U6AH 4CL7A 3O6KL 5DC9B 1A02N 3FCTA 3F7QA 2GSGA 4FFWC 1N5AA 4NJAH 4NUJB 4N90E 5EUOA 1YYLH 3TNMA 4IRJA 2IQ9L 1XH3B 3CIQA 1MAML 3W0WD 1A2YA 4PRIA 2P5EB 2AKRB 2O5XL 3FQUB 3L95A 1BGXL 4ZO8A 3BGFB 1OP5H 3ULVH 5INCA 1H3TA 2CRIA 5J7CC 2FRGP 5CS7A 4YXKH 3HHRB 1FFNB 2CD0A 4XHJC 4XT1C 5E4EC 5CLTA 4CVXB 1WSST 1UCBL 2XZQL 5CJ8A 1ZMYA 3HC3H 3ESVF 4EN3C 5DF0A 4P4RA 4PP2A 2GJJA 4WI6A 4L1HA 3HG1E 3JWNC 1FRGH 1RJLB 4WHYG 5HD8C 5I1IH 4UNTA 1I75A 4OFIA 1A3QA 4H26B 1KLGA 1ZAGA 3L3DA 5HHOB 2G5BA 1CDCA 3BIAX 1TTFA 4H20H 4HJJL 4HC1H 4MQXD 4NQXA 5KANI 3BT2H 3BO8A 5IKCB 3LRSB 1SYVB 4JY6A 5K9KB 2FL5A 3VFSA 3SDCA 3PWPB 1U8NA 1A6WH 1E4WL 4I2XE 4XNXH 1WZ1L 4H1LB 1RJLA 1EFXB 4JZJA 1TCMA 4R0LA 4MAYB 5HDQL 4YHNA 3V9FA 3AU1A 3LKRA 2BY1A 5ILTL 4MHHG 3BP5B 5F3HB 5FGRA 1FZJB 3BWUC 5C0DB 2J2ZA 4WO4D 3VFSB 2EDKA 5F88A 1L9NA 3KPOA 4Y8DC 4HFWA 5KVFH 1BX2A 4YDIH 2YK1L 4QEGA 1L0QA 2XFXB 2PXYC 1I9EA 2CRYA 4G6ML 4MS8C 3WS3B 3D18B 2GY7B 3ARFC 4KZDH 3ARDB 4GRLB 5F88B 3BQUD 2VLKD 1FZKA 1BM3L 3C6LC 1DJSA 5DQJB 1N64H 2R0WL 2APXA 3LQZA 2WWKO 2ICCA 5EBLA 3HNTH 4BK5A 1B3JA 1Y0LA 1GZPB 5AD0A 4HH9B 1B4RA 5KSVA 1KCKA 4YIQB 2F5AL 1G9MH 2SEBB 3LMJL 4RAUA 1T1WB 1G7JA 2J88L 2YPLA 3TP4A 5CEZL 1WWAX 4LLYB 1IC7H 1RUQL 2PR4H 4PG9A 5GGRY 1QRND 1HKFA 3CDFA 1C5CH 5KBNC 4KGLA 3IXTA 4LPUA 5MENE 1BF2A 5IG7B 4GH7B 4UBDC 1MOEA 1UKSA 5GRVK 4JRWA 1N64L 3VXOA 1BEYL 5DJ0B 3DX9A 4L8BB 5KVEH 5GS2H 1NFDA 5GGQL 3MACL 1IT9L 5IT2H 1NEUA 2XWJB 3RVUD 5E94A 4CN1A 4M6ML 2Q8BH 4ONHB 5CP7A 3CX5K 3EHBC 2X4QB 4YWGL 5CEZH 2W38A 2QR0B 2G75B 3DYOA 5DJ0A 2GK0A 4EN3D 2QV2A 2E6QA 4KTDL 2VYRE 5AZ2L 4XPTL 4NOFA 4P46A 4LNVA 3GMLB 4M93B 4PB9H 4URTB 1NDMB 1S5IL 5C09D 4TUJB 4CADB 1QQDB 3I84A 4GW4B 4LSVL 3T4YB 1FNGB 2AEPH 4GG6E 4U0RB 1ZEAH 4U6HB 5JW5B 1QSED 2CXKA 2R29H 1MIEL 5JW4R 1BZ9B 5SWSB 5DT1L 4BFGA 2HTLD 1X5GA 5AG9A 4ZTPH 4Q0XL 4HPOH 2A38A 1YPZB 2AJ3A 4IDLA 1YEDA 5EBWA 1KCSL 2X4OA 5ERWB 1CLOL 3NABL 1ZA3A 3QHZH 3SO3B 3TM6A 2PO6B 4OD1L 3I85A 4AT6B 3S37X 32C2A 1CFTA 1PFCA 5EO1B 3QQ3A 1I7RB 2IAMD 4HWBH 1S9VB 3VRJA 3L7EA 4LCWE 4Y4FC 1S5HA 3MJ8B 5EWIL 4OD2A 3VXNB 5D7LA 3NFSL 2FEEI 4EDWL 4R90L 4JFED 4P2RB 4DTGH 3L5XL 4LEOA 5HJ3A 4QRRB 5BW7C 4XP6L 3V4VL 1DUZB 4X7CC 3T2OA 1NAMH 4KJQC 2DM4A 3V6OE 4GBXC 5BS0B 4YXLH 3GKWL 3MCG1 4BZ1H 2VLJA 4O2EB 3ELAT 4UOW0 5EZIL 4LBEA 1OHQA 5D7LB 4BUGA 1JHLH 2EECA 1A22B 4XP4H 2E9IA 3VGHA 3S35X 3ZKMC 5LXGL 3AXLB 5LCVH 2APTA 2OR9L 3HE7D 4BZYA 1FNLA 5DEGB 4QTIL 5A2KH 4J23A 4UU9B 5IB5B 1LK3H 4ZO9A 4LCYB 1ULVA 3QCVH 5ITBH 1KEML 1JZ6A 1JYVA 1LDPH 2X44D 4JHBA 4RRPA 3MBED 2BP3A 1A7QH 5HHMB 4FQ1H 3WFZA 1L7TL 1UKQA 1EZVX 3GBML 4P2RE 3RAJL 1YNKH 1ODAA 3QCTL 3KNBB 5EU7E 1S7TA 2BK8A 5BOZG 2X89D 4HEME 1MIMH 2JB6B 4JVPA 4KGJA 3O81A 1I7ZA 2ZG3A 4HFUH 4TQEH 5FGCE 1A7NH 2PR4L 1HHHA 5DLMH 5KSBB 1SHMA 3RY6A 3PHOA 3D85A 2EIBA 3SBWC 1Y18B 2R9HC 5KN5B 3BAEH 4DGVH 3TO2B 3O8XB 1TFHA 4OCRL 1N3NB 2IPTH 3VXQB 3X12B 1W0VA 3OKDA 2OXHA 1HZHH 1P6FA 3GK8L 4BSVA 2O5ZH 5HYQA 2R4RL 3JWOL 4J3OC 3RVWC 2E7LA 3EOAB 3UBXA 2H32A 4EQ3A 5IWLC 3D69B 3QIUA 3UBXI 4N9GA 4MJ6A 2P4AB 3MROB 3ZYIA 2GQHA 3ARGB 4QWWC 4PJHF 1I9RH 3C8KB 1I9JL 5ICXA 3JTSA 3O6FA 2VXQL 3HG1D 1N8ZB 2YPKB 4JGJA 2VR5A 4QTHB 3QUMA 4PJ8D 3WYRA 1XIWD 3GMNA 5M7QA 3UBXG 1U41A 2P5WE 3EUUA 4HCRA 5F1SA 5F6HJ 4JN1L 2B1AH 5HGAA 5ID0B 5HYJD 2OI9B 3MROA 4XXCC 1C16A 2LAGB 4L29B 4ISVB 3I75B 2LFGA 4LHUB 1RIVH 5HYIA 4DJMA 1DBBL 5EN2A 8FABA 3B2VL 3UTSB 4JQIH 4Y7MA 1O5DT 5C0BE 3BE1L 1DQLH 2HKHL 3P30H 4JO1L 2GSIB 5E8PA 3RVXC 2C4XA 3TVMC 3CZJA 3LKSA 4HW6A 1LEKA 4K7FB 2WINA 3IDMA 3SGEH 3RDTD 3U1SH 5C0JB 1GZQB 1QSVA 4HGWB 1MVUB 4CN4A 1PKQE 1SEBB 3UZEA 4NM8L 2IAMA 1XGTB 2VWEE 4MWFB 4RISH 4PJEA 2NXYD 1CT8B 1L9MA 2ZUSA 4XXDB 1AR1C 4LVNB 3LKQB 3CVIL 3TA3B 2NX5B 3OB0K 2EZ0C 4Y5VB 2EC9T 4XPGH 3MRMB 2WK2A 2DAVA 5I1EL 2IBZY 2D7TH 3B3IA 3T1FB 1FZMB 1T7WA 4ELMB 1KNOB 2AGJL 5GRYA 3OG4B 4Y88A 2QQQA 5I74B 1SEBA 5JHLH 1ADQA 3DO7A 4M3KB 1JGLL 2CMRL 1Y6KR 4LLWB 1I1FB 1RZ8B 2FIKA 2ITCA 3FO9A 2OX5A 3VFPA 1CICC 3QPXL 2B1HH 1IFHH 3ZTNL 4X7TB 5GGRA 2QSTA 5HDBE 1S7QB 4MA1C 3QDME 2EYTB 3VI3E 3IDJA 4G9FD 2DKUA 4X7FC 4E5XA 4FFZL 3FL7A 4E0RB 1U8IA 4I4WB 2VSCA 5C6WH 1I1FA 4N0YH 4XNZC 1MH5B 3OJ2C 3ZKQD 3T65A 3AM8C 2F8XC 2Q3ZA 1Q9KB 4NBYB 5B38G 4G6AD 1G9NC 4M1DH 1EIBA 4NCC2 5E1AA 5DWUH 1AGDB 4RMSA 1OARH 1OAZL 4ENED 2FYYA 5D2LE 5SX4H 5FUZL 3VXSD 5D1ZC 1A7RH 1JWMB 3ZZ1A 3VDAA 2X4RB 1LDPL 3QNXB 4YE4H 3PGFL 4WTXA 3KPNA 4NRZA 5B8CB 5CLWA 4LQFL 3T65B 3EYQD 3ULVE 4NQCA 5ALBL 1R0AL 4Y5YA 4N0CD 1MJ7L 4MAYD 5TDPB 3S35H 5HBBA 5EIVA 4LLUB 4PY8I 3UTSE 1JRHL 1NCCL 2BOCB 4K3DL 2PO6C 1HHGA 5IESL 5DMGC 3ZKND 1ITCA 3RUGF 4IIQA 2XG4A 4NYLA 3UZVB 3GMMA 4WHCA 5HVGB 3K2UL 4HFUL 4TQEL 5I9QC 3B9AA 4IOFD 2YMXL 5DLML 2GHWB 4XPBL 4Y5YB 1RJCA 4LHJB 1LILA 2GW5A 3OJDA 3LY6A 5CEYB 3VRIB 3WFBL 1ETZA 5JW4M 4I18A 3V7AG 4IOIA 4QRTA 2VR9A 4M7ZC 3CVHB 3FO2B 1RULH 5FYKH 2QKIB 2ZOLA 5EUOE 4K3DH 4GW1A 1MHCA 3EZJB 4JFXB 1NANH 1CI5A 1OTTC 5D6DA 5B39G 3DMMA 1ZXQA 1ETZB 2EEBA 4I18B 5DD5L 5DJCB 1XR9A 3M8OH 3REVB 5JLZA 3DROB 2OM5A 1F6LL 1RZ7L 5IJKA 1SY6A 1T83A 3S9DB 1PSKH 1BBDL 1FSKB 5FO9B 1QR4A 3KXFE 5DRWA 3T0AA 5CIPH 1HSBB 4Y5XC 1DBJL 4AEEA 3DMMB 2P45B 4Y19D 2XZZA 5JO5B 1K6QL 5DJCA 1T89C 5FKPA 1UKTA 1EEYB 1QSFA 2NY6C 1CE1H 5DUPH 4C4KO 4ZS6D 1G6RH 2OI9C 4PIRF 1MJJA 1CLZL 5GIRA 3V5HA 1QSFE 1HNGA 4RA0C 2FNBA 3WL9B 1RZKL 2QQKL 4JRXB 2R8SL 3KR3H 3PUCA 5IMMA 1A4JB 5KVMC 4XP4L 4DKAA 4ETQA 2EDEA 2FDBP 5L9DH 1JTPA 2ICWB 2WZPD 3IAQA 2N7AA 1M4KA 4RFEA 4LSRL 1DN0A 1PX3A 5E6ID 3IDGB 3JV5A 1JV5B 5DURB 3H2WA 4NNPL 4D9RE 5HYJA 3PGCA 5INCB 2BMKB 1VACA 1AR1D 2UWEA 1E6OL 1IC5H 2AXHA 5CKGA 1XIWA 1T2XA 4YDKL 3ZDXF 5FOBB 3T0DA 1F3DJ 5KVEL 4KK8D 2DQTH 5B3NA 1UH3A 3SCMC 1MCKA 4UB0L 1TVBA 4P4RB 4WUUD 1KLFA 4BUHA 1VPOL 1FVEA 3NN8B 3KAAA 4I77L 3EZ8A 3DV6B 1NBVH 1QFOA 2VKXA 3QG6B 4W4NA 4YUEH 5FOBA 1KLGB 4XPAL 3K8MA 2FO4B 4NO3A 4XNUH 5IEHA 4PJ8C 5IFAL 5E2JA 3JUYA 4XPTH 2I5YH 1TNMA 5GSRB 1AY1L 4OGXL 3B2UC 1G0XA 2QSCH 3KPLA 2NW2A 3P9WB 5IW6B 4AYFA 1K4DB 3LVEA 1PKQA 3UXFA 4D9QD 3WCYA 4IS6B 1P7QA 3UO1L 5IMKA 3PWUA 4FFVC 5FYLH 2Z0BA 1FL3B 4FQJH 5DT1H 4HF5L 4AL8H 2DDQL 2NY0B 2NZ9C 1KB9J 1TVHA 1MHEA 2MWCA 1EEQA 5KSAB 4N0CC 1BFOA 2OZ4A 4G8IA 2XZCL 4QLRA 3QUXC 2DYPA 1XF4A 4FQIH 2J12B 4TSBL 4WFHE 4QWWD 1OCWL 4IS6A 3M1BB 5D7IF 2DWEB 5TQ2H 1K8DB 1K4CA 3V6BR 2JIXD 3E8UH 3NA4A 4YGVA 3V5KB 4OCSH 3QHZL 5KVDH 1TVHB 5GGTH 1LO5A 4NBXB 3UO1H 4OI8A 4NQVB 2XTJD 3C5JA 4WUUE 4EI5A 5ETUA 4HF5H 1NKOA 5I74C 1RVFH 5BRZD 4QHNA 1MUJB 2K1MA 1IM9D 3ZYJA 3VGAB 2X10A 3T1WA 2EIEA 4JPKH 1ZTXH 4FP8L 4X80L 3WE6B 3FOMA 4PV8A 5IGXH 5KSVB 1CZ8H 3L5HA 5CAYB 1J10A 4MDIA 1S9KC 4XPFL 4TNVK 4FQXB 5T1KA 4HWZB 4Y1AB 3IFNH 1R5IB 1P84K 3EYOB 2XNAB 2AJVH 3F7VB 3QXAB 1FL5B 4JO2L 1KTDA 2AW2A 4YXHH 3NCYS 1L0YA 4L8CB 2VJXA 1OT2A 3RX5A 4MJ5B 5KVGL 1I4FB 5T3XE 3V95A 4JFDB 3QDHA 1F42A 1ZGLB 5F9OL 4P9MH 4Y1AA 4ZD3L 4NZDA 1KJMA 4RZCA 4P9HH 3NAAL 1SJEA 1CZ8L 1ZGLP 3RPIA 2Z8RA 3EYOA 5EUOF 1FLTX 2B39A 1KEGL 4MZ2A 1J1PL 3CGTA 4M5ZH 2XZQH 4NT6B 4UTAH 3QEQE 4AJ0A 4Q9CA 1ZLUH 5HGHB 2LV4A 1S3KH 1CGYA 2DTML 1MAMH 5L6YL 2CLZB 3GI8H 4NO2B 5GZOD 1V3JA 1CDGA 5HDBF 2CK0H 4YEEA 1T7VA 2GT9B 1JNJA 3TN0C 1CR9L 2JIXA 2AK4D 2JLLA 1DBAH 4HC1L 4TVPH 1CL7I 3U0PB 3MLZL 2CR3A 1MLCB 3GSNB 4G8FA 1ROWA 4Y2DC 4N0FA 43CAB 4KRPC 1A1NA 3T8XA 3ZKSD 5I1LA 4D0BA 5C08A 5CJQL 1FIEA 1FNAA 3UTSD 4LHUG 5T3XL 5DD1L 4RDQF 1NCUA 3GSWB 2HKFH 1UJ3C 1F6AB 1XAUA 4FXGA 1CK0L 3C6SB 1IGFH 4P46D 4R8WH 4OF7A 5EBGA 2YN5A 4JFEB 3VCLA 3U46A 1PG7L 1RZKH 3P4NB 5DEFB 3A6CL 2H32H 2ZP0T 3T8XB 4XPHH 2X4UA 1XF1A 1U3JA 2FD6L 4HJJH 1NQBA 2DMKA 3SKJL 4KK8C 4YHYB 2VAAA 4E9LA 3BEWA 3RNQB 5JQ6L 1LEGA 2CH8A 1F02I 1I3GL 1J8HD 4KY1L 2YWZA 3O2WH 5HDQH 2YPLD 3NPSC 5HGDB 3VMOA 1JFQH 1KIUA 2F58H 3DMMD 1P7KA 4HV8A 4IRSA 1G7LA 2V2XA 1LK2A 4LVEA 4WTWA 4N1HB 3RWCA 1P4BL 4P2RA 4M7LT 1EO8H 5GGVY 3EJYD 3HMWL 3DPBA 1KULA 2YUZA 5SV4A 5FXCH 4HS3B 3CDGA 3WLWD 5FB8A 3JUZA 4KVCH 2EXYD 4Z8FH 4L1DA 4KRMB 5BS0A 5HGDA 2IFGA 1C8PA 1UFUA 4X9FA 4S11A 3RWCB 3FTGA 1C5CL 1YNTA 4JE4B 5C0IA 4OLUH 1R3LB 1LEIA 12E8L 3V7MA 1U6AL 3FO1B 5EU5B 4UU9A 5IB5A 4KHXH 4PJ9D 4GG6A 1IVLA 1IJ9A 4N0RA 2P7TB 2E7BA 2YMXH 5I71B 3G5VB 4TRPL 5F7MC 3SKOB 5C0IB 5IK3A 3QWRA 1JHKH 4OQTA 1F4WL 1J7VR 2PW1B 4BFEA 1KG0B 3DUSB 5C0BD 3QO0B 3BGAA 5C0AA 4QT5A 1UEYA 4XMPH 2A0LD 2Z92B 5ITFB 4ODBD 4OM1L 2ORBL 4BFIA 2XTJC 4KV5F 2IAND 4U1KB 3BJLA 4RBPK 2X9YA 5ESQB 1NUGA 2Z9TA 4CVUA 2XKUA 4ETYA 4YHPB 2YC1B 5ANME 2IBBA 4PGDB 2YWYA 5IB3A 5MEOA 2UZIL 3F12B 5INDB 1TPXC 1M7DB 3LN5A 3PG2A 4FQXC 5DD5H 3UC0L 1FGNH 5C0AB 3FN0H 4ZFFB 4K8RL 3HZKA 1I1AB 3SQOH 3B8SA 1U95B 3T77B 2AV1B 1FDLL 1YDPA 5HYQB 4C83B 3U4AA 2IF7A 4PP1D 4Y1AE 4YHPA 3EKCA 3MODH 4K07A 1P2CB 1R3IH 3X3FH 1ZGLM 1UXSB 5DVOA 1FG9C 4L5FL 4M7JL 4JZNB 4PBWD 4HUXB 1N8ZA 2YPKA 4KI5D 1YDPB 3QUMB 3MLTB 5J3HD 1CDHA 2H2SC 5HI3D 2HLFC 4J1UA 2I9LB 1PZ5B 4B53A 2AVGA 4YZFF 3PWJB 2XWTA 2FB4H 5DJ2A 4HPOL 4P5MB 3IDUA 1D5MB 5EZOH 3RBGA 5FF6B 1N2RA 3HNSH 4Z95L 3CFDA 3NMEA 3PWNA 4WVRA 1AD9B 4JVWA 4PLKD 5CEXB 4AH2A 2Y5TA 5FK9A 4FQQB 5BZWA 2ADIB 2OTPA 1YMHA 2LTQC 3P0GB 1PZ5A 5IEKA 2BVOB 3BZEB 1NLDH 3QIBD 1YUHA 4PJBB 2AK4E 4Q6IA 1EH9A 1UJ3B 4OZHE 2X7LA 1CVSC 4P59H 3OF6A 3DGGB 3O4LE 1XGTA 2BVQA 2IG2H 3NIDE 4MWFA 4U6XA 5EDXA 5J56B 2CKBL 1GYAA 4JFZL 1TETL 3BKYH 4JFOB 4PJBA 5T1KD 3VMPA 3LN9A 4MJID 5I1KH 1FCCA 4K94C 5C71A 5CD3B 1I3RA 1X5ZA 2X7LB 4PY7A 1AGFA 2PETA 2AK4A 4HWEL 15C8L 3RVWD 1JHLL 2AEQH 3IF1B 3MV7A 4NQTA 4UINL 2VZOA 5K59F 3TGXA 1CFNA 3DSNA 2P8LA 4BQ8A 2C1OB 2XA3A 1BIIA 1OAUL 5C6TL 4JAMB 1KT2A 4Z7WE 2DI7A 2RBLA 5ISZE 1KPRA 1RUPH 2C5DC 5F1OB 5IM7A 5E7BA 4NCDA 4F33A 3VFTA 4JFYA 5EUKB 3KPRB 5DEZA 3D3VA 3C8DA 2GYSA 4ERSL 3O0RH 3B9KD 2V17H 3D3VE 3HE6A 1IGJB 3L3GB 4PBVC 4I9WE 1UQSA 1OTUC 1YNKL 4KJQD 3HMWH 4AEFA 3BKML 4K8RC 1Q9OB 1CXKA 3MYJB 1DLHB 5TE4L 3UROR 2EDXA 5HYJE 1C5BL 3DETD 1A6UL 2R23B 5FKAA 4PUBH 4N9OB 1CIDA 1HKLL 3GBNH 2BNUB 3CZFA 3LEYH 1WBYA 4ZUSA 3BPLC 1QSEE 2WLYA 3G6JE 3GBLA 3O2DA 4LPXA 3LD8B 4F15C 2AS5M 1U3HD 5DZNA 2MCG1 4G8EA 3LOWA 5I19L 1AKJD 1SYSA 1WFOA 2V2TB 2EH8L 3BIKB 1A7PL 1MCSA 1T1YA 4EI6A 1HHIB 1MCLA 1R3KB 2XTJB 4GKSB 5E9DB 1FGNL 4PGZA 4P5TD 1JZ2A 4H8WH 2APWA 5JXAH 3VMNA 2BHZA 3MGTB 2A77L 3EFDL 3MRLA 2FWOB 3BZ4A 2RIKA 1P69B 3OR6B 2P42B 1IILE 3OXSB 3VGFA 1QHOA 4LQ1A 4U49A 1WAAA 4Z7QF 2VN7A 4WW2A 3T2PA 2O61A 1G7QB 4KTEH 2Q3AA 3BP6A 4U1SB 3MRCB 3GIZL 3CFKA 3MCKA 3OJMB 4WUKL 1YYMH 1S3KL 3S3SA 4YH6A 1L7IL 2DQUL 3PDGA 5J9PA 1CIUA 4I3GA 4JRYB 4RNRA 1ND0A 2JJUA 3GMQA 4CMMA 2KPNA 4KROD 4AIOA 2WP3T 4NQED 3TV3H 3QJFB 5I73B 1P4BH 1GOGA 3Q1SL 3QUYD 2X1QA 4E41B 3O9WB 2DBJA 3IGAA 2V2WB 3E8UL 3FRUB 3FRPG 3QQ9D 1BHGA 3D39E 2I9TA 1HSAB 2NXYC 2EKSA 3BPNB 5C6PB 2NLJB 3P77B 3CUPA 3UAJC 4YHOL 4HWNA 3GKWH 4JLRB 2C1PA 4M61B 3TYFB 1L7IH 5DUML 2VLLA 3ZYZA 3K4AA 2D9QB 2E5EA 4NFCA 2CKBB 2ICWA 2MKLC 3E2HB 3LPWA 3ZDYF 3FQTA 1T6VN 1FV1B 5FM8A 1MNUH 4BH7A 3QEGH 4TTDC 4OGAC 5C0EB 4X83A 2NYYD 3NBNA 2JJTA 1NMBL 2MPAL 1DSFL 4OFYA 3QRGH 4HIXH 1SEQH 4PTUA 2MTPA 2WUCH 1AC6A 1R5WA 4PJIA 1L6ZA 1XR8A 2E6PA 3QHFH 4GKZB 5F1NB 5TDOA 3VGBA 3RWJA 3PGDB 3AAZB 4LDOB 5C8JA 2J8UB 4PJCA 3SCMB 1TVBB 2OS7A 3FZUD 3GK8H 1PQZA 3V4PH 3FO0L 4OKVA 4NQDD 3VH8B 3C2AH 1QKZL 2R1XB 1P5UA 2ITDB 3T08A 4CVWA 3D3VD 1RZIB 3CFCL 4FOMA 1XGPB 4WDIB 5F1NA 4NQDE 2A74A 4HGMA 4KI5C 5HHVL 3SDCD 2I60L 1ZHLB 4ZSOE 4P4KD 2M1KA 2F53D 4HUKB 3EYSH 5CZVL 5EO0A 4HUMB 2NQCA 2ZJSL 1LP9F 1RZIA 2BCKA 3SPVB 1TENA 2A74B 3PQYD 3BQUC 4QRSB 4PRPA 1FE8L 3KYAA 3ILPA 3PWVA 1DQQB 3TBYB 3EO9L 3VFWB 1IMHC 5EO0B 1H5BA 3NZ8B 3MC0A 3MUY1 1XF4B 1INQB 3OHXB 4GSDL 3FQWA 1CDJA 3QO1A 4XMPL 2AXFA 3TIEB 1J1XH 4GG8A 3W9EA 1E4XI 4UNVA 5IVXA 1TVDA 5ISZD 3BH8B 4HMDA 4UTBL 3ZE1E 1UC6A 2CDGB 3JSSA 1BD2D 4QHKJ 3NZ8A 3KPTA 1G1CA 1GGBL 1RU9H 2VITA 1AD0A 3SDAB 5DD6B 3JXAA 4OCYL 1A6AA 5JPNB 4LVNC 3N1FC 5D1XC 3S37L 4P3WA 5TQ0H 4MNQD 4UOJA 1G1YA 4GRLC 3LS5H 4WWKD 3W39A 3K1DA 3WIIL 4P4KB 2NY3D 1R5IA 3WDJA 3GM8A 1IKFH 1CLCA 1YC8A 2ICES 4Y4HD 2HWZL 4OFDA 1A6ZB 4U1NB 2E7MA 2AK1L 1IAOB 4L8CA 1HXYB 2YD7A 2J7LA 3BHBB 4M6OL 3ZO0A 1HCFX 4G7VH 1KFAH 1CFBA 3S88H 4KWUA 1JE6A 4N5UA 2HAZA 1VGEL 2XN9A 5DK0B 3PQYA 4Q2ZA 2HVJA 2Z93A 5I16A 2EC9U 4JJ5A 5BQ7B 3KDMA 2B0SL 2A9MH 1NSNH 2CJUH 5DZLA 4XNQB 3BHBA 4GMSH 3HNSL 1YEKL 3MLSL 3DX7A 3HC3L 3LRSA 4C56D 2FL5B 1VPOH 4XH2A 1X7QA 5I6XC 5CIPB 3OB0H 2HYMA 4PJ7A 2JB5L 3O3EB 3D6GA 4JZJB 2DQIH 3QT2A 2EH7L 1KCRH 1T0MB 2Y07L 1VGEH 4NQUA 2Q6WB 4G8FB 4G5ZL 1U91B 4D0BB 4X9BA 1X5IA 1RZJL 3BEVB 4HPYH 3WS6A 2FR4A 1YEKH 3GSWA 3WO4C 1KN4L 2LQRA 4A6YA 3W0WB 5BVJA 3OKMA 5I1AA 1JK8A 5HVFB 4LGSB 3FT4A 4L8SA 1M1SA 3ARBD 2AJZB 2V9TA 4GXVH 4F57L 2VDKH 4NQDA 2BSTB 1G7MB 1ZWIB 3W2DH 1GGYA 2NY2D 1D5XA 5BXFA 1IAKA 4OTXL 1MRFL 1S7RB 2OP4L 4Y8AA 3MODL 1NCCH 4K23H 4U33A 5C0CA 5F7YC 2IBGA 5IESH 3FT4B 5D7IB 3ECBA 4L4TE 3BN3B 4LF3B 2Q7YB 3O6LL 1T21A 4LLVA 1HILA 3BRDA 3QNYB 4ZDHB 4YR6B 1NGQL 4JN2B 4JKPH 2VZ1A 5C0NC 3MUJA 2R1WB 2Y72A 3H9SE 5FECB 2AQ1A 3QWOA 4LLYA 4M43H 2ADJB 1UWGH 4HS3A 3W11C 2F8VA 3NCBB 5L2JB 1A9EB 1WCQA 3DURA 1QPPA 4LHQB 4J6RH 4QOKE 4U2ZA 4RCAA 4JPIB 4Y5XB 4OB5H 1MAJA 4N68A 3BZFA 1V7ML 4BQ9A 4GRWE 3BKCL 4LCCA 4LLDB 2PNDA 3NZHL 1AHWB 2IQ9H 4HUVA 4Q9RL 3TPUB 2ADJA 4NQEA 1UA6H 4OLWH 2O5XH 4K3HA 1EHAA 5L2JA 2G75A 1NCBH 5KS9A 4NHCH 1ZTXL 4RWYL 2FHBA 1XZ0A 4ORGA 3I3DA 5DZOA 3IJYA 1G7PB 3TFKD 2E7HA 3RWFB 2V6HA 5FUCC 5T3ZL 4XAWL 4LVOC 3QDJE 3VXUA 4ZFOB 3O2DL 3VFVB 2PW1A 1BLNB 1DEEB 2V5YA 4HLZG 3QUYC 5KS9B 1HNFA 5L8JB 3KPQA 5B21A 1U8QB 4X6BB 4C58B 3HPJB 1WZMA 2A83B 2Z35B 5E9DD 2GUOB 4NM4H 3NOIA 3RL2A 2HFFB 5FYJD 1Q1JH 3CXHJ 3BT2L 3KPRD 1J1XL 3EHBD 3RGVC 3D25B 3QFJD 5TFSH 5CJQH 4HIIB 2EDTA 1RUPL 2I26N 4H8WC 2UVFA 3BWAA 1J12A 1I9RL 4N8VG 2ICEA 1D3CA 4LSTL 4UV7L 3W82A 2X1XR 3RWGA 1BQLL 5T33H 1P2CA 1H8NA 4HIEB 1GC1C 1IAIH 4FNLH 1ORSB 3BD3A 3RTQB 1F00I 3FO0H 3MJGX 4HIIA 3Q5TA 3W9DA 1MJ8H 5BMFL 1Q38A 4XP5L 4M5YH 5D8JH 1AXTL 1FYTD 5J6HA 3OAZH 4KI5F 3PHQA 4F2MA 4CGTA 3FONA 3GGWA 4MXVF 3HE7C 2CSPA 3U6RB 2XWTB 4M6AA 3RHWF 2PUQT 3T0EE 3WSQL 3BE1H 4WFFE 3HKFA 4JHWH 3GBMH 4APQB 2Z31A 4LBEB 3WFCL 1RZJC 5IHZB 3ETBF 4MXQC 4U3XA 5JOPD 1WUNT 2MCPH 1JMXA 5LGJB 3CU1A 3MUGA 4RDQG 5KVDL 2GK2A 2VABB 3DRTB 2XWBB 3SGDI 3QBTB 1PYWB 5DEGA 3KS0H 3G04B 3ZMRA 1MFBH 1RQ5A 2A9NH 2B4CL 5ISZA 3TZVC 3WN5A 5F7UA 1KGCD 2YR3A 4ZOEA 3WXVL 3BVNB 4K7PY 4RRPG 3QHFL 1BREA 1T80A 2JCCA 1JFQL 1KV3A 3DGGA 2R69H 5J57B 5C09B 5LGJA 5T1MB 2BRQA 3L5WB 4OQTH 1U36A 3KYOA 2O93L 3OMZA 1PYWA 1Z5LB 3GMPA 2IEPA 4NC1C 4DCQA 1ZS8A 2F74B 4K71C 1U8PB 4EVNB 5HPMA 5DHVB 3Q3GA 2I27N 1YYML 1I3RB 4R96B 4KK5C 4ZXBB 1MHHB 2AK4B 4PJBE 4WY7L 4Y16C 5C0GB 4RFNC 1ZE3C 2VDKL 3KYOB 1SY6L 4HBQA 5F8RC 2BSSA 4UT6L 3D85B 3PHOB 4Q0XH 3LKNB 5HY9A 2KKQA 2BVYA 5E5RB 3E1F1 1Q72H 4ZUWB 8CGTA 2OP4H 2D9CA 1KTKE 3EIFA 1DQMH 1ZHBB 3MV01 3H9ZA 5CJXA 2ICWI 3TA3D 5D7JB 4XBPB 1P4LA 1BVLA 4Z7OF 4HEPG 5T1LA 4I48A 1OWRM 3AREA 5JIIA 5IQ9A 3WJJA 4Y4HA 1I1YB 2ZKHH 3BUYB 3V8OA 4JFYB 5EUKA 3WHE1 3FT2B 5JHDA 3GSRB 4MJ6B 4OCWL 4U6YA 5HY9B 1SY6H 1FL6A 3ARYA 1P1ZA 2DJUA 1KJ2L 4QHMB 5D5ME 3S88L 1HQRB 3CC5B 4H20L 3HUJF 1BVZA 3RKDD 1T03H 4G6FB 3QIWD 1KPUA 2Y7QA 3QWRD 4R0LC 5IR1B 1H3PH 3V7AE 3RVVC 1EUUA 2ED7A 5D1QC 4XBGB 2BOBA 4XNXL 4L4VA 3HE7B 1RFDL 4P2OD 4F3FA 4QHLB 1F8TH 2ZNWA 1I9JH 5FEBA 3VRLE 1B4JH 5DI8B 2FECL 4X6CA 3UTZB 5BS0D 1KENL 3ES6A 3UJIH 3V5DB 1QG3A 3GJFH 1ZLSL 4MD0B 4YXKL 5HI3C 5B8CC 4G9FA 2EYSB 2BOBB 1UM5H 1ZK9A 2P5WB 3C2AL 1YY9D 4KPHH 1ZT7B 3H0TA 3NA9L 4RQQA 4XCNB 1HIML 1JCKA 2WINB 4KZEH 1LK3L 4DTGL 1NBQA 1FJ1A 1G9MC 1QLEH 1JWUA 1IQWH 5I18H 4WJ5B 5DI8A 5ITBL 3OKOA 3VXPB 1U3HB 5FUOH 3MRPB 4MX7B 5EU6B 5I8KL 2CLRA 4QXGL 3DXAD 2J5LC 2Y36L 3OSKA 3I6LD 4WU5A 3O6MH 2OQJA 5HYEA 1DVFD 2EIDA 3UJIL 2NW3B 2Q87A 2DF3A 3PQYE 4JO4L 2FJHB 3B3IB 3T1FA 4PRID 2BXYA 4FN0A 4XVTH 4ELMA 5LQBH 1JWUB 4WJ5A 4NWUH 1CTOA 5B38B 4K94L 5A3IC 2EE9A 3EDKA 1IKNA 1ADQL 4JM2A 5K9QG 5M94B 2OTUA 3C9NB 5BZDB 4QHKI 1EVUA 1MF2H 1CBVL 5IROA 1NLDL 4QXTB 3DXAE 5BRZE 5IJVA 3DVNA 1IAMA 3FRUA 4S0TD 5B38A 4OQ1A 4KVNH 4HX1A 5I2IB 4JHZA 4MB5A 5J1TC 4MXQD 3MV9A 4NZUL 1KIRB 2ZSVA 4YDIL 5T1DL 4JM4L 2VKWA 3SE3A 4UV4L 1W72H 5BMFH 5T5NG 4M61A 5EH1A 3CU7A 1T04A 1QFWM 5H94B 3IRPX 4PR5B 4XC1H 3NZHH 2HLAB 4NN7C 1WWCA 3DVNB 5HHQA 2X4RA 3GHEL 4MAUL 3E2HC 3QISA 4HX1B 5I2IA 1QBLL 3RL1B 2D31A 4YDKH 25C8L 5A2JH 1WEJH 4P99A 1FGVH 4P5TC 4QKXB 5HVHB 5FA3B 4QRPB 5I30L 5E24E 4HWUA 3KLDA 3ILQC 4U1JA 3TH4T 1DR9A 1DBBH 2HH0H 3B8YA 2IWGA 2XPGB 1R5WB 5TDOB 1CFSA 3RWJB 5BJTB 3MRRA 4HKXA 4YHIA 2W65A 2YXFA 4JDZB 5E8OB 1Y6NR 5TGBA 2ZG1A 4PJ5A 4RMRA 4P2OC 1EUTA 2HTKD 4X98A 2DLFH 1EJOL 3V2AR 4LAQH 4I0PB 2A6KA 4P23C 4TOYL 2D4DA 3O0RL 4ZAKB 5F9JB 1SM3L 4O2CB 2P47B 5I66B 5IHLB 2R1YA 1ZHKB 1U3HC 4QF1B 3LKOA 1OAQH 4BSWA 1NH6A 3AC0A 4OCNC 5D7IE 4EZMA 4Y4FA 3PL6A 2D3VA 3NGBB 1OGTA 4KUCF 2A6KB 3MXVL 4NN5C 3S8WA 3QDJB 3RGHA 3MJ7A 4JQXC 4X4XB 3WDHA 2VIRB 3QEUA 5KOMC 5GGTA 1PW3A 4NP4L 2CPCA 1UH4A 5FGBA 3VXTA 2RFXB 3F58L 1GHFL 1E4KC 1JNNH 4WFFD 3FB5A 2NTFA 1QFHA 1BJ1J 4L9LA 3ZTNH 1HSBA 4PRHD 4M5YL 1AQKH 4HBCL 3GIVB 2A1WL 3WNOA 1QHPA 1NCAL 1DANT 5FKPB 2VUYA 4OZIB 3B9DA 4MQXC 2A6JB 2Z31D 1AXSB 1RZ7H 3M17A 1QBML 3MNVB 1R3JB 3SKUD 4HG4J 2IGFL 3BP4B 4K3JH 3L95B 1GGCH 3BH8A 3ULUD 4E42A 1JGEB 3VXSB 1FPTL 4ETQB 2F15A 1PY4A 1CFQA 1M71A 5JOFB 4CBPA 3WXWH 1HDMB 1JHTB 1ZA6A 4ODXB 3H9SB 3QUZD 5F71A 5GSVB 1EFQA 3D39A 1MCCA 1ES0A 3BP7B 3UJTL 1YMMB 1UB5A 2ZG2A 3CPLB 3U9UA 1Z9MA 2RB8A 4AMKH 1PBYA 2APBA 4X6EA 1A1MA 1NMCC 4P4KC 3ZTJG 5HVHC 1RUAH 1CFQB 1A6TA 1UVQA 3OR7A 1QFWL 4R4FH 1HDMA 4KMQA 1VFOA 3PL6D 4U05A 3WO3B 3QPQD 3RWEA 4LSRH 3VGEA 2P5EA 1MVFA 5FUZH 4O02L 5C86A 4PJAE 1BVKA 2DD8H 4OFVA 5IBTL 3GB7B 2E27H 3QDJD 5DD3H 4DKEL 4YBQD 4I0PC 2W91A 2ZNXA 3BAEL 3QG6A 4S2SB 1NCBL 2R2HB 5FM4A 4PLJC 1QUNA 1LE5A 3CJJA 3GSNH 3RX7A 3LDBB 4Z7UA 1GOFA 3NTCL 1HEZA 5CIPA 2VDQL 5C3LD 1KTRL 4FRWA 4JFHD 3AFLA 1T2JA 2W9LA 1SMOA 5I75C 5DVMA 2Z8VC 4NKQB 3QUKA 1T0MA 3HAEG 1VERA 1HH6A 2HKFL 1YEJL 4XMLL 2E27L 1C1EL 1NCNA 1OOAA 2WIIA 1DQJA 3ULSB 1OQOA 3P73A 2ADGB 1MRCL 2COQA 1M6OB 5D5MB 3X3GH 1D6EB 5LBSL 1NEZA 3WUWA 4BQBA 3KYNA 4H1LA 4WV1A 2IALB 4JRXD 4WUUB 1EFXA 3C2SA 3SKJH 2YPVL 6FABH 1VENA 1F3RB 2AJZA 1FNFA 4HG4K 5IW3A 4PG2C 2BSTA 1BZ7A 4MA8L 1B2WH 4HH9A 4P49A 5I1HL 3MV9D 3SGJA 1YEJH 4XMLH 1DUYB 1YQVH 2IAMC 1A9BA 3ILQD 3BDYH 2OJZH 4NRYA 4DWHA 4L3ED 4RFOL 5CBEA 5EG6C 3WS3A 1T21B 4LLVB 4MVBD 2HRPL 2YPVH 3DX9B 5E4IA 1LO4L 1FYHB 5I1GL 1IGMH 3C5ZA 1YPZF 4HWZA 5DFVC 1DP0A 2PCPA 3P9MB 5GZNC 2Y6SC 3LB6C 2R2EB 5EO9B 4G9DB 3QG7L 2BERA 5JHDE 3OX8A 1CICA 1Y0LB 3I6KA 4U7SA 4MA3B 5AZEH 12E8H 1BP3B 4WEUD 3BZFB 2VDRL 3X13A 4LSUH 1CLOH 1HWHB 3NABH 4RZCB 1F5WA 3EJYC 2KDGA 3SO5A 3GEWB 3QXWA 1FO0L 1NKRA 2AK1H 2DOCA 3L5IA 2LU4A 2M2DA 4BH8B 2VC2L 3DJ9A 3P4LA 1XCQB 1I8KA 1ADQH 1IQDB 4JQIL 5E5UB 1GSMA 5KVGH 2MQ0A 3SDYL 2DMCA 1XZ0B 4ORGB 5CWSB 1WISA 1N26A 1RUML 4OZHA 1LO2H 3KXFA 4NO0D 4PJ9A 5C0FB 3LS5L 4IRJC 3TESA 5DK2A 5F7LB 2ARJA 4JG1L 4NGHH 5IB1B 3Q5YA 3VWKA 5I17B 2CDFB 1QR1A 4M5ZL 3IJHB 4PGEA 1NBZB 3WXWL 1S7SB 1DEEA 1UWXH 2DS4A 1AE6L 4RMVA 3KLSA 1U8QA 4X6BA 3PWLB 2GK0B 5L2KB 5HHXH 2AABL 5HHOD 1OPGH 3ULUC 4AEIH 3BMVA 3D2UA 4Q97A 1IC7L 1RUQH 3U9PH 4OZHB 2PO6A 1YEHH 4PJ9B 1F6AA 3FAWA 4FXGB 5C0FA 5DK2B 4JKLA 2ARJB 1VFMA 5I17A 5E99L 1NBZA 2IJ0C 2HA1A 2HFTA 1NSNL 2DJ4A 2UY7A 2GI7A 3GSXA 3S5LB 1PY9A 3QEHB 3NGBC 5D1XD 4PJDB 2ICEB 1IAIM 4NN5B 4F37K 1J87A 1LEGB 2GFBA 1IGFL 3FFCD 3GSVA 3VXUE 2DLGA 3T0EA 3RDTA 4JKMA 4LSPL 4FQJL 4GO6B 5F97E 1ZHNB 3PIQB 4FQ1L 2UWEE 4JPKL 2J5LB 1BD2A 2VLRB 4TSCL 3KLHC 2YEZA 1MCQA 3SQBA 2FH8A 5KSBF 5MI0B 4ODSH 1LK2B 4QHUB 4XC3H 5KS9E 1JN6A 5C9JB 5GS0H 3QA3B 4OAWB 1HE7A 1XGRB 4D0CB 1RHHB 4ZPTB 1YC7A 3CFCH 4UMGA 4XHQA 5M95B 1JGUL 3RDTB 1OAQL 3PIQA 1ZHNA 4WI2A 4JDTL 3RHWK 4FFWD 4IJ3C 5ANMA 5HHVH 3MRJB 4QCIA 5MEND 4XC1L 4APQD 1B88A 5EBMB 2YEZB 1KF9B 3MTRA 1P9MC 4EBQL 2YRLA 4NNXB 1J8HE 2LU7A 1MI5D 1MCPH 5JZ7C 3EYSL 2HVKB 1PSKL 1QZ1A 5EU4B 4ZTPL 1A6PA 4X6FA 5C0AE 1JUFA 5K9OB 1B6UA 2IMMA 3ROOA 2NY1C 4DKFL 2EYRB 2CRMA 3B43A 4LEOB 5HJ3B 1ZVSA 3F58H 5LWYH 4YHZL 1X5JA 1DUZA 3MRFB 5EOCL 2HH0L 5IQ7H 1S7TB 4ODTH 2BSED 4AEHH 4MD5B 3BGMB 3FCTB 4KK6D 5IFJB 1Q8MA 3VWJB 3BXNA 1KYOK 1IBGH 2CLVA 4HZLA 3VGGA 2P8MA 4NJ9H 1FLRL 3S34H 1Z5LA 1Y18A 5D71H 5GHWL 4K71B 3G08B 4NPYB 4D2NA 4EVNA 1A14L 1SM3H 3NIGE 3L3KA 1RIHL 3NFSH 7FABH 4MD5A 1ZLUK 3MLXL 5ECJE 4G6MH 4DKDC 4JFEE 3OKLB 4DAGH 3S36L 5FDWA 1KCUH 3QUML 5FA4B 4RGND 3EYVB 5JPMA 1BQHG 2F53E 3HI1B 1LP9E 4YXLL 5AWNH 1NC4B 4NJ9L 1D9KC 4PP2B 3MA7A 1XGYH 4XWGL 3WBDA 5JR1H 1ZHBA 3RY4A 3FQXB 3H42L 4XP1H 1NLBH 4PP1C 3DETC 3MLZH 3ZTJH 1DBJH 4JM4H 3P0YL 4JHAL 5EORH 2J6EL 3G5YB 2BDNL 4ZAKD 1YQ2A 3REWA 5E03A 1C5DB 4PJ7E 2H9GB 2J4WL 2CIIB 1WZKA 3HMXA 1KCUL 3OGCB 3O4OB 4IMLB 3OAZK 3DUUA 4QHMA 5DD1H 4OIIH 4LHUA 4MXWL 3X12A 3CC5A 4I3RH 3FQXA 3BZDA 8FABB 2L0DA 5JW3H 4YHNB 5IR1A 3ARGD 4MCYB 4L4TA 1IAIL 4FNLL 2DQJL 3RUGE 1JGVL 2FJGB 1GIGH 1IM9B 2FCBA 4OGYH 2PW2B 2VDRH 3RTQC 4LSUL 4A6YL 3RZCB 1HOCB 2AEIT 4Z7UE 1GZQA 2AJXH 4OZFB 1TETH 3M45A 1OPGL 4U7KA 4M48H 2YHGA 4PJEB 2B5IB 2ADIA 3QDMA 2XRAH 5DMYA 5DJXB 2X05A 2DKMA 3EFDH 4FMKA 3UTQA 3TBSB 1EFXD 3QQ4A 5DUBB 5DWUL 1FJ1B 1LO2L 4PRNA 4YK4B 5DR5L 1WF5A 2V7HA 2HJLA 1UM4L 1JYWA 1EZVY 2CLRB 1VSCA 4P2QD 4PRHA 3RWDB 4KKBD 2ITCB 1GZPA 4WU5B 5AD0B 3RU8L 4X7DC 3A0OA 1CFVL 3UTQB 3TBSA 3QQ4B 3B9KA 2NY7H 5DUBA 1MRFH 2P1YA 1YEHL 4WI9A 3KLHD 4H25B 4ODWB 3LQAL 1QNZH 4R2GD 5BW7A 4MMZC 1ZKAA 3D0VB 3PWPE 4HQQH 2WBWB 3O3AB 5BVPL 2BNQD 3H7LA 3K2UH 4XXDA 5DK3A 3ISWA 3TPKA 5HHOE 3RA7L 5IV2B 3C9NA 3QIBC 2EDBA 5BZDA 5I1KL 2EXWD 1S7UA 2E3VA 4PRPE 2B4CH 4Z0BL 3CFBB 1QFUL 4H88L 4ODWA 4HS8L 2OL3L 1WBXB 4HIHA 4OT1L 2A73B 4HS6B 5JA9A 4HKZA 4K8RD 4QRUA 1S8DB 3KPNB 4NRZB 3F6IA 5DQ9A 1KIRA 2ZSVB 4JANB 3BISA 5IV2A 4OM1H 3MLPA 4ZUUB 1MQ8A 1S7UB 1QTYT 5I1JH 5E56A 1RI8A 4XNMB 3QJHB 1M7XA 4TUJA 4CADA 2OTWA 2MPAH 3M8OL 1G84A 4PRBA 4DW2H 3FT3A 3RL1A 2BJMH 1UA6L 1WFUA 1F4AA 2VDNL 1YA5A 4LU5L 2XOTA 1BZ9A 5SWSA 4Z7NF 5EZOL 5F7DB 2BNUA 1RSFA 1B90A 1WICA 3LIZH 3SY0B 4OZGA 1ZT1B 4KJYA 3WIHA 3I50H 3SBWA 2O26U 4G8GE 1AI1L 3AROA 3DX6A 3U2SA 3GSQA 1LD9B 4I9WD 3QIWB 5D1QD 1IFHL 3GUTA 5ID1B 3L7FA 1F11B 2MHAB 3P11L 1NAKH 4JDVA 5HHXL 2Y25A 3F5WB 1NUNB 2ZCKH 1BWMA 2UYLB 1JPSL 4LLUA 3JV6A 2FATL 1MFAH 4C4KT 3S98A 5CCKH 4M7LH 4ZAKA 5F9JA 1ZT1A 4KJYB 5A3ID 2E7LC 4XAKE 4FQHB 3UTTE 32C2B 3TT1H 3JZ7A 1BAFL 1Q1JL 4HJ0D 3MV7D 2PYFB 4LHUD 4RGNC 1IGYB 2H41A 1TCRA 2BNRE 2W0FA 1WK0A 1A7PH 3FZUC 1NCDH 4CNIA 1X5FA 4V1DE 4FA8A 1D9KD 5H2BB 2I24N 1CGUA 3VRIA 4LARH 3JV6B 3VE0A 4HSQA 4G42B 1INDL 1KXQE 2M26A 3PGFH 4IOIB 2VIRA 3QEUB 3IU3A 2F58L 3HNVH 3TVMB 2ZOLB 1KOAA 3UPAA 1EO7A 1OLZA 4F9PA 1H3XA 1ZOXA 2AI0H 4YAQA 3ZKXB 4CNIB 5E2VL 1H9VA 5ICYA 2GCYB 1OD7A 3EOTL 4NKDB 3X11B 3MX0A 3GIVA 4A6YH 4LASH 1NCDL 4KVCL 4Z8FL 2BC4B 5F70A 1A6WL 4R2GC 2CGRH 5JLZB 1F2XK 1QFPA 3TVMA 1UACL 3ARPA 3M17B 3WJLA 3NCJL 4NZTL 2EKSB 5KJRH 1KXVC 2ZWLT 1TJHH 2NLJA 5E70A 3V6OA 1CD1B 3DNKA 2EXYC 1NFDE 1U3YA 4OLYL 1VKXA 5EUOB 4KHXL 6CGTA 2EE6A 2VZVA 2BVPA 1KXTB 1OAZH 1ZA6B 4IRJB 4JGMA 4ODXA 1MJJB 5GSVA 3NIFE 5C0RH 2G60H 5JQ6H 1TQCC 2DI8A 4LFHD 1CU4L 4S1QH 4BH7B 1YMMA 5L2KD 2X41A 3K74B 3UJJH 3EYUL 43C9B 3NCJH 3G9AB 1FFNA 3BDXA 4M62H 4PY8J 3SDXB 3LKPA 1GGIL 4RFNB 4UILH 1NFIA 1OF2A 2IANE 3CK0H 1A6VH 3T0XA 3TO2A 4KK6C 3O4OC 3FOLB 3BX7C 2EIZB 5I30H 2EDJA 2NX5D 5BO1L 4UIKL 2NW2B 5TPWH 4LIQL 2VXTL 2A2QT 5D7JC 5KZCB 3SDXA 1RJYA 4HKBA 1H0DB 2FO1A 1YJDC 2VMFA 3UC0H 2C26A 4BELD 4F7EA 3TLRA 4NKMA 3CH1B 3LDBC 5GGUA 4E41D 4J4PA 4FQ2H 3BN9D 3C8KA 4U1LA 1JGDA 2Q7NA 2EIZA 1EJOH 3JTSB 5HI5D 1HH9B 4XPFH 3KHQA 3P4MB 1U92B 2MQ3A 4J12A 4UQ3A 5K59E 4G3YL 3LKRB 3UYRL 3F7YB 2J4WH 3RVTD 1DQJB 1PDKA 3BP5A 5F3HA 3ULSA 3Q0HA 5C0DA 2I60H 2KBGA 4U1LB 4IJ3B 5D5MA 1LO5B 1EERB 4JFFA 4POUB 3UTSA 3KPLB 4OLVH 3P4MA 5C2UB 4ZNCD 3SGDH 3MV7E 3LIZL 1MUJA 3SDDD 1JF6A 3LS4H 1FP5A 4XAKD 2HG5A 3QO1B 2PF6A 3HB3C 1FBIL 4Y4KB 3CSPA 1A1OA 2BHUA 1MHEB 1G9EA 3PNWB 5KSAA 1WT5C 4LSQH 3GI8L 3H6JA 2IAMB 1FZKB 4OZIF 3KLAB 1MFAL 4DW2L 3F7VA 1FL5A 1D5ZA 4F7CB 1DBML 4G6JL 4YDJA 3SDAA 3VWJC 4FXKA 2VDNH 1A6AB 1KUMA 3MBEC 5ABDE 2MSPA 1V3MA 2KZWA 4XP1L 1XF2B 3ME0A 4P9ML 3NH7L 3QEGL 2DQGH 3QI9B 2QSCL 2SEBA 4RAUB 2EEAA 4GXUM 1SJEB 4N8CL 5EB9A 5F3BB 5DJAA 3CFEB 3KLAA 4PG9B 4LLWA 4PRIE 2O5YH 4YGAB 4HDIA 3DV4B 4QXGH 2Z8SA 4B5EA 1NCAH 3WE6A 3NPZB 1U8LA 1LO3L 2X89A 1EXUA 2HTKC 3HI6H 3RX8A 4EIZC 4FQLH 3I02B 2C7UA 1NMCB 5E94B 2DQGL 1MPAH 4JR9H 2XNAA 1IKFL 1U8IB 4PJHB 4XX1E 5F9AC 3ZE1F 4UB0H 4ONHA 1XGQA 5CP7B 4UV4H 4EDWH 3U0PA 4R3SA 4PGJA 5F7HA 4U7MA 1EEZB 4MSWB 1FG2B 3QNZB 1UJTA 3OXRB 5A2IH 3UZQA 1NAML 4HS8H 3V6ZA 1T22B 4LNRB 2F9BT 5IFAH 4NN7B 1RZGB 2Z91B 5CZXC 1RJZA 4U4BA 5JNYA 3VD4A 4WW1B 3VFNA 4GW4A 5IGXL 3CFJB 1YMME 4MSWA 5TDPA 3TIDA 1HINL 3QNZA 5HGHA 3BN9C 3CXDL 5F6IC 4NO2A 2BOCA 3DBXB 3H7BA 1KYOJ 4BZ2H 1JYXA 1MWAB 3QDGE 1ACZA 4WTZG 2R0ZL 3W0WA 5BVJB 4YFLF 4YBQC 3GRWA 4ZOAA 5KSBE 2E7CA 1IC1A 1M05A 4LSSH 3B5GA 1RY7B 1KIQB 5JMOC 4ZFGL 2IPUK 4NIKB 4G7YH 4WCYH 5JXEA 2MOVA 5BXFB 3OL2A 1Q9WB 4J3XA 5JMRA 1S5IH 2NY5C 5CEYA 2WWMD 1J0JA 3CFIC 2D03L 3DBXA 4J7RA 1S7RA 4UTBH 3SJVD 3K81A 5C0CB 3QULA 2NY4D 1T0NA 3HA0A 1OP3K 3DVGA 4I13B 3RGVD 1OAUH 5C6TH 4KUZL 5D7IA 3DYMA 3IFLL 3X14A 3QQ3B 1EHLH 3ZKNC 4H8WL 1OSPH 2Y06L 2DTMH 4S0SD 4Z0XA 5MI0C 2X4UB 5JW3L 4LVHB 3QI9C 2B2XL 4NP4H 4JEGB 1GAFL 4MAYC 3R4DA 2XQYG 1KCLA 4JB9H 1XGRA 1I9IH 4D0CA 3QULB 1I8LC 3TZVD 1LNUA 3BJ91 5IVOA 4ZFZB 1F2QA 2YA0A 3MRDB 4OGYL 1RUKL 3BIBX 4IMKC 3DRQB 4IHOB 1AR2A 1NPUA 3FB6B 4PLKC 5EU6D 1LO4H 5I1GH 2FZ3A 4HV8B 4NNXA 1S7XB 3LCYA 5HHPA 4XVJL 2HVKA 4D9QE 3QR2A 3BD4A 3CSGA 5CILH 4X6FB 5GGSY 4FTVE 5GIRB 1CYGA 4MB3A 4RGOH 3MRDA 4PLJD 3JVGC 1UENA 2FBJL 1G9NH 4NQSB 3HR5A 2DLIA 3LS4L 4ACPA 4OQTL 3DTXA 4M1GH 4NCC1 4O58H 4KRNA 3VFOA 3R1GH 1FZOB 1I1AD 1BOGA 1J1PH 1E28B 5CGYD 1SJHA 1JPTL 2FLBT 4OZGE 1ZSDA 3FTGB 4Y19E 4ODVH 1EPFA 4JRYE 4DZBB 4AL8L 5DTFB 4DUWA 1MCFA 4NQSA 1FNHA 2X4SB 4D9LH 4XI5D 1FNEA 5BOPA 5HYJB 2BVEA 1NDGA 1M7IB 3LV3A 5IMLA 1LDSA 1NC2B 3V52H 2P7TA 5F6IB 3UAJD 1AP2B 1N5AB 1R6VA 1KJ3L 4N8CH 1N5YL 1E6JL 3TNMB 4DZBA 5FA4A 3K7UA 5K93A 2G60L 3MNWB 3VW3H 4QRPE 5CINL 1IZKA 1E0OB 3DUSA 2NXZB 5L2KE 5SWZA 3LV3B 1FVEB 5C08E 5IMLB 4KDVA 5D7LE 3DHJA 3SDYH 4BSVB 1K2DA 4MLSA 2DMBA 4KRPB 2Q8AL 1SVZA 3D69A 3QIUB 3MLYL 5GZND 2F5BL 5C07A 3OKYA 2OK0H 4GQ9H 3MZGB 3QH3B 4JFZH 4PREA 5GSRA 1JVKA 4W4OC 3QEQA 5GRWA 2GAZA 4QTHA 3MXWH 4ZPVB 1N7ML 4H26A 2Y6SD 1TJHL 3GMNB 3D87B 5I1IL 4JPVL 4OD3L 3GJFK 5JORB 2R69L 5HGAB 4I8DA 4K7PH 3ULVD 4FQ2L 4ISVA 3LRHA 3N06B 5K33A 1HINH 3RZCA 1UJ3A 4APQA 6FABL 4M1DL 4J6RL 1YEEH 1V05A 3MRHA 4OLXH 3S36X 4R0LB 3TO4C 2CKBH 2ATKA 1NC2D 3T4AB 7CGTA 2XYCA 1QLEL 4ZUVB 2PXYD 1F58H 5DO2C 3U36A 1IARB 5HD8D 4R2GB 4C57C 1FYTE 3NVQA 4NKIL 5E8PB 2A6DA 1SJXA 4YE4L 4WWKA 2C3GA 3T04D 5CD3A 3V0WH 4XNYL 3CFDB 2QADD 2NZ9D 4QHNB 5CEXA 4JN1H 2WSKA 3L3HA 4LCUA 3R0NA 1MLBB 3U0TB 3L3JB 1U42A 5KSAD 4IRSC 5TE4H 3O9WD 5H37H 5D1XA 3RUGA 3CXDH 2NX5A 3TH3T 2A9NL 4F7TA 1INDH 5EIIA 3B9KB 4GRLA 4LSQL 3WXVH 1RK0A 5LG1A 1KNOA 3LEYL 4Q9RH 1KT2B 1DQLL 1KTDB 1PG7H 1ORQB 3L3HB 3ABZA 2QHRH 3VFTB 5E2VH 3LKNA 2DM3A 5IVXF 3RY6C 2RJMA 2JJVA 2UUDH 1JPST 2A6IB 2I07A 3WEXA 1FO0H 3E0GA 5CHNB 1G7JB 3NIDF 3HI5H 1ZLVH 3RPIB 3RTQD 3CFBA 4AG4H 2WLZA 1WBXA 1P4LB 4GAGH 4ESKA 3RFZC 1R5VB 4HKZB 1AO7E 4AM0B 3PV6A 1PLGL 4LPTA 5JHDB 4OZIE 1X44A 1OSZA 4LKXB 5T3ZD 3QIUC 5I1CH 1PJ9A 4Z7WF 5FKAB 4L8BA 4LP5A 1CXLA 2FYYB 2GJ6E 4X99B 4Z7OE 2C1OA 4NNYA 3LSOB 3R8BB 5F21B 2XY2A 1NGYA 5GPRA 1I85A 4X0KB 3T3PF 3WIHL 1EHXA 5IM7B 4PRBB 3TBTA 3U7WH 1JRHI 1NCWH 1U8KA 1OB1B 5CBAB 1H3GA 3UEZA 1J88A 5J11C 4Q58C 1A1NB 4L4VB 4EI6B 2LABA 5E6IB 1CGSL 4F3FB 1OGAB 4KUCD 4QHLA 4GKSA 4G6JH 5EZLB 5I1CL 1BFTA 5F89A 4X4YA 5I8CA 5E08L 1QQDA 5GRVL 3GSQB 4UAOC 1DLHA 2AEQL 5SWZD 2DQJH 3U46B 3QIWA 3MBXH 5ID1A 4W68A 3L7FB 2X70B 2R23A 3RIFK 2W0LA 1MFBL 1ZT7A 1MQKL 4TRPH 4S10A 1KJ2B 3ARDC 4K3GA 4CKVX 4I2XA 5FV1L 5A2LH 3RNQA 3KPMA 1WQVT 3WUWG 1CGXA 1F4WH 5EOCJ 3CVHA 3FO2A 1J8HA 3MRPA 1PD6A 5D6CB 2QKIA 3MO1B 4GFTB 4PJIE 3TBWA 3ARGC 4HXAH 1YPZA 4PJAF 2AJ3B 2Q8AH 1PEWA 5CMAB 4ZG1A 2H8PA 2EDFA 1T1YB 1P7KB 2HT4D 4XP9L 2AQ3A 2DLHA 4I2XB 1JIBA 4PS4L 1XR9B 3CLEL 5E1HB 3CD4A 2BHYA 3SE9L 5FAAA 4HKJA 5DYOA 4YHLH 2V5RA 4JPVH 4OD3H 5FCUH 5CZKA 1DBKH 5T5FL 3L7EB 4PB0L 3CUPB 3DI2B 3OXSA 1FDLH 3VXNA 2GCYA 5LGHL 2P5WD 2UY6A 1MCWM 4HWBL 4KKNA 1UWGL 2QQLH 2W1NA 2HP4A 3O3BB 5JA8B 3ZDZE 5IJVB 1FVCA 1R3LA 4HJGA 1LEIB 3ZL4H 5TQ2L 1U8MA 2PTVA 2VQ1A 2F5BH 5DYOB 4MDJA 1AGCA 3QI9D 5J9PB 3RA7H 1CL7H 3B9VA 5CGTA 5AYUL 3AM8A 1ND0B 3I3BA 3ZE2F 1WIOA 5ADOH 4PTUB 2AJSL 4HK3J 3O9WA 3HN3A 2A77H 1BM3H 5IK3B 3BPOC 3NCYP 1TITA 2FB4L 2FGWH 3Q5OA 4XBEL 5DMIL 1DN0B 5AAMA 2NXZC 3U83A 5I8OL 4UIMA 2AJYL 3QUZA 2VXUL 3PGCB 4PJGA 2YSSB 1A7BA 1FAIH 3DXAB 1VB9A 3O2DH 4Z78B 4KUZH 1EHLL 1MWAL 1F4YL 1UCTA 4K55A 5AG8A 1Y6MR 1N6VA 2DBLH 1OF2B 4NFDA 3U0WL 4JKPL 1NMAL 3TWCH 4D9LL 1RURH 4L4JA 3F12A 5INDA 3BFOA 4UDUB 2VAJA 4HKXB 4OT1H 1A7QL 5ESAA 1T4KA 5F8QC 1MCJA 1UM5L 4XMKL 3VG9B 1OAXL 3WNKA 1I9IL 3MRGB 5FO8A 3VFGH 5E2UL 2FX7H 4JJHA 4I18C 2FH6A 3V6FA 1WITA 4PJCF 4DUXA 4F7EB 4M6MH 5ADPH 3HAEB 4JQVA 1WIUA 5GS2D 4BSWB 1A7NL 3HE6C 1BQHB 1RV6X 1GGUA 2ZCKL 3ZT6A 5L6YH 1WC7B 4EUPG 3A6BH 2AXGB 2AEWA 3MV8E 3OKDB 3PL6B 4KQ3H 3VI3F 5C08D 2R8SH 4B0MM 5JXED 3DMMC 5MEQB 2FSEB 1U92A 5KVFL 4O58L 1PKQB 3MRQB 4J1UB 3NCFB 4F8TA 2H32B 3PWJA 4K94H 4TSAL 3UTPE 1EV2E 1T83C 4P5MA 3TZVB 3L5XH 4MA7L 2NZIA 5FF6A 5TF0A 5HGBB 4DEPB 3BH9A 3I6LE 2QBWA 1VEOA 1N0LA 1G0DA 3MNZB 2OSLB 4X6DA 1N7MH 4Y4FD 5I75B 2P43B 3C5SA 4BZ1L 3WSQH 1LMKA 4QGYA 4XWOD 3O6ML 2C3VA 2G2RA 2WBJC 1AFVH 4NO5B 4OFKA 4M7LL 3SJVE 2DWEA 3KG5A 1FFQA 5HDOA 2DI9A 4JG0H 3WKMH 5IEKB 2PYEA 4K2UL 2RQ8A 4P2QB 1YUHB 4Q6IB 4Y4KA 5LCVL 3TZVA 2Q1EA 5D7LD 3U7AA 1V8HA 1EDQA 3PWVB 2VB5A 3BH9B 3D0LB 3W39B 3CCHB 5DRXB 4ZXBC 3GO1L 3VA2C 4OZ4A 5J4MA 1IM3A 3MOBH 1A6UH 4Q9QH 3B9EA 2X1OA 1NGPH 3OZ9L 4R97B 1GAFH 4GS7B 3I3EA 3GFUA 1JI2A 4G5ZH 4ODHH 5IVXB 3D0LA 4X6EB 5D2LA 4GJTB 2VLRD 4LRNH 3CCHA 5DRXA 2FD6H 5C1MB 3TCLB 5IT2L 2R0WH 1JNLH 1U0QA 1FSKC 4L9DA 3U4BH 3FFCB 1AXTH 4JREC 5J1SC 1I3GH 4U0QB 1TQCB 2H2PD 1OW0A 4ZMAT 1NGZB 1VGKB 2JCCF 4I3SL 2N1KA 2VO5A 3VG9C 4Z7WB 3LH2H 4KHTH 1QVOA 3FFDA 3MLVL 4JAMA 3QXTA 2VDLL 4LAQL 4PJHA 4F33B 1U93A 4S2SA 5D1QB 3WJJC 4RAVB 4Y16D 4LSVH 4ELMF 1T1XB 3ARTA 3C87A 4G6AC 5CUSL 5BV7B 1QLFA 5BO1H 2E9BA 4J3UA 1UQSB 2YA2A 4MJ2A 2R29L 5DVLA 1T22A 3N1MC 2FECI 3STLB 3SKMB 4A6YB 4GUPB 5SV3A 2Z91A 5I15H 1LHZA 4WW1A 1JK8B 3MXVH 4GQPH 1BGXH 4JJ5B 4L8SB 4UAOB 1KBGL 5B3JF 3NFNB 4RAVA 1HH6B 1CS6A 1NGXA 1Q94B 3RAJH 2ADGA 1N59A 4PB9L 5LJYH 3JV4A 4LRIA 3BPLB 2MNUA 1U8HB 2R39A 3KYKH 2IFFL 3VWJD 2ZOKB 4GG6F 4KAQL 4X8XA 2VXTH 3BIKA 3NFNA 2XY1A 2YD1A 5HXMA 4LF3A 5C2BL 1IE5A 3RBSA 3OG6B 3E6HB 3R8QA 4ZDHA 4R4NC 4QY8B 1KENH 2LVCA 2VAAB 4ZD3H 1KN2L 3BEWB 5D9SB 1UZ6E 3O3DA 4IIQB 4NYLB 3OKMB 1T0NB 4XBEH 5I1AB 2VN4A 3KVQA 1ZV5A 1OTUD 3SDDC 1HIMH 5LKNA 2FWOA 3BZ4B 3Q6GL 1WZ1H 1A9EA 1U2CA 4R97C 3TA3C 3ZDZF 2ZKHL 4KROB 4OBRA 4KJPC 2VL4A 2O61B 3NACH 3IFPA 3P9LB 2FATH 4KQ3L 1INEH 3BPCA 3P9MA 5TF1H 3HZVA 5SWZE 2DQDH 3WFBH 1QRNE 1YMMD 1KJ2H 1YECH 4HXAL 4WIQA 3BQUA 3ECBB 2PO6D 1JZ7A 4IHOA 4RFOH 4LAJH 1AXIB 4K9EL 2F19L 1V3LA 2YK1H 5KOVC 4Z95H 3QUXB 1DVFC 3X13B 1KPVB 2NYYC 3O4LD 5IBTH 5HDLA 3T0WA 4YO0A 1VADA 2AABH 2VLKE 3Q2CA 3ORJA 1T66D 1RK1A 3IS0X 1C08B 1QEWA 1OGAE 1UWEH 3RWHB 1MF2L 4XNZB 4L3AA 1LO3H 2HFEB 4R4BA 2NY0D 1P7HL 4NQCD 4GOSA 2W0KA 1BBDH 2X5PA 4LCWA 5FCSH 3BMWA 4Z9KB 1DDHB 2A83A 1KPVA 1MPAL 4JR9L 3MR9B 2WBJB 3VXMA 4XTRC 4I5BB 3MLSH 4QXUL 5EC1A 2GJ6B 1RK1B 3VWKB 1TNNA 2NY4C 4JPWH 4LKCA 2R0LL 2ZZUT 4HLZH 2D4FA 1FNEB 2OZ4L 5E00A 3H8NA 2GITB 5J11B 1GGIH 1WBZA 2IPTL 4ZNEA 4X5LA 4L4VD 4LGRB 2YZ8A 4PGBB 4EEEA 3UPRB 1CD0A 1G7PA 3V0VA 4I5BA 2ESVA 4HMCA 5GS0D 4JFHE 4PGDA 4XP9H 4EN3B 1IEBA 1A4KB 4PJFE 3LN5B 3T09A 4FG6C 4LIQH 2Y5EA 4AG4L 1B2WL 1AE6H 2DLTA 4CDHA 3EYQC 3EGSB 4KDTC 3HPJA 5EFIA 1TXKA 3UPCA 1U95A 4OGAD 4P23A 4U1HB 3TEUA 2VLJE 1K2DB 2GUOA 3S37H 2GFBB 5MEPA 4F7PA 4BM7A 3IKCA 4EDXB 3IB4A 3Q6FB 4QOKD 4MJ4A 4X8JB 5L88H 4UUJA 2P8PB 1YNLH 1OARL 1FH5L 2FBOJ 4RA3A 3NN8A 3AY4A 2GTWA 4X4MA 1TJGH 2EDRA 3QEQB 5IIEA 4YFDB 4Y2DB 2CUIA 3IKCB 4EDXA 1GJIA 1MCDA 4M48L 4XXCA 3G6DH 5B3JE 4X8JA 3MRJA 4QCIB 3CLFL 3ILPB 1TLKA 1EBPA 4ZS7H 3ZE0E 5JDSB 4RX4A 2DIBA 1NL0H 1F6FB 4XVUC 5IW6A 2EICA 3G6JA 1K4DA 2R4SH 3FQWB 2ATKB 2NTSP 2DQHL 1VFAB 3U36B 3IDIB 3GGWB 3LEVL 3TIEA 1NFKA 2UZIH 2YPLE 1CG9B 4PRDB 1SMAA 5E8NB 5I8EA 2DQIL 2GJ6D 2VISB 4X6CE 4G8IB 5F9WB 2DYPB 1YEFL 3CLFH 3MFFA 3BXNB 4GRWF 4IOSD 2J1KA 3N1PC 5HTSA 2VABA 3DRTA 5JQHC 2XWBA 1AGEB 5D93B 4JREB 1O0VA 5D1XB 3G04A 4HT1L 4L4VE 1I3UA 3JV0A 3G08A 2V5MA 1KN4H 3MUHL 2EDHA 5E8NA 4MA1B 1I1AC 1XT5A 2J8UF 4MHHI 3DHMA 4IM8A 5FHBH 3MMEA 2CUMA 2BNQA 3SDDB 3SGEI 5T1MA 2IPUG 1DL7H 1CGWA 4Z0BH 2W60A 1MCNA 4ZYKB 3MRIB 4W81A 3EW3B 4O9HL 4YC2C 4DCQB 3BRGC 2YD8A 2DRUA 1U8PA 4K23L 1P1ZB 2JJSC 1A0QL 4HCRH 2BRRL 3MMEB 3P0VL 4YHML 3G5XA 2B1HL 3L5JA 2Q86B 2QJDA 1I4FA 2Y36H 1UWEL 3QEQD 1LP9B 4XCEA 5J12B 1X7QB 4YFEA 3SDCC 4ZUWA 4M43L 3MLVH 5DUMH 5GGVH 1JZ3A 1FIGH 2ZUUA 1IL1B 5DRZB 4X6CB 4FTVD 5T1LB 4S1SH 2Y1VA 5IF0B 5IUSA 4Y5YC 1CXFA 1KEGH 4HIJB 2D0FA 4IRZH 2EKJA 3HG1A 2NY0C 4UT7L 5CINH 1Q0YL 1OAYH 1ACYL 1IL1A 3OKOB 4WV1C 3VXPA 4X4YB 4IIQC 3RGVA 5EU6A 3FB8A 4L3CA 4NQDB 4D94A 3QDMB 3WLBB 1RUAL 5DJXA 4N0FB 4K7PX 4QRRD 1HZHL 4HIJA 4FQIL 3V4PL 1DBAL 4P57A 5C08B 1JGVH 1R3KA 2VZSA 3ARFA 1UZ6F 3MLYH 5DA4A 3W11D 3ARBA 3KYKL 2WV3A 1ZVYA 2EDWA 4BZ2L 2R15A 3MGTA 2H1PH 1Z6JT 2XA8L 4QO1A 5FOJA 5FYJL 3MO1A 4LEXL 3VXMD 3UTOA 4PRHB 3RWDA 5FIEA 35C8H 3PP4L 3WLBA 5FGCB 1UGNA 25C8H 4LOUC 2QQNH 4TULH 2XKSA 4I0KA 4XNYH 3LZFL 2EXWC 3HFMH 1G7QA 5E8EA 3DOSA 2NR6C 1I7TB 4KTYA 4NC1E 2K7PA 5F7EL 4C56A 1W72L 3DURB 4GT7A 4JO2H 1L6XA 5IQ7L 3MOQA 1QACA 1DLFL 4TUOA 5DSCA 1T89A 3S96B 5TE6L 4K2UH 4JB9L 5F9OH 5J8OA 1B0RB 2VQ1B 5GHWH 1OCWH 2ZUTA 1EO8L 3LB6D 1PZUB 4QXWA 1H3WM 4KAQH 3MOBL 3IJSA 4RMQA 2KL6A 4U1IB 1JTOA 3OZ9H 2ENSA 2BFVH 2H3NB 4H88H 3HZYA 4JM2D 3Q48A 2N4IA 4F15B 1FV1A 1X5LA 2W65B 3MV9B 1URLA 1X5YA 3GHBL 3KPQB 3KHOA 1T20B 2MCPL 1D5IH 2Z8WC 4MNQB 1S9YA 3VXRA 2EDNA 3IFNL 1QBBA 3NCCB 4PR5A 1EGJA 2X4NB 5J06A 4N1CA 4HC1A 4OZGB 1TIUA 4JFPB 3DGCR 3GJFA 2AEPL 4OD1H 4J8RA 3TC9A 2XQBH 3DX6B 1J0ZA 2DKSA 4QOKB 4JZOA 1AC0A 4PJ8B 2DTSA 3E3QC 2D31B 2C3XA 4GMTH 3VG0L 4QT5B 3C60B 3AS1A 3JWDH 2Z92A 4MNQA 3F5WA 5HHNA 1E27A 3GNML 3QZWA 5E99H 1MNUL 3O45B 2YC1A 4QOKA 3VXME 4B7IA 4X5WA 2HFGH 4F9LC 5GS1A 1D5BB 2D7QA 2X6MA 5GJTH 3RU8H 1SEQL 5FM5O 3W9DB 4YNYA 1MELA 3J8F7 1SJVA 4X98B 5DGQA 3QZWB 3PHQB 5DMKB 2FSEA 4X4ZA 3UCRA 4F2MB 4G42A 5HHME 3SE8H 1KLUA 2NY3B 3P4OB 4WFHD 3THMH 3FONB 3IU3B 1BJ8A 1D6VH 3PDOB 4FZEL 3U6RA 1GC1H 3H9HA 4DVBB 3QXDB 1YPZE 1JYNA 2P46B 4HUWB 1HXMA 5MERA 4PRPB 5J89A 4LCWD 3F6LA 4G8GA 3BPNC 3QDGD 1I7UB 3VD9A 2GJZB 1P9MA 3EAKA 1J11A 4R90H 4WO4A 5F7WC 2WQ8A 3L9RB 2AXJA 1I8MB 3QRGL 1L4IA 2GSGB 2BC4A 4POZC 3OHXA 4NUJA 4X4XA 2C3VB 2G2RB 3PDOA 1JHTA 1TQBB 1X4YA 4DQOH 5E6ZA 3H9HB 2IH1B 4PV9A 2DQEH 2VZTA 5E2TH 3RPKA 5FYKU 1XF3A 3MPCA 4EI5C 3MLUL 4AH2B 4AQ1B 4OZ4B 5BZWB 2GY5A 2VITB 4CVXA 3HLAA 4AENA 1XF5B 3BW9B 2A6JA 3F7PC 3GMPB 4PS4H 2VDOH 3N9GH 1CL7L 3RWEB 4Y5VC 5ESVB 1KACB 5H37G 2OMBA 4PV9B 2NY1D 2NY4B 4WI8A 5FO7B 1D9KB 3STZA 2OL3B 1MRCH 2PYED 3M07A 4OBSA 4DKEH 4AIZB 1MJ7H 3S35L 2CUHA 4JY5L 3LZFH 5LGHH 4Y89A 4WFEE 4JM2C 4PJEE 5HHOA 4BFBD 3ZDYE 4M7KL 2VRAA 4H1LH 4JFOA 2XXCB 5I73C 3BP7A 1EEUA 5IROC 1JZ5A 1D9KA 3FOLA 4Z77B 3CPLA 3U9UB 3QUMH 1IEAB 1FVDA 4WHTB 1FCGA 3ROLA 3TN0B 4N8VB 3PQYB 4LEXH 4Q2ZB 4ZS6C 1DLFH 3ARUA 4HH8A 4JCLA 2Z93B 2FGZA 2KZ1B 4GLRH 2N7BA 3OR7B 3AU1B 4X6CF 3IF1A 3MV7B 4XWOC 2C4FT 4NSKB 4M4PA 2WIIB 2HTLC 3P73B 4PJGF 2HRPH 4TYUA 3QFJE 4Z77A 1HQRA 2ED8A 3IFOB 3KYNB 5E8DH 4PJDF 1B6DA 3AUVA 2JK5B 2XFXA 4DOHB 3HC4H 3QQ9C 5I1HH 4OCXH 2BX5A 1LE5B 1SBBA 3LPFA 2RAMA 1DQDL 1TJIL 3B4NA 3VD3A 4OJFH 1CXHA 4ALAL 3UDWC 5DJ8A 4O51B 3N85H 1YQVL 5DC4B 1HEZB 2JTDA 2P49B 4MXVE 2E9JA 4NM4L 4ERSH 2YD6A 1A9BB 1H5BC 2NPLX 3K8LA 1S7VA 2D03H 2FEDC 4KMTL 4MS8D 4TUKL 4G9FB 2Q76B 1WTLA 1FYTA 2V7NA 1OP9A 5TFSL 1G7HA 1ZWIA 4KKAC 5IVZB 3A67H 3E6HA 5DUPL 3CZFB 3C5ZB 1WBYB 4C59B 2DM2A 5I1EH 2CO7B 2D7TL 4MCZB 1U3HA 5D9SA 1W8NA 5IBLC 5JIHA 2R2EA 1LQSR 1D5ZB 4F7CA 1S7VB 4ZSOB 4G80A 3SE4A 2IPKB 4HK0B 3AVEA 5I0ZA 3KR3L 4WI3A 1ITBB 3O4LB 4DN4L 4FXKB 3C60C 5L9DL 2V7NB 4YQXL 1Z2KA 3MBXL 4ELKA 4TNVF 1WWWX 1G6RB 5E9DA 2YD5A 4XP5H 2ADFL 4NRXA 4UT9L 2F54A 1K3IA 5KAQG 4RMWA 1CDBA 1UZ8A 4J3VA 4M62L 1BBJB 3BQUB 3OV6A 4ZSOA 4KK5D 2IPKA 3DV4A 4HK0A 1C1EH 3WFHA 1LE9B 4X6DE 4GBXB 4LSTH 3KYMB 4I0CC 4UV7H 5IP4A 4JKKA 1CVRA 1PX4A 1YEGL 3BESR 5H35A 3AMKA 4LVHC 5GZOC 4KJWD 3OTTA 3ARQA 4X7SH 1XCTB 2BVTA 5JW4N 4OF8A 2J8HA 3BP6B 5SWQA 5TH2A 4LCCB 1NDMA 1UZ8B 2PN5A 2VUOA 1T1ZA 5IFHH 2ADFH 1C08A 4UT9H 1MCRA 5IHBA 3ZT5A 1FG2A 3HE6D 5I0DA 3IDNA 2QSQA 3PWLA 5CGMA 3QJFA 4ZTOH 5J12C 4G43B 5D1ZA 1RD6A 1T7ZA 5D96B 1JRHH 4GKNA 1GHFH 4L8DB 2V17L 3QXUA 2X40A 3MFGB 1T1ZB 3LAFA 2BSRA 2BY2A 5GJSH 5E00B 5I1JL 1J1OL 5EU7C 3TIDB 3LQMA 3G6AB 5BV7H 4WI5A 1W0WA 4JVUA 1MFCL 4RGMC 5C70A 2NY7L 1F3JA 3T0EB 3ULVF 3FQTB 2BY0A 4RWYH 5LBSH 4EN3A 1VHPA 4JDZA 3QWQB 5IHUH 3O8XC 4QGTA 3SGKC 2VLRA 2D2OA 4MNQE 5ENWA 1DANU 3HS0B 5EFIB 2X42A 2EH8H 1YY8B 2EDOA 4NM8H 4GAYB 3TT3L 4ZAKC 3H9YA 2R1YB 4NO0B 4HHAB 4CAGA 1FFRA 1JP5A 4GKZA 4Z76B 1S9XA 3FAXA 1QYGH 1A7OL 1QRKA 1JPSH 3RWGB 1FLRH 4HIEA 4V2BA 4K9EC 3RI5K 4JRXE 5F6HI 2X2YA 5ENWB 4JKWA 2YRZA 4NHCL 2ZCHL 3GSXB 5D6DC 3WV0A 5DVNA 5EU3B 3WHXB 3OJVC 3MJ7B 1XGPA 2ZUWA 3CMOH 4WDIA 3N1QC 4XCCL 2DWDA 4F80A 5BRZB 1HCVA 4ZFZA 1JZ8A 5IJKC 3X3FL 3FJTA 4MGXA 1HYRC 4O02H 1A5FL 4EKXA 4ODVL 4ZFOL 1BD2B 3I6GB 1WV7T 1ZHLA 2ARJQ 4I1NB 1MREH 2HRLA 4OSUH 2ESVD 1B4JL 2ZCLL 5DQDH 2MMXA 5EU3A 3G6JB 5B22A 1QSEB 3HRPA 3S97C 3CH8A 4JY4A 1BMGA 4LVOB 3NTCH 2R2CA 5CP3A 1MI5B 4Q6IC 2J6EH 5KG9A 3DTXB 5DFWH 2ERJB 4U1MB 1XFPA 5EBMA 1UXWB 4MYWB 1H15A 3V6OC 1DQQA 3VFOB 3TBYA 2WBKA 3QUYB 3A67L 3KJ4C 1H5BB 4C56E 2E9WA 1E4XL 3WFEH 3MGOB 1INQA 1U3ZA 1QSEA 1ZSDB 3MFFB 4I3RL 2JB6A 4NZTH 5C09A 1M71B 3OAYK 4YBLC 5JOFA 5FYLD 5MENA 4HWEH 1P7QD 5D93C 1OTSD 2OXGA 1DQDH 1AGEA 2GTZB 5DJYA 1FN4B 1ES0B 1F97A 2DQFB 5E2TL 1MI5A 5KG9B 4GS7C 3TT1L 2YKLH 4LLQA 4ONGL 1FO0B 5DHVA 3K2MC 3VXQA 2HMIC 2ICWJ 3GJEB 2J8OA 1NLBL 4R96A 1JBJA 1L0XA 1MJUL 2D7PA 3GO1H 1A6TB 1UVQB 3S4SG 3QP3A 1I1CA 2ENYA 3MJ9A 4ZYKA 1T7XA 1N4XL 2GTZA 3MNWA 3MRBB 5DJYB 4YX2H 1CK0H 4YJZL 2F53B 3OKNB 2I5YL 1IC5L 5ICXB 5DHYA 3ULUE 5ILTH 1J0HA 3O6FB 2FJFB 5D2NC 4JY5H 2OLDA 1J5OL