1K6QL

Crystal structure of antibody fab fragment d3
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
210
structure length
204
Chain Sequence
DIKMTQSPSSMSASLGESVTITCKASRDIKSYLSWYQQKPWKSPKTLIYYATSLADGVPSRFSGSGSGQDYSLTISSLESDDTATYYCLQHGESPFTFGSGTKLELKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATPIVKSFN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords immunoglobulin Fab D3, light chain
publication title The crystal structure of murine Fab D3 at 2.4 A resolution in comparison with the humanised Fab D3h44 (1.85A) provides structural insight into the humanisation process of the D3 anti-tissue factor antibody
rcsb
source organism Mus musculus
molecule tags Immune system
total genus 48
structure length 204
sequence length 210
ec nomenclature
pdb deposition date 2001-10-17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1k6qL02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1k6qL01
1MCPH 5BVPL 3CSYA 3RZWA 1T0PB 5IJVB 1EBPA 1KC5H 1ORQA 1UH3A 5ID1B 3Q2CA 5C0DA 2C7UA 1X5FA 4ISVB 1WAAF 2I07A 1I85A 3U7YH 1SJXA 3G5VA 2EDHA 1E0OB 3E2HC 2UWEF 3C9NB 2VE6B 5J13C 2DLEA 4H0GA 1PLGH 1A1OB 2CRMA 4O2EA 3D87B 2XN9D 5IIEB 5LWYL 2W9DL 3I6GB 1G7LB 1IAOB 3SDXB 1CDBA 1A6AA 5GSRA 4HIIB 4JB9L 4JHBA 2EDKA 1XGRB 2MKWA 1YUHA 3TA3A 1XR8B 5CSZB 5D5MA 1U8KB 3ARGB 3MRDA 1KJ2B 1T03H 1R5WB 4XMKH 3TCLB 4RNRA 1UZ6E 5HHPB 1OD7A 4WU7A 3TESA 4NN7B 1GH7A 1H3GA 1LO2L 1IC4L 3VWJA 4X0KA 4APQA 5HHVH 4PGJA 5JQ6L 3NFSH 1JF5A 1S5HB 4DK6A 5CWSB 1DSFH 5LXGL 1KT2B 3GSNH 2X4OA 4IRSC 1XF4B 2P5WE 3QQ9D 2BY3A 1MJUL 2OS7A 1JI2A 4MNGE 5E0QA 3FN3A 5DK2A 4MD5B 2Y06L 1HN1A 2XRAH 1RHHA 1NGQL 4TULL 3P0GB 2MQCA 4XBGB 5KSUB 1PDKA 3DMMB 3QIWD 4WEUD 4PJFB 3HAEH 4FQ2H 1QFPA 2A83A 3EGSA 5DJCB 4JRXE 5E95B 4P5TA 1UKTA 4NM4L 5FUOH 1P1ZB 3N1FC 1RZKC 1CE6A 3VFRA 4MB4A 1V05A 4JGJA 4P9ML 1HNGA 4YR6A 1G7QA 2LVCA 1L7TH 25C8H 3TT3L 4JM2F 3CXDL 3KDMA 1EFXD 3C8HA 1UA6L 3MUHL 4J3TA 1QYGL 4ZOAA 1RIVL 3ARXA 4WENB 3BAEH 4QHMA 2WWKT 5GGQH 4WU5B 3V6OE 1XGTA 2B4CH 5D1QD 1P7KA 3OR6B 2UY6A 3C8KA 1BOYA 4PRDA 1K4DB 2A6IB 3CU7A 3MZTA 2GT9A 3UXFA 4OZIB 2ID5A 4LKCA 2R56H 4QY8A 3MUJA 3TPUA 1YC8A 1MCIA 1NPUA 3LS4L 1D5IH 2GSGA 3OB8A 5CJ8A 1WBXA 1WZKA 1MPAH 3MUY1 3VD9A 3D0LB 4K8RL 3U9PL 2VLME 5ISZE 4XH2A 3EYFA 2E27H 2P5WB 2DI9A 1RVFL 1MJJA 4NQEE 4MNGB 4XXCA 3HPJA 4Z0BH 2VOTA 3ZHKA 3ARFC 12E8L 5TQ0L 1B2WL 4H0HB 5GISH 3SKJL 1C7SA 1DQJB 2NPLX 1RUAL 4JRXB 5DQJB 4AEEA 4DUVA 2E9IA 1S7XB 3P77B 4CMMA 1M05A 1G7IB 2FIRT 4RZCA 2NXZD 2VDNL 3ZKMC 4DTGH 1ZLSL 2GTZA 3IF1A 3ZE1E 1RQ5A 3I50L 1U8JA 1BQHA 3PL6B 3ZTJH 1A14H 2BNRA 1UKQA 1U6AL 4DAGH 1JGUH 1OAYH 5I2IB 3SE9L 2EDXA 4Y4HA 1CXKA 5JIPA 3C6SA 3OR7B 1PKQE 5F6IB 2ZSVB 1L9NA 4GMTL 3WLBA 4XP6L 4ODSH 4Y2DA 2ED9A 4R4BA 4NRYA 2OJEA 1ZEAH 2NY4B 4X5XB 4MQ7A 5FAAA 1OOAA 1B0GB 1FGNL 2DD8H 1A3RH 1E28A 4DN4H 4S2SB 3DHMA 1NFKA 1RUKL 1RZ7L 4YHML 4XPHL 2OK0H 1UENA 4JRYA 5ISZB 3B6SA 2WQ8A 5FOBB 4BFEA 3O8XC 1NCAH 1DQLH 4NQEB 1T66D 4YBQD 1LP9A 4G3YL 4ODXA 3RVUC 2OJZH 3QEQA 1EZVX 1IZKA 2UY7A 4K7FB 4RA3A 4X7SH 4PS4H 1W2KT 5FGCE 4U6XA 1QFWI 4CVZB 4ETQB 3H3PL 1DQML 4PY8J 2P45B 4WFFE 3TM6A 5L2JB 1MWAL 5DI8B 4XP4H 3GO1H 1XMWA 1UXWB 1WIUA 2L7UA 4ONGH 4FZEL 4NKDA 3DURA 5D6DC 5I1GL 9CGTA 3O11A 3PGDA 5T1DH 2C3VA 3C60C 2DJ4A 5BS0E 3A0OA 4D9RD 3TA3D 4Y5YC 4O51A 4ZFOA 5HYQA 5T1KA 2OZ4A 5FHAL 3EIFA 2R23A 5BV7L 3Q5YA 4J3VA 5GGVY 5DMKA 3RWGA 2FX7H 3QHZL 1PKQB 3M17B 4KJQC 3VG0L 2J3SA 2JELH 4APQD 5CJQH 5H35A 3QQ3B 3U2SA 3GI8L 5ACZB 1FNFA 1IC5H 1YJDC 1I7RA 3QFDA 4PJ8A 1SM3L 3K74B 5IW3A 2NXYD 3SGEI 5EU6E 2X1OA 1Q8MA 4W6XB 3TIEB 3H7BA 2WP3T 3ILPA 3HB3D 3NABL 3TF7C 3VRIA 1TQCB 3GB7A 5BO1L 5DFVD 5HGBB 1M4KA 5AD0B 1KPRA 1RSFA 5E08H 1HQRA 4MAYC 1ZVSA 3QDGE 1T89C 4FFZL 5F7MC 4U1IA 1HYSD 1AGDA 4WW1B 4DKAA 4DOHE 2PYEE 4J7RA 1LO3H 3H3BC 4OLUL 4U6VH 5CP7A 3PWPD 1QEWA 4M6NH 5FGCB 4XX1G 4D3CL 4XAKD 4ZODA 4I9WD 1EHLH 3O41A 4OUOA 3KNBB 3LKNB 3QEGL 2W65A 3LN5B 3B3IA 3D25B 2BVOB 5ACMA 2OLDA 3SDYH 2MOVA 1H15A 3RA7H 4XNUH 5DC0A 1URLA 4P4KD 2Y7QB 1Z5LA 2IPUK 3WO4B 3HE7C 2R0ZH 5C07D 1FVCB 1RK0A 2CKBL 2EO1A 1C1EL 4UI2A 4X6DF 5EORH 4EI5C 2FBJH 4G8GA 3U30C 3U4EB 5C86A 1SY6L 4HMDA 1DUYA 5D7LE 4HIEA 5D2NE 4I0CC 4K2UH 4MGXA 3V8OA 4RRPG 1MNUH 3BGAA 2CUIA 3SDAD 4ODHL 1EO7A 3EOBA 4EEEA 4YHOH 3S5LB 1A9BB 5EU6B 1W72L 3MYJB 2XWBB 1Y6NR 3S36X 4FFVC 4H1LB 1LEKA 3FN0H 4B0MM 5K33A 1OAQL 4PB0L 3B9KC 3S37H 2YN5A 4HXBH 5C0AB 1EH9A 1FNGB 2PYFB 1EXUA 1P2CB 3V4VL 3QDGB 4HGKC 1KCUL 4Z78B 3I6LD 4A6YB 1WT5A 4KJWC 4DOHB 2PYEB 4LMQE 3CVIL 1JZ2A 5JR1H 1L6ZA 1FL6A 3ELAT 3I6GA 4HC1H 4Z7WE 1Q0XL 1YMMA 3SKUD 3MA9L 3LB6C 2AJYH 1Q94B 3DECA 5DWUL 4YHYB 4ZO7A 4HIIA 3RZCB 1AGCB 4NDMB 1XGRA 4WDIA 1KLGA 2NY2B 5SV4A 4Z77B 1IVLA 5CSZA 3QIUB 1INDH 2CDGA 3BE1L 4LRIA 1R5WA 3GSWA 5L88L 2XN9E 1CFSA 3QWQB 4K3GA 4WHTA 2BMKA 4G8IB 1OPGH 3VXTA 4HLZH 3EW3B 1FGVH 4PLKD 2ZOLA 4P2RD 4M93C 3T0WA 3NZ8B 2EDQA 2OSLA 5F7HA 3E8UL 3FMGH 4QHKI 4UILL 1ZANL 5H2BA 4NQXA 1XF2B 5D7LB 5D2NB 3IJYA 5EG6C 4GRWF 1PEZA 2JB6A 3MLSH 4M8VA 4MD5A 1HHKB 3HRZA 1K8DB 1LE9B 5ITBH 2FHBA 5D2LF 3BH8A 1WTLA 3BYTA 3WS3B 5KSUA 3TGXA 3O2VL 35C8H 2B0SL 3DMMA 2NW2B 3CCHB 3TBWB 4PGBB 1WCBB 1TNMA 4HK3N 2XZCL 3JXAA 4RFNB 5IHZA 4WY7H 4FMKA 3QEQD 3BKJL 3DSFH 4MNQE 1P1ZA 4EN3B 2DM7A 2IPTH 4OFYA 4MWFA 2VISB 4MA3A 3LPFA 3PP4H 5CFHA 1EMTH 5DJ6A 4XNQA 2DWEA 1F3JB 2OMBA 4PLJC 1EJ6A 4Z7WB 5GZOD 1ZLVK 3C08L 3E6HB 4JO2L 4JZOA 4PYHA 1I8MA 3OGCB 1N0LA 1IRAY 5FFLA 4V1DA 4FQHB 3EKCA 2XN9B 1K4DA 1ED3B 2AJZA 3IDGB 3MCLH 4U4BA 1NLDL 5MEPB 1VGEL 2A1WL 3QI9B 1FNSH 1HINL 3S35X 4OZIA 2HH0L 3MRPB 4MS8C 1GJIA 2E9BA 3F8UB 3OKKB 3ET9F 1ZGLA 1VFBA 4DQOL 5MHSD 1F4XL 4HW6A 1IAIM 4PRPA 4HEME 2WK2A 4NCDA 4PJ8D 5CSGA 3RUGE 2FHFA 3NZHL 4XRCA 4UTAH 5LVEA 1V7NL 4BELD 5HYSA 1NCNA 5IW6A 5DDHB 2CK0H 5D9SB 4GKZA 4URTB 5EBLB 2DM4A 2EEDA 4XCYB 4BQ9A 4TTGA 3QJFA 5DJ8A 5KSVB 4AT6A 3LKPA 4QRRE 2NW3A 3VDCA 1DQJA 1GOFA 2X41A 3RI5K 1ORSA 3BJLA 1NDMA 4TVPD 1K2DA 3MR9A 2P5ED 4MNQB 4YC2B 4EOWH 2CRIA 5I8CA 1Z3GH 5KAQF 3VU2A 5D72H 4UT6L 5GRJL 5F3BA 2YEZA 4OD3L 4TQEH 4CNIB 4NNPH 5FYJU 3JV6A 2NCMA 4OZHA 2OR9L 1H0DB 4ENED 5I2IA 3FB6B 1HQ4B 5DD1H 3VFGL 1H3UA 4FQJH 2FB4L 4XVSH 3VXRA 1DBKH 3ARFA 3PIQB 3LMJL 3MLPA 3T0DA 3NA9L 4LLVB 2C3WA 2FBOJ 4JR9H 3FQTA 3HKFA 2AABL 4QTIL 1BFSA 5FXCH 4BH8A 2HLFD 3WNMA 1ZHBA 3K81A 5MENA 3V52H 2DL2A 4XAWL 2VJXA 1N6UA 1PY4A 5IROC 1QHPA 3LPGA 2ATKB 2Z31C 4G8GD 1B0GA 3GBML 2VDQL 1Y0LA 3PQYA 3U46B 5IV2B 1IGIL 1IC7L 3RPKA 5J6HA 3RUGB 2HG5B 4KRMB 4JFOB 5CLWA 1FZKA 2I27N 1J0KA 4JVPA 4POUB 4AK1A 4NN5C 3VFNA 2I9TB 3CIQA 1A3LH 3LDBB 4KMLB 3K8MA 4OQTA 1UM4H 2UZIH 5T3XD 1X4XA 5IMLB 1JFQH 2H32A 4NKQB 2XNAB 4LAQH 1ZS8B 1A6PA 4WWKB 2Y6SD 4QRRB 4OCYH 2GYSA 5E99H 2LAGB 3DRQA 4OZGA 3W2DH 4NZTL 4OIAA 4XPFH 2JIXA 1MAML 3S35H 1UXWA 4MD4B 3WNLA 1E4JA 5I6XB 4I3RL 1YMMD 3RIAF 4NGHL 1CFVH 3X11B 5FKAB 4I3SL 4OD2B 5JW5B 5FYLD 3RFZC 1H5BC 4P3CH 2Y36H 1NFDA 3O8XA 1P6AB 2AXHA 1NMAH 2BSSA 1BEYL 1CCZA 2E7HA 2DM3A 2H26A 1GPOL 2G9HA 2FCBA 3CPLA 4R4FL 4PJDB 1WFUA 3QQ3A 2VL4A 4RQQB 5ACZA 5KVEL 4P59H 4D9RE 1YQVL 3LRHA 2XY1A 5GRZA 5GXBB 3HPLA 4OT1H 3IDJA 4OQ1A 2FWOA 1VEMA 3LD8B 3QXWA 5D6DA 4RA0C 2HP4A 3I6KB 5E5UB 3IU3B 5E9DA 1RUMH 4IOFC 3SY0A 3RWEB 4HX1A 3MRQA 3C60A 2CUMA 1SVZA 3GBLA 3QP3A 4D0BB 3RDTC 1GHFL 2UVFA 3DYPA 4Y5YA 1DEEB 1M7IA 2EE6A 3VFOA 2A77L 5FYJE 2LTQC 4ZAKC 5FEBA 2VITB 4RGNE 5BMFL 2AJSL 2CO6B 2FIKB 4WW1A 4DKDC 4NJAH 4XTRC 3ZDXF 4MLSA 2ZUSA 2N7BA 4CUCA 3JWDL 1BJMA 1JYVA 5DUBB 4FABL 4KQ3H 4ZO9A 4RAUA 4WW2B 1CICD 1JNLH 1DN2A 4LHQB 4IRSD 1NC4B 4P5KB 2ZUUA 3BIAX 3FTGB 4OLYH 3PWPE 3RJDA 3GSNB 1FLRL 3H42L 4UTBL 5T5NG 5IMOB 1DQDL 4XAKE 1IC4H 4I9WE 4U1LB 5CKAA 1FVCA 2WWKO 2ZCHH 1T89A 5JQ6H 4LGSB 4K7PH 5AAWA 3KJ4B 3BIBX 4GW5B 5DFTA 4JPVH 5LXGH 2FYYA 3B5TA 1BPVA 1HHIB 5E2WH 5ILTH 1X44A 3U4EA 4J4PC 4P2QE 2B4CC 2RGSA 5FK9B 3T0VA 3F58L 1MFBL 2N56A 4AMKH 1TTUA 1C16B 5E2JA 1JGVL 5C07E 3VH8G 4WGVB 2R2HB 3S5LA 1NEUA 2Y06H 4PRPD 4TULH 1D6EB 3MYJA 3W9DB 4PTTB 4DWHA 4JDVB 5KZCB 4KUCD 4OKVA 3V5HB 1GGBH 3I02A 1CQYA 3HE7A 3JUZA 5C0AA 4MXVF 3U0PB 5CZVL 4NM4H 1CG9B 3QDGA 3MV9E 4RGNB 4XCEB 4EI5A 2VKWA 3CVHL 3GIVA 3MJ9H 3H9YA 3MTRA 1IE5A 2LE9A 5MEQA 3O2DA 5FOJA 3LPWA 1MRFH 3VG9B 5GRWA 1Q94A 1UA6H 3QA3A 5C8JB 4OCSL 5E2UL 1AY1H 1FN4A 2K9UA 4NZUL 3OXRA 3I6LE 4HS6A 3QIUA 1FCCA 5JO5B 4TUJA 2MWCA 3WFCL 1TCRA 3L3DB 3NAAL 3CFBB 3B9KA 5BZDB 3BUYA 3VXRD 3ARFD 5EUOA 3MO1A 1TTFA 3IGAB 1A9EA 4GLRH 4HJ0C 4LP4A 5FGSA 3CMOL 4H5SB 3X12B 3RTQC 5EZIL 4M7ZB 1XF2A 3DXAE 4OCWL 4TNWF 4OFKA 4P2QB 2IPKA 4L8CB 3ZKMD 4UV4L 4FQIL 4P4KB 5E6ZA 1Q1JL 5IESL 5DEFB 3PQYD 4HZLB 2IANA 4P2RE 3T2NH 4Z7OE 4HSQA 3OJMB 1HHKA 1MCFA 4LSQL 5GS2H 4KZDH 3LH2H 4P9HL 2A73B 5CUSL 5TQ0H 1B2WH 3EDEA 5I8KL 4D0DA 1WCBA 3SKJH 3NA4A 3DYOA 1EVUA 1FFOB 1P9MC 3SDAB 4LPXA 1DR9A 5IB3B 4YHKL 2VDNH 3GSQA 3MV9B 2GCYA 2FATH 3TJEH 5I16B 4WUKH 4XNXL 1UT9A 3SE9H 1AI1H 3QZWB 4ZPTB 5SX5H 3OGCA 3TO4B 5CINL 3OKMB 3A6OA 4DKFH 4GMTH 3WXVH 4LGPB 4XP6H 4FQHA 1X5KA 2XA8H 3O8XD 5D71H 5I1CL 5IG7A 1AO7D 4X7TB 3CFDA 2Z9TA 2ICWB 4P3DA 4KC3B 1YYML 3G5XB 3B8YA 1FZJB 1T5XB 3RNQB 3T08A 4B7LA 3OKKA 2BVQB 2FJFA 4OLWL 5IW1B 2X40A 3KPQB 3WNNA 1ZE3C 3DXAB 1RUKH 1ZWIB 4RISL 1KB5A 4HBCH 4HCRL 4ETYA 5L8LB 5DS8B 3OAYK 5E4EC 5T1LA 4P2RB 4FN0A 5LGHH 4HH9A 3RIFF 1O5DT 3F7YA 1TZHA 3C60D 3VCLB 5MHSE 1G6RA 1J1XL 3HS0B 5GGSY 4GXVL 3GSRB 6FABH 3A67L 1T7VA 4JDTH 1K5NB 3KR3L 2VDPL 1MCDA 1B0RB 4KJQD 3VXUE 2D31B 3T0BA 2XACC 4TUOB 1MCNA 3ARWA 1IFHL 5DZLA 5CLTA 5HI5D 4L9LC 3WUZA 4F2MB 5IQ9B 3TN0C 1MY5A 1SVCP 1FPTL 5IHUL 1V3KA 3P30L 4WFED 5TE7L 1NGYA 3ZTNL 1BFVH 5L2KE 2P5EE 3MNWA 2IGFL 3HC0B 3PF2A 1CDGA 2F53E 2NX5D 3PHOA 4MD0B 1YY9C 1AD9A 3VG0H 4MAYD 5CD5C 4Q58C 4NHUB 3IJSB 1U3ZA 5JUEL 1L0QA 2FZ3B 1FNAA 4XPGH 3KYKL 5CJ5A 2VXTH 1A7QH 2P24A 1SBSL 3S3SA 1B0WA 4PTUB 4PUBH 4UIKL 1OW0C 5IV2A 2Q6WA 2YXFA 4OGXL 5IHBA 2X4PB 4LVNB 3NCEB 1P5VA 3MOQA 5J57B 2HG5A 5JOFA 1A6ZA 5I30H 2LQRA 5ALCL 3IFNH 1J0HA 1XCQA 2AKRA 2R69L 5TDNB 2AJ3A 4MJ4A 2VXSL 3STLA 4PJEE 4DGIL 3L9RB 4ZNEE 1EGJH 5H8DA 3HE7D 2XNAA 3Q0HA 4LSTH 3HCVA 4C83B 3NFPA 5DTFA 4M7KL 5IROA 3HTLX 4I48B 4EI5D 2Z31A 1CT8B 3VXUB 2DQEH 1T4KB 4QGTA 2P46B 5T3XE 1YEIL 4PJIE 1A7NL 4QNPE 4QRPE 3BN3B 3QUXB 2AV1B 4X80H 5TE4H 4X4MA 2A9NL 2VLKD 3UTTA 3WIHA 2OX5A 3OZ9H 2OL3H 5L2KB 4FFVD 2P5EB 2QHLA 4MAUH 2CKBH 5E00A 1NCCL 4K94L 5ICXB 1C1EH 2IC2A 1BVZA 4CDGC 4AIZB 2F53B 2HJFA 4JVWA 1SY6H 3JTTB 4PJDA 5EU5A 1B88A 1JGLH 4LCIH 3I3EA 4ONHB 4KJWD 4MCZB 4OJFL 5F96L 4HK0B 1TETL 1U8OB 1W72H 4JANA 3LB6D 3QDJD 3IU3A 4OZ4B 4MJIA 5A2IH 1LP9F 3NCFB 2IAND 4PB9H 1BZ9B 2CH8A 4KJYB 3RWEA 1KN2H 5CILH 1H5BA 4HUXB 1OAQH 4IBLT 4POZC 4EIGB 1DEEA 2HFGL 4HPYL 3NIGF 3V4VH 3QUZB 2VITA 3RKDC 3IAPA 2FIKA 4PJEB 2V2XB 5F9WB 1BBJB 1ZHNB 2X70B 2NY3D 1DBJL 3CVIH 4M61A 5JQHC 3ZHLA 4HJGA 4PD4K 2C5DC 5SWQA 2F19L 4J3OC 2F8OA 3RY5A 2R8SH 3FAXA 3GUTB 5CBAA 4TOYL 4DGVL 3DX9B 1CGUA 2GUOB 5E7FA 1S9XB 1UJ3B 5KVFL 1YEDB 1X4YA 4QXUH 3UTQA 2GY5A 1FO0A 4OSUL 4PJIB 2I9LA 4QRPB 4AG4L 2X4SB 3VFUB 3RDTA 5E8PB 5EN2A 3TH2T 2R2EA 3T77B 4MA8L 3W5NA 1D9KB 4ZAKA 3TV3L 5AWNL 3G6AA 4WTWA 4BKLA 4NWUL 4ALAL 4K71B 3I2CL 2ZKHH 3X3GH 5IGXL 1RZJH 2H3NA 3QEUA 2OI9C 4UIMB 5I74C 4QWWC 1QLEH 1RIHL 3CNKA 3BVNB 5HHXL 2PO6C 3HAEA 1YMHA 3UJIL 1BJ8A 3IKCB 1LO5B 3JWOH 4MNHB 5D70H 3KWWA 4BSWB 3EO1A 4LIQH 4HWBA 1ZTXL 3U4BL 3BPNC 4PLJD 1AFVH 2CIKA 3O2VH 2X9XA 4I2XE 4XGZA 1ONQB 1MOEA 2DLFL 3IB4A 5JDSA 3O6FC 1JGEA 3AXLA 3PXJA 3MRLB 4XCNB 2KDGA 5IMKA 3B2UC 2V17L 4JZNA 5F93C 2XQBL 4EI6B 4J4PA 3CFJB 4MS8D 1OT2A 4I77L 1TNNA 1BECA 5EU4A 4JO2H 4HFWA 3B5GA 1V3MA 1JWUA 4PJGA 1JHLH 5SX4H 1IM3A 2E8ZA 2A6DA 1LHZA 3RIAK 1MVUB 1NAMH 5I8EA 4RMWA 3IGAA 4DVBA 1CICB 2HH0H 4GKOA 4JFPA 3P4LA 3TNNA 4IIQC 4KDTC 2AVGA 3X12A 2BXYA 3MLRL 3MXWL 1GOGA 4L4VE 3WHE0 2YUZA 4R7NB 3NZHH 4C55A 4XNYL 1V7NH 3LQZA 1MFAL 4KHTH 3QUKB 4RMUA 2ZNWA 2VQ1B 1BOGA 1CLZH 3V7AG 3AS2A 5CJXC 4EBQL 3QQ4A 3NCYP 5BW7C 4FP8H 4I2XB 2GEEA 1M71A 1UC6A 3W11C 5HHOD 1Q72H 2RFXA 1UGNA 1C5DB 2HMID 1F4YL 4KKBC 4YZFF 4H1LG 3V4UH 5HVGB 4XCFH 1MRDH 2BDNL 4U3HA 4C54A 1IEBB 2YUWA 2WIIB 3RTQA 3SDXF 4BZ1H 2QQKL 5I16A 3ULVL 2Z31D 3QXAA 2HN7A 1TENA 2LU4A 1LDSA 1J05B 4FQQA 1RJLB 3A6BL 1YEFL 3QZWA 2FX9H 2ADFL 2E5EA 3LMJH 3TO4A 4FQLH 3LQAH 3UYRL 4OF5A 3UYPA 3UTTD 3DUSA 3OAZH 2W92A 1S7VA 4U7KA 3OAYH 4QTIH 3K1DA 3IKKA 4F9LC 4W68A 4IHOA 1P9MA 2R1WB 2B2XL 2WINA 2R0LL 2CMRH 2DAVA 4CN1A 3G5XA 3ZKXB 2KH2B 3P73A 1LEGA 3GBMH 4XB8A 2P42B 1HILA 1Q9LA 3C2AL 5DRNA 4P2OC 3DGGB 1JWMB 5EH1A 5IW1A 4MJ2A 4N0RA 5ID0B 4NKIL 1IC7H 4OLVL 4TPRL 5T1MA 2WBJB 2JCCA 3VFMB 2CRYA 1AO7E 4I0PC 3TT1L 2JJTC 4UOW0 4L4VB 3WNOA 4HS3B 4M48H 4Z5RB 2F5AL 5ADPL 3J8F7 4NQUA 3VFWA 3QXDA 4PJFF 4MJID 4FNLL 5F7LB 1Q0YL 4D94A 1YEJL 3GSVB 2VN4A 2AS5M 1YECH 1OTSC 1JPSH 5EU7C 5EU3A 3L3JA 4JJHA 3FT2B 4QYOA 4X6EA 4D8PA 3DSNA 2PW2A 1CN4A 4MLIA 5IM7B 5DRXB 2FO1A 3ULUL 4JFYB 3SDDB 2VUOA 4UAOC 1U36A 5EZLA 4HWUA 4HUNB 1FBIL 3DRTB 3AREC 1B4RA 5A1AA 1CIDA 4I3SH 5A3IC 1QFWL 2WQRA 1GAFL 2DKUA 4OI7A 5CEXA 1Q9OB 5J11B 4IOFD 2ZPKH 1UZ6F 2X9WA 4MA1B 1VESA 1RULL 3HC0A 3PDOB 3RDTD 3HC3L 4IRJB 4JN2A 1GGTA 3T3PF 2GITB 2X4NA 4OZIF 4ZAKD 2G60L 3Q6GL 3FB5A 5I66A 5KVEH 5GS0C 2FZ3A 1YQVH 1ADQH 1G0YR 4GRWH 5B39B 3ALPA 3RBSA 5CCKH 5L6YL 4JGUA 2OR8A 1LO4L 2NX5E 4U1GC 2AK4E 4L9LA 3ZE2F 2HKHL 3TIDB 3O2WL 3WCYA 2X4PA 1P4LA 3ZDZE 5IVXA 4GAGH 3EFDL 4KMTH 4TNWK 1VPOL 5D1ZB 3WKMH 4I13B 5J56B 4M7LH 2AJUL 4JHAL 2DI8A 2XKNB 3VW3H 5GGVL 2VZ1A 4X4XB 4LCUB 4L5FH 4YE4H 4EUPB 1ZSDA 4JY6B 1XGUA 1KULA 4YK4C 4R8WH 3TBSA 3MV11 4PP2A 4I48A 4XVTL 3C5SB 5F8QC 4PRBB 3U83A 2ZUQB 5J12C 1NCWH 2P44B 4S1RL 3H9SA 3FHAA 1OW0A 2O5ZL 2L0DA 2CR3A 5I1HL 2EIBA 4G6AC 5JMOC 2D03H 4JLRB 1I3GL 1AHWC 1S7RB 2VLJE 5FUZH 1HDMA 4IS6A 5I73C 2J8HA 5C0JA 2VB5A 3S98A 2EIZA 4M6OL 3MCKA 1BHGA 1UVQB 3VFPB 2SEBB 4JO1H 2YWYA 1ND0A 2J8UE 4WUUD 1QSFD 1UM5L 5IUSA 3F58H 4C56A 1ES0B 3N1MC 4F33B 4D9QD 2VLKE 5LAXA 1JGVH 4MCZA 4Y8AA 1U0QA 5EOCH 1S9VB 5F7WC 4L29B 1MCQA 4OB5H 5TDOB 1A5FH 2V5SA 2B8OT 3ARTA 4UB0L 2AK4B 5D7IA 2BSRB 1KIUA 3TBTB 4PBWD 3M1BA 4OUUB 4QRUA 2Z92B 1OP9A 4NPYB 2G2RA 4HC1A 4JFEA 4NUJA 2XZZA 1GZQA 4WIQA 1ZLUK 4YPJA 3EDKA 3QUZA 5CZVH 2EXWC 1ZOXA 1G6VK 3G9VA 3KGRA 3MJ7A 3ZO0A 1J87A 2V2XA 4JFZL 3QDJE 3CVHH 4KROC 1U8LB 1BBJA 2CDEA 4OZGF 1Q9WB 3DO7A 4NIKB 3RIFK 1OP5K 4HUKB 4HJ0D 1AH1A 3U36B 3FO2B 4YHNB 3FQXB 4X5LA 2HJLA 3ZE1F 1L0YA 4PJ5E 3MRMB 1EHXA 3RTQD 3HMXH 3BKML 4ZUUB 1I7TB 1P4IH 1G7MA 1JN6B 1AGFB 1OD9A 4GAYB 2HT4D 4MYWB 4UUJA 1LK2A 2EH8L 4UOJA 3WFCH 4L3CB 3KS0H 4K9EH 3N50A 2DLHA 4QRPA 3IRPX 4X9BA 3NAAH 2VLJB 1VFMA 1NCTA 2N1KA 4S0SD 1JHKH 4G80A 2VXUH 3FQNA 3CMOH 1U2HA 4NNYA 5EPMA 1IM9B 1IGCH 2J8UB 1XH3B 5EZIH 4U1SB 1VKXB 3H0TB 3HR5B 4OCWH 1T1XB 1LILA 1OL0A 5DHYA 2VLKB 1Q1JH 3HHRB 5IESH 4MNHA 3IFLL 3GSUB 4CVXA 4UQ3B 4ZDHA 5K9KB 5F97E 4ELKA 1BIHA 2QV2A 5C0GA 3SGDH 3GHEL 5IJKC 2AGJL 4WTXA 5CUSH 5I8KH 1E4KA 4PV9A 4DZBB 2XIDA 3HUJA 5L9DL 1JTTA 1JWSB 4S1SL 1A6TA 5C6TH 1BMGA 2FLRT 4BSVA 1HHHB 4XXDB 3KXFE 1QNZL 1T0MA 1XGYH 5DD0L 1EAPB 4D9LH 3KPRE 1FZMB 3QUYC 5DD3L 1KTRL 2PO6A 1QSEA 5HYFA 4KK8D 5CEZL 2JB5H 1KJ3L 3CFJA 2WUCH 1IBGL 4Q6IC 5GIRB 3FFCA 4PJ5B 1F4WL 2R39A 2YD9A 3OMZA 5CINH 2ZCKH 1AP2A 3BEVB 1F3DH 2NY3B 2R2BB 3EYSH 3CZFB 5DLMH 3O6FA 3CFEB 2QSVA 3GMRB 3QCTH 3EFFA 1NJ9B 5EO9B 2BVPB 3VXSD 1YYMH 3QB7C 1NDGB 1F11B 3HG1E 4X8JB 5A2KH 4RMQA 5J1TC 5CGTA 1JMZA 2XXCB 1U92A 4LLAA 1ACYL 4GKNA 5IVOA 4XBPB 2APBA 5MEOB 3GNMH 3KJ6H 4RISH 2HLAB 1P7QB 3G6DL 4KK6D 2ADGB 3D3VE 5DQ9B 3AGVA 3VFVA 2YPVL 4DUXA 1B6DA 5E2TL 3MRNB 3TLRA 1AIFB 3TN0D 1MWAB 5D7SL 3HNSL 3DGCR 1MFDL 1X5JA 4PJ7E 5C7XL 5FGBA 3LEYL 4KAQL 1KCSH 3RPIA 1R5VB 2X7LB 3W5MA 3MNVB 4NO2A 3KR3H 1YY9D 1XF1A 3WFHB 5GJTL 3KXFB 3RVWD 3IU4L 5CD5D 5BV7B 4IIQA 4KDTA 1IFHH 1LDPH 4PJCA 4R0LB 3KPRB 2WIIA 3GSXB 3O3BA 3D2UB 1XCTB 4RMSA 3KLHC 5HHOE 1FPTH 5B38A 3H9SD 5F1KC 1QBLH 1KIQA 2VDLL 4O9HH 3D39A 1SYSA 5AUMA 2C4XA 2V2WA 5CJXA 4WV1B 4Z7UE 5SWZA 1KCVH 5DMGC 3BP7B 4JZJB 1KCRH 5D1XB 2DQIH 1M7DB 4K3JL 1SEBA 3W9EB 4UV7L 2X4RA 1UB6A 5I1JL 3ARDC 3FFDB 4PJHE 1SBSH 4JCLA 3HG1B 4C56D 3PWLB 2QADB 3GSOB 4OGXH 2XZAL 2BFVH 3WN5B 1KNOA 4Y88A 4XVJL 1UCBH 2ATPA 4GRLB 2HWZL 3T0EE 3D3VB 2R69H 4FTVA 4YFLF 1I75A 1I1RA 4Z0XA 1TVHB 2VXSH 2ADJA 4OF7A 4DGIH 4PY8I 1EK3A 4PJ7B 2HTLC 3QCVH 4K3DL 5EOTB 4ZS6C 3DIFA 3MRCB 3BD4A 4F9LA 3L95A 3GHBL 4F15C 5FHBL 4M7KH 3NGBC 3VE0A 4EIZC 1U8NB 5D96B 3P9LA 1OSZA 1EX0A 3MLZL 3L7EA 5E5MA 2CKBB 5K9QI 1YEIH 3QXTA 3DRTA 3MRHA 2RB8A 1A7NH 4I0PA 5MP6L 1X4ZA 4YGAB 1KFAH 5B8CB 5HHOB 5CS7A 1R5IA 1DVFD 5EO1B 2A9NH 3OF6D 3BEWB 3GM0A 3BWUC 2FJGB 5KS9A 2EDEA 2A6KB 5LQBL 1W72B 1JGDA 4POZD 5B3JF 2VWEE 5JXEC 3VFSB 1X9QA 5A40E 5HPOA 1CS6A 4LSUH 1OCWL 3DYMA 4S10A 4OV5A 3G5ZB 3MGTB 3RKDD 3SGJC 5FECA 1FCGA 4Z7VE 3ARRA 5JPMA 1MHCB 2EDTA 3UTPD 4XMPH 2CLZA 4OJFH 1A6WH 1U8IA 5F96H 1P4BL 1X3DA 4JPIA 4PJHB 5IVZA 1TETH 1OARL 1U3YA 1C5CL 5I9QB 4BFBD 3MRGA 1BFOB 3TIDA 3AREA 4L8SC 4LQFL 1BQHG 1RZJC 3QNZA 3D9AH 2R1XB 1BJ1H 2NLJB 4ZUTA 5KN5B 1V3LA 3CFCH 3T0EB 1A6VL 1NANI 2CO7B 3JWOC 1RPQA 2HFGH 4AYFA 4OLZL 3ZLQC 5I18L 5DJDA 4X7FC 1HSBB 3WIFB 5C9JB 1LEIB 4X5WA 1KTDB 1YYLL 1A7PL 2DIBA 4Y4FC 4M8QB 4X4XA 1DBJH 5KSAB 1XIWB 3OQ3B 1TVBA 2F19H 1TMCB 2ESVA 2V7HB 2M2DA 3BGMB 3QXUA 3CUPB 4QWWD 3P9WB 1REIA 1OAZH 4ZD3H 1GRWA 2BHZA 2HKFL 5KVFH 1BWMA 3Q1SH 3UDWC 3VFTB 3FFCD 2XTLA 3SCMC 2QKIB 3MRBB 1A0QL 1S7RA 3MJ8A 5AAMA 4AG4H 3TO2A 2MSPA 2DQFA 4JDZB 4PGDA 1QQDB 1G9NH 4MA8H 4G8EA 5AWNH 1T1YA 5KG9B 4HT1H 3C5ZC 2SEBA 3I2CH 2XZQL 3BHBA 5IGXH 1LD9B 5KJRH 3O6FD 3BW9A 4NJ9H 4LPCA 3NCMA 4YWGH 1RIHH 4NFCA 3PE9A 5HHNB 4DZ8B 5HHXH 4H0IA 3BO8B 3L1OL 3UJIH 2EYRB 4Z7VB 4ZUWB 2W9EH 1GIGL 4Y16B 3RUGF 1HXMA 3I3DA 1XZ0A 5FKPB 5C08A 2KZ1B 4WUUE 2AK4A 2GAZB 3R8BB 3DV4B 1LK3H 5DJ0A 3MJ9A 3IFPB 1EEYA 1Z6JT 5DVMA 1AHWA 2J2ZA 2PXYB 4OUUA 1CTOA 5GSVA 2FL5A 4KI5C 3ZT5A 3RHWF 3UX9B 2YR3A 1HZHL 1MIEH 2DBLL 5A2JH 2ZG2A 3HI6H 1MCEA 5E8OB 1B6UA 1KJVB 2I5YH 5F9DC 1TITA 4N0YH 4I18B 3BOVA 4NKOB 3RL1A 4KRNA 3ZSTA 3SOBL 2V5MA 2FEEI 2W0FB 4LBEA 1UH4A 4PREA 2NY1C 2Z8RA 2VXQL 4GRMB 2KBGA 2D7TL 3FONB 1MQKL 2VDRH 3PHQB 2KQMA 4ZYKA 4JFQA 1NMCC 2G5RA 5L7XL 2DOCA 1INQB 3B8SA 4R96A 2Z93A 2L4OA 4L3CA 1MF2H 2ZUVA 2VLJA 5EBGA 2IH3A 4TUKL 5K59F 1A4JB 1UG9A 2UZYB 5SWZD 2YPKB 4PJDF 2ARJA 2ORBL 4RFOH 5EO0B 1CU4L 1JIBA 1PW3A 2R4RL 3BPOC 4HIHB 2C4FT 1S8DA 4KKBD 1G9EA 3LQAC 1CGXA 4LLDA 3MXWH 1VKXA 3JV4B 4ZSOE 1JPST 1MFAH 1KTKE 3K4ZA 3S4SB 5C0EA 5TF0A 3HMWH 1T22B 3GMLB 4EBQH 5I8OL 3PNWB 1U58B 4J3WA 5GHWH 5CBEB 4R2GC 4YFLI 1JPGA 1ZT1A 1KLFA 2YUVA 5HYIA 4UT9H 1S7UB 1WWCA 1PKOA 2X4QB 5JNYA 1RHFA 3PWUB 3RWCB 2COQA 2P48B 4XXDA 4JPWL 3N9GH 5KANI 2BDNH 4XCCH 5F89A 1G9ML 3JSSA 1PZUB 5E4IA 5GPRA 2QL1A 2QQKH 1I4FA 3GMMA 2DIJA 3ULVH 4WW2F 3WHXA 4P46C 4PJBE 4P2OD 2IMMA 1P6FA 4HWZA 5ADOL 2EKSB 3BIKA 3O4LE 5EZOH 4G6JH 1XF5A 2VABA 1MLBB 2UYLA 5IJKA 1J5OL 4ODTL 3UYRH 3BEVA 3IJHB 3MFGB 4Q9QL 1FVEA 5DR5L 2HRPL 1N7ML 2L7JA 3FOMA 2B2XH 4OM0L 1R3KB 2BVPA 2R0LH 3NVQA 1M6OA 4MXWL 4P99A 3WNKA 1OTSD 4E0RB 1FG2B 3QUYA 4NWTL 4PRNA 3VD4A 3C2SA 2UWEA 3BGFC 4OLVH 3W0WE 4M7LT 5MEOA 3TT1H 3PG2A 4Q6IA 5EIQA 4HKXB 2DQGL 4RMRA 4ZSOB 5ADPH 3VXSE 3MRNA 3ARED 1BM3L 4KTEL 4TSBL 3LCYA 4PJ9B 5GGUB 5A3ID 2APVA 1RZIA 1CQKA 4LCCC 1QSZA 4HS8L 4WI8A 1R5VA 8CGTA 3NPSB 2X7LA 5EA0L 2DTML 4N9GA 1RJZA 3WFHA 3P4MA 3MLTA 4ZXBB 2EE2A 4GG8A 3ULUH 4K55A 3MNZB 3AAZB 1TZGL 2GJJA 5GS0D 2ESVD 5E8EB 3D2UA 3EO9H 3UCRA 1XCTA 5D7JB 5DD6B 1A6UH 2YSSB 4GBXB 3VDAA 4PJBB 5IEHB 5LBSL 4Y19D 3IS1X 5F7DB 3QNYA 1T1WB 1C08B 2HFEB 3KYOA 3O4LB 4NNXA 3EZJB 4MCYB 1N26A 1RFDH 3UJJH 2YOCA 2XWTB 1T7YA 5HDBE 4QRQA 4RGOH 2WIMA 4AL8H 4Z6AT 2C1PB 1KPVA 2YKLH 3V4PL 3Q6GH 1FDLL 3W9EA 1A4KB 3AFLA 43CAA 4QRSA 5ICZA 1OHQA 2C1OA 2VLLA 4WFGD 5FO8B 3JBG7 5FM4A 5L0QB 2EEBA 4GS7B 3T09A 1T04B 1R24A 2NY5L 2VAAB 4LFHG 2Z35B 1EGJA 4XNZB 5J89A 3M45A 1MRCL 4TNVF 4RGMB 2AEPL 1WC7A 3C5JB 3W0WB 1HHJA 4ZFGL 5A43C 1MCWM 5JW4N 1KENH 1VPOH 1G7JB 3VXSB 3OWEA 3I3BA 2W60B 4KTDL 1C12A 3JV0A 3SGEH 2AJUH 1E4WL 4JHAH 1MI5A 5JOEA 3SQOL 1GZPA 1MCHA 5BRZA 4R3SB 4CW1B 2DRUA 1CFTA 2IADB 4ZQKA 2IBBA 5FB8A 2BVYA 3MRCA 3U0TB 3TYFB 5F7KC 4EDWH 1KTLB 3Q6FA 1VFOA 1DUZA 2OL3A 1X7QA 3K7UA 1YEEL 2EYTB 4B50A 2R0WH 1CF8L 1CD1B 4GAFB 3BDBA 1X5HA 3TJHD 1HOCB 5I1HH 1L6XA 2FH6A 5KW9L 4LHUA 1NLBL 1FYHB 1BQLH 5ETUA 4KWUA 3B43A 3F7RA 4X4YB 5EO1A 3B2VL 1UH2A 3GJEB 3LEVH 1R3JB 4M6OH 4IRZL 4XBEL 3FOLB 4QCIB 2AI0L 3G9AB 3MV7D 2X1PA 4ODWA 4Y5VB 5KSBE 1NBZA 1IMHC 1VGKB 1MLCB 4L4TB 1W0VB 1OGAE 5TPWL 4K9EC 5EOCJ 2VDKL 4MZ3A 3AB0C 2CIIA 3SQBA 5DSCA 4KROD 1JPTL 3DV6A 2J1KA 1RUQL 4M1CC 4LSVL 4HUUA 1Q9KA 4AENB 3SKMA 1BFOA 3GJFH 3CVHB 5DQDL 3GRWL 2QQLH 3V5KA 3FN9A 1QPXA 3I84A 4NQCE 4Z7OF 2I26N 3PV6B 1JZ6A 1G9MC 4NC1E 4MDJA 1ITBB 2ZUYA 4U6YB 3NIFE 3RWDA 4KHXL 2D7NA 3SE8H 5JXEA 3RNKA 5HVHB 5DJXA 4XZUA 4TSAL 3SGJA 1AXTH 3V7MA 3MBXL 4A2MA 4UQ2A 2EDLA 1KJ2H 4NRXA 4E42B 4YHZL 5J06A 2B1AL 1NBVH 2R4SL 1JK8A 3D85D 2DQTH 4GW1B 4UBDC 5JOPE 4L8SA 5HGHB 4DCQB 3CXHK 2V5RA 3LS5H 4KRPC 2HT3C 2EH8H 2QKIA 1T1ZB 3ORJA 3CSBA 1FNEA 2FGWL 3KPNB 2FDBP 3IDNB 5I1KL 1A7RL 3BQUB 4JHZA 1N5AB 2BNQA 3IDXL 3STZB 4PRAA 1N59B 1WK0A 2A74B 4YHPB 1YEGH 2VKXA 4H8WL 1H9VA 4Y4FA 4LASL 5J4MA 3RX5A 5KSBB 3VGAB 2ED8A 5INDB 4OD1H 5FV2A 1FL5A 1IKFH 1OGAB 1RU9L 3L6FB 2X4UB 1DVFB 4YDIH 3QUYD 2P4AB 2CDFA 1PJ9A 3FB7B 1I1AB 1QVOA 5B39G 3FO9B 1JYXA 4HIXL 4P49A 3SCMA 4F8TA 2AXJA 4U05A 4NQCB 4X6CE 3PWJB 3MBEC 2DQHL 4NQDD 3QEHA 5L9DH 2PTTB 2VL5B 3E3QC 3N85H 3RWFB 5KBNC 1JUFA 2P8LA 4XP1H 2P8PA 3MXVH 3UPRB 4JE4B 3C5ZA 2D0FA 5FYKD 4NKOA 4J23A 1FH5L 4X7EC 2Z0BA 5DZNA 1KJ3H 2H8PB 1E6JH 1IBGH 4I0KA 1DQTA 5IFJB 1U2CA 1F4WH 1NAMA 3KLDA 4MSWB 2H41A 3V0WL 4EUPG 1NGZA 3BZEA 1F3DJ 3RL2B 1INQA 2RR3A 1CXLA 5H94A 2B1HL 3PGCA 3UTZB 4DEPB 5FDYA 5DJZB 2YZ8A 4WVRA 3Q3GA 2ZOKB 4Y5XC 5IB4A 1Z0MA 3QAZC 4OIBA 3QNXB 4HIHA 1XGPA 3NH7L 2W07A 3LKRB 4UT7L 2OYPA 4OCXL 3GFUA 3JV4A 5J6GB 1PD6A 4N5EC 5JW3H 3VGDA 5D7IF 5I75B 2OTWA 1YPZE 3S4SA 3KLHD 3OKDB 1J86A 3DVNA 5JW4Q 5E8DL 3PP3H 3GMLA 3DBXB 3T2PA 1IEAB 4JM2D 1RJYA 4KAQH 2CLVB 1JTPA 2QSCL 4HHAB 4X6CB 1CXEA 1NGWA 1PYWB 4JCMA 5IFAH 1MI5D 5DMGD 1AQKH 3QIBC 2X5PA 4M5ZH 1WBZA 4M62L 5BRZD 4I4WA 4O58L 4F7CB 4S1DC 2MMXA 1JNNL 1OAKH 4JKKA 1OF2A 2FO4B 4X6DA 4UDTB 4JN1L 3ARDD 3CX5K 2VXVH 5IFHL 2Q86A 2H6PB 1X5IA 2Q76A 4NQSB 3RY6C 4ZFZA 4LHUD 2XFXA 5ESVB 2FJHA 4A2LA 4CU7A 1T5WB 2OQJB 3RVVD 4RWYL 4K07A 3U9UB 3OX8A 3ZKNC 3RX8A 3OG4B 1QKZL 1U95B 2HTLD 3VDBA 1R3KA 1TJIH 4ZS6D 5BQ7B 4MJ6B 2CUHA 3DX8B 3S34L 3ZKSD 4IMLB 4E0RA 5DK0A 3P3YA 4U2YA 3BKCH 3CK0L 4JFDE 4GFTB 1T83A 1FYTE 3E1F1 5T5FL 4JO4L 4P46A 4X7CC 3WL9B 1KEML 4CN4A 1YNKH 1HSAA 1SJHA 3FT4B 3MOAL 2HWZH 2DKMA 5MI0C 1U91A 2NY0C 4G43A 5EU7E 3KPMB 1YPZB 2IALA 4NSKA 3VMPA 2FEDC 5CMAA 2BSED 3HUJF 4ELME 4AZ8A 2IBZY 2Z91A 1F8TL 4RDQF 1K8IA 1TZIA 3OHXB 1RY7B 5C09D 4ZTOL 4JY4B 4KGLA 3K2UL 1WEJH 4QXGH 1KYOK 5F3HB 8FABB 3HZVA 2DYPB 1RZFH 5JXED 1EO8L 5JLZA 1WGOA 5A2LH 3RHWK 1R3IH 4CADB 1G7PA 2NY7L 2HRLA 2IG2H 3SJVA 1U8QB 4J8RA 32C2B 3KPOA 1ZHKA 1QHOA 3PGFH 1ADQA 1JL8A 4UINH 3WSQL 2K3TA 2PF6A 3O3EB 3O4LA 3QO0A 4JY5H 3WFDH 3WEXA 4JREC 5C1MB 5D2LA 4LCCA 2KKQA 4F57L 4YUEL 1XF3A 1RIUL 4NQVB 4ODVH 2BNQD 3BMVA 5ERWB 3VWKB 2EYSB 5EUKB 3QPXH 4R6UA 4QGYA 5CEZD 2AJVH 4Z76B 1SMAA 5J1AB 3FJTA 3M8OH 5KANG 1RD6A 2HT2C 2VNCA 3EYOA 4X98A 1G9NC 3INUL 4YXLL 4ZFOL 1OARH 1YEHL 3ULSA 2VAAA 4JFDB 4XPAL 1VHPA 1HNFA 3VXPB 5EFIB 1FYTB 15C8H 3W0WA 4BUGA 3LRSA 4IJ3C 3VXOA 5C70A 1J18A 1D5ZB 3LHPL 3GMPA 4M43L 1HHGA 4F7PA 1FJ1B 2F74A 2BJML 1DN0B 2O5YL 3SGKC 5I18H 5F1NA 4ELMB 2J4WH 3X17A 1QRNA 3BH9B 4AH2A 4HQQL 1RK1A 2IADA 2LU3A 1A7PH 3TYFA 1K85A 3TZVC 3AU1B 3C5ZD 1AKJB 5GRVL 4E41A 1HCFX 3DUUA 3V0AC 2EYTA 3MLVL 1PFCA 3UTSA 5I71B 1UWEL 3QDMD 4KXZI 4HXAH 5DMIL 4ZFFA 4TVPL 4ONFH 1LNUB 1OP3K 1R3HB 3C09C 4QHLA 1WWWX 2PCPA 4M9PA 3HE6C 1ZA6B 4F7MB 3GJEA 1YNLH 4KPHH 4ZS7L 1NBYB 2VIRB 1H8SA 4Y4KB 1YNTA 4QCIA 1CFNA 3THML 4LU5L 4KGJA 1VGKA 2PW1B 3BZFB 4L4TA 1N5YL 3T1FB 1INEH 5E8NA 3IXTA 2P49B 3QHFL 4LF3A 1K3ZA 3ME0A 4H1LH 4LLMA 3VXNA 3MV7E 2YD4A 2ZSWA 4HMEA 3TVMB 5I19H 4JM4L 2XYCA 2XTJD 1IGTB 5ENWA 3RGVC 3ULVE 3IETA 4YPGA 4OGAD 3BZ4B 5J3HC 2AK1L 1OAUL 5FCSH 1KOAA 4A6YH 2PTUA 1HZHH 2DBLH 4U1HB 2Y5TA 1D5XB 3HMXA 4LNRB 3L5HA 4U1JB 1UYWL 1QG3A 4XHJC 3WXWH 3LKOB 5JHDE 2GFBA 4RAVB 7CGTA 1VACA 4JHWH 5TH2B 2OCFD 3I9GL 4HGMA 3DUHA 5L7XH 1JZ7A 3VJ6A 3MV8D 3JVGC 4U1NA 1FFRA 2V7NA 1OTTD 1N8ZA 2ITCA 2J7LA 1FL3A 3OJDA 2BX5A 5AZ2L 5C3TA 2H2PC 4Y4HC 2YD3A 4F58H 4JKLA 3STZA 5E5RB 5JXAL 1CLYL 4LARL 1N59A 1A3QA 4HPOH 4P23B 2A74A 2BZDA 2F15A 4LVOC 1QFUL 2R4RH 4Y2DC 5FYLL 7FABL 4LCWE 1DQQA 3EOAA 1UJTA 2EC9T 4MQTB 3DI2B 5CGYC 1JF1A 1CK0H 4XC3L 2DQDL 3L6FA 3P4NB 4WTZG 1R0AL 3E6FA 4GSDH 3KPPB 1DLFH 3ULUE 3IVKA 5HHMD 1S7QB 4HK3J 4P46D 1I1AA 3MV7B 1IAII 5B22A 3FO9A 3C6LB 4M3KB 2QR0A 4IMKC 1WV7T 1WAAE 5I0ZA 1T7XA 2VL5A 4BK4A 5GS3A 4G6ML 3ROOB 4TNVK 5F88B 3R0NA 3MREB 4BQ6A 3S36L 2XKSA 2CD0A 3EYVB 3LEXB 5LG1A 2H8PA 4NQDE 1JHTA 1JRHH 1KIRB 3WDIA 2E9JA 3V6BR 3MRKA 3QUML 4KKCC 5JHDB 4X83A 3SJVD 4F3FB 2X4TA 3REVB 3V5DA 1FIGH 4QT5B 1HH6A 2CSPA 2Q3ZA 1FC2D 4BFIB 3U1SH 3ZDYE 1J5OH 4ODTH 3QULB 3RP1A 5GRUL 1ZKAA 3MBEA 5DR5H 5DJ2B 3TBYB 2JF1A 4WI9A 4AM0A 4LNVA 1WUNT 1N7MH 4MXWH 3FQRB 3MACL 2WANA 1J1OH 3PXHA 4G8FB 4DVRL 4PG9A 4NWTH 4LPTA 4JO3H 5F1OB 1UZ8B 2B5IC 4GMSL 4LCWB 2VZ3A 3MA7A 4JQIH 1JV5A 3QFJD 4NUGL 1I1FB 3MZGB 5DEGA 4KTEH 1H3PL 1DCLA 3PWVB 3GEWB 3KLAA 5AYUH 3ZDZF 2EDBA 5LCVL 5GGSA 4M6AA 5JORB 1RZKL 1IEAA 2PR4L 4N0CC 2CLVA 3WFEH 1CE1H 4WNQA 2J5LB 5EA0H 4Y5XA 4NBZB 1MHEB 4D0CB 1QRND 2AJXH 1CR9L 4RRPA 5GRYA 4L3AA 4FXLA 2YK1L 5EIIB 3LIZL 3MRRB 3BP4B 4QHNB 5IK3A 4NQDB 2G75B 3KPLB 2H6PA 3O6LL 4KFZC 3UTSD 1SQ2N 4CU8A 2NNAB 4MA7L 4CAGA 4Y2OA 3ROLA 3TPKA 5C2UB 2OTUA 1PSKL 4Y1AA 4MDIB 2AERT 3BP5B 4NZJA 2X1QA 3JUYA 2WNGA 3O9WB 2AEQH 4JKMA 1FDLH 1SYVB 5IBUB 5CJOL 4PG2A 2GTWB 3QIBA 2XOTA 4LLWB 1U3JA 2J8UF 5IQ7L 5ANME 4JJ5B 4MJ6A 5E6IB 1F5WA 1ETZB 5JHLL 5IR1A 1J1PH 3ECBA 1YDPB 1MRCH 1OSPH 3MRIA 1QLRB 3H9HB 3DX7B 4B5EA 4N0UE 1G1CA 3RY6A 1OY3B 1BD2E 3DVFA 3VI3E 4DKEH 3P4OA 1F58L 1VSCA 3EJZC 3SQOH 4TRPH 5HDQL 2G5BA 4RMVA 1WTGT 3G6JA 2GK0B 3SDCB 4JKPH 3OHXA 3T0XA 1F6AB 1RMFL 2PETA 3IDIA 2Q7YB 1MCOL 2DYPA 4QOKA 2NY6B 1IGML 5FF6B 2JE8A 1CF8H 3NCJL 3QWOB 4JM2B 4OQTL 4PRHA 1NLBH 2YA0A 4OZFG 5C09E 2HJKB 5DJYA 4M1CD 4QXTA 4KU1A 5CD3A 2HTKC 3B2VH 5GS1B 2YPLD 3FZUC 1I7ZB 5IB2B 1N3NA 3BPCA 3ARGC 1T2JA 3CLFH 3RI5F 1M7XA 1OB1B 1IARB 3EDJA 5D8JL 4LSSH 3MUZ1 4WJ5A 1XGQB 2P8MA 3GJFB 1FV1A 4NN7C 1IQDA 3VWKA 4N8VB 2EYSA 4V2CB 1HI6B 4ZO8A 3REWB 2ZCLL 3OKOA 2VDKH 4NHCL 1KN4H 2W59A 3CFKA 5ANMB 1RUQH 3K8KA 3VXMD 4LSVH 3WD5H 4QLRA 3HRPA 1I3RB 1P69B 3V79C 5ITFA 5DQDH 3QH3A 3VXPA 5EFIA 5HYEA 4PV8B 2JJWA 5DF0A 3MOBL 5CEZE 1B9ZA 3QG6B 3NACL 4LLQA 3WIIL 4GKSB 4UBDD 4N0UB 1BIIB 2VC2L 4WO4B 2HT3D 1OAXH 1BD2B 4K7PY 3MRJB 4O5LL 2EZ0C 2YA2A 3DMMC 1U8HA 5EBMA 4KHXH 1OP3H 5K9JL 1FE8H 4QRTB 4K3EH 5ICYA 4TSAH 1A1MB 4L8DA 4O2FA 2EECA 4L9DA 1GGIH 5T3ZD 1HEZA 4YHZH 5B21A 4Y89A 2AXFA 2B1AH 4LPYA 4NO3A 4YXHL 3TNMA 2YN3A 5F7YC 5DYOA 3P0VL 1N6QL 5C09B 4ACPA 2H2SC 4X6BA 3OKEB 5DC4B 4HUVB 3OPZL 1HH9A 1YJDL 1ZA6A 2DDQL 3P9MB 4G6KH 4KH2A 4TTDD 3FCTA 3T4AB 5DC9B 4XWOD 4CVUA 4NO0D 3FQWA 2VLRA 3EOTH 3SGKA 3UYOD 4Y4KA 2X1WL 1R3LA 4H8WH 3QDME 4NZDA 5A16B 5SWSB 4JFFE 4JVUA 5D6CA 4RCAA 5I1AA 2QQNH 1EBAA 4XP5L 2DTSA 4Q0XH 1UWGH 3TZVA 5HSFA 1IGFH 1RU9H 2MQ3A 3BESR 4XWGL 1AGEA 1E27A 1X5ZA 4YO0B 3WE6B 1JYNA 4G9FE 4E9LA 5IKCB 3TVMA 3NTCL 4P5MA 1KGCD 4LVHB 4HDIA 2F5BH 5DRZA 3O3DB 5FO7A 1J8HD 3X14B 2FX8H 1KXQE 3BZ4A 5FYJH 4HWEH 2DQHH 4PRIA 4P3WA 3HE6A 4PJ7F 4AEFA 5ACLA 3NFNA 1EEZA 3QRFM 2CLRA 4H20L 1AE6H 4U1JA 1EDQA 1O0VA 2XTJE 1E4XH 2B7DT 3IRZA 3TC9A 1WIOA 1CL7H 3GBNH 4KKAD 4L3EE 2K7PA 3EO0B 5HGAB 3SPVA 4S0TD 2EDNA 3CH1B 4GLRI 1GYAA 4NYLA 3PL6C 4N5ED 1DL7H 3KPSD 1YY8B 4NT6A 1B3JA 3RGVA 1T3FB 2VO5A 3F5WB 5IOPA 2CJUL 1QZ1A 5IBLC 1F6FB 2FEEL 5HVWA 3O2DL 4W81A 1MHPL 4Y1AD 5F6IC 1XAUA 4U1MA 5HI4C 4EVNA 3V6OC 4P23A 4LKXB 1U3HB 3MV8E 4H25B 3DVGA 3QDMB 3FT3B 5BVJA 1F42A 5HY9B 4JFFB 1YN6B 2NY4C 3QIBD 3MFFB 4M1DH 4UT7H 4LLYB 5EC2B 3CD4A 1A1NA 4OCXH 4N0FA 4PJHF 1GXEA 5F72S 1ZA3B 2YMXL 1EO5A 2JKXA 1AQDB 5C0IB 2J88H 5E8DH 2WLZA 3JVGA 3GMOA 2H1PH 2I60L 4PJXE 3TFKC 4O4YL 4G9FB 1C7TA 1FFNB 5HYJA 1XR9A 1ZT4A 2GJ6A 2QSCH 4LRNH 4MJ5A 1UCTA 2BOCA 5I76A 3DARA 4M62H 5HHME 2WMPA 4XC1H 2LFGA 3ZKND 4O58H 1LGVA 1JMXA 3AC0A 3NIDE 3ZHDA 2XTJB 3QWRA 5K9OB 1FFPB 1OTUC 4P4RB 1Y6MR 4XB7A 4HIJB 3OL2A 2CQVA 4L3EB 1KSRA 3Q48A 4F3FA 1OGTA 3REVA 4PRHD 1NBQA 1VADB 4YGVB 1HYRC 1N2RA 3PJSB 3IFOA 4BFIA 4RWYH 4YAQA 2NY0D 4IMKA 5C0BD 2LAAA 4MZ2A 1S9YB 2FEDD 3TCXA 1Z2KA 1RZGB 4WI7A 5GGTH 2F54A 3NN8A 2NTFA 2ZG1A 4NM8H 4QO1A 5HHQB 2YA1A 3FQRA 1G84A 2O5XH 4LCYB 5FA4B 2A0LC 3MV8B 3QO1A 1UB5B 4F7TA 3O0RH 1MH5B 3OXSA 2AQ2A 1NL0H 4OF8A 1FIEA 1PG7L 4PJAE 3HNTL 4HV8A 4JO4H 5F9OL 3GMQB 1B4JL 3R06A 3GMNA 4G6FB 3RWIA 5TF1L 1D5MA 3CC5B 4HJJL 3WV0A 3ARBB 4ODUB 5HPMB 4FQXB 3JTSB 2GJZB 5ELIA 4M5YL 2J6EA 4YIQA 2NZ9D 4PJXB 1TQCC 4KZEL 1HE7A 5LJYH 5ALBL 3CDCA 5IB5A 2JK5B 2IQAB 2IQ9L 1UQSB 2KZWA 1L7IL 1KB5L 3OAUH 3VWJD 3FKUS 3LV3B 3I75A 4WEBL 1FZOA 5F8RC 3L3HA 3VH8A 2H9GB 1T21A 2OXGA 2NY7H 5FM8A 3HZYB 3X13A 1VA9A 2HT2D 3V7AE 1I9IL 5FA3B 1G6RL 4MVBC 1BLNB 1RZ8B 1S7SB 3GM8A 3LZFH 1OM3H 1VCAA 5CZXD 5DRWA 5C0CA 1GL4B 4XI5D 4QEGA 1GC1L 1TCMA 1BVLA 2NNAA 3FB8A 3O6KL 4Q9RH 3OV6A 4I5BA 4KI5F 4FQCH 1CIUA 1K6QL 1BVKB 5A2FA 2X09A 4NRZB 2IEPA 1QR1A 4GUPB 2OR7A 1G7HB 3WO4C 1MJ7L 3O9WA 4RAHA 3PABB 3WLWC 2VLRD 3WUWB 3UBXA 2NZIA 1EJOH 3VXQA 2IFFL 2H45A 2FD6L 3AM8C 1JPFB 2BRRL 5E6IA 2MCPH 1YEHH 3HNVH 4P5TD 1BBDH 3TZVD 2WUBL 4YHIB 4G42A 4PJAB 5CP3H 1QLRA 3BWAB 3DX6B 4DGYL 2ADIA 2JJVA 1GGCL 2GSIB 4M43H 3QXVA 1I8IB 2BJMH 2O5YH 3ES6B 4FXKB 4HGWB 5FDWB 5T33L 1H8OA 1NEZB 3HLAA 2DWDB 5BS0B 4O02L 4N90E 1QBML 1K4CB 4PR5A 3LSOB 1EA9C 5DUPL 4U6HB 4KI1A 4V2BA 1CDUA 3HC4H 4G9DA 3SHSA 5I1IL 2DQJL 4JPKL 3S96B 4TVPH 1F4AA 4Q9BA 4YHYC 1KEGH 1MHHA 4HKJB 3RZCC 3W82A 3VA2C 4BUHA 3T4YA 2NY2C 1CBVL 4LEXL 1A2YA 3LKQB 5IB2A 1DBMH 3G5YB 3QIUC 1ITCA 4ZS7H 2MJWA 5JMRA 5J3HD 3CX2A 1XGQA 5IJVA 1N0XH 3GJFA 5EWIH 3R1GH 3THMH 5ID1A 4OIIH 1HI6A 3OBAA 4HLJA 4ISVA 5AG9A 3T8XB 1SJEB 3IXAB 4YDVB 3EAKA 1LO0H 2YPLE 4YX2H 3C9NA 2VE6A 1IQWL 3WIHL 3GK8L 1A1OA 4YEFA 4Z7QE 3E0GA 1AXSB 1YZZA 4YH6A 5IIEA 5D2NC 1G7LA 1F90H 4HKZB 1IAOA 4NO5B 3SDXA 4W6WB 1MREH 1KB9K 2QQQA 4G7YL 4ZUVB 3QG6A 2YC1B 3A6CH 4M7JH 5FM5M 4Z7NF 4N0UA 3CXHJ 1MCPL 1XR8A 1U8KA 1KC5L 1FP5A 3ARGA 2W38A 1KJ2A 2BNRD 3VXME 1BD2A 5HYJD 1IGYB 1F97A 3TCLA 2GJ6D 5F21B 5HHPA 1I9JH 4HH8A 3U7YL 2H2PD 4JG0H 4Y4HD 2VDOH 1HKLH 4RFNC 3WJJC 2VUYA 4LVEA 3BDXA 3G08B 3U82B 1PLGL 5EBWB 1S5HA 4Y2DD 5T3XH 5CWSA 4EN3C 1KT2A 3FO1B 1NC2B 2RQ8A 4OLXH 4R9HA 5FV1L 2XWJB 5CGYD 3HN3A 2OMNA 3QWRD 1J9CT 2C3GA 2PKDA 1XF4A 2VR5A 2IAMB 2E8YA 2BOBB 1CGSL 4YBLB 3BKYL 4XMKL 5INCB 3MRFB 3B9DA 4XBGA 1CFBA 3UPAA 2DQCH 5JXAH 3T4AA 4JRYD 1CLYH 3ARUA 4J3SA 2DQUH 4JGMA 3L3IB 4PJFA 5DJCA 5FYLH 5SWSA 1DSFL 1AJ7H 1NKOA 4Q6YA 2FSEB 1FO0L 2F54D 3FRPG 4OI8A 4XC3H 3QI9C 1IILE 2R29L 1FQ9C 1NUGA 2YPLB 5F1IB 1IAKB 1H3VA 3EJYC 4DN3H 3SO3B 1NCDL 5B4MC 4XMLL 5BZWB 3FQUB 4NC0B 3ZE0E 3ETBF 1AR2A 3T65B 1WZLA 3CSGA 4IDJH 1S5IL 4FQ2L 4G6MH 4OGZA 4OCRL 4WU5A 5TGBB 3S88H 4NC2B 3VXMB 3S36H 3KYMB 1I1YB 3OR6A 5KVGH 5T1KD 5FUOL 4HWBL 1KGCE 2A6IA 1I9RH 1J8HE 1J0JA 2XV6B 1GC1C 2V6HA 1JYWA 1OLZA 5SX4I 3M07A 3U7WH 5BXFB 3QUMH 25C8L 4YC2C 4XVUC 3EUUA 1J11A 5SX5K 5DVLA 3CH1A 5IF0B 3D0LA 2P5WA 3BAEL 5GGQL 4PGZA 4PGEB 4DW2L 3F5WA 2HVJB 5C0CD 4MNGA 3PV7A 2B4CL 1T7ZA 1PZ5B 2OM5A 3DPBA 4N1EA 3SKOB 3WKNA 3MGOB 4N0CD 5HGGS 4LKXA 1U3HA 1A7BA 1HIMH 2R1YB 3KPSE 3ARSA 4JRXA 5DQJA 2R56L 3GKWH 4GMSH 1YEKH 4KY1H 5EC2A 1S7XA 4ZPVB 3P77A 1G7IA 5I1LB 1D5IL 1MPAL 4OF0A 3N1PC 3R0MA 3HZMB 5D93B 5C0IA 2E27L 5KVDH 3CX5J 2DB8A 4NO0B 3MUGB 3QIWB 3PL6A 1H3TA 5LCVH 3D6GA 4Z0BL 1FAIL 3IDMB 3VRJB 4G9FA 2RBLA 3QT2A 4OTXH 5EC1B 4R26L 4JG1L 3WFBL 3LDBC 4HFUH 4NP4H 5GISL 1MUJB 3OR7A 2WSKA 1MJ8L 2ZSVA 3DROB 3V6OA 1CZ8H 4WFHD 3ARZA 1MCBA 2BC4B 4WWKC 5F1SA 4DTGL 1HWGB 2RCSL 4X5XA 3KYNB 1EFXB 3BYYA 5DURD 2AP2A 3TBVB 1OT1A 5CIPB 4BZ2H 2YD8A 3OTTA 4L3EA 3MLUH 1A14L 3TYGL 3IDYB 5I6XC 4NOFA 5D1QB 4DAGL 4S2SA 4WHYG 1OAYL 4IOIB 1PSKH 1AGBB 5GJSL 2DKSA 2NR6C 4FHBD 5ISZA 4FXGB 5FOBA 2AV7B 4NQEA 1S9YA 2GW5A 5DUMH 5JIHA 3L7FB 5CJOH 1TQBB 5KSBF 1D5BB 4LQ1A 4K7FA 2BCKB 3GGWB 5CKGA 3KPSB 5JHLH 1KYOJ 4CVZA 4ETQA 5C0BE 5J1SC 1O7VA 3V95A 3GMQA 5L2JA 4MX7B 5DI8A 4DN4L 5CEYB 3L3OB 3LD8C 4HF5H 2OK0L 1Z9MA 3L5XH 3MYZA 4QF1B 5HPMA 3MROB 1DQLL 3L3GB 5IBTH 2HTKD 2OJZL 3FZUD 4F37K 3QDAA 3ARGD 4EKXA 3NIFF 4YXKL 2NXZB 3BUTA 5DT1H 1UQSA 4X7SL 4PS4L 1IGMH 1PKQA 3M17A 1ZLWH 3NCJH 3GO1L 3S3PA 4OQTH 5D5ME 2H32H 4ONGL 1S7SA 3VGGA 2IBGA 5EOQH 4WW2C 3TIEA 3EYUH 4YLQT 5T1DL 5E56A 3QJHB 1KJMB 2IWGA 2IMNA 5D8JH 5BVPH 3BP6B 5HGBA 5AD0A 2QSTA 5IT2L 3WDHA 1GOHA 4ORGB 4QHUB 3PABA 2ZCLH 3ESVF 2EZ0D 2JELL 3DMMD 3AMLA 3KJ4C 2ERJB 3FRUB 1O7SA 1DE4B 1WBYB 1FSKB 5ESQB 5LWYH 2W9DH 1FVDB 5C0BB 1N64L 4U7SA 3KNBA 4OFYD 4JB9H 3LKNA 3WIIH 4AIXA 2AQ3A 1U8PB 3LN5A 3BI9X 3D25A 2BVOA 4U0RB 3CSYB 4MB3A 1ORQB 1XEDA 5LKNA 5C0DB 4O5LH 2C7UB 5E1AB 4Q97A 3ES6A 4EUPH 5HDLA 1CI5A 1LO2H 2Y7QA 5BS0A 1WLHA 4FRWA 1LO3L 2K1MA 1K4CA 4M03A 3LSOA 4U6VL 4V1DD 2HAZA 4RIRB 4HWNA 4RGNC 4U6HA 2CR6A 3PDGA 3AM8A 1NANH 4CMHB 1A6AB 5GSRB 2EC9U 1YUHB 1MJUH 2BHUA 3TA3B 4WI6A 3VG9C 5D5MB 1JF6A 3MRDB 4HKJA 1EHAA 1A9BA 1WZ1L 3RA7L 4RNRB 5EU6A 3OPZH 1NGQH 4WU7B 3RX7A 2EE3A 2XWBA 4KVCL 3VWJB 2P5WD 2BSTB 2R0ZL 4X0KB 4APQB 4H1LA 1QLFB 2O93L 2XKUA 2VRAA 4NN6B 1CYGA 4YDLB 1FNGA 2NTSP 2PYFA 4XP5H 2FBJL 5EORL 2NXYB 3L3KB 1NFIB 1P2CA 4OM1L 1X5AA 2X4OB 4Z78A 4A6YA 4JRXD 2DBJA 2PYEA 4P9MH 3KAAA 5IBUG 4M7ZC 5DK2B 3TT3H 4YHOL 4IOSD 2DS4A 1QFHA 3CXDH 1RHHB 4HKZA 4P4KC 1N4XL 3RZCA 1AGCA 1QYGH 4NDMA 4Z77A 1RIVH 2A83B 3G6JF 3VA6A 3S37L 4HXBL 1IGYA 3UROR 3PWPB 4P5TB 4H20H 5IBLD 1PG7X 1K3IA 2Q3AA 4G8IA 1CE6B 1V7ML 3VFRB 1WJ3A 5HI4D 3SDAC 1G7QB 5JR1L 4P2CG 3NZ8A 1MAJA 1TPXB 2BNRE 4HC1L 5MEND 3Q5OA 3KDMB 2NY4D 3LS4H 2AJYL 2V5YA 5D7LA 4R97B 5D2NA 3EDFA 4K8RH 3U9PH 4Z18A 4QHMB 2FHCA 1WFOA 1RVFH 4N68A 5C07B 1XGTB 1LE9A 1K8DA 1P7KB 2NYYC 1J10A 3C8KB 3TFKD 3WS3A 3O2DH 12E8H 1OPGL 2VLMD 3TO4C 5ISZD 2NW2A 2KQNA 3CCHA 3TBWA 4PGBA 3SGDI 4Q74A 1RUAH 3WJJA 4QY8B 3TPUB 3RBGA 4CL7A 3FMGL 3VRLF 2GSGB 1WBXB 2YMXH 1ZLSH 4EN3A 5M95B 4N8VG 3IYLW 5F1IA 4JRYE 4XH2B 3EYFB 4R90L 3I50H 4HKBB 1OTUD 2VISA 1MJJB 1QACA 1LP9E 3HPJB 4LHUG 2I24N 2JIXD 1F3JA 2BHYA 4Z7WA 1U6AH 3QEQE 35C8L 3E6HA 3NIGE 4ELMF 2D9CA 1T2QL 5TGBA 4WY7L 2ARWA 1I1YA 2XN9A 4CMMB 4RZCB 4M9OA 3DSFL 3RVUD 1ED3A 1IAIL 1WZMA 3IDGA 1MY7A 3IF1B 5MEPA 4R4NC 3QI9A 2IPTL 1U8JB 1FGNH 1BQHB 3MRPA 3PP4L 2Q87A 1EMTL 2W0KA 2BNRB 2ICWJ 2QEJA 5IF0A 1RZ7H 4YHMH 4XPHH 3OAZK 2X44D 3C6SB 4PGEA 1NGXB 2WP3O 5DDHA 3WLBB 5D9SA 4G3YH 5E9DD 5EBLA 4R4BB 4NRYB 4XCYA 2MFNA 3GDBA 3MCLL 5KSVA 3Q5TA 4MQ7B 3H3PH 1DQMH 3BT2L 5F9OH 5I1LA 1B4JH 1E28B 1MWAH 4MNQA 2ZWLT 5D4QA 4LOUC 5C71A 4JRYB 4FZEH 5I1GH 3B6SB 3MUGA 3O4OB 1Y6KR 4MVBD 4WFFD 4LVNC 2CK0L 1LP9B 3IDMA 4ODXB 4CNIA 1F4HA 4TVPE 1H0DA 3QEQB 5ALBH 1U9KA 2YD2A 3FB6A 5FHAH 1HQ4A 5GZNC 1Y18B 5BV7H 3U4AA 1UFUA 2RJMA 3BN9C 3PIQA 4U6XB 4LLVA 1BZQK 3QHZH 3WNPA 4WI2A 1Z9OA 3WLWD 3GI8H 5JA9A 3SKNB 2UUDK 1Z3GL 1C5BL 2C9AA 5D72L 1SM3H 2ATKA 4NKDB 3DURB 3TWCL 2DICA 1F00I 3PGDB 3H9ZA 4TQEL 4NNPL 2ICES 3U46A 3JV5A 3NABH 1JE6A 3O6KH 4O51B 5FUCE 4ZFOB 4CKVX 5HYQB 3QUXC 5T1KB 1K6QH 3RUGA 2R23B 5F44A 4JFOA 4FQJL 4XVSL 5EU6D 1DBKL 2WM0A 3RWGB 2D7PA 5BO1H 5DMKB 4BH7B 4G8GE 1G0XA 1MJ7H 2I9TA 3ZKQD 4FFZH 2P7TB 3L7FA 3U2SB 3QYCA 2IFFH 5IMLA 1I7RB 1LQSR 2FD6H 4OLUH 5C0AD 4KUZL 3QFDB 2BCKA 1ZS8A 4PJ8B 4WWKA 4QRRA 2YS4A 2WUBH 3QDGD 3H7BB 3ILPB 4D3CH 5JIKA 4ENEC 2CKNA 3QEGH 5CEYA 3L3OA 3VRIB 4MD4A 2JJSC 1MEXL 3GB7B 3H3KA 3LKSB 1KPRB 5DD5L 3OB0K 3ULVF 3X11A 5FKAA 3CGTA 3L5WB 1HQRB 3F6IA 1ZVSB 2CRZA 4OD2A 5JW5A 2HLFC 2NY2D 4U1IB 1JZ5A 3QIUD 2LVEA 5F7FA 2W9LA 4LAQL 3QUZC 5DUPH 1QEWB 4OCYL 4YFEA 1YMME 3B9KD 5F9WC 3O41B 4XPFL 4RQQA 5FYLE 2DQJH 2W65B 3B3IB 2F8XC 4ODHH 1H15B 2EIEA 5D7LD 1WFNA 1UJ3C 3PDDA 4X6FB 3QJHA 1KJMA 2EIDA 2ICEB 3I6KA 1Z5LB 1NMAL 1RK0B 3OJVC 2VR9A 4D0BA 1QOKA 4PB0H 5TFSL 1RAMA 4ORGA 4G8GB 1D9KC 4NKMB 1KCUH 4HIEB 4K71C 1ZT7B 4GQPH 4P59L 1NKRA 4OT1L 2ZG3A 1WBYA 3EOBB 4HZAA 3BD5A 1Q0XH 5DUBA 3K4AA 3MA9H 5T5NF 5DWUH 3K80A 3ULUF 3SE4C 4M00A 4WW2A 1RUML 2BY0A 2WWMC 1U8PA 1LEKB 1NC4A 4P5KA 1PQZB 1JI1A 3BE1H 3FTGA 5L88H 5E1AA 3GSNA 1EXUB 1E4KC 4PIRF 5IMOA 1IC1A 4KVNL 4U1LA 4NJAL 3MCG1 2MCG1 3OJ2C 5E6YA 4RIRA 1FL6B 4GW5A 3KPTA 1HHIA 3E8UH 1YMMB 3C87A 4RX4A 4UILH 1ZANH 5FK9A 3QI9D 4KQ3L 2YXMA 1JNLL 4WDIB 1KLGB 1C16A 4TN9A 4X9GA 1A02N 4V1DE 3EJYD 2R2HA 1CGSH 2CDGB 1RURL 3BKYH 3GSWB 4OLYL 2Y1VA 1CFSB 5B4MD 1D6EA 2VTFA 5GS0L 3ZDYF 4JFXB 3W9DA 4WHTB 2BMKB 4PTTA 4YBHA 3VXTB 2BSTA 1X5GA 2B0SH 4JDVA 4P57B 2ZCHL 3T3PE 1QLFA 5T1LD 4K7PL 4OZIE 3V5HA 2ZOLB 2XZCH 2M26A 3E2HB 5J13B 4JPVL 2OSLB 1KCLA 4ODBD 1FO0H 5E2WL 5F9AC 5ILTL 3BKJH 1NFIA 3L3KA 3U0PA 1CG9A 4PRPE 2R29H 5H2BB 4C57C 1CICC 4NQXB 4XPBL 3F62A 5DXWA 4AMKL 4XCEA 3IJYB 3ZE2E 3PWNB 2D0GA 4O2CB 3WUWG 2JB6B 1NCDH 4XMLH 4ZG1A 3HRZB 4MNQD 3CLEL 4YNYB 4XVUD 3BH8B 3TH4T 5C8JA 3C08H 2ENSA 2F8VA 1OQOA 1S5IH 3QUMB 4IM8A 1GGBL 4OCRH 1KXTB 5IHZB 4LAJH 5JO5A 5FGBC 4HD9A 4YHLL 3PWPA 1X5YA 2C26A 3L3DA 4HWBH 3CFBA 5BZDA 1NLDH 1VGEH 2A1WH 2EC8A 3MJ9L 1HINH 1NEZG 1MCLA 4MWFB 4MA3B 5F7EL 4IRSB 4H5SA 5DJ6B 4XNQB 2DWEB 4DQOH 1MRFL 4OZHE 5DGQA 1F4XH 4ZUSB 4P2QA 1A7OL 4L8CA 1AY1L 4P4KA 3VXRE 3GI9L 4JZOB 2VSDA 1I8MB 3IT8D 5DEFA 4DW2H 5C07A 4HZLA 4V1DB 4ZNCD 2YD6A 5MENE 2A73A 2AJZB 2X89A 3RVXC 1FFOA 4Z95L 1NUDA 3PQYE 3HI5L 3SDAA 1ZGLB 1VFBB 3FAWA 2UZXB 5IB3A 3ZKXC 3MV01 4PRPB 3S97C 3UTOA 3MV9A 4WWKD 4QRRD 3ILQC 4XRCB 4UT6H 5HYSB 4HKBA 5GRJH 1MCWW 2WBJC 3T2NL 5IW6B 4KZDL 2IBZX 1FAIH 4OD3H 4GKZB 3LH2L 1IKNC 1EVTC 2OR9H 2X1XR 4U3CA 3BZDA 3QJFB 4R26H 5DJ8B 3VI3F 4JG1H 4AT6B 3VFGH 4OZFH 4ZPTA 3WFBH 3LKPB 2FB4H 1UKSA 2NW3B 1KF9B 2NR6D 2X05A 1MJ8H 4HUMB 3NA9H 3OKMA 1ACZA 1ORSB 4OZGE 3TH3T 1NDMB 4HBQA 1K2DB 2AABH 3MR9B 5TQ2L 4X7TA 2RCSH 4XAWH 2ICWA 1GGYA 5I8CB 1VFAB 2FATL 5DVNA 3OKLB 3TJEL 3RKPA 1FZJA 1T5XA 3SDDC 3RNQA 4WUKL 3DETC 5F3BB 2VDQH 2YEZB 2BVQA 5GGTA 3JV6B 3TYGH 3RJQB 3KPQA 1I8KB 1IGIH 1NFDE 4OZHB 4FG6C 4CGTA 1TIUA 3DXAA 1AI1L 1ZWIA 5KAQG 5GJSH 2BXZA 4C4KT 5DS8A 3VXRB 2XQYG 3ARFB 1NGXA 4GAJL 2WBWB 4DKFL 1MFEL 4P2RA 3WXVL 5J11C 2XA8L 4FABH 5D71L 4MA1C 4OKDA 3FQTB 3VCLA 4BH8B 5MENB 1ZHBB 2Y25A 4IRJC 2GY7B 5HVFB 2DLTA 3HS0A 3GSRA 2ZJSL 2QTEA 1K5NA 1Y0LB 3LVEA 1B0RA 3PQYB 5I1DB 4NZTH 2D31A 5E9DE 1MAMH 4TUOA 2VDML 2EDYA 5J6HB 4HBCL 1DEDA 1FZKB 4I3RH 4F2MA 4NGHH 5IQ9A 2ENYA 2UUDH 2Y4SA 4P2YA 3VFNB 5LGHL 3BJ91 1NC4D 1WICA 2H32B 1DBAL 4YXKH 1BEYH 1Y18A 5D1ZC 1MSPA 1WF5A 4HUWB 3T04D 4MD0A 1GPOH 6FABL 3QBTB 4JDTL 5EB9A 4R4FH 5AYQA 1ZVYA 3DRQB 4OZGB 4NHUA 3IJSA 3SKNA 2JIXB 4WFEE 1V5JA 3BFOA 4XTRD 1J0ZA 4HG4K 2ZUQC 4RX4D 5FYKL 4PTUA 2PTVA 4RBPK 1IT9L 3PUCA 3S37X 3SN6N 1BFVL 1NFDB 3O8XB 3JZ7A 1AO7B 2BSSB 2D3VA 3QISA 1FORL 1GHFH 1X5XA 2VR4A 2H26B 4BH7A 5IT2H 5TDNA 2G9HB 5CP3A 1EV2E 3CPLB 2A77H 1HXYB 2P7TA 5KZCD 1JZ3A 5BMFH 2AJSH 3OB0H 3O6ML 3L9RA 3UBXI 2B39A 5DHVH 5HI5C 4XPGL 3HPLB 2VXTL 3IDJB 1A7QL 1S3KL 2FWOB 5FYJD 4C83A 3JWDH 4PUBL 4RGND 1TJHL 1N64H 1CT8A 3VXUA 4J4PD 2P47B 5E9DB 5IVNA 1T4KA 4MQSB 3SY0B 3RWJB 4HX1B 3MRQB 3C60B 3OSKA 5I30L 3IFNL 3LKSA 5C0AE 1FNLA 4Y5YB 3L5WA 3QUXA 1M7IB 2AV1A 3VFOB 1FLRH 3H42H 2QLVB 4UTBH 1DQDH 1EGJL 1P5UA 5L2KA 2P5EA 4LSTL 1WQVT 5ICXA 4AIZA 2F53A 2J12B 1EUUA 1QO3B 3JTTA 1DJSA 3HFML 2DQEL 1MFBH 4RAUB 4ONHA 4B41A 1WZ1H 4X80L 1YQ2A 4KV5E 4HK0A 5TE4L 4P2QD 2JJSA 1U8OA 2NX5B 4X6FA 3SEPA 4KVCH 2ICEA 5EUOE 5FCUL 2Y72A 2WBKA 4OZ4A 1KB9J 4MAYB 4N1CA 3OZ9L 2OL3L 1BZ9A 4KJYA 4GXUM 4MAUL 4HUXA 4K8RC 4KXZH 3UEZA 2FYYB 1W0YT 1T6WA 4NKMA 4OM1H 1VDGA 1JGLL 4PJEA 1ZT7A 2X89D 4ZNEA 3HZKB 4LCIL 1W8OA 1ZHNA 2X70A 2IANE 2ICCA 5HI3C 3MV9D 3GUTA 1N4XH 5CSBA 4OCSH 3DX9A 5E2UH 2GUOA 4NZUH 1S9XA 1UJ3A 4OKVB 4PB9L 4AQOA 4PJXF 3MQIA 1YEDA 4F80A 1KN2L 5CILL 1PQZA 3I02B 3STBA 3HE7B 2D7QA 4PJIA 4YEEA 2X4SA 5AG8A 2NYYD 3VFUA 5E8PA 5DHXB 1EEUA 3T77A 1V7MH 4EI5B 1E6OL 3TO4D 1D9KA 3U30B 3GIVB 2RIKA 6CGTA 3WDJA 2AEWA 3NIDF 5MEQB 4UIMA 4FMFA 2R8SL 3BVNA 3QA3B 4JQVA 5C6WH 4EQ2A 2E6PA 1FN4B 4UV4H 1AC0A 2DJSA 3IKCA 3OXRB 4FQIH 1LO5A 4HS6B 1RUPL 3SE4A 4QXUL 4BSWA 4TUJB 2EDDA 4LSQH 1TCRB 5IP4A 4P9HH 3DXAD 4JFXA 3B9KB 3V0VB 3BUYB 4YQXL 5B3JE 5EUOB 4P57A 1ONQA 3MO1B 2NY3C 2W0LA 3ZYZA 1A9EB 4NOBA 1K9TA 2ZKHL 3X3GL 4LGRB 1RZJL 3MRLA 4XCNA 1QLEL 4YHKH 2YBRB 2IPKB 4PJAF 3PWNA 4EI6A 3QDJB 4O2CA 4R4ND 4R90H 3JWOL 1CLOL 5D70L 2XXMB 2IANB 4XNXH 4LIQL 4YNYA 5DO2C 1BX2B 1AFVL 4OCLC 3QUMA 1T2QH 4D0DB 3K1KC 5E70A 5JPNB 2O61B 4AJ0A 5I1CH 4M93B 3K3QA 1IAIH 3GSQB 1MVUA 5FM5O 1JBJA 2GCYB 1CICA 1DTUA 4IRSA 5BV7C 4R0LC 4OLWH 2JTDA 1KIPB 1P84K 1QP1A 4ZUSA 4R7NA 1EERB 4HCRH 3SE3C 5L8JB 4WHCA 4LOUD 1BGXL 3O3UN 3QUKA 3BX7C 4RSVA 1JHLL 2VQ1A 5IG7B 5IEKB 1QRKA 2CPCA 1LWRA 4WV1C 3CFDB 2V9QA 4P3DB 1NAML 1AXIB 2CGRL 4I2XA 4JZJC 1J1XH 5GZND 5D1XC 3X3FL 4F9PC 4GXVH 1C5DA