1K7BA

Nmr solution structure of stva47, the viral-binding domain of tva
Total Genus 7
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
7
sequence length
42
structure length
42
Chain Sequence
SCPPGQFRCSEPPGAHGECYPQDWLCDGHPDCDDGRDEWGCG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The solution structure of the viral binding domain of Tva, the cellular receptor for subgroup A avian leukosis and sarcoma virus.
pubmed doi rcsb
molecule keywords SUBGROUP A ROUS SARCOMA VIRUS RECEPTOR PG800 AND PG950
molecule tags Membrane protein
source organism Coturnix coturnix
total genus 7
structure length 42
sequence length 42
ec nomenclature
pdb deposition date 2001-10-18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
4.10.400.10 Few Secondary Structures Irregular Low-density Lipoprotein Receptor Low-density Lipoprotein Receptor 1k7bA00
2JM4A 2I1PA 2FCWB 1XFEA 2M7PA 1D2LA 2KNYA 1J8EA 1JRFA 2M0PA 2KNXA 1D2JA 1F5YA 1K7BA 1CR8A 2FYJA 1N7DA 2FYLB 1LDRA 1LDLA 2M96A 2LGPA
chains in the Genus database with same CATH superfamily
2JM4A 2I1PA 2FCWB 1XFEA 2M7PA 1D2LA 2KNYA 1J8EA 1JRFA 2M0PA 2KNXA 1D2JA 1F5YA 1K7BA 1CR8A 2FYJA 1N7DA 2FYLB 1LDRA 1LDLA 2M96A 2LGPA
chains in the Genus database with same CATH topology
2JM4A 2I1PA 2FCWB 1XFEA 2M7PA 1D2LA 2KNYA 1J8EA 1JRFA 2M0PA 2KNXA 1D2JA 1F5YA 1K7BA 1CR8A 2FYJA 1N7DA 2FYLB 1LDRA 1LDLA 2M96A 2LGPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2JM4 A;  2I1P A;  2FCW B;  1XFE A;  2M7P A;  1D2L A;  2KNY A;  1J8E A;  1JRF A;  2M0P A;  2KNX A;  1D2J A;  1F5Y A;  1K7B A;  1CR8 A;  2FYJ A;  1N7D A;  2FYL B;  1LDR A;  1LDL A;  2M96 A;  2LGP A; 
#chains in the Genus database with same CATH topology
 2JM4 A;  2I1P A;  2FCW B;  1XFE A;  2M7P A;  1D2L A;  2KNY A;  1J8E A;  1JRF A;  2M0P A;  2KNX A;  1D2J A;  1F5Y A;  1K7B A;  1CR8 A;  2FYJ A;  1N7D A;  2FYL B;  1LDR A;  1LDL A;  2M96 A;  2LGP A; 
#chains in the Genus database with same CATH homology
 2JM4 A;  2I1P A;  2FCW B;  1XFE A;  2M7P A;  1D2L A;  2KNY A;  1J8E A;  1JRF A;  2M0P A;  2KNX A;  1D2J A;  1F5Y A;  1K7B A;  1CR8 A;  2FYJ A;  1N7D A;  2FYL B;  1LDR A;  1LDL A;  2M96 A;  2LGP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...