1K7EA

Crystal structure of wild-type tryptophan synthase complexed with n-[1h-indol-3-yl-acetyl]glycine acid
Total Genus 100
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
100
sequence length
268
structure length
261
Chain Sequence
MERYENLFAQLNDRREGAFVPFVTLGDPGIEQSLKIIDTLIDAGADALELGVPFSDPLADGPTIQNANLRAFAAGVTPAQCFEMLALIREKHPTIPIGLLMYANLVFNNGIDAFYARCEQVGVDSVLVADVPVEESAPFRQAALRHNIAPIFICPPNADDDLLRQVASYGRGYTYLLSRSGVTGPLHHLIEKLKEYHAAPALQGFGISSPEQVSAAVRAGAAGAISGSAIVKIIEKNLASPKQMLAELRSFVSAMKAASRA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TRYPTOPHAN SYNTHASE ALPHA CHAIN
publication title Crystal structures of a new class of allosteric effectors complexed to tryptophan synthase.
pubmed doi rcsb
source organism Salmonella typhimurium
molecule tags Lyase
total genus 100
structure length 261
sequence length 268
ec nomenclature ec 4.2.1.20: Tryptophan synthase.
pdb deposition date 2001-10-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00290 Trp_syntA Tryptophan synthase alpha chain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 1k7eA00
3W2NA 3ABRA 3W23A 2DZTA 1DVJA 1EPXA 4TMBA 1YXYA 1VYPX 1IXPA 1VPXA 5FF7A 3C0JA 1K8YA 3L65A 3ZFHA 4WXZA 1THFD 3M16A 3N2XA 5CPLA 3L66A 1O60A 2DP3A 3LRMA 3LCLA 4YCPA 3VE9A 3P74A 3F4WA 1W8SA 3FKKA 1VCFA 1JJKA 2AGKA 4JIPA 1A5BA 2W79A 3QM3A 1AW5A 1DJQA 1PCKA 5HNRA 2NUYA 5BW6A 1W56A 1TQJA 3OIXA 1WYIA 2A21A 2DU2A 3A24A 3PBVA 1F6KA 1SFLA 3W7EA 4R7JA 3KVJA 2W6RA 5AC7A 4K6AA 2YDAA 1TO3A 3SZ8A 1EP1A 2Y89A 1G67A 4TU1A 3GX9A 3W6YA 4O14A 1K8XA 3GR8A 2X16A 1SW7A 2KZHA 4GE8A 1P5BA 2X2GA 1PS9A 1QAPA 3PSVA 4UTKA 4RR4A 1U83A 1KTBA 4MZYA 2YGYA 4GFSA 4GUHA 3NQFA 3M47A 3C2RA 2X1TA 3VCRA 1O95A 2GPTA 3LLFA 1F74A 3QRHA 4I7VA 3T78A 4DPPA 4NQ1A 2VXNA 4CCCA 4N9CA 5D32A 7TIMA 1GEQA 3QYQA 1G4TA 1VLWA 2XFWA 4IPIA 3R2GA 1PHWA 4H6KA 1N7KA 1Z48A 3NNTA 2FLIA 1GPWA 4XTDA 3PUEA 2DZWA 3RU6A 2OCZA 2C6QA 2AQWA 5D2TA 4WY0F 4RCXA 1EWDA 3F1QA 2A1YA 3LCFA 1A5CA 3W7OA 3DFOA 1LROA 2VFDA 3NQDA 4JTJA 4KFNA 1IXNA 3QPZA 4Z1CA 3FS2A 2ZBTA 3QH2A 1FDZA 3E12A 4TIMA 3SGZA 3W87A 4BFAA 4HNTA 4ZL1A 4IPJA 3WK0A 3QEZA 3P62A 1KM4A 4N4PA 4Y90A 2QAPA 1PVNA 2B4GA 4R53A 3PG9A 3BV4A 1OK6A 4AHPA 1G7VA 3QC3A 2A0NA 3SECA 1LBMA 2VFHA 1ZCOA 1HO1A 5BMXA 1OFRA 2A7RA 3A5VA 4N02A 5D2WA 1W5PA 4GBUA 3TH6A 4LRTA 4AHOA 1PV8A 4GWEA 3W72A 1OFOA 5F2LA 2BLEA 2TYSA 2ZZ2A 3CTLA 3G1HA 3TKFA 4LRSA 3HJZA 3N19B 4EOUA 4CQ8A 4QITA 3HOJA 1ZENA 1NEYA 4Z1BA 1N8FA 4KFOA 2NX9A 1XC4A 2Z2UA 3R89A 3VE7A 3B0UX 5CSRA 5D09A 3R12A 4JTSA 3GR7A 1VYSX 3L0GA 1Z42A 3MI3A 1VYRA 1XUUA 3C4UA 4UTMA 5F4XA 3LOTA 3NL3A 1GYLA 3M7WA 3CLMA 4A2SA 1DOSA 4ZQCA 4ORMA 2NWSA 1SZNA 1F5ZA 1Q6RA 2OX1A 3WJWA 1ONRA 3W86A 1S5TA 3M1ZA 3EWYA 1YDVA 1JQVA 2QCGA 2QCLA 3GB6A 4LU0A 4N6EA 5AOUA 5I3HA 2ZCGA 2CLLA 3LGEA 1TV7A 3NQAA 3PUDA 1H7PA 1F73A 3DGRA 1M7PA 3W7IA 3NQGA 1MSSA 1P0KA 3W3OA 1YTDA 3BO9A 5GVJA 3LERA 4PEKA 3N3MA 3SJ3A 3S9YA 2E5DA 3W2MA 3W7MA 3DH7A 4LS2A 2HSAA 5G1YA 4YXGA 1UUMA 1U5JA 3W74A 5EKYA 5G4EA 4OV4A 1S3HA 1RQHA 3UWYA 4LY8A 1QPNA 1K8ZA 4NJHA 1JVNA 3P5YA 5HQEA 1X1OA 1I2QA 2J9YA 3P80A 3QQ1A 3P67A 3F03K 1TV5A 2VKZG 3I7SA 3NPVA 3LHVA 2R91A 3W1AA 3IIPA 3L5AA 2QF7A 1Y0EA 1VHCA 5FI8A 3EX3A 1KLYA 1XXXA 3ABQA 4OHQA 2WO5A 5TBOA 1H50A 3HPXA 2FB2A 3RK8A 1QO5A 5DCBA 3BGJA 1FWRA 3L0KA 3U6WA 4GUFA 2G97A 1ME8A 1QFEA 5D2YA 1TRIA 3YPIA 3EB2A 3THAA 3HO8A 4FNTA 4YCOA 2QR6A 1GVFA 3QQ0A 5AHFA 3UPWA 3UXAA 1LYXA 1G69A 1RV8A 2V9DA 2QJIA 3BW2A 1EX5A 3CC1A 1XDLA 4FNUA 3TU9A 1ZHAA 4UTWC 1ICQA 3IRDA 1EA0A 1H7XA 3ZWTA 1KV5A 1BWKA 4HSOA 1TYGA 2FTPA 1ZNNA 1S5VA 3TQ0A 3GXNA 3WJSA 3UYCA 1T96A 2F7FA 4A21A 3ABSA 3GZ3A 1QPOA 4Z0JA 4FX7A 5K3VA 3P5ZA 2Z6IA 2C14A 4LVBA 3DHFA 2GOUA 5I3GA 5D04C 3OA3A 5HJLA 3LDVA 1TCDA 4NUWA 3G1VA 1RPXA 1LZOA 3OVPA 3A22A 4MZ8A 1R47A 1UASA 4NJGA 1Z41A 2JGQA 3PG8A 4WUIA 4JTGA 3EKZA 4WXYA 2A85A 1NVMA 3G1XA 4Z1DA 2RFGA 3DKJA 2QKFA 4UXDA 1DHPA 5CPMA 5LKYA 2C15A 2QCHA 3NM1A 4LS0A 4Q33A 1WAUA 4HSNA 3BLFA 4P61A 5AN7A 1D3HA 3NQ8A 4O8RA 1EUAA 3C8FA 3E02A 1TTPA 2YW3A 1VGAA 4L4MA 1RQEA 2Y61A 3UY8A 3QSTA 2TMDA 1BWLA 2HMCA 1J4EA 4PCFA 3LV5A 3EWZA 3TR2A 3MBDA 3TW7A 4O12A 3TXVA 4ADTA 1DV7A 1YPFA 2J24A 2BTMA 3PF3A 2DJXA 4O28A 2CWNA 2WSYA 5F1VA 5KTLA 3IVUA 3ATYA 1I2PA 1R2SA 1JCMP 5LGZA 1D9EA 3JRKA 4LUIA 1L6WA 4CCEA 5L6UA 4DO5A 4JY8A 4OBTA 2P10A 2DZVA 2BXVA 4PA8A 2QCDB 2Y85A 2DZSA 4BWLC 4ML9A 1SZGA 4L4LA 1BEUA 3CQ0A 3IV3A 4FNSA 1S5WA 3MYPA 1H60A 1G7UA 1JQXA 5EA9A 4MZ1A 5BOOA 4O17A 4CQAA 3F4NA 2QCDA 1SFJA 4BI6A 3T55A 3GDMA 1AK5A 3HF3A 2R94A 3QW4B 3KRUA 1NAL1 1L6YA 5LHFA 2NUWA 4XUGA 3UWUA 3MO7A 4AEOA 4MKNA 2ZTJA 3NQ7A 2F84A 3KFTA 4YWIA 2W0UA 3FJLA 2D73A 2Y7DA 3KVMA 3BPWA 1IXQA 3BG3A 1GVSA 4CNNA 3I68A 5DLCA 3W84A 1W54A 3KVKA 5HINA 2ZZ6A 1W3NA 1DJNA 2J9ZA 1TIMA 4JX4A 2YXGA 5J5DA 2B0MA 2OT1A 1YPIA 1HFBA 1LCOA 1JRCA 4IX0A 1JCLA 3HG5A 3UPBA 2QCEA 5D2XA 5KITA 3G22A 5EBUA 4ZQOA 3S5YA 3MI6A 3W1QA 2PURA 1JCNA 2E5CA 3NL6A 1XDMA 2QCNA 5FEZA 2Y70A 4PH6A 2ZZ7A 3NR0A 3SW6A 3WK2A 3HPZA 4LV4A 3M6YA 1Q45A 5HR7A 1R30A 5K2ZA 3ABOA 1TPUA 1YTKA 4S2BA 1DORA 3DI0A 5FF3A 4FIRA 4DELA 1KM2A 1RD5A 2NV2A 2Z0IA 4NXKA 4UMBA 2V82A 4C1KA 1GJPA 3S6DA 5LNVA 4UTHA 2R14A 1JUKA 2VEPA 4N9EA 2E6DA 2QCFA 1TTJA 1KFCA 3LHTA 5BRBA 1O5XA 3FKRA 5AYZA 1TPB1 2ZQ0A 3CEPA 1H62A 3MI2A 2Q8ZA 1NFBA 3G1AA 5DELA 1Q3NA 3FEMA 4UFJA 1LRNA 3TXZA 3MP5A 1KBJA 3W73A 3EXSA 1K03A 5E93A 4IQLA 3V75A 4U4MA 1KM6A 3PUOA 1UUOA 3U8GA 3OBKA 5AC6A 5CSSA 2ZZ1A 1KM3A 4ZQNA 1I2RA 5L9FA 4ZQPA 3IVSA 5F2MA 1VHNA 4JN6A 1WOAA 4A29A 1KBIA 3GDRA 3L5MA 1PHQA 3I7RA 5EL1A 3TW6A 4DQWA 2UV8G 1FWSA 3LXCA 5DBTA 1GVQA 1FXPA 3LBCA 5HULA 4UTTC 4JICA 1IIHA 2RKXA 5IBXC 2CLIA 1CW2A 3LHWA 2DZUA 4WD0A 5F2IA 4ZQRA 5LNSA 3FLUA 5H91A 1MEWA 3W7PA 2X1UA 2G5WA 2OZ0A 2ZA2A 4UNKA 3NQ2A 2WPBA 3O6DA 3TNOA 3NL2A 4GRSA 2YFNA 3IEBA 4BK9A 1HUVA 4Q4KA 1KTNA 2E5BA 4MLRA 3PSWA 5CZSA 4RK8A 4KFPA 4JTUA 3STEA 3C2FA 3TQKA 4UFMA 1YADA 1W3TA 1OFDA 1F05A 3LM7A 2YPIA 5CZTA 4UMAA 5TIMA 4UIOA 3S1XA 2AAMA 4JIQA 3LRKA 3GKFA 1W5QA 1I45A 4NXSA 4JTFA 1ZALA 4RV8A 3LTPA 5AHIA 4Z0SA 3EXTA 2BSLA 5U4NA 4B5NA 4X3ZA 1D3GA 1ALDA 1LLZA 2PRLA 3LI1A 3S1WA 1B4EA 1MXSA 4XTIA 4O54A 4ZQMA 1TPC1 5F2GA 3SI9A 1GWJA 3TE9A 5T26A 5BNKA 4FX6M 3W7DA 5D05A 5J5RA 3GKAA 1TMHA 3GIYA 3NDOA 1OVDA 1N55A 1JULA 3STGA 4I9AA 5E1QA 5KINA 1EP3A 3TJLA 1ZAIA 3PR2A 3HGSA 3NQ6A 4O10A 3W2LA 1BTMA 3IGXA 1AG1O 3HG3A 1M6JA 4LVFA 4UFLA 3CIXA 4JNMA 2ABAA 3B05A 3LCHA 5I3FA 2NX1A 2B7QA 2JKAA 4HN4A 2H6RA 1DQWA 3TSBA 3C52A 1YXDA 3D0CA 3RF9A 3EEGA 4FB7A 2ATSA 5CPOA 5AHNA 2E1DA 2WJZA 3MP3A 1LOLA 3DAQA 4LTSA 3L0NA 4DO4A 1G4SA 1YXCA 2QDGA 2XN1A 1FWWA 4Y8FA 3TUUA 2HS8A 4YL2A 2ZRUA 1IF2A 5AYXA 3BW4A 3IIOA 3TV8A 1C8VA 2PE4A 1FXQA 3NQMA 2HS6A 4NU7A 1B3OA 1PIIA 1GOXA 1FBAA 3W70A 5C5YA 3W75A 1T8XA 1L9WA 3BLEA 6ALDA 4A3UA 1OF6A 2CFFA 3BLIA 4I7WA 1R2TA 4JXCA 2Q3OA 2CU0A 1K7FA 2FPTA 3PVFA 1YTEA 3PBWA 1KV8A 1SPQA 3R13A 5CZ0A 1MZHA 2I14A 4IUOA 3O6YX 4AVFA 3NQEA 4R33A 1XI3A 1XL9A 1KW1A 2Q3RA 4LUJA 1E51A 4M6QA 2ISSA 5FF0A 3RLVA 4K8EA 4TR9A 2XN0A 4QSHA 3NPWA 3W7RA 3KHJA 2EGZA 5G2HA 4JX6A 1TSIA 3UY7A 4NNCA 4PL1A 2NZLA 4MYAA 3B06A 5FF2A 2Y7EA 1G4PA 3EWBX 2QAFA 4H4IA 1EEPA 1Q6LA 1ZAJA 5EMUA 1H51A 2FPYA 2Y7GA 5D2VA 1P1XA 4XKYB 1ICPA 3B0VC 3GNNA 4MUZA 1FCQA 3G8RA 2FPVA 3O1NA 4KWWA 3LCGA 1LORA 4K38A 4XBSA 4K8HA 1QNVA 4S1FA 2RDUA 4QNWA 3O15A 1B4KA 3NVTA 4NVTA 4XKYA 5KMYA 1ZFJA 4K7VA 4AH7A 1XM3A 1OX6A 4RKAA 4MY1A 2VFGA 4AHQA 4DEFA 3G1YA 3TC6A 2WKJA 5DCDA 1ADOA 3AO0A 3LB0A 1OK4A 1YLVA 2EPHA 4JY9A 5AC8A 1CX9A 2ZZ4A 4LNYA 1W31A 3W1UA 2QDHA 2C1HA 2OMAA 1GVOA 3GDTA 3QMTA 3G0SA 5D03A 4N9DA 3PAJA 3WJZA 3O16A 1M7OA 3BG5A 3B03A 1FDYA 3FOKA 3PY2A 3TQVA 4MLJA 3WJXA 4EVZA 4QJ1A 4O13A 3LCIA 4ONVA 4IJBA 4X2RA 3UWZA 3TMLA 4M6PA 1FCUA 1OYCA 1B57A 1BKSA 4QM1A 2A2IA 2JKEA 3I6RA 2B7NA 3KXQA 5F4WA 4CNPA 2DZXA 5C55A 1AL8A 3STFA 1KM5A 4GUJA 3GYEA 3P7YA 3LLDA 2PRMA 4AWSA 3OEXA 1QDSA 3PB0A 4OQVA 4WJEA 3MBFA 3W7JA 4UC5A 3KRSA 5EYWA 4Y96A 3SFKA 4NX0A 5G4WA 4LVDA 3UWVA 3C6CA 1H61A 3W9ZA 1W5NA 3EXRA 2GJLA 4MY9A 1VJIA 2E09A 3W1PA 4ZMGA 1SZFA 4BWLA 1A5AA 2E68A 3W7CA 4XQ6A 1QCWA 4DF0A 3T40A 2P0OA 3RNDA 2A7NA 1Q6QA 3PB2A 3RLUA 4HNUA 2V0TA 5FEWA 2V5BA 4K7YA 1OFBA 4NNAA 3NOEA 4MFEA 5K9DA 2C0AA 3M5YA 1W0MA 4M7SA 4N4QA 4CCDA 2H3DA 5HWNA 4ICNA 3FIGA 3M5ZA 4W9TA 3BARA 3QPYA 1O4UA 4O1AA 2FQIA 4UCGA 1LBFA 3A5FA 2Z6JA 4IX2A 1LTDA 4DF1A 4Y9AA 3VKJA 3NAVA 3TFCA 3U2OA 3M43A 3KX6A 3WFAA 3EX1A 3JS3A 1FCVA 2V2DA 3GXTA 2OT0A 1OFQA 4A22A 1TPDA 1LOQA 1KA9F 3RFAA 1QPRA 3MMTA 4UTUA 5LZLA 5AB3A 1GTHA 3H54A 3MUXA 5A5WA 2NWRA 5FESA 4WZHA 4GXMA 4HNVA 1AW2A 3C61A 2DZPA 4MOZA 2V30A 1TPWA 3Q94A 1SSDA 3N34A 3OVRA 3GLCA 4RJEA 5KZDA 2P1FA 1I2NA 4FNRA 4P2VA 1TB3A 4POCA 3O07A 3NQVA 1NF7A 4JTTA 4O16A 3LHZA 3QJAA 5H2ZA 5HUPA 3G0UA 4GC4A 2ZZ3A 1A53A 4IMCA 3G18A 3P60A 1MO0A 5D33A 2JGYA 1K02A 1G4EA 4LWWA 4E38A 4RLIA 1XBXA 1RR2A 3NO5A 5LNRA 3M5VA 4O4WA 3B0PA 3W88A 3DKLA 1SO6A 3TCEA 1SU5A 4LVGA 3KRZA 3TK7A 5IM51 4UTTA 1M5WA 1OYBA 3VNDA 2EHHA 2YFOA 3NM3A 3SIZA 1TTQA 4DF2A 5AHMA 4WOZA 2GVJA 2V2CA 4O1DA 2YW4A 4AXKA 3MYOA 2A6LA 3NPUA 2YCEA 3B04A 1FQ0A 4PODA 4AF0B 3L21A 4UFKA 4JR5A 2NXIA 3W71A 4GUIA 3FJ6A 4RXFA 4FIQA 3L5LA 5K4XA 5HWJA 5HR6A 4BF9A 2TPSA 3N2MA 1TPH1 4AF0A 4O52A 4ADUA 3USBA 3M0ZA 2BWGA 1QR7A 4I7UA 1V7YA 2WQPA 3VFLA 1SO5A 2A7PA 2VFEA 4LOCA 2WNZA 1EB3A 2NXGA 4JYDA 4DBDA 3BVJA 5BMWA 1AL7A 3GDLA 4E0CA 3HGJA 5I3JA 4DBEA 3S5ZA 4Z08A 2G96A 3DI1A 1RVGA 4TX9A 1GYNA 5G5IA 4AWTA 5MHBA 4EIVA 1I4NA 5EPDA 1SW3A 2QEZA 3UZJA 4E2DA 1K7XA 3GK0A 4D2JA 4O0KA 5LNUA 1W37A 1G6CA 1WQ5A 1VC4A 1C29A 5LGXA 2A6NA 4HHPA 5AFDA 4OGZA 4X22A 3W7NA 3PBUA 1KM1A 2CLMA 1OYAA 2B7PA 1SQ7A 1X6UA 3MHUA 4ZVJA 2A5HA 3UZ5A 2YSWA 3CM4A 4O57A 3CB8A 3IIZA 1H5YA 1FX6A 4GNJA 4QIUA 2WOQA 2ZZ5A 3OHIA 3QMSA 3TAOA 4JTIA 4X9SA 1EWEA 2FJKA 3W2KA 1OFAA 4FF7A 2CLKA 4KKXA 2ATMA 2NXHA 1W3IA 4FEZA 5G1TA 3P8IA 1ME9A 5K9XA 4JEQA 3INPA 1LBLA 3Q2DA 1KFBA 5DXYA 4HKPA 2CZ5A 1F2JA 3LI0A 1VR6A 1TTIA 4N9BA 3G3DA 4O19A 3NG3A 1SW0A 3QZEA 2OJPA 2O7QA 3V1PA 3ZR4A 3S1UA 3L67A 1VCVA 3NA8A 1NSJA 1GZGA 4JS3A 3MHFA 1K3UA 2ISVA 4CNOA 2H8ZA 2ZA1A 1Q6OA 1I8JA 3DFTA 3DU0A 4AB4A 3OG3A 1C9DA 1VZWA 8TIMA 4E2BA 1GVRA 3BG9A 2WNQA 1VQTA 1W1ZA 2CW6A 4Y6GA 3W1NA 3IGSA 3UQNA 1TQXA 4OE7A 5CG7A 3EWXA 1L6SA 2V8ZA 3G1DA 2QJHA 4NJIA 3TSDA 1HTIA 1OABA 3I7QA 4EF8A 2RDTA 5DN1A 4FO4A 1HL2A 2GQ8A 3NZRA 2IQTA 1ME7A 1XCFA 2C16A 4UFHA 4JTEA 4PTNA 1RQBA 2YR1A 4YMZA 1XFBA 1DKWA 3PC0A 1H7WA 3DZ1A 1TREA 3MJYA 2TSYA 1Z44A 2V81A 2E77A 4JX5A 3PBYA 1TPEA 5I3IA 1ML1A 1JR1A 2V2HA 5DY2A 3W7GA 3TAKA 3BGGA 1XKYA 2I9EA 5EY5A 4K39A 2CZFA 1A5SA 3N9RA 3ELFA 4HIBA 1H7OA 4QISA 3G8EA 2ISWA 2ZDRA 1QPQA 4JDBA 4MY8A 2ZFAA 4IWWA 4DXVA 3CU2A 3KAOA 1T99A 1FWTA 2WSRA 2NV1A 3T7VA 4MJMA 4MPQA 4WX2A 1H63A 1SZEA 3HMJG 1TRDA 2JK2A 1R2RA 5CKSA 3N9SA 3S42A 1TPFA 3DFQA 2NX3A 2YZRA 5K4ZA 1F6PA 4MIMA 5U7SA 1JCXA 3L9CA 4O50A 3TSMA 4G1KA 4ADSA 4JD4A 3W1MA 1YDNA 5K9CA 3L68A 3UXDA 3EX6A 1KFLA 4IMGA 2CLEA 4PC8A 1L2UA 4RX0A 5KZMA 1TJRA 3SSJA 1PE1A 3S0CA 2FDSA 1WX0A 1H1ZA 3CWNA 5CPNA 1J5TA 4UR7A 3EWWA 3LCWA 2H3BA 4NJKA 1VH7A 2QUUA 2G95A 5LHEA 5DBUA 4JTKA 3W22A 3N73A 5CGQA 4A2RA 3LTSA 3QFEA 4IOTA 3W7LA 2E6FA 3CPRA 2ALDA 1QWGA 3STCA 3T4CA 4AAJA 2GUUA 3CIWA 3CHVA 3QMRA 1I2OA 2C19A 2J6XA 4HNNA 1HO4A 4QQ3A 2X1SA 4FHAA 3LHYA 4NJJA 1SR9A 2X1RA 3KOFA 4LS1A 3UWWA 3EX2A 3C2EA 3DENA 3ATZA 3NEVA 3TA6A 1SO4A 3CEUA 1KFJA 3A23A 3MHGA 2DORA 3HPSA 3GDKA 2ABBA 1IXOA 3HGOA 1OFEA 3FYOA 4FNPA 3A21A 1XBYA 3M41A 3G0XA 4WOQA 2TRSA 5KZEA 1PCWA 1X8FA 4HPXA 1LOSA 4OV9A 4MJZA 3M5XA 3THQA 3C3NA 1WA3A 1KTCA 4UTWA 1OHLA 3MP4A 4LT9A 5I3KA 3W7HA 5D37A 3PS7A 2B7OA 1FY6A 2QCCA 4EWND 3W7KA 4EF9A 3FFSA 2VENA 1GG1A 4RZ5A 1ICSA 1VRDA 3TJXA 4OWGA 1LDCA 2RH9A 5G2WA 3FYPA 1LM1A 2EKCA 1K7EA 3P82A 1P0NA 2WV8A 5CZJA 4UUIA 3M44A 5DXXA 1KFKA 2E6AA 2GVGA 1T0OA 1OX4B 2FFCA 2Z1BA 3HBLA 3W2UA 4BI7A 1FWNA 2H8XA 1FDJA 2XN2A 2C18A 1SO3A 4UTIA 1IGSA 3HGRA 1OX4A 2Y63A 4O1CA 4K37A 1B9BA 1JCYA 5G2IA 3Q58A 5D30A 3TDFA 2J9XA 1DBTA 3S5OA 1P4CA 1EUNA 4N2YA 4Z1AA 4UFIA 5AHEA 1JRBA 3TIMA 3BK0A 3IIVA 3W2JA 2QJGA 2QUTA 4RZ6A 1SSGA 3GNDA 3P8JA 2Y6ZA 1GT8A 2C13A 3NYZA 1OJXA 1V5XA 3E96A 4XBKA 4JTLA 3TMQA 3NGJA 4O18A 1VS1A 2NUXA 3GXPA 3B4UA 4M6VA 2CZEA 3SGUA 5LNWA 3HB9A 4NZJA 4DPQA 2Y7FA 4UTLA 5HUOA 4JDYA 1NF0A 4O1BA 1LLWA 4BR1A 1ZY9A 1XBZA 3M9YA 4QNEA 2Q8LA 1AW1A 3NPXA 5ABTA 3IGUA 3E0IA 1JCJA 3G1FA 1UB3A 2JBMA 5E0KA 3MWAA 4TMCA 3W1TA 1H1YA 4BI5A 1HG3A 1JUBA 2HTMA 3PULA 3H55A 3LHUA 4O53A 1X1ZA 4IMDA 3NXFA 4IGHA 3LRLA 4NNBA 4DO6A 4FXSA 4NT0A 1F76A 3S8HA 5LSMA 3T44A 4OT7A 4TO8A 4UR8A 1O5KA 2VFFA 3B8DA 1YYAA 3O8AA 1UJPA 3UD6A 2PRHA 5D02A 3FA5A 3TROA 2LLEA 3W1XA 4PL2A 5FEPA 3W76A 4AWUA 3TC7A 1KM0A 1WOBA 2VEKA 4IXXA 2ZRWA 2O7SA 2YYUA 3EKLA 3L2IA 1A50A 5F1UA 4JTHA 5AYYA 3G24A 2H90A 4O15A 4PFMA 1W5OA 2VEMA 4ALDA 2FIQA 3LXBA 1JUEA 1ZJIA 3MW7A 3A9IA 3HG4A 3LV6A 4UTJA 3WK1A 2NLIA 2Y62A 3SY5A 2ZA3A 2DJLA 1WDWA 1LRTA 3Q37A 1X7FA 2RHGA 1TJPA 3DHDA 4CLMA 6TIMA 3RMJA 3HIJA 1GQNA 3UWQA 3HG2A 2A4AA 1J2WA 3E49A 4RZ4A 1PL9A 1GTEA 3O63A 1QOPA 1TV8A 3GVGA 4LC8A 5HMSA 2EAWA 1KLZA 4UNLA 3C2VA 4FXRA 2QCMA 4ORIA 2GJNA 3CT7A 3CWOX 4KWVA 4U28A 2CLOA 3IVTA 4MVAA 3NQCA 2ZRVA 4J9JA 1MEHA 5KSWA 1WBHA 5SWUA 3W85A 1XUZA 3IIXA 2ZYFA 2BZNA 5C6MA 3NL5A 3O05A 4H3DA 1AMKA 4IXHA 4NZFA 3QF0A 4GUGA 3DFPA 2WSQA 4C1LA 1H7RA 3O6CA 4O0ZA 5F4SA 2BX7A 4MFDA 2J27A 1UBSA 2CLFA 5IBXA 4OU1A 4NX5A 2GVLA 1W5MA 4Q32A 3QW3A 1TPVA 3GAYA 3DBPA 1LP6A 4RXGA 3JR2A 2E6YA 1WXJA 5DY3A 1CI1A 2RDWA 4JGDA 3DFSA 3ZS4A 1GG0A 3W07A 2JKPA 1WV2A 2J88A 4AMAA 3HQ1A 1SUXA 1XBVA 3G3MA 4QAIA 1FCBA 2V5LA 4FNQA 3LTYA 2VOMA 4M7TA 1OG0A 1UCWA 3S1VA 4IMEA 2WNNA 3GAKA 2C3ZA 4GJ1A 2R8WA 2VFIA 3TX9A 1EP2A 4O11A 3BW3A 3PM6A 2GQ9A 2VELA 2ZRYA 3WK3A 2CLHA 2X30A 2ZTKA 4CQ9A 4N6FA 3WJYA 3VI2A 1VLIA 1ZAHA 3LXAA 3R8RA 3P84A 1DQXA 3C56A 3ANYA 1LRQA 3O06A 2I1OA 4FX8A 1DL3A 1RZMA 3AJXA 4MYXA 4IMFA 3I65A 3SR7A 5HWMA 1KFEA 4S2CA 3UNDA 1EIXA 1QMLA 4R34A 3ZWSA 4HPJA 3E9AA 4LVAA 2PC4A 4O4VA 5FF4A 4WQ6A 4YLWA 3OVQA 2CZDA 2YYTA 2ZRZA 3KVLA 3N14A 4LV9A 4M5PA 1OF8A 3QSRA 3R5EA 4JYEA 1WBJA 4WY0B 4XZ9A 1QO2A 4XWUA 2GQAA 1IIGA 1OX5A 3W7QA 2PCQA 3PWAA 4UMCA 3P61A 4JYFA 5TQLA 3LCXA 5A8GA 1F7BA 1O94A 3G1SA 2EF9A 2VC6A 4WY0A 4K36A 3K30A 4HT3A 3C2OA 1MEIA 1VCGA 1OFPA 3EWUA 3NZ1A 3DFNA 3EX4A 3W1RA 5FEXA 1H7NA 3S5NA 1R46A 3LX9A 3TFXA 5C54A 3P81A 4M19A 2YX0A 3DXIA 4LC6A 3H53A 3LBMA 1FUYA 2QUVA 5AHLA 2Y88A 2VEIA 4LW7A 2FB3A 3W83A 5C2XA 5K7JA 1QOQA 2ZRXA 5D38A 1YDOA 3W1LA 4ZZ9A 5DCEA
chains in the Genus database with same CATH superfamily
4E4PA 1FFRA 3AHZA 3ABRA 4IP5A 4DXKA 3G2GA 4TMBA 2A3HA 4ZBCA 3N4FA 1J10A 2WSPA 1EJRC 5FF7A 1CGYA 1I1WA 3M16A 5CPLA 4H9VA 1BFNA 4Y9OA 3P74A 1FTXA 1B90A 1W8SA 5ABGA 4PMVA 1AH3A 4OFCA 3QM3A 1AW5A 1PCKA 1KRBC 3GBEA 4IIGA 3PZGA 4HA1A 1TQJA 2PFHA 3AXKA 2PDJA 1TZ7A 2DU2A 1F8MA 2PODA 3SJNA 3W7EA 2CXGA 3KVJA 1O7AA 1QW7A 3H2OA 2C1GA 3EDFA 4K6AA 1BGGA 3SZ8A 1EA9C 1G67A 3CV2A 3GX9A 3QR0A 1PS9A 3B8WA 3PWGA 3PSVA 1XP3A 2GZXA 3KBWA 3PZMA 1IWBA 1DP0A 1OC7A 4CQCA 3KE0A 3VCRA 1ZQ5A 2GPTA 3LLFA 4RDWA 3OLEA 4IP7A 2XM1A 4RE2A 4AD2A 4N9CA 5D32A 2EKGA 4J7RA 3IWPA 2I56A 3A4XA 4B5TA 2DT0A 1P0DA 1R0MA 1VLWA 3TZFA 1N7KA 4KEVA 1JD7A 1VBJA 2BV9A 5CSYA 3DERA 2E8ZA 3KBJA 3PUEA 1VIZA 4KRTA 2VRJA 4XO6A 4US5D 7REQA 4WY0F 2OTDA 2R9RA 1JYXA 1VD6A 3AJ7A 1WKFA 2VCAA 3AMKA 1GOMA 2WC4A 4PULA 3DFOA 3DOPA 1NFGA 1IXNA 3VD7A 2I9UA 4BFAA 2XH4A 4TIMA 3SGZA 4HNTA 4FSAA 4W4QA 3OU8A 5H6HA 4N4PA 4Y90A 3PG9A 3BV4A 2OB3A 4EACA 5H8PA 3E74A 2VFHA 1NTHA 4Q8TA 4N02A 3CZ8A 4KERA 5D2WA 4AHOA 4GWEA 3AMLA 5F2LA 3VD5A 5A3HA 2BLEA 3CTLA 3TKFA 3R94A 4Y9PA 4AD3A 4HOXA 3HJZA 2WWDA 3N19B 4EOUA 4HPGA 3PZUA 4Z1BA 2C1IA 4B5UA 4JFSA 1OGGA 2NX9A 3ZVIA 3B0UX 3R12A 4HNCA 4GX8A 3MI3A 5CJMA 3C4UA 5F4XA 2BXYA 3A12A 3AUJA 2XIJA 3LPFA 1F5ZA 1LQ0A 2OX1A 2VD8A 1S3TC 2BDQA 3GG0A 3W86A 2A3BA 4KIEA 3GB6A 4LU0A 3SCOA 5I3HA 4B5WA 4JL2A 1TV7A 3KW3A 2DUAA 1V02E 3CZEA 3IAQA 5A1AA 1H7PA 1H41A 4D1IA 1XYFA 2QXWA 3W7IA 3NQGA 3N6JA 4IJCA 5GVJA 3LERA 1GZ1A 1CXHA 2VMFA 2PWDA 3CL6A 3VM5A 3S1GA 5LYRA 3W7MA 4F0HA 4LS2A 3WBWA 5G1YA 4O0QA 1A0EA 2WANA 1S46A 1MXDA 5CJNA 3NDYA 3E5PA 3AXIA 2BY2A 4LY8A 1GOIA 3GVRA 5BXSA 4GVFA 4U5KA 3FVMA 2J9YA 3P80A 3QQ1A 4DM2A 2IKGA 3VIOA 1JXKA 4C6PA 4N42A 1XR2A 3NPVA 3P0WA 3CT2A 2AQOA 3W1AA 5H8MA 3L5AA 3V5OA 1Y0EA 5FI8A 2VC7A 4OHQA 5TBOA 3T0AA 2DSKA 1J0ZA 3AMCA 3IJQA 4H2CA 3L0KA 3WO8A 1QFEA 5D2YA 1F8IA 1JPKA 4FNTA 4QEEA 3G77A 3UXAA 5AHFA 2PDPA 2V9DA 5BRQA 3CC1A 4FNUA 1UPMB 2Z7GA 2DZAA 4C7GA 1K8CA 1W1A1 2ALRA 3FEQA 2EPLX 8XIAA 1XLJA 4J40A 5CBIA 2OFJA 3KHDA 2ACQA 2WMJA 1BRLB 3UYCA 3CASA 1XIFA 3HV9A 4CCZA 3P5ZA 1SMDA 1JYWA 5D04C 3MUIA 1QNOA 3A22A 4MZ8A 1UP2A 5FJUA 1Z41A 4WUIA 4JTGA 6REQB 2XH0A 2A85A 1EO7A 3GTHA 4PCTA 3VGDA 3DKJA 2QKFA 4ES4A 4HK6A 4E2OA 3KDNA 4GYKA 2BVDA 5TNVA 3NM1A 4Q33A 4HSNA 4P61A 4E3VA 2DSWA 3C8FA 3S46A 1OQFA 1RQEA 4NZ3A 1JDFA 2Y61A 4NAFA 4KCWA 3VMOA 4C6MA 1BWLA 4JHZA 4PCFA 3LV5A 3TR2A 4REQB 4DUXA 3TW7A 4O12A 3TXVA 3QOKA 5I00A 5E9XA 1V3JA 2BTMA 3ZM8A 4C7FA 5KTLA 4BF5A 2HCVA 2V5JA 3R10A 5LGZA 2EPNA 3BH4A 1TZZA 2P10A 4PA8A 4QTGA 4DZAA 4ZO9A 4L4LA 1S5WA 2J6VA 1JDCA 1H60A 2I5GA 4MZ1A 4DJEA 3R25A 4CQAA 1EBGA 2DY3A 2QCDA 1AK5A 3U7VA 4G7EA 1CXEA 1FWAC 2NUWA 4XUGA 1NWTA 3GSMA 2EG7A 4LY4A 3BG3A 1E6NA 5DLCA 4ZTYA 3KVKA 3FJNA 2VRKA 4J3UA 1GKQA 1TIMA 2YXGA 5J5DA 2B0MA 1UZ4A 2OT1A 1YPIA 5DF0A 3IK4A 1JRCA 3UPBA 2IS7A 1T5AA 4EXBA 5KITA 3GO2A 2QLYA 2ON3A 2PURA 2PWEA 2D69A 2VO5A 3AYTA 3B3DA 2Y70A 1P0EA 3GG7A 1V6YA 5JIPA 1YTKA 3IPWA 4S2BA 1DORA 1VPYA 3V0UA 3AALA 5DMLA 2PDYA 4FIRA 4PMXA 3E2RA 4UMBA 4ZFMA 2V82A 3ARYA 2CZVA 4XZIA 4C1KA 4CD8A 9XIAA 1V3IA 5LNVA 4DB7A 4JQAA 5I79A 4UTHA 4JTRA 1TR1A 4AIUA 4A6GA 4OKDA 5AYZA 1H62A 2WLZA 4B3KA 2QPSA 5FJRA 4UFJA 3TXZA 4A3RA 4I3GA 3W73A 4KESA 5E93A 2GDUA 1OY0A 1BXCA 1SFSA 4U4MA 2ZX9A 5AC6A 3WBYA 5CSSA 2ZZ1A 1DWJM 1KM3A 1TE6A 4MPKA 2R1KA 1WOAA 1I75A 3L5MA 3I7RA 2L5HA 3WNKA 5CLTA 1TA3B 1FWSA 3LXCA 1A3WA 5HULA 4ZB5A 4CVWA 1IIHA 3RJXA 2RKXA 1QHZA 5IBXC 7ODCA 2CLIA 1FH9A 3LHWA 2DZUA 2FZ8A 5F2IA 3FLUA 4ERGA 2ICSA 1MEWA 2GJRA 4AY8A 5C9WA 2OZ0A 4Q4RA 1BVNP 3UZYA 2FTWA 2GJXB 3NQ2A 4JQ4A 1EOMA 1BQGA 3NO3A 3O6DA 1HUVA 4KIRA 4Q4KA 4LUSB 4MLRA 2GUBA 4ZEPA 5CZSA 5BYWA 3WEMA 3ECQA 4U3AA 4ZODA 2O9OA 4UFMA 3H2NA 4W5ZA 3ZQ9A 4I5XA 1EJ7L 4X9YA 5IFTA 3LM7A 1NFPA 3PBMA 4UMAA 4UIOA 2JEPA 3S1XA 4JIQA 4QR6A 2DFAA 4ZE4A 4B4HA 2PWUA 4IJRA 1Q7ZA 1W5QA 1I45A 1GJUA 3UW6A 1W1PA 1ZALA 5AHIA 4NG3A 2HE5A 2BSLA 4B5NA 2V6AA 3EA1A 2PRLA 3LI1A 1XJBA 2R1LA 4C5ZA 1TPC1 2Y8UA 3ZLGA 2AKZA 5D05A 3H12A 4U3CA 1TMHA 3STGA 3Q45A 5KINA 1EP3A 4WRHA 3TJLA 1MRQA 2BGNE 3FDKA 1E1CB 3RLGA 3LLXA 4JNYA 4R9OA 3II1A 1XYLA 5I3FA 4IHCA 7REQB 1WUFA 3RCMA 2H6RA 1UOKA 3TSBA 3C52A 2RAGA 4JFVA 2UBPC 1JI2A 5AHNA 2P8BA 5BRPA 1XHGA 4X2PA 3O2LA 3WCZA 4J2PA 4LF2A 4I9MA 4IGNA 3CHEA 1XCXA 4A05A 1NWRA 3TZNA 3QHOA 4LTSA 1P1MA 2QDGA 2VZVA 3FSUA 1K77A 4V1XA 1V02A 5C8BB 1H09A 1QI2A 1JG9A 1Q13A 4H8UA 5FAJA 4JFUA 1H5VA 2OKOA 2PE4A 3ITGA 4ATDA 3FAXA 1DE5A 1PIIA 3TTQA 3W75A 1T8XA 4XUYA 2QVHA 3CHFA 4I7WA 3BLIA 1UA7A 5LIXX 1BYDA 1X7IA 1R2TA 1QI5A 2CU0A 1A4LA 1Q7QA 1J0KA 1K7FA 2FPTA 1YTEA 3PBWA 1MZHA 2I14A 1FWHC 2XIMA 3NQEA 4WDTA 1KW1A 3P14A 2PGEA 1J0YA 3KHJA 3OG2A 4ATWA 4PBFA 4YTSA 3H2AA 3L4VA 4NNCA 4AZ6A 2HPMA 3KM8A 5FF2A 3PAOA 4RDZA 1EEPA 1Q6LA 2OWCA 1ZAJA 4PEEA 2G41A 2FPYA 3ES7A 1P1XA 1BF6A 5HBFA 3B0VC 2WCAA 3O1NA 4H04A 4S3DA 1P6WA 1LORA 3VA8A 4L56A 4XKYA 1ZFJA 1NDWA 4UOJA 2W5FA 3UGRA 4AHQA 4QXIA 2J4GA 3G1YA 4LX4A 3FHAA 3AO0A 2DVUA 3CL7A 2ZZ4A 4LNYA 1E4LA 3W1UA 2QDHA 3PPGA 1QI4A 1GVOA 2H9AB 1M7OA 3B03A 3FOKA 3PY2A 4H00A 4MLJA 3UG4A 3QLLA 4QJ1A 4O13A 3LY0A 1GONA 2YCKX 3WQ8A 1E5JA 2OWXA 3UWZA 1OT2A 3FNDA 1BKSA 4QM1A 4PSRA 4PB4A 2JKEA 2DZXA 1KM5A 4PUDA 2G4JA 1DJXA 1V0NA 4GUJA 3GYEA 4KQNA 2J47A 2PRMA 4AWSA 1CXFA 1SZRA 1QDSA 1I0BA 3M0YA 3MBFA 1XLIA 5EYWA 3WNLA 4Y96A 5G4WA 1MRAA 2GDVA 2GJLA 3CMFA 2PD5A 1GVYA 3GH7A 4B2DD 4JIIX 4Q3MA 4GQRA 3CS2A 4DF0A 4WK9A 2XZ9A 3RLUA 4HZ7A 4MNJA 2Q01A 1Q2SA 5K9DA 8CGTA 3M5YA 1PX4A 4Q7BA 1W0MA 3RLHA 1FFQA 5HWNA 1GYMA 3FIGA 3WQEA 2ZVIA 4P8WA 4ZXOA 1JAKA 3BUVA 2F38A 2FQIA 2OODA 3HFTA 3ALFA 1LBFA 2WVUA 2Z6JA 4IX2A 1LTDA 4UWMA 2PZNA 4DF1A 4GK8A 2HXTA 3VGFA 4V27A 1FHVA 1NM9A 1L0PA 4IQEA 3EX1A 3JS3A 3K1DA 1HKWA 4U2YA 1OGSA 4XBJA 1OIFA 4NAFB 3SY1A 1RH9A 2WC7A 1QPRA 1DEDA 3L4WA 3DUGA 2Z1SA 3H54A 3MMUA 3MUXA 5A5WA 4RL3A 4HNVA 3C61A 1FOBA 1QRQA 4MOZA 1RCQA 2V30A 3Q94A 4IISA 3N34A 5I6SA 2RDXA 4QAWA 4TOQA 3GLCA 3W37A 1GOQA 1I2NA 3OLDA 4IGMA 4L6HA 4P2VA 3LMZA 2X0SA 4HU4A 1NF7A 1TV2A 3HQNA 3MO4A 3QJAA 5H2ZA 5HUPA 1LQ2A 1KWGA 1V79A 2W61A 3EOOA 4B4FA 3GW0A 4IMCA 3URQA 1K02A 3ARTA 3I6TA 1REQA 2KX9A 4E38A 1W9DM 1RR2A 2HV5A 2OGJA 3TNBA 3D3FA 1EF3A 2DT3A 1LG2A 2POZA 3TCEA 3K8LA 1SU5A 1AQFA 3TN3A 4UTTA 2HEJA 4FI4A 3VNDA 2EHHA 2ACSA 1HJSA 1UD2A 3TOPA 4DF2A 1HKKA 4WOZA 1M7JA 2PDWA 2F2HA 4EPDC 2ZIDA 3GQYA 5GJMA 1KCZA 4M51A 3DG3A 4W85A 4Q8UA 3JZEA 2VZOA 3VU2A 4C60A 3MSYA 3S6OA 4AF0A 3EB3A 4TV5A 3GNPA 1UH3A 4ZO7A 2A7PA 2VEGA 1C8QA 1Q85A 3B8TA 3GDLA 4TXEA 3MKVA 4HCLA 1NELA 2EO7A 5DRIA 2Z28A 2X0HA 1GYNA 1XCWA 1I4NA 5EPDA 2QEZA 3UZJA 1K7XA 4H6EA 3T2PA 1WQ5A 1OG6A 3MJMA 1XRSA 1KRCC 2A6NA 5AFDA 3SO7A 3PBUA 2VGIA 2AL2B 2CLMA 2B7PA 3MHUA 1Q6FA 2A5HA 2WKLA 1W3KA 3CB8A 4E8CA 1K9DA 3MS8A 3IIZA 9CGTA 2WXDM 2HK0A 1PYMA 3MQTA 1N8WA 2FGBA 1JZ2A 3TAOA 3WFLA 4CUCA 1JFXA 3WX7A 2CLKA 3FA3A 3WD1A 2ATMA 2NXHA 1W3IA 3P8IA 4JZ5A 3E0FA 3UCDA 3R4IA 3DYPA 2V63A 3Q2DA 2CC0A 3QPEA 5DXYA 3AYVA 1WE5A 3HQOA 2CZ5A 1TTIA 4W5UA 2OG9A 3QZEA 3T42A 4Q6JA 1HKVA 1HL9A 1T6MA 4KF1A 3L67A 2GOKA 1GZGA 3WEOA 1SM9A 5ENLA 3BJTA 1DXIA 3HQPA 4WGXA 4AB4A 2E3ZA 4ROQA 3KTCA 4B5SA 3V35A 8TIMA 1TR9A 4HA0A 4E2BA 1GVRA 2OZ3A 1VQTA 4EXQA 3W1NA 3IGSA 3UQNA 2G3NA 1TFVA 3R0DA 2PU1A 1FWJC 2BMBA 1OABA 5HMEA 3I7QA 2PGWA 4P8VA 3BAIA 5DN1A 4FO4A 3NSMA 4E8DA 3NZRA 5I0DA 1GGOA 1MDRA 1ME7A 1H0IA 2YIHA 4D6JA 4JTEA 1DWHM 1RQBA 3BANA 1PZ3A 4HOWA 3UJFA 1TREA 2TSYA 1Z44A 3LK6A 1VJSA 3R79A 4GGBA 2XH7A 4CD4A 1X98A 3PBYA 3AU6A 1XLBA 1TPEA 1GVEA 3SQLA 5I3IA 1ML1A 4XSLA 3WH5A 3GTFA 4KETA 3D3AA 4NRSA 1XKYA 3VPLA 3VOJA 5CG0A 2CZFA 4I9TA 1UKPA 4HIBA 3ITTA 4DXVA 5B7YA 4ICCX 3KAOA 1E5NA 4E4UA 1VKFA 3T7VA 3CUFA 4ACZA 1SZEA 2YCJA 1IV8A 3HMJG 3Q65A 1TRDA 1A5OC 3K4AA 2JK2A 2O9PA 3VOIA 5K4ZA 1D7FA 5U7SA 1JCXA 1LT8A 5CC5A 2YB4A 3LQGA 4DLFA 1R3TA 3TSMA 4PUKA 4G1KA 1IZKA 3ZT6A 3MUAA 3W1MA 1WDQA 1YDNA 4Q6XA 1KGWA 3GY1A 3GH4A 3UCQA 2CLEA 4UZUA 4JTDA 1PE1A 3S0CA 3GHRA 4UR7A 2OLSA 3EWWA 3LCWA 2HJPA 1VEPA 1LG1A 4HVXA 2QUUA 3BCJA 1ZGDA 5CGQA 3N6QA 4D8ZA 2WMIA 2VGFA 4XK2A 1ZPTA 3LSCA 3QMRA 4AAJA 1XH1A 2C19A 4HNNA 4QQ3A 4LAZA 1J0HA 3REQA 3MMWA 3IJ9A 4LS1A 2OXNA 2F6KA 3NEVA 1KFJA 4MAVA 2GK1A 4QDMA 3A23A 3MHGA 4Q8WA 4LH8A 1V6TA 4S3CA 3KOYA 1NDVA 3GDKA 4JCLA 3FYOA 1SYTA 4PRRA 4LUYA 4WOQA 4WSKA 3GTIA 1PCWA 2PGRA 1LOSA 4OV9A 3THQA 3C3NA 1WA3A 1V7AA 5M1TA 2V5DA 4GI9A 5D37A 2B7OA 4XAYA 1JZ4A 2QCCA 1XSIA 3W7KA 1H3GA 3HPAA 4IIHA 3TJXA 4UQBA 1K7EA 1P0NA 3GG1A 5CZJA 3CB3A 4F0RA 1DTNA 1T0OA 3U2EA 3HBLA 2Y8VA 1ZSXA 1XLCA 3AWOA 1PPIA 1EC8A 1R3RA 2H8XA 2R82A 1SO3A 4UTIA 2WZHA 4EANA 2FVKA 4QRNA 2WJFA 2V69A 2Y5SA 3IANA 4L64A 4KGJA 1JCYA 1C92A 1DBTA 4GJJA 3CZGA 4AEFA 2WVSA 2WVTA 4GYFA 4Z1AA 2HBXA 4F2BA 1ECEA 3BK0A 1HJVA 4S3EA 1DJHA 4DAFA 1IYXA 2QUMA 3W01A 4PMNA 1SSGA 3BZJA 4F3HA 4IIEA 2WVVA 3E96A 3CAKA 2EJ1A 4NZCA 3NFUA 3TTEA 3UZZA 1RCOB 2J8FA 1J01A 1WNOA 4M6VA 2CZEA 4UQEA 4RNHA 4UTLA 2ZADA 4JDYA 1NF0A 4NI8A 1LLWA 4P5UA 3S9IA 4JNZA 4ZFCA 1ZLPA 4BR1A 1BG4A 2JIEA 2VGBA 3B4YA 4JTAA 2WZIA 1AW1A 1XPGA 1JCJA 1B5TA 4J3TA 1VENA 3ME3A 1QNRA 3H7UA 3LHUA 3VNYA 1YHTA 4O53A 4IGHA 3LRLA 3OJGA 3P2VA 4FXSA 4NT0A 1F76A 1GHRA 4OT7A 4TO8A 5D9PA 2Z1VA 2VFFA 2PWFA 1DHKA 4NI3A 3SY8A 4DWSD 4FZIA 3UD6A 2PRHA 1JZ3A 1TJ1A 3WD2A 4HMEA 1XINA 3KWSA 1VFFA 4J3WA 4HHLA 3AMDA 5C71A 1B3VA 2O7SA 3BAXA 3PTDA 5E5CA 1A50A 5F1UA 4JTQA 4J3VA 5AYYA 3M0XA 5DFAA 4EAYA 1YNYA 1CECA 3W27A 1ZJIA 1LUCA 4UTJA 4WDUA 2Y62A 1E6XM 2YLAA 3RXZA 1FKWA 3F2DA 1VP5A 1C90A 2WMGA 2D20A 5A95A 3RMJA 2WHMA 3HIJA 3HG2A 3E49A 2MNRA 2FZ9A 1PL9A 1AJZA 1QOPA 4IZGA 4A4AA 3RILA 3IACA 4LC8A 5HMSA 1BQCA 4UNLA 3C2VA 1E4NA 2QCMA 5JH2A 5LXEA 2GJNA 3I3BA 5IDIA 3RG6A 4XSMA 5AC4A 1POKA 3AC0A 5SWUA 3QKZA 5M5DA 4YS1A 1DTUA 3IIXA 1E71M 5I2UA 1YQ2A 2G3MA 2BY0A 3QTPA 4WDWA 1AZ1A 4GUGA 4WKFA 4O0ZA 3N2CA 1VEOA 2BX7A 1HKMA 2J27A 5IBXA 2JALA 3NCOA 2GVLA 4AY7A 1LP6A 4RXGA 1HF6A 3A64A 1PTDA 1Z69A 5T9BG 4JGDA 3EWDA 3DFSA 4MNKA 3W07A 2QV4A 1AH0A 1WKYA 2J88A 4JFTA 1SUXA 3USZA 3LTYA 2POTA 4D6FA 4H8VA 4GI6A 1E0VA 1JDDA 1QI3A 3MVTA 3MY9A 3R11A 1KFWA 2R8WA 3APTA 4ICMA 3WH8A 1FWBC 1EP2A 4O11A 3PM6A 4FLOA 2X30A 3VI2A 1VLIA 1ZAHA 2NSOA 1DQXA 4C6JA 4IMFA 3I65A 1E0UA 3S6TA 1KFEA 4S2CA 5A8PA 1QMLA 4R34A 4HPJA 5IHSA 4O4VA 4ZXLA 3U7BA 1UR1A 2ZRZA 4LV9A 1TG7A 1DWFM 3TONA 2EBNA 3PTQA 2ZUTA 5TQLA 3DHUA 1O94A 3TN6A 2YA1A 4K36A 3MWCA 4J5NA 4A8RA 3NZ1A 3DFNA 3PN8A 2XJ7A 3A13A 3IJDA 3O6AA 1X6NA 3H2FA 5GNZA 3H7RA 3PFMA 1XD0A 5CBJA 3AXHA 2OOFA 3MPGA 5HOSA 2Y88A 2FB3A 5C2XA 1UD3A 4E4FA 5K7JA 3F4VA 2ZRXA 3CH9A 3EPNA 1HQTA 4GACA 3W23A 1XLKA 3F4DA 2D22A 2X0YA 1HX0A 1YXYA 4JKMA 1WXYA 1U1HA 1Y5XA 1IXPA 4F0LA 1VIWA 2ACRA 4WXZA 3APYA 4KEMA 4M8UA 4TX8A 5CGMA 1O5QA 4W7WA 3LRMA 1PEZA 1UR3M 5AYIA 4ERIA 3VE9A 1E43A 3WNPA 1ELSA 2HVNA 2WMKA 3FKKA 5FACA 1JJKA 4JIPA 1A5BA 2W79A 1Q7MA 1DJQA 4QQUA 2Z7KA 1W56A 3OIXA 3D47A 1WYIA 2ZUUA 1H4PA 2A21A 1P7TA 3WELA 4B3ZA 2FYMA 4R7JA 4Y7EA 4GA8A 3KBMA 1TO3A 4D6CA 1BVZA 2ZXQA 3GR8A 3GHTA 3VIMA 1QW8A 2VX7A 2X2GA 1CGUA 4ZO6A 4PGLA 1QAPA 4L7ZA 4RR4A 4W86A 1U83A 1KTBA 4R88A 1U30A 4W8AA 4EPBC 1NDYA 4GUHA 3NQFA 3M47A 4CN4A 1VFSA 2HWGA 3UNTA 5B7ZA 4DPPA 2WJDA 1JL8A 3LG3A 2QULA 3UXKA 1WO2A 4PMRA 1MNZA 3RRXA 1HNYA 3NOYA 3S2MA 3R2GA 4YPJA 2UY5A 3GH5A 1FHLA 1Z48A 4MG4A 3EPOA 3W6MA 2FLIA 5GJPA 3POHA 4XTDA 2G3JA 2DZWA 3RU6A 2OCZA 2WCSA 4I8YA 3W24A 3CUHA 1A5CA 4AW7A 2PLJA 1LROA 2VFDA 3NQDA 2Z2AA 3QH2A 1ZL1A 3E12A 3W87A 4EWJA 3DG6A 3WH6A 3GXFA 2PLMA 1PVNA 3RIKA 3A3HA 4L4OA 1FWGC 5C9UA 2X40A 3ARVA 4OECA 2A7RA 2DZBA 1GJWA 1KXQA 1W5PA 3WQGA 3W72A 3LPPA 3GC5A 1RLDA 4GQGA 4K1WA 4CQ8A 5A2BA 2VDHA 4IM4A 2CCRA 2FH8A 2WC3A 5IDZA 3FN9A 1XC4A 2Z2UA 5G1MA 3VE7A 5CSRA 3L12A 3S47A 1VYSX 3L0GA 3LOTA 5C70A 3NL3A 3M7WA 4AZ7A 3CLMA 4GISA 1UH4A 4D6GA 3NTYA 2VJXA 4XVEA 2RGMA 5CGTA 1ISYA 5HJXA 2AKMA 3IV8A 4Q22A 4XD6A 5C9ZA 4AD0A 3PZTA 3W82A 1V0KA 3PUDA 1VBGA 4HGXA 3F2CA 2NQ9A 2ZOXA 1P0KA 3BO9A 4HMCA 3SJ3A 3S9YA 1R38A 3WQ5A 3DH7A 1U5JA 4DZHA 3IJ8A 4QJ3B 3VKKA 4X0VA 4WSJA 1QPNA 1F3WA 1I9CB 2I5IA 4UOQA 3V4BA 2C8NA 1UH2A 3OYXA 2ZICA 2A3CA 3P67A 2Z4GA 5FJOA 3I7SA 3LHVA 1UP0A 4DJED 3GU9A 1E9IA 5CC3A 4GZEA 3EOEA 3NUKA 4GCAA 1K6AA 1KLYA 1VF8A 3T2OA 1H50A 2FB2A 1PIFA 3L4YA 3WLPA 4QE4A 4MB4A 4CD5A 1FWRA 3IK2A 1Y8BA 3YPIA 2MANA 1EYEA 4EXAA 1GVFA 3UPWA 1G69A 2O56A 1GNXA 3BOFA 1EX5A 1XDLA 2O55A 1ZHAA 4IFKA 5DMMA 3KOWA 2GFTA 4MB5A 5HNUA 1EDQA 3EMQA 4UTWC 1EA0A 3TYZA 1H7XA 3ZWTA 1KV5A 4HSOA 4NF7A 1ZNNA 3TQ0A 3GXNA 3WJSA 5KZ6A 2VZUA 1VFMA 1ZS2A 2GGJA 3GZ3A 5K3VA 2CHNA 2Z6IA 1LUCB 4LVBA 3DHFA 4DI9A 3ZOAA 4B5XA 4XVDA 4NUWA 1RPXA 2OU4A 4NJGA 4AUBA 2JGQA 3PG8A 4A8LA 3EKZA 2X2YA 1NVMA 3G1XA 5FKYA 4UXDA 1YW1A 2HDJA 4W7UA 2C15A 3BCFA 1IEQA 4K8GA 2YBTA 1WAUA 3BLFA 1UWAA 1J11A 4FLSA 3GR4A 3H26A 2ZUVA 1TTPA 2YW3A 4OOUA 3ZSTA 3RPTA 3WNNA 2HMCA 1ENUA 3EWZA 1S2UA 1OC6A 1DV7A 4PFHA 2J24A 2ZE3A 1J12A 2HVMA 5AVHA 2CWNA 3G5EA 5F1VA 3IVUA 3WZ0E 1I2PA 2YJQA 1R2SA 1DPMA 4X63A 2WZEA 4CCEA 5L6UA 4OBTA 2HVOA 1UKTA 2DT1A 4BWLC 2BS9A 3LNMA 3CQ0A 1CGWA 2PDCA 5EA9A 4LANA 5BOOA 1CDGA 3VDHA 3F4NA 5CZKA 2AAAA 4CVUA 3QW4B 3KRUA 2YKKA 1UA3A 3UWUA 1QXLA 3MO7A 4MKNA 2ZTJA 4PUEA 1Q4WA 5DQPA 2GGHA 2Y7DA 3BPWA 3VTRA 3BAKA 6PTDA 1OCJA 2DPEA 3I68A 1UQZA 3CWHA 1CXKA 3W84A 2ZZ6A 1RP9A 2J9ZA 4JX4A 4HZ6A 1ZP3A 1LCOA 2GVYA 3HG5A 2QCEA 2OQYA 3G22A 4OTKA 3S5YA 3W1QA 3FW6A 3NL6A 4F40A 1XDMA 3WLKX 2QDDA 1GQLA 5FEZA 2PC8A 2ZZ7A 2TODA 3ZVHB 3NR0A 2Z2BA 3WK2A 2G4FA 1ODUA 5K2ZA 5CLWA 3ABOA 3ITLA 3RAOA 1XPYA 4TTUA 4KWUA 3WLSA 1KM2A 1WXZA 2NV2A 4NXKA 2PDXA 3PBGA 4YTQA 2X41A 1JUKA 2E6DA 4AISA 5BRBA 1TTJA 3XISA 3MA8A 1GOKA 4DM1A 5HPOA 3SCVA 1GQJA 1TPB1 2ZQ0A 1Q66A 3CEPA 3LZ3A 2Q8ZA 2YCLA 2XISA 2DSVA 3EXSA 3V75A 3R8HA 1KM6A 4INFA 1UUOA 1PZ2A 3OBKA 4QCEA 3CAVA 2E9BA 5A2CA 1I2RA 4H8HA 3BAWA 4JN6A 4XZHA 1F3XA 3P93A 3UXIA 5FSEC 1KBIA 2WPGA 1X1NA 4J4KA 5A6KA 2IPGA 4AVNA 4QEHA 5ABHA 2R1MA 1KCKA 3WMLA 1GVQA 1FXPA 4JICA 2HISA 1GOWA 4HZ8A 1EJVC 3WH9A 1CW2A 2AMXA 4WD0A 7ENLA 2VNCA 3SN1A 2AOSA 3GHSA 4JN7A 3W7PA 4IG2A 1X97A 4DJFA 3S3GA 2G5WA 2VVSA 2ZA2A 2ZC1A 3L7RA 1BSIA 1MVYA 3THUA 3BWWA 1B3WA 3NL2A 4BK9A 1TX2A 1B2YA 1KTNA 4RK8A 2DW6A 4KFPA 4JTUA 3LSBA 3TQKA 4KT2A 1QUMA 4PMOA 4P7LA 3RM8A 1BKHA 2X05A 1AD1A 1DIKA 1E4IA 5CZTA 1U1UA 5TIMA 1DIEA 4C6OA 2A3AA 3LMYA 3U4FA 3RCNA 2CYGA 3RPDA 3GKFA 4NAEB 4JPGA 4NXSA 2Y2WA 1U2YA 3CQJA 2W63A 1PDYA 2EXOA 4Z0SA 5U4NA 4DHGA 4PB3A 1LLZA 3S1WA 3LGDA 3A9BA 5F2GA 1TZ9A 5BNKA 3TP4A 1XRTA 5E1QA 4HCDA 1ZAIA 1EH9A 3LD5A 4O10A 3VC5A 2QMKA 3IGXA 3HG3A 4MADA 2IPWA 1PKMA 4PMJA 4JNMA 5EB8A 3B05A 2REQB 5AY7A 2NX1A 2JKAA 4HN4A 5H8UA 2J79A 2DUXA 1BVWA 1RBOB 4JQ2A 5I24A 3RF9A 4J35A 5CPOA 3QV9A 3EOUA 3FXGA 4GMEA 5BU9A 1JNDA 3L0NA 1NWUA 1YXCA 1FWWA 3ORWA 3TUUA 1HP4A 5KETA 2ZRUA 1BYBA 3UETA 3UA3A 3VD4A 3BW4A 3IIOA 3NJ3A 2ZUNA 4I5RA 4IH3A 4JTCA 3NQMA 4NU7A 1FBAA 3V16A 5C5YA 1L9WA 5E9AA 1VFLA 2CFFA 3E2QA 4FALA 3EB4A 4MNLA 4A3HA 3GG8A 1SPQA 4HP5A 4IUOA 3O6YX 4AVFA 2INEA 3QZAA 4R33A 1XL9A 5DMYA 4LUJA 1E51A 4M6QA 2ISSA 2VRQA 1DWGM 4QSHA 3W7RA 1X39A 2EGZA 1I1XA 2BHZA 4QGCA 3ITOA 3B06A 4HD5A 3GBDA 1XLGA 1G4PA 1GEHA 2Y7GA 1RP8A 5D2VA 1JYNA 1ICPA 1AA1B 1ISWA 1IR1A 1SJCA 3GNNA 4MUZA 1SGJA 3VNZA 1FCQA 2FPVA 4XISA 5CAKA 3LCGA 4K38A 4K8HA 4C6IA 2IKHA 4QNWA 1W32A 3EPMA 3QOMA 3NWRA 5H1WA 3NVTA 1CB2A 4NVTA 1M01A 1ZBCA 4RKAA 4MY1A 2RJHA 4DEFA 1US3A 3M0JA 2G8ZA 5E09A 1ADOA 2BGQA 3EDJA 1UKOA 4MF4A 3LB0A 1OK4A 2EPHA 3GE7A 2PP3A 4JY9A 1KC7A 1UMYA 5HANA 3BLDA 3GDTA 2BXZA 1EJUC 1PYFA 3O16A 3AXMA 3WJXA 3PFRA 3MSDA 3M46A 3OIHA 4X2RA 6XIMA 1M65A 3WDHA 4M6PA 3A47A 5C9RA 1F3EA 2B7NA 3U2CA 3POCA 1IWAA 4CNPA 1XDJA 1GZJA 3KOXA 4BZYA 3STFA 3V5FA 2ZX6A 6CGTA 1EEXA 3LLDA 2EJAA 4V2XA 4DBSA 4NX0A 1PKLA 4LVDA 3UWVA 1H61A 1W5NA 1XH0A 4Q8VA 3VOHA 4GOAA 1G9HA 4MY9A 1VJIA 2E09A 1KO0A 3W1PA 4DXXA 1FRBA 4V1YA 5REQA 3WLTA 5EFFA 4WF7A 3D6NA 1KKRA 2FZMA 2CHRA 2E68A 3T9PA 3W7CA 4Z2GA 1UYQA 5ABFB 3RNDA 4HNUA 3V0TA 2V0TA 4GIEA 4BEUA 3BL3A 1X38A 3R1ZA 4N4QA 3AISA 3IGHX 3PPHA 1U1JA 3RMEA 2PTWA 1KNWA 2GGGA 5E0FA 1H1NA 2XVLA 3BARA 2WZTA 4DYKA 4GABA 4Y9AA 3VKJA 3V1HA 1XLEA 2W4XA 1UR9A 3MZNA 2PDNA 1ITCA 1M1BA 3IJ6A 4PN2A 4PYSA 4DBWA 2YXXA 4DRSA 2OT0A 1CGVA 1OFQA 3KLLA 1GKPA 1TPDA 1KA9F 5GJNA 3F5LA 1I60A 1W3JA 5LZLA 5AB3A 4GXMA 1TWSA 4HYWA 1FVPA 1SR0A 1SSDA 3OVRA 2VYOA 4RJEA 5KZDA 2P1FA 2F8QA 4CNTA 1NIUA 1QWKA 2PEVA 4FNRA 2ZX5A 2CESA 3O07A 3WNMA 4YIWA 3VUPA 4O16A 4DO7A 3ABZA 3TVAA 3G0UA 2ZZ3A 1V3KA 2BG5A 4G9PA 2QPUA 3B9DA 4RLIA 5BWAA 1XBXA 3NO5A 4DI8A 1YDYA 3B8SA 1Z89A 2ZE0A 4V15A 1SO6A 1E1EA 2OKTA 4ASTA 4QE1A 3HMCA 1YBQB 5IM51 2J74A 3AXXA 3UA4A 1XQLA 4H6RA 1OYBA 1TV3A 1P6CA 3THDA 4A35A 1W9PA 3AZSA 2BFGA 4O1DA 1XS2A 1HL8A 1UROA 2PWHA 4YVXA 4AC7C 2A6LA 2FGZA 5BWFA 2VUNA 2C7FA 4KCVA 2NXIA 4GUIA 1DQUA 3FJ6A 1BXNA 2VWTA 3W81A 3TEVA 4O52A 3USBA 3M0ZA 4GH1A 1S2AA 3ENLA 1V7YA 3VFLA 2V3FA 1O66A 1SO5A 3H22A 5CC6A 2E28A 2PTYA 2NXGA 3SN0A 2QJMA 4JQ1A 1ONWA 2GGIA 1ESWA 4EPKA 3V5CA 1CLKA 5HATA 2W91A 4DBEA 3S5ZA 2D0GA 5HPCA 1CLVA 3DI1A 1FWEC 1RVGA 1KR0A 1E6QM 1W91A 3H4XA 5G5IA 4AWTA 3LYEA 1L2QA 4AD4A 4EIVA 4E2DA 3KTSA 4Z2JA 4ZOCA 3OLGA 3GW3A 5EBAA 1C29A 4ZE5A 2G50A 4OGZA 3ZJ7A 1XIMA 2ISDA 2O4QA 1KM1A 4BCEA 1SQ7A 1X6UA 4HBKA 4O57A 3FGCA 2YCIX 3O0KA 2HNEA 4MWAE 8A3HA 1D8CA 3K5XA 3K8KA 1PIGA 3QMSA 3MCOA 1EWEA 4X9SA 2FJKA 1OFAA 3H4WA 4FF7A 4KKXA 4WDXA 2GDQA 3CL8A 4JEQA 3INPA 1UQYA 3VZYA 1ISVA 4G56A 4GH3A 1F2JA 3E1F1 3LI0A 1VR6A 4N9BA 1CTNA 1W1TA 4I9JA 3KL0A 4RE3A 1XLMA 2DIKA 3V1PA 4QLLA 3VIHA 1VCVA 2QF8A 2VR2A 4CQDA 2ISVA 1TJ0A 2H8ZA 3DEQA 2JE8A 1VZWA 4AD5A 3ANUA 4TVUA 1W1ZA 2CW6A 4Y6GA 3B8UA 5CG7A 3EWXA 1XRFA 3BLLA 2QJHA 1HTIA 1EJWC 5TF0A 1CB7B 4G1NA 5C2CA 3GS6A 4C6NA 3BLPX 3B8VA 1OSEA 2XZ7A 1JF5A 3CXOA 1XFBA 1DKWA 4Q8PA 4DWSC 1E55A 1H7WA 4NL1A 2E77A 4JX5A 1XICA 8RUCA 3TAKA 4RE0A 1A0CA 4K39A 3WSUA 1UD8A 3C2YA 1H7OA 1I0DA 4QISA 1QPQA 4TVCA 2ZFAA 4W93A 1A0DA 1EGMA 2BY3A 4IT1A 1H63A 1GQIA 2IUZA 3UZWA 2GSHA 1R2RA 1S2CA 1BYAA 1ONEA 2NX3A 2YZRA 1B3XA 2WHJA 4OIFA 1B54A 5HNNA 4QG8A 4PR4A 2GLKA 4JD4A 2DV0A 5CEWA 1UD4A 2FHBA 3NDZA 3SADA 1R3WA 3SBFA 3UPMA 2WM1A 4BQ3A 1H49A 2FDSA 1WX0A 1NOWA 3URAA 3IJIA 3MDUA 3ZJ6A 2FJUB 3SCQA 4ECLA 3O0FA 4ZSTA 2PI6A 3N73A 1KCLA 4IOTA 1CXIA 2D2JA 1WZKA 2E6FA 2ALDA 2E40A 3CIWA 2CLPA 4FHAA 3LHYA 2DVTA 2GWNA 1SR9A 1HGYA 3WF0A 3UWWA 3EX2A 4YJ5A 1HN1A 3DENA 3VIJA 4C1NA 3CEUA 4LB4A 4M1BA 3E0WA 1W3LA 2X8RA 1ZRQA 3WQCA 1C7SA 1IXOA 2ACUA 3HGOA 4WEVX 1Q63A 1OFEA 3I10A 3A21A 1XBYA 3M41A 3CUXA 3KWXA 1X8FA 3VX0A 3OLIA 1UKQA 2VL4A 3R7MA 4UTWA 2BB0A 1Y65A 3MP4A 5I3KA 3SN4A 2DQXA 1QVBA 3UU0A 1FY6A 2XVKA 3FFSA 2CBUA 3RM9A 5LIUX 1HT6A 3AIUA 1VRDA 1T40A 3TC3A 4M80A 1YMYA 3T0CA 3TYBA 3DG7A 4R3UA 3OZYA 1HKIA 1Q6EA 3W02A 1Q8JA 3IJLA 4S3FA 1KFKA 2E6AA 2W9MA 1OX4B 4H01A 3KDOA 5M17A 2YBVA 1FDJA 3WL0A 1IGSA 3VNJA 3WLJA 3VIGA 5CPTA 4JQ3A 3CO8A 3M0MA 1B9BA 1RUSA 3B9AA 5DMNA 1EUNA 1NOFA 2NQJA 4UFIA 4KS0A 4PUUA 2HNHA 1JRBA 4LAKA 5AZ1A 3NURA 1OIMA 3E3HA 1IQ8A 4RZ6A 4NIRA 1D7KA 1GT8A 2C13A 2XFYA 3AOFA 5HXMA 2ZWZA 5D9OA 4UTFA 4PUJA 1NU5A 2EPMX 3B4UA 5REQB 5LNWA 1K9FA 2Y7FA 5CH9A 3GYCA 1RY8A 1E0TA 4O1BA 5E0CA 4J3ZA 3SUSA 1ZY9A 1HXJA 2PU0A 4BS0A 5CPQA 1R87A 1R9XA 1EZWA 4M56A 1UB3A 1GKRA 3VGGA 4IIBA 2BNJA 2BHYA 1HG3A 1JUBA 3LA4A 1IWPA 2IQDA 3WLHA 1TMLA 4TQTA 4NNBA 3OTRA 5CPSA 2F61A 4DNHA 4C6EA 1US2A 4UR8A 1O5KA 3WQWA 4LAOA 2FGLA 1YYAA 3O8AA 3KZSA 4HTYA 3TROA 1ZTVA 4PL2A 3B9NA 2CBVA 3OHMB 1WOBA 4IXXA 2J77A 2WQDA 4P7QA 2J8GA 3G24A 4YTRA 5FJIA 2FZNA 3CAQA 1FA2A 3ZYZA 4PFMA 4ALDA 3LXBA 3S2CA 2FTYA 3N6HA 4IL0A 3DX5A 3LV6A 3WF2A 3MZ2A 2ZUMA 5HAOA 1WDWA 1R85A 2JEQA 1LRTA 3VD3A 5MKGB 1FWFC 1X7FA 1UD5A 1XIEA 1FP8A 1TJPA 4CLMA 1XV8A 4S38A 3V36A 1HVQA 3GNRA 2WHKA 2A4AA 5D8WA 1W6TA 4GBDA 3SCUA 2IPFA 1TV8A 4XV0A 3GVGA 2PWVA 4LUTA 4ORIA 1PXGA 4RPPA 3CT7A 4KWVA 4BQ5A 1F6YA 1XG4A 3IVTA 3NQCA 3NVDA 4E6MA 4FLQA 1WBHA 4JIEA 2VOTA 2BP1A 1C91A 5GNXA 1T7LA 3U9IA 4LCRA 3NL5A 3O05A 4H3DA 4C65A 5HNTA 4PCSA 1GORA 3TLQA 3WD0A 3WYZA 1J0JA 3WF4A 4XZWA 2V38A 2BY1A 1UBSA 4OU1A 2GJPA 2XM2A 4GVIA 5EFDA 1M04A 3EEZA 3JR2A 2E6YA 1W1YA 1PUDA 2WMHA 1EGVA 3I4KA 2FVLA 3QR3A 4MWAA 1GG0A 2QIWA 3RX3A 1Z7AA 1GK8A 2Z00A 1GHSA 4AMAA 1EGZA 3G3MA 4FPSA 1LQAA 3KP1A 4FNQA 1US0A 2BOGX 1H11A 1UCWA 2OPJA 1IHIA 2C3ZA 1XSJA 4XD3A 2J7HA 2P5NA 4F48A 4ACYA 3TX9A 4AZCA 2QHAA 1Y5VA 1MWOA 4PBEA 4LF1A 2HROA 2QYGA 3E0VA 2ZTKA 4N6FA 4S3JA 1EL3A 2QGHA 4DWSB 3VGHA 3LXAA 3R8RA 3P84A 3ZLFA 3OYZA 5CBBA 1K1DA 1LRQA 4FX8A 2ZDSA 1RZMA 3AJXA 4MYXA 1O5RA 3SR7A 1TVNA 5HWMA 3E9AA 1ZCCA 3ZJKA 4P8UA 1CGXA 3SRKA 3W53A 1QASA 1WBJA 1FWDC 2YBUA 5HQMA 4G8TA 4PTXA 4XD4A 1IIGA 4Z1YA 4UMCA 2J25A 1WDDA 4L1XA 3P61A 4JYFA 5DX7A 1E3ZA 4QBXA 1F7BA 4XD5A 4WY0A 4HT3A 5FD0A 2J7FA 4S3KA 4G6CA 1H7NA 3S5NA 4FS9A 3TFXA 2YA2A 3QY8A 3ARUA 4M81A 2IPJA 1FUYA 5AHLA 3ES8A 1K4HA 4US6A 4DJEC 2BVWA 1QOQA 2CBJA 3QFWA 5MF5A 3AS0A 3W2NA 5JXQA 4HMDA 1IT7A 2DZTA 4NYUA 1N82A 4ROPA 1VYPX 3NO1A 4Q4PA 3M6DA 3AIWA 1JAEA 3C0JA 3GIPA 3L65A 3WQ6A 4H8NA 1W1B1 3GXDA 3L66A 1O60A 2DP3A 2VR4A 1CXLA 3F4WA 2AGKA 4D71A 3UBPC 1HP5A 1RBLA 3UR5A 5BW6A 3COTA 2HPIA 3AZRA 3EDDA 2PDLA 3LS9A 3TYAA 1E73M 3PBVA 1F6KA 1A5UA 2FMOA 1SFLA 5FOOA 4AX6A 3U0HA 2W6RA 5AC7A 2YDAA 3ALGA 1DYSA 3FAWA 3ZZ1A 1K4GA 3A4JA 4TU1A 3W6YA 4WKAA 2KZHA 4GE8A 1X6LA 1P5BA 5I02A 1QT1A 1QK0A 1GCYA 5A2AA 3MV11 4MZYA 4WIWA 4GFSA 5PTDA 2J8TA 1RK5A 2X1TA 2CKRA 4DLMA 1O95A 1QBBA 3K1GA 4R5EA 3T78A 2VXNA 2PDMA 2VC9A 7TIMA 3BAYA 3WUBA 3QYQA 2EPOA 3FHQA 1G4TA 2XFWA 3KCOA 2NQHA 4GD0A 3JU2A 1PHWA 4WVXA 1EOKA 3HJEA 2J7CA 4FA3A 4FLRA 1GPWA 3N29A 2VUYA 1UR4A 2WAGA 4CEXC 2C6QA 2AQWA 5D2TA 3W38A 1XYMA 1XIBA 2BOEX 2OR2A 2XG9A 4QDPA 4RCXA 4UB9A 1EWDA 1OZQA 3DCPA 1YKWA 2VP8A 2VHLA 3W7OA 4DX3A 4KFNA 3T4WA 3QPZA 4Z1CA 3FS2A 2ZBTA 4AMCA 1FDZA 3SEPA 2OLAA 4ZL1A 1C8YA 3QEZA 2UZ9A 2QAPA 1N2VA 2Q71A 3QC3A 3K4DA 2XUCA 1LBMA 1KCXA 1ZCOA 3WN6A 2AGTA 1OFRA 1EDGA 3UCCA 5M3WA 1PV8A 3PZ9A 4PMUA 1OFOA 1HZYA 1K9TA 2ZZ2A 2TYSA 3G1HA 4H9YA 4LRSA 2VCCA 1L8PA 5T9CE 3WLOA 4FR6A 3T0DA 2ANUA 4GJIA 1NEYA 1N8FA 4DWDA 3UEQA 3R89A 1E15A 3AIQA 5D09A 1GPFA 4K68A 3GR7A 1VYRA 4XO7A 4UTMA 3T2QA 1OWQA 4HK5A 1GYLA 3QY7A 3AIRA 4A2SA 2C71A 3ZIZA 1Q6RA 4OVXA 3CLWA 1S5TA 3M1ZA 4B9YA 2YDSA 3EWYA 2QCGA 2QCLA 5AOUA 1PSCA 4N6EA 5C7VA 4ZR8A 2CLLA 3LGEA 4MB1A 3FV9A 2B81A 2YB1A 4QCFA 1F73A 3DGRA 1CIUA 1EX1A 3W3OA 3ZO9A 2XYLA 5CQ1A 2OOGA 1E9ZB 4AWEA 3N3MA 5EMLA 2E5DA 4AZHA 5I7GA 1ISZA 3GFYA 4C6LA 1PTGA 4QLKA 1UUMA 2HZGA 3A3XA 4V33A 1S3HA 1RQHA 3DECA 3UWYA 3DN5A 2WBGA 3CQIA 1CNVA 4NJHA 1OBAA 1JVNA 2Q09A 1W9UA 1PDZA 1UR8A 3AHVA 2PBGA 1I2QA 3UYIA 4IPLA 3F03K 4J1OA 2XIBA 1UIPA 4XB3A 1R7AA 3JUGA 4LPCA 4RZBA 4KRZA 5HK4A 3VD9A 4GYPC 3ABQA 1IEWA 3GNXA 1RA5A 3SUWA 3SGGA 3BMWA 3WD3A 2BASA 3GFZA 5DCBA 3QLDA 3BGJA 3U6WA 4GUFA 2G97A 5XINA 1MW2A 3VKCA 4XX6A 1ME8A 1TRIA 3THAA 3HO8A 3EOLA 1LYXA 1RV8A 3VCCA 4DYEA 3BW2A 1WKDA 4HPNA 1FWCC 2YDRA 5I03A 4AZIA 3U4AA 1TYGA 4H9TA 2HE8A 2PUZA 1UWUA 1S5VA 3WUGA 1UZHA 4A21A 2ZXBA 3ABSA 1PKNA 4Z0JA 3CGTA 1M7XA 1NARA 2DW7A 5I3GA 1UC5A 3OA3A 5HJLA 4OBSA 3SCSA 3KBSA 2OZ8A 1BRLA 3H2MA 3Q4DA 5FA5A 2O4MA 1UASA 4WXYA 2OEJA 1YIXA 3LM3A 5CPMA 3BDKA 2NVAA 3R43A 5LKYA 2QCHA 4LS0A 1PAMA 3WIJA 1MUCA 3ZMRA 6REQA 5AN7A 1D3HA 7TAAA 3NQ8A 3W00A 3E02A 5I09A 4HU3A 4IGSA 4L4MA 4C6KA 4ZSUA 3QSTA 2Q6ZA 3N18A 3LZ5A 1J4EA 4ERAA 1OD0A 1J6OA 1LT7A 1TWZA 3MBDA 3SFWA 3NYDA 2WSYA 5JBDA 1KXVA 1TX0A 3ATYA 3UG5A 4REQA 5M03A 2O9TA 1B3ZA 1SFTA 2YL8A 4DJFD 1UW9A 1JCMP 3GU2A 1D9EA 3JRKA 4W87A 4AFYA 1L6WA 1JPHA 5F7UA 1XX1A 4DO5A 3VAVA 4MTVA 2BXVA 2QCDB 2Y85A 3AUOA 2DZSA 1S5MA 3FCPA 4ML9A 3T05A 4G7EB 1BG9A 1D2KA 1BEUA 4FNSA 3MYPA 1ZJBA 3WMSA 1JQXA 1RVKA 1PO9A 3O9NA 4O17A 1D8WA 4GY7A 1SFJA 3GDMA 3O3RA 2R94A 4Z2KA 5LHFA 1TV4A 4AEOA 3N13A 3NQ7A 2F84A 1LWHA 3PNUA 1LWJA 1IXQA 1HVXA 1GVSA 1C7TA 3DYOA 3BSMA 4TUFA 5EGRA 1W3NA 1DJNA 1VJZA 4LEQA 1VPQA 3C0QA 1KRAC 4O8AA 4P7OA 5D4YA 3HPFA 4IX0A 4KCUA 1I6NA 4C6QA 4HN8A 5D2XA 3ARWA 5EBUA 1U5VA 1R86A 3MI6A 3AIEA 1JCNA 3CMJA 3TA9A 2J13A 1W9XA 3SW6A 4JBRA 3HPZA 3UG8A 5HR7A 2WSKA 3WENA 3BQ6A 1CWYA 1TPUA 2Y0FA 2IQ0A 4S23A 4AXNA 1YX1A 4DELA 1RD5A 2Z0IA 3VDGA 1GJPA 3S6DA 1F9CA 4OJYA 3M0HA 3G6LA 1O5XA 4EAMA 3RRAA 3FEMA 4EKJA 3DESA 3MP5A 1K03A 3VNMA 4IQLA 1J18A 3PUOA 1E6PA 4QX4A 3M0IA 2BHUA 1UBPC 4F0KA 4ZQNA 5FIPA 4LYPA 2FZDA 5L9FA 4ZQPA 4ATLA 3VIPA 5F2MA 1DJYA 1VHNA 4GC3A 3GDRA 1PHQA 1WDRA 1DJIA 5EL1A 3TW6A 2WCGA 3U57A 2XINA 5DBTA 4FXFA 4UTTC 1C9WA 1EDTA 4I6VA 3EOSA 1XIJA 1AODA 4AYGA 4M29A 5J8LA 4GY0A 4E2VA 5C0QA 1X96A 1VAHA 1TA3A 3CV1A 2DUZA 3GDBA 4LCQA 4RPQA 4XG1A 4PTMA 3WDPP 3RU8X 3E2SA 1TWWA 4OOZA 4X0NA 4D8AA 3CQHA 4TTGA 4GRSA 1UD6A 2VVNA 2YFNA 1J79A 1UZDA 1R3QA 4AIBA 4C6BA 1IEIA 4K3ZA 1T41A 2GJXA 3STEA 3C2FA 3ERPA 3H7VA 1XLLA 1YADA 3AAMA 3UJSA 2UY3A 2DH2A 2P0IA 4GO8A 4LUSA 4RE4A 2YPIA 3SQMA 3TYUA 1KQYA 4QHRA 1CBGA 4XZLX 5A6BA 3QGKC 2G3FA 3LRKA 4Z17A 1RXOB 1L6FA 5D9NA 1XC6A 3UGVA 4RDVA 3KCLA 3LTPA 4X3ZA 1D3GA 1ALDA 2DT2A 1MXSA 4Q4MA 4XTIA 4A3QA 4UNIA 3SI9A 1GWJA 3GWQA 2PGFA 3UZXA 5FL1A 3TE9A 3N2OA 4FX6M 3W7DA 4FMVA 4DJDC 3GKAA 1A5MC 3GIYA 3NDOA 1JULA 1AFSA 1JPIA 4I9AA 4QDWA 5A6AA 4GIYA 4A8NA 1VFTA 3HGSA 3LQLA 3NQ6A 3W2LA 3N2TA 4J3XA 3T8LA 1AG1O 2VX4A 1M6JA 3AZTA 3CIXA 5DANA 3AYSA 4TX6A 1EPVA 1JD9A 1XG3A 5BROA 2B7QA 1JXJA 1E1CA 5CSUA 4NILA 1DQWA 1K9EA 4QG9A 3D0CA 1DXEA 3MUY1 3VDBA 1S2WA 1PX8A 3VC6A 4FB7A 3GNOA 4F0SA 2BVYA 2E1DA 4AZ5A 4GO9A 2GVEA 2Z27A 3MP3A 1R3VA 1XIDA 3H23A 4GY1A 3ZJ8A 4DO4A 4DY1A 2XN1A 1JIBA 1TWIA 4YL2A 3PUGA 3TV8A 1U22A 5M2FX 3E0LA 1FXQA 2HS6A 3VOGA 3CV6A 4MAZA 1AZ2A 4HYRA 2OYKA 2W67A 4C6FA 4A3UA 9XIMA 1CEOA 2J7DA 4H1ZA 4JXCA 3UR7A 4AYSA 3VXGA 2QZRA 3CHCA 4Y9MA 4HNOA 3EMCA 3PVFA 1KV8A 4ZENA 5CZ0A 5JH1A 1XI3A 3WF3A 2PS2A 1VEMA 3J7HA 5FF0A 3RLVA 4K8EA 4TR9A 4AZGA 4HMNA 2NVCA 3NPWA 2E8YA 1TSIA 2VQTA 5BOEA 1VB9A 1PJ9A 3WNOA 1MQQA 3EWBX 2QAFA 3ONBA 4C5YA 2VZSA 3M4HA 3T8QA 5EMUA 1UC4A 5FJJA 2CPUA 3P0XA 4XKYB 2G0WA 4PUMA 1ITXA 3G8RA 4PSPA 4XBSA 4XKMA 1ITUA 1QNVA 1GVIA 4S1FA 2RDUA 1IZJA 3O15A 1OCBA 1B4KA 1WP6A 4K7VA 4AH7A 1XM3A 2OYLA 3HV8A 4LAMA 4HB7A 2VFGA 4LSBA 2GQ3A 1S1PA 2WKJA 3KS6A 1H2JA 2D0HA 1V93A 4PMZA 1R9YA 1EHAA 1CX9A 3QHMA 4L1WA 4HQVA 2C1HA 2Y8KA 3ONCA 4FR1A 1EBHA 2OMAA 2PCEA 3QMTA 3APGA 4OUEA 3PAJA 3WBXA 5HDRA 1FDYA 5FSDC 3R0KA 1SVDA 4ONVA 5BCAA 4YHEA 3ANVA 4IJBA 2H9AA 3BQ5A 1FCUA 1OYCA 3D5HA 4I5UA 2UY4A 1B57A 3H2EA 4L6OA 2HBVA 3N1AA 3EGJA 3I6RA 3HZ3A 5F4WA 3MUZ1 4LYKA 3FDGA 3MSRA 3WDJA 1NH6A 2O92A 3PB0A 4OQVA 3KRSA 3C6CA 3IRSA 3NXLA 3W9ZA 2CEQA 2PAJA 3EXRA 4ZMGA 4B91A 1FH7A 4JN8A 1QCWA 4XAFA 2P0OA 2WB5A 3NZQA 2A7NA 1Q6QA 2D2GA 1LLOA 3PB2A 3TJ4A 1E56A 5FEWA 3EZ4A 4K7YA 4O1EA 2EG8A 4MFEA 3OODA 2P76A 4I6KA 1JEZA 2EG6A 4YU1A 5CC7A 4UOZA 4M7SA 4CCDA 1CYGA 3CK5